3DHGC

Crystal structure of toluene 4-monoxygenase hydroxylase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords toluene 4-monooxygenase hydroxylase alpha subunit
publication title Structural consequences of effector protein complex formation in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 25
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3dhgC00
3RNFC 3N20C 2RDBC 3N1ZC 3RNGC 3N1YC 3GE3C 4P1BC 3Q3OC 3RNBC 1T0SC 1T0QC 3I63C 3RMKC 3RNCC 2INDC 4P1CC 3Q14C 3N1XC 2INCC 3Q3MC 3I5JC 3RNAC 3Q3NC 3Q2AC 3DHIC 3RN9C 1T0RC 3DHHC 3GE8C 3RI7C 3RNEC 3DHGC
chains in the Genus database with same CATH superfamily
3AU5A 3H9DA 2JRHA 2HE7A 4RM8A 1SJHD 1TS2A 4YT0B 1YN4A 1E7VA 3IXSA 4XC2A 3ZYYX 2VRRB 2C7NB 1IBXA 3UINB 3AEFB 4XGAB 1Y56A 1EWYC 4NAWB 1OFFA 4KDIC 2C7MB 2JZZA 2L52A 2KANA 4IUMB 4FJVB 2V4LA 2RPQA 4RF0A 3IAM1 4W9DA 2L32A 1ZP0B 2AWTA 4JWSC 1E9MA 1NDDA 1Y8RC 1NI3A 3PVLA 4AOFA 2D07B 1BUIC 2ZNVB 2PE9A 2WXKA 3H7SA 4XWWA 1TGZB 1J19A 1D6EC 3DDCB 2D11A 4DXFA 4BVUC 5JHBA 3Q8FA 5GXGB 3VVWB 2WWZA 2JU6X 5EE9A 2WXIA 2GB1A 3TEYA 5IOIA 2ON8A 1V8CA 4B0MA 3QWZB 2QDFA 2WP9B 3TMPB 1UBIA 1WRIA 2G4SA 3PREA 2ZVOA 2I2YA 4HEA1 3K9OB 3PLVA 3OG5A 2WX0A 3M62B 3EUB2 2DNFA 3VHTC 2WXRA 1IP9A 2LRWA 2QJLA 1SXTA 2MA9B 3ZXVA 4KGRA 1WXSA 2KDEB 2RGFA 3TEXA 2J0KA 1ESFA 1T5XD 2KWCA 2W55A 4REZA 4HVBA 5G5HA 4AWJA 5AUKA 1WX8A 4A3OA 1T0RC 2WXMA 1J7CA 1B9RA 1ROEA 1OQYA 3O65B 4OVUA 3BK1A 1UD7A 2AYOB 1MHHE 2MP2B 4OZCA 1FCCC 5LXIB 3RNCC 2MBQA 2WU5B 4I6PA 2LD9A 2WXPA 3RNAC 3Q3NC 1T6BX 4HKZE 3RYTA 2O2VA 2KO3A 3P4SB 5JXVA 1Z2MA 3Q69A 3WAOA 4N9F4 2CHWA 3P63A 4EE2A 2ZW0A 4CO7A 2HTHA 1I4QA 3BIID 2JPHA 3TJPA 5E6NA 2K6DB 1KTKA 2BW2A 3ZTCA 1C77A 3R7QA 1VZ8A 4EFOA 4NQLB 3RZWC 3V6CB 4DHZE 4ZDVA 4N59A 3PGEA 2ICIA 1I4RA 4GU2A 3GZNI 4OZBA 2QCZA 1RRBA 1JWMD 3ZO5B 3CMMB 1PUTA 4JPSA 4BOZB 3KVFB 2O6VB 5G2NA 1N60A 1KH0A 5FKAC 3BYYB 4OVZA 1YMHE 4DBGA 1HZ6A 2QIEB 4GSWA 2BBCA 1WGYA 4GOCA 3I9V1 4GB9A 4E71A 4GMVA 1DOIA 4TUUA 3PSEB 1E90A 2BPSA 3ZNHB 5EE1A 3TIXA 4H2AA 4MELA 2KNBA 5CHFA 4YSZB 3DBHB 3UGBB 3TEWA 1QOGA 1F2RI 4KDLB 2DZIA 2V0GA 2AL3A 4M01A 4KZCA 2L76A 4W9CA 4ANUA 4K3CA 4KSKC 5FK9C 2DBYA 2DENB 1FO4A 3ZW3A 1SSNA 1WFYA 3VR9B 2IO3B 4PYUA 3PZ8A 2HD5B 1AYFA 1J7AA 3TCAA 2BYEA 1MVKA 2WDRB 2BKFA 1WGDA 2KJ6A 2L1AA 3GOEA 2LXCA 4FHKA 5TR5A 1TT5B 3V62A 1DOYA 3URYA 3MC0B 2KLGA 3VDZA 2DYOA 2KWVB 5G55A 2D5GA 3AE8B 2EMTA 4NNJB 1WH3A 4KZ0A 1WJ4A 3IFWB 3P42A 1WR1A 1TS5A 4F1SA 1L2NA 1FRDA 1NEKB 1FRRA 2MH7A 3PV1A 4HJKA 4IWPA 2KACA 2J42A 1QF6A 3L13A 1WXVA 2KN5A 1MI0A 1JWBD 1WI0A 4K81A 4W9IA 2XBBC 3K9PB 1GG3A 1MG8A 4FADA 4IKGA 3PRMB 5EE3A 1BMLC 3A9KB 4II3B 3WAMA 4EZJA 3AE5B 1WZ0A 4C80A 1PDXA 3WAPA 2BB5A 1KM7A 3AH7A 3BY4B 1H4RA 3JYUA 1FEHA 3W2DA 3RN9C 1UGJA 1JRPA 1FNWA 1KLGD 3GE8C 3KUCB 5BMIA 3VRAB 3W5UB 3T8MA 4JLCA 2KDMA 4YXDB 3Q8EA 3MC8A 1TZOA 2WDVB 4LNNA 5T8IA 3ZQ4A 1IYFA 4P6VF 4AQ7A 2KC2A 1YX6B 3L16A 2D3GA 3PHXB 1L6UA 2IO1B 2DYMA 2RDBC 3RD2A 3SFDB 3S2AA 2XK5B 5HKHA 3BVMA 1PQSA 3NRZA 4RFBA 1T0QC 3QAQA 3N30A 3BK2A 3N3KB 3T3OA 4OZAA 1XEEA 2BGFA 4DHJD 3L0WB 3I3TB 4HKQA 4FXCA 1WF9A 1TKEA 3EFUA 2IGDA 4UDUC 4ICVA 3VTVA 3KUZA 2IO0B 3DWMA 3NUHB 2ACZB 1ZXHA 2KD0A 3T3NA 1C4AA 1NVID 4ASWC 2CU1A 3MTNB 4PYZA 1VZ6A 2FE8A 1WE7A 1V86A 2K1FA 4TQ1A 2LGIA 2PVGC 2WX1A 1KFYB 3TBLD 4MH8A 3JSVA 4M8NA 1VCBA 3U30A 2MBHA 4HDQA 3R2IA 1TJEA 3QHTA 3DBLB 3CIRB 4X57B 1KRHA 5DPSA 4RGNA 2Z0DB 2GBRA 2NBVB 2JUOA 2G4DB 1UGMA 2XN9C 1QKZA 2KFJA 5J17A 1BT0A 4N58A 3CF6E 1E8YA 4FJYA 3CSFA 3NS8A 4WJOA 1D5XC 3VUWA 4MSQB 4DDGD 4YSYB 1F9JA 2MP2A 1TBEA 2LGSA 3HUIA 4DXAB 3V6EB 3VH4B 2BYTA 4ZYSA 1E7PB 3DHHC 4QAYA 4W9KA 1YJ1A 2FUHB 3NHEB 2OHFA 3NOBA 3A9JB 4G0NB 5TSSA 5AZHA 3KW5B 5BMGA 3P2BA 4M0WB 3QX1A 4EOYA 4YL8A 2NPTA 2K9XA 3I63C 4E74A 5BYRA 1EM7A 3DBHI 4FJZA 1ISNA 2OJWA 2KK8A 2XNAC 3N9YC 1TTNA 2MEKA 4G3XB 1B1ZA 3B2GA 1K8RB 3EECA 2LASA 1FNUA 1Q10A 2JYEA 3HVZA 2D3CA 2LFIA 4B0EA 1L6VA 2INPE 2R61A 3KWLA 3ENEA 3V61A 5C3JB 4C7YA 1MHXA 2QHOA 4NAMA 2HJ8A 3HM6X 3QA8A 2R2QA 2NBWB 1I4PA 1A70A 2KVRA 1I4XA 5J18A 2GBNA 3BZDB 3NS1A 3KWVA 2KJRA 1XLPA 2JZ3B 2O6VA 1WMHA 4J3OD 4ZRKA 2M0AA 4OHJA 2CJNA 2KXJA 3UI3A 2DZMA 1SF0A 1MJDA 1SE4A 3VXWA 2QMTA 1ZDXA 1PYWD 1HTQA 4C4VA 1ZDVA 3H8HA 1V1PA 3APDA 2WGSA 1UUPA 2C60A 1QZEA 3PRZA 2Z59B 1VR9A 2XEWA 4YTMB 2FNJB 4ZRIA 3M63B 1WGGA 2REXA 1E5WA 3NZSA 1CK1A 1R4MB 2PJHA 2LJ5A 2KQ4X 2CHZA 2KTRB 4HPPA 2N1VA 2DZKA 2BS3B 3ZRFA 2N4FA 1NYQA 4ARCA 2M17A 4W9GA 4PS8A 1XF5L 2L83A 3AU4A 2MW5A 3LJ3A 2Q5WD 2DHZA 3ML8A 1ZPSA 1J8CA 1P7FA 4MACA 4PS7A 1ACCA 4BAXA 4S0RA 2WXLA 4YSXB 2GMIC 2KWUB 3DVNU 4MT5A 3AULA 2KMAA 2PE6B 1QOAA 4W9LA 3O13A 3AEGB 4MDKE 4YTPB 2KZRA 1LM8B 3HVDA 2CHXA 4RGMA 5IAAC 2Y5PA 3A33B 4FA6A 1K52A 2JVCA 2FIDA 4MJSB 1PGXA 4D2KA 4AP4C 3KYDD 2RD0A 5D94A 2WXQA 4TV3A 4KGSA 2JZPA 3KQ4A 4IC7B 5J2RA 3ML9A 1P9DU 2KMMA 2V3PA 2KOXA 4ANWA 2V3NA 3ZXRA 1J0GA 1NENB 4WWPA 1VZ7A 4FN2A 3C0RB 2QEJC 1WSPA 2NCNA 3GE3C 3PRPB 3WA0A 1T0SC 1XLNA 4HROA 4ZRQA 3AE4B 1TKGA 3DBLI 3PZ7A 2N7JA 1RAXA 3ALBA 2JF5A 3H7PA 5D2MB 5MPOA 4GIVA 4LTUA 1VLBA 3X23A 1EF5A 5HHDG 3QCAA 2LZ6A 2G9HD 2KFKA 3FC4A 1SB3C 4LJPB 1WX7A 2GBKA 2RSUA 3LDZE 2LGYA 1C9FA 1V97A 5I4DA 1V81A 1FFVA 2PEAA 1V1OA 5BMHA 2PIAA 4WAFA 4ZOHC 3AE9B 2D2QA 3VTUA 1FNVA 3ECIA 2MWSB 4RM9A 1EU3A 2KVZA 4XDCA 3ZGZA 1WJNA 5H92C 2AQ3B 4P7IA 1WXMA 2V3SA 2VH1A 1N63A 4WJQA 4LK0M 1ZKHA 3FILA 3AV8A 1V80A 4LCDE 1GAQB 2G45B 3B1LX 1WY8A 1QILA 1XT9B 2BT6A 4MM3B 1TIFA 2N0SB 2WS3B 2MHJA 2PKOA 4RMAA 1UELA 1XLOA 2LEKA 1RLFA 1SBBB 2AL6A 4MEMA 1L7YA 2NVUI 4EKUA 5EE0A 3ZNGC 1S1QB 3B08A 4J6IA 4JIOU 1ZOYB 5E6OA 1H8CA 3NZ3A 2PMVA 4LNFA 5JH5C 3RNGC 3U8ZA 1V5TA 4ZRJA 3L17A 2G1EA 1U4AA 2Z8LA 4NJCA 1SE2A 1EWCA 1SEBD 3VR8B 4BZAA 1OEYJ 2X8XX 4WIPA 4LDTD 3VRBB 3DPDA 4KGTA 1M4VA 2IBIB 4DQOC 2M1MA 1DYQA 1CZPA 1L0VB 3U7ZA 1WR6E 2GOWA 2W82A 3WALA 3T9LA 1PFDA 2N9PC 4GDLA 5E6JA 1RM6C 4LNIA 4GDKA 1WZ3A 1ZE3D 2IY0B 3GB1A 1NI2A 1FXAA 3HHMA 1FIQA 2RDHA 3JVZX 4RCOA 4O1NA 1N5XA 1UF0A 2OOBB 2ZZPB 1WE6A 1R4MI 3M3JA 2FCNA 1C4PA 4ICUA 1SGHA 2BWFA 2JX5A 3V3XA 1IBXB 3IAS1 3HM3A 4EZKA 2LVOA 4ZHPA 4KIKA 1WX9A 4WWMA 4ANVA 4C00A 4BKTA 4W9FA 2N9KA 4WH4A 1SE3A 2EELA 3EC8A 3ZJUA 3VUXA 3ETRA 1ZXIA 1P0RA 4A6QA 1ET9A 2LGXA 3IBEA 3APCA 4BKSA 3U52E 1VDVA 1P3QU 2TSSA 2BVCA 2K6QA 1X1MA 1GJZA 3AE1B 4HPMB 1WGHA 3R3MA 1C3TA 3ZTDA 4A8XC 3Q3JA 5KHQA 2MX2A 1EUVB 2AX5A 4WWOA 5AEKB 2IGHA 1OEYA 1A5RA 3C19A 4ITKA 2L8JA 2IPKD 1RFKA 2VZKD 3ONSA 2N9LA 1KOTA 1WWTA 1ET6A 1YQ4B 3ZNZB 4A55A 4K7UA 3M95A 4NAWA 1V49A 2D10A 2IO2B 4ACFA 3CSTA 3ZIMA 1AW7A 4P1BC 1YN5A 4TKNA 1F0ZA 1XCTL 3RT3B 1IPGA 3RMKC 1V6EA 2ZCBA 2H89B 3W5VB 2L05A 1CJEA 4RGTA 1UWXA 3DOWA 1N61A 1N6ZA 1Q5WB 2PW9A 4MGIE 2VH2A 1XCQL 3AE7B 4IG7B 1SJED 1YOVB 4NPNA 2BYFA 2M4NA 2D3AA 3ZLZA 4AUQC 1MG4A 2RR9A 2I1KA 2PPHA 1WXAA 3B0AA 4DXGA 2YVCA 2NS5A 3AEBB 3L54A 4CYEA 1JW9D 3PS6A 2J4XA 1LQBA 1JQ4A 1WIAA 1BXTA 1C78A 1CMXB 4S17A 1YIWA 2CU3A 3L4PA 4IM2A 3V60A 2BKRB 2JT4B 1F52A 4W9EA 1XXGA 4A90A 2MJ3A 1IUEA 5BYSA 1LO5D 1WXQA 4IM3A 5D7GA 5IP4D 3IT6B 3KLSX 1V9JA 3MP9A 4FLHA 1E6EB 1F1HA 1NYRA 4N6EB 2O2VB 1R4NB 4NJ7A 2IDYA 3AMZA 3PT2B 2K0PA 1UZXB 1D5MC 3L10B 1HE8A 2LRUA 4HCNB 2L3ZA 2CR5A 2V1YA 3MHSD 3ZKJC 3R7RA 1CQVA 3RULA 3R66C 3DWGC 3E56A 5HI1A 5FR3A 2MBEA 3N32A 3Q2AC 4XDDA 4BBNF 3X0WA 2Z0EB 2B76B 2DWQA 4G11A 1WYWB 2WXNA 2GBMA 4HJGE 2H88B 3WCQA 3C8YA 2N7DA 3BINA 3SHQA 4RH6A 3NVWA 2MCNB 1JRUA 3PHWB 1V5OA 4JWUC 2QC8A 5IO9A 3MFGA 3SU8X 2HJ1A 4BKGA 1JROA 3E9SA 4KSLC 2OJRA 4YWGG 2QILA 4KX6B 3N1YC 3ZDTA 3BWUD 4RF1A 3ZRCA 3P1MA 3VQIA 3SDLC 2MBBB 2J52A 4JE3B 3JW0X 2K8HA 4LNKA 3A4RA 4FHJA 2J0MA 2JSVX 4I6NB 3QC8B 2K25A 3MC9A 1D4BA 3ZVVA 1T0YA 2N7EA 4US9A 4NQKE 3AM9A 2KT7A 3W1SC 2L0TA 2DAJA 3RNBC 3B2FA 3BVZA 1Z5SB 3WIMA 4RGOS 2HTME 4DHJB 2M56B 5BYQA 3RNFC 2NTTA 1D5ZC 3RPFC 4K3BA 2V4IB 3AEDB 1OQRA 3FKYA 1FMAD 2DZJA 2ONQA 4ARIA 1I7HA 3NVZA 1N62A 2NR2A 1P98A 2Y3AA 2KMCA 2J7QB 2FCSA 2PVOD 3U2SC 3L08A 4L1BA 2WYQA 2BF8B 4BBNC 1RWSA 2EMSA 5AUIA 3RI7C 4MGZE 3TSSA 5LNK1 4MGYE 4IW0A 3MHZA 4DK5A 4A9AA 1KLVA 1LFDA 3UF8A 1T3QA 5L83A 3SR6A 1TYGB 1FM0D 3P4RB 1YQBA 2MQJA 2J53A 4IM0A 1I35A 3I57A 3U7DA 2Y5CA 1VRAB 4ZRPA 4L23A 1QQRA 4EEWA 3AEAB 4E3CA 5LLIA 1QT9A 2KJHB 3BYTB 3Q3FA 4L2YA 1FCLA 5D3DA 2K22A 1EF1A 1TY2A 2D3BA 4F7ZA 4WJPA 3DVGX 3NG0A 1AN8A 5CHVC 2LHDA 3A1QB 2IZVB 1VJKA 1GPXA 4C56C 1XLQA 2W3RA 2ZCCA 4WQMA 3ZNID 5DPWA 3EA6A 3IT4B 4A3PA 4W9JA 3OLMD 4KVGB 3EFCA 4GXBA 4A20A 1E10A 3N20C 2JXTA 3N1ZC 1SIJA 2Y5BB 3FAHA 1NBFC 2JXXA 2JRIB 5E6PA 1HXYD 2UYZB 1FD6A 4US8A 1EO6A 3VTWA 4CHKA 4IWQA 5C1ZA 1M94A 2BQQA 2KHWB 3AE6B 4DHZB 3ZJVA 1WYGA 3A9KA 4USAA 3P4PB 3RFZB 4IOIE 3KUDB 1VD2A 3AXCA 2B3AA 1PGBA 1K51A 1YNTE 4LLGM 2N9XA 1HTOA 1HEZE 2O6VD 1E0ZA 3NZUA 1R4NI 1L5PA 4RNAA 1YQ3B 3D32A 1JCKB 3P4QB 4JGHB 2V9HA 2I1JA 4NZLB 2E3TA 4EUTA 3DBRB 1L4DB 5JHAA 1WJUA 1HA5A 3QQ8B 4AJYB 3JSVB 3MJ5A 2LWPA 2IJ0A 3LB8C 2XK5A 3Q8CA 2WNMA 1WRDB 5D6JB 4NY0A 2MJEA 2YEPF 2KDFB 3RNEC 2M8SA 4KKJA 1ZW7A 2NBUA 2FBWB 1P7EA 2QSDA 1AWDA 4OW0A 2KDIA 5IKCM 2MLBA 1FXTB 2CJOA 2CKHB 3VFKA 4TMAB 1I42A 4URKA 2LVPA 2G3QB 5HG2A 3AE3B 2L7RA 4NJ6A 1KLUD 2R2OA 3RCZA 2K39A 1LGRA 1Q1OA 3IVFA 4PS3A 3UQBA 2I38A 1K50A 2NPTB 1ZGUB 3RZFA 3Q8AA 1PGAA 1UNSA 2PLPA 3Q14C 2WHIA 2AEHA 1STEA 3QARA 3EGRA 3R2TA 4HRSA 5G5GA 2NTSA 5DCNA 4F8CB 2KAJA 1UBQA 1MPEA 2FIFA 1DGJA 4MSMB 1E8ZA 4TQ0A 1RFAA 4JL9A 1FPYA 5IN7A 4AS1A 2L00B 2KN4A 1ENFA 1E8XA 2C5LC 1I4HA 4EZLA 1GB1A 2N9EB 4LJOB 4PK1A 4HWIB 2WXFA 2K8CA 3AN1A 1WMHB 3Q6BA 5AZFA 2LI5A 5AZGA 3W9CB 4YTNB 4FBJB 3A9JA 1DOXA 3DBSA 3NVYA 5CTRC 1C4CA 2LJIA 3AECB 5KHOA 4M0WA 2WDTB 1UH6A 1I4GA 1V2YA 4WWNA 4C4VB 4LNOA 3VUYA 1TY0A 1F77A 2SAKA 1V1PB 3NY5A 1KF6B 2JQRB 4KV2A 2LXAA 4P16A 2KYWA 4K1RB 2MBOA 4MH0E 4ANXA 1FFUA 2KKCA 4K7SA 1YJIA 5BO4B 3NVVA 4XWTA 1GUAB 2WU2B 4WJNA 2KX3A 2K8BA 1AARA 4HK2A 2FCQA 2DLBA 3VAWA 2BWES 1S3SG 4K7WA 4HCPB 1JWAD 1G6JA 4M02A 2KDBA 2M0XA 2ZEQA 1UWMA 1SE9A 1C79A 2AQ2B 2BB6A 3TUOA 5JZEB 2LUEA 3N1XC 2J0JA 3V05A 1SIFA 3ZJTA 1XD3B 2W3SA 4CQNA 4PT5A 3RUIB 2WXGA 3H6NA 1JMLA 4GLSC 4XYCA 3HRDD 4B9KA 2YLMA 2NMQA 2GRIA 4Q2JA 1GNUA 2INDC 2PTLA 2ZPYA 2UWQA 1WJ6A 3GS2A 4II2B 2WXHA 3I5JC 3DCGA 1IGDA 2RPVA 3AE2B 1YJJA 3H1UA 5GMVA 4GGQA 3A4SC 2LVQA 4BFRA 2LHEA 3OJ4B 1RYJA 5C2TB 3WANA 2JY6A 3U4EG 5DPTA 3A1QA 3IHPC 3LXFA 2CS4A 2KTRA 3AB5A 2KTFA 4JX1C 4G50A 4HLEA 4DWFA 1YN3A 2KX0A 2LUMA 3DBRI 3UIPB 4WQOB 2SEBD 3NJTA 1EU4A 4LDTB 4JQWC 2KQ7A 5LXHA 3PLUA 3CWIA 4HXDA 1WM3A 1TZ1A 2INNE 2ZVNA 3B9JA 4HDOA 1OGWA 5C23A 5HFYA 4WAAA 4OVVA 5L95C 2FUG1 2UU7A 3ZDMC 1R7SA 2ZPNA 1JWUD 1QLBB 2X38A 5FR6A 3H7PB 3BVGA 2A5UA 1JALA 4DDID 2GI9A 1QOFA 3ZUNA 2EKEC 3PPAA 3PTFC 4XX5A 3TEZA 2W9NA 1XO3A 3QJZA 1HQRD 2KFKB 2OEDA 3HK0A 2YEPB 2GBJA 3OAWA 2ASQA 4MGKE 1HZ5A 1D3ZA 4MJSA 1WM2A 1KJTA 3TL5A 1QOBA 1WGKA 2K5PA 2M19A 4WURA 5CHWA 3W1SA 2RMMA 2MSED 3VH3B 3KH0A 2E6XA 2FCMA 1YD8U 2KC1A 4BKSD 1ZUD2 2KWDA 4ZHOA 3UIOB 2WXJA 1L0XB 4GN1A 2MJDA 3IG3A 3W1YA 1F2RC 5IA7A 3FILB 3UQAA 2EKIA 1JWSD 2BTEA 4TSSA 2LMCA 2IGGA 2HDEA 1TS4A 3KYCD 5CX3A 4AJWA 2DAFA 1GC6A 4P1CC 2KQSA 2LGDA 3DQVA 2VZKB 3SFEB 2A4ZA 1TS3A 3APFA 2ZW1A 2BS4B 2N1WA 4C7ZA 3OWEB 2DYBA 3SD5A 1K53A 4XZ4A 3QK0A 5EDSA 4FULA 2RDGA 4BOSC 1OTRB 2ZNVC 2AQ1B 3PO0A 5DPRA 1GB4A 2INCC 1Q0WB 2IY1B 3DHIC 1XQQA 1GOZA 3HIZA 2ZJDA 2JYTA 2WDQB 2WLBA 2IYDB 1MFWA 4GDLB 1P1AA 4GDKB 4M8MA 2WQYB 3AEEB 4MM3A 3LYYA 3MJWA 3DVNV 4XE0A 2K3UA 2FAZA 4ZYNA 2C7HA 4R3DA 2JWUA 3OJ3A 3GP7A 2KLCA 1J7BA 1N5WA 5H8YE 3SEBA 3J9CA 1IGCA 3DHGC 1WGRA 4M00A 1E7UA 3PZDA 3EHVA 1L0YB 2BS2B 3Q3OC 1FXIA 1GC7A 2DX5B 3GZNB 3QIJA 3R8BA 2WXOA 4KIKB 5D3IB 1E8WA 3Q3MC 1YX5B 4HPLB 3ABVB 1C1YB 2L0FA 4B95A 4IDIA 4IWOA 2W54A 2MRPA 4W9HA 1TKYA 3Q8BA 4KKIA 2C9WB 1OQQA 2BYVE 4B6WA 1C76A 4I6LB 1LXDA 1L4ZB 2GLSA 2JWZA 3DVGY 3AI5A
chains in the Genus database with same CATH topology
3RNFC 3N20C 2RDBC 3N1ZC 3RNGC 3N1YC 3GE3C 4P1BC 3Q3OC 3RNBC 1T0SC 1T0QC 3I63C 3RMKC 3RNCC 2INDC 4P1CC 3Q14C 3N1XC 2INCC 3Q3MC 3I5JC 3RNAC 3Q3NC 3Q2AC 3DHIC 3RN9C 1T0RC 3DHHC 3GE8C 3RI7C 3RNEC 3DHGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNF C;  3N20 C;  2RDB C;  3N1Z C;  3RNG C;  3N1Y C;  3GE3 C;  4P1B C;  3Q3O C;  3RNB C;  1T0S C;  1T0Q C;  3I63 C;  3RMK C;  3RNC C;  2IND C;  4P1C C;  3Q14 C;  3N1X C;  2INC C;  3Q3M C;  3I5J C;  3RNA C;  3Q3N C;  3Q2A C;  3DHI C;  3RN9 C;  1T0R C;  3DHH C;  3GE8 C;  3RI7 C;  3RNE C;  3DHG C; 
#chains in the Genus database with same CATH topology
 3AU5 A;  3H9D A;  2JRH A;  2HE7 A;  4RM8 A;  1SJH D;  1TS2 A;  4YT0 B;  1YN4 A;  1E7V A;  3IXS A;  4XC2 A;  3ZYY X;  2VRR B;  2C7N B;  1IBX A;  3UIN B;  3AEF B;  4XGA B;  1Y56 A;  1EWY C;  4NAW B;  1OFF A;  4KDI C;  2C7M B;  2JZZ A;  2L52 A;  2KAN A;  4IUM B;  4FJV B;  2V4L A;  2RPQ A;  4RF0 A;  3IAM 1;  4W9D A;  2L32 A;  1ZP0 B;  2AWT A;  4JWS C;  1E9M A;  1NDD A;  1Y8R C;  1NI3 A;  3PVL A;  4AOF A;  2D07 B;  1BUI C;  2ZNV B;  2PE9 A;  2WXK A;  3H7S A;  4XWW A;  1TGZ B;  1J19 A;  1D6E C;  3DDC B;  2D11 A;  4DXF A;  4BVU C;  5JHB A;  3Q8F A;  5GXG B;  3VVW B;  2WWZ A;  2JU6 X;  5EE9 A;  2WXI A;  2GB1 A;  3TEY A;  5IOI A;  2ON8 A;  1V8C A;  4B0M A;  3QWZ B;  2QDF A;  2WP9 B;  3TMP B;  1UBI A;  1WRI A;  2G4S A;  3PRE A;  2ZVO A;  2I2Y A;  4HEA 1;  3K9O B;  3PLV A;  3OG5 A;  2WX0 A;  3M62 B;  3EUB 2;  2DNF A;  3VHT C;  2WXR A;  1IP9 A;  2LRW A;  2QJL A;  1SXT A;  2MA9 B;  3ZXV A;  4KGR A;  1WXS A;  2KDE B;  2RGF A;  3TEX A;  2J0K A;  1ESF A;  1T5X D;  2KWC A;  2W55 A;  4REZ A;  4HVB A;  5G5H A;  4AWJ A;  5AUK A;  1WX8 A;  4A3O A;  1T0R C;  2WXM A;  1J7C A;  1B9R A;  1ROE A;  1OQY A;  3O65 B;  4OVU A;  3BK1 A;  1UD7 A;  2AYO B;  1MHH E;  2MP2 B;  4OZC A;  1FCC C;  5LXI B;  3RNC C;  2MBQ A;  2WU5 B;  4I6P A;  2LD9 A;  2WXP A;  3RNA C;  3Q3N C;  1T6B X;  4HKZ E;  3RYT A;  2O2V A;  2KO3 A;  3P4S B;  5JXV A;  1Z2M A;  3Q69 A;  3WAO A;  4N9F 4;  2CHW A;  3P63 A;  4EE2 A;  2ZW0 A;  4CO7 A;  2HTH A;  1I4Q A;  3BII D;  2JPH A;  3TJP A;  5E6N A;  2K6D B;  1KTK A;  2BW2 A;  3ZTC A;  1C77 A;  3R7Q A;  1VZ8 A;  4EFO A;  4NQL B;  3RZW C;  3V6C B;  4DHZ E;  4ZDV A;  4N59 A;  3PGE A;  2ICI A;  1I4R A;  4GU2 A;  3GZN I;  4OZB A;  2QCZ A;  1RRB A;  1JWM D;  3ZO5 B;  3CMM B;  1PUT A;  4JPS A;  4BOZ B;  3KVF B;  2O6V B;  5G2N A;  1N60 A;  1KH0 A;  5FKA C;  3BYY B;  4OVZ A;  1YMH E;  4DBG A;  1HZ6 A;  2QIE B;  4GSW A;  2BBC A;  1WGY A;  4GOC A;  3I9V 1;  4GB9 A;  4E71 A;  4GMV A;  1DOI A;  4TUU A;  3PSE B;  1E90 A;  2BPS A;  3ZNH B;  5EE1 A;  3TIX A;  4H2A A;  4MEL A;  2KNB A;  5CHF A;  4YSZ B;  3DBH B;  3UGB B;  3TEW A;  1QOG A;  1F2R I;  4KDL B;  2DZI A;  2V0G A;  2AL3 A;  4M01 A;  4KZC A;  2L76 A;  4W9C A;  4ANU A;  4K3C A;  4KSK C;  5FK9 C;  2DBY A;  2DEN B;  1FO4 A;  3ZW3 A;  1SSN A;  1WFY A;  3VR9 B;  2IO3 B;  4PYU A;  3PZ8 A;  2HD5 B;  1AYF A;  1J7A A;  3TCA A;  2BYE A;  1MVK A;  2WDR B;  2BKF A;  1WGD A;  2KJ6 A;  2L1A A;  3GOE A;  2LXC A;  4FHK A;  5TR5 A;  1TT5 B;  3V62 A;  1DOY A;  3URY A;  3MC0 B;  2KLG A;  3VDZ A;  2DYO A;  2KWV B;  5G55 A;  2D5G A;  3AE8 B;  2EMT A;  4NNJ B;  1WH3 A;  4KZ0 A;  1WJ4 A;  3IFW B;  3P42 A;  1WR1 A;  1TS5 A;  4F1S A;  1L2N A;  1FRD A;  1NEK B;  1FRR A;  2MH7 A;  3PV1 A;  4HJK A;  4IWP A;  2KAC A;  2J42 A;  1QF6 A;  3L13 A;  1WXV A;  2KN5 A;  1MI0 A;  1JWB D;  1WI0 A;  4K81 A;  4W9I A;  2XBB C;  3K9P B;  1GG3 A;  1MG8 A;  4FAD A;  4IKG A;  3PRM B;  5EE3 A;  1BML C;  3A9K B;  4II3 B;  3WAM A;  4EZJ A;  3AE5 B;  1WZ0 A;  4C80 A;  1PDX A;  3WAP A;  2BB5 A;  1KM7 A;  3AH7 A;  3BY4 B;  1H4R A;  3JYU A;  1FEH A;  3W2D A;  3RN9 C;  1UGJ A;  1JRP A;  1FNW A;  1KLG D;  3GE8 C;  3KUC B;  5BMI A;  3VRA B;  3W5U B;  3T8M A;  4JLC A;  2KDM A;  4YXD B;  3Q8E A;  3MC8 A;  1TZO A;  2WDV B;  4LNN A;  5T8I A;  3ZQ4 A;  1IYF A;  4P6V F;  4AQ7 A;  2KC2 A;  1YX6 B;  3L16 A;  2D3G A;  3PHX B;  1L6U A;  2IO1 B;  2DYM A;  2RDB C;  3RD2 A;  3SFD B;  3S2A A;  2XK5 B;  5HKH A;  3BVM A;  1PQS A;  3NRZ A;  4RFB A;  1T0Q C;  3QAQ A;  3N30 A;  3BK2 A;  3N3K B;  3T3O A;  4OZA A;  1XEE A;  2BGF A;  4DHJ D;  3L0W B;  3I3T B;  4HKQ A;  4FXC A;  1WF9 A;  1TKE A;  3EFU A;  2IGD A;  4UDU C;  4ICV A;  3VTV A;  3KUZ A;  2IO0 B;  3DWM A;  3NUH B;  2ACZ B;  1ZXH A;  2KD0 A;  3T3N A;  1C4A A;  1NVI D;  4ASW C;  2CU1 A;  3MTN B;  4PYZ A;  1VZ6 A;  2FE8 A;  1WE7 A;  1V86 A;  2K1F A;  4TQ1 A;  2LGI A;  2PVG C;  2WX1 A;  1KFY B;  3TBL D;  4MH8 A;  3JSV A;  4M8N A;  1VCB A;  3U30 A;  2MBH A;  4HDQ A;  3R2I A;  1TJE A;  3QHT A;  3DBL B;  3CIR B;  4X57 B;  1KRH A;  5DPS A;  4RGN A;  2Z0D B;  2GBR A;  2NBV B;  2JUO A;  2G4D B;  1UGM A;  2XN9 C;  1QKZ A;  2KFJ A;  5J17 A;  1BT0 A;  4N58 A;  3CF6 E;  1E8Y A;  4FJY A;  3CSF A;  3NS8 A;  4WJO A;  1D5X C;  3VUW A;  4MSQ B;  4DDG D;  4YSY B;  1F9J A;  2MP2 A;  1TBE A;  2LGS A;  3HUI A;  4DXA B;  3V6E B;  3VH4 B;  2BYT A;  4ZYS A;  1E7P B;  3DHH C;  4QAY A;  4W9K A;  1YJ1 A;  2FUH B;  3NHE B;  2OHF A;  3NOB A;  3A9J B;  4G0N B;  5TSS A;  5AZH A;  3KW5 B;  5BMG A;  3P2B A;  4M0W B;  3QX1 A;  4EOY A;  4YL8 A;  2NPT A;  2K9X A;  3I63 C;  4E74 A;  5BYR A;  1EM7 A;  3DBH I;  4FJZ A;  1ISN A;  2OJW A;  2KK8 A;  2XNA C;  3N9Y C;  1TTN A;  2MEK A;  4G3X B;  1B1Z A;  3B2G A;  1K8R B;  3EEC A;  2LAS A;  1FNU A;  1Q10 A;  2JYE A;  3HVZ A;  2D3C A;  2LFI A;  4B0E A;  1L6V A;  2INP E;  2R61 A;  3KWL A;  3ENE A;  3V61 A;  5C3J B;  4C7Y A;  1MHX A;  2QHO A;  4NAM A;  2HJ8 A;  3HM6 X;  3QA8 A;  2R2Q A;  2NBW B;  1I4P A;  1A70 A;  2KVR A;  1I4X A;  5J18 A;  2GBN A;  3BZD B;  3NS1 A;  3KWV A;  2KJR A;  1XLP A;  2JZ3 B;  2O6V A;  1WMH A;  4J3O D;  4ZRK A;  2M0A A;  4OHJ A;  2CJN A;  2KXJ A;  3UI3 A;  2DZM A;  1SF0 A;  1MJD A;  1SE4 A;  3VXW A;  2QMT A;  1ZDX A;  1PYW D;  1HTQ A;  4C4V A;  1ZDV A;  3H8H A;  1V1P A;  3APD A;  2WGS A;  1UUP A;  2C60 A;  1QZE A;  3PRZ A;  2Z59 B;  1VR9 A;  2XEW A;  4YTM B;  2FNJ B;  4ZRI A;  3M63 B;  1WGG A;  2REX A;  1E5W A;  3NZS A;  1CK1 A;  1R4M B;  2PJH A;  2LJ5 A;  2KQ4 X;  2CHZ A;  2KTR B;  4HPP A;  2N1V A;  2DZK A;  2BS3 B;  3ZRF A;  2N4F A;  1NYQ A;  4ARC A;  2M17 A;  4W9G A;  4PS8 A;  1XF5 L;  2L83 A;  3AU4 A;  2MW5 A;  3LJ3 A;  2Q5W D;  2DHZ A;  3ML8 A;  1ZPS A;  1J8C A;  1P7F A;  4MAC A;  4PS7 A;  1ACC A;  4BAX A;  4S0R A;  2WXL A;  4YSX B;  2GMI C;  2KWU B;  3DVN U;  4MT5 A;  3AUL A;  2KMA A;  2PE6 B;  1QOA A;  4W9L A;  3O13 A;  3AEG B;  4MDK E;  4YTP B;  2KZR A;  1LM8 B;  3HVD A;  2CHX A;  4RGM A;  5IAA C;  2Y5P A;  3A33 B;  4FA6 A;  1K52 A;  2JVC A;  2FID A;  4MJS B;  1PGX A;  4D2K A;  4AP4 C;  3KYD D;  2RD0 A;  5D94 A;  2WXQ A;  4TV3 A;  4KGS A;  2JZP A;  3KQ4 A;  4IC7 B;  5J2R A;  3ML9 A;  1P9D U;  2KMM A;  2V3P A;  2KOX A;  4ANW A;  2V3N A;  3ZXR A;  1J0G A;  1NEN B;  4WWP A;  1VZ7 A;  4FN2 A;  3C0R B;  2QEJ C;  1WSP A;  2NCN A;  3GE3 C;  3PRP B;  3WA0 A;  1T0S C;  1XLN A;  4HRO A;  4ZRQ A;  3AE4 B;  1TKG A;  3DBL I;  3PZ7 A;  2N7J A;  1RAX A;  3ALB A;  2JF5 A;  3H7P A;  5D2M B;  5MPO A;  4GIV A;  4LTU A;  1VLB A;  3X23 A;  1EF5 A;  5HHD G;  3QCA A;  2LZ6 A;  2G9H D;  2KFK A;  3FC4 A;  1SB3 C;  4LJP B;  1WX7 A;  2GBK A;  2RSU A;  3LDZ E;  2LGY A;  1C9F A;  1V97 A;  5I4D A;  1V81 A;  1FFV A;  2PEA A;  1V1O A;  5BMH A;  2PIA A;  4WAF A;  4ZOH C;  3AE9 B;  2D2Q A;  3VTU A;  1FNV A;  3ECI A;  2MWS B;  4RM9 A;  1EU3 A;  2KVZ A;  4XDC A;  3ZGZ A;  1WJN A;  5H92 C;  2AQ3 B;  4P7I A;  1WXM A;  2V3S A;  2VH1 A;  1N63 A;  4WJQ A;  4LK0 M;  1ZKH A;  3FIL A;  3AV8 A;  1V80 A;  4LCD E;  1GAQ B;  2G45 B;  3B1L X;  1WY8 A;  1QIL A;  1XT9 B;  2BT6 A;  4MM3 B;  1TIF A;  2N0S B;  2WS3 B;  2MHJ A;  2PKO A;  4RMA A;  1UEL A;  1XLO A;  2LEK A;  1RLF A;  1SBB B;  2AL6 A;  4MEM A;  1L7Y A;  2NVU I;  4EKU A;  5EE0 A;  3ZNG C;  1S1Q B;  3B08 A;  4J6I A;  4JIO U;  1ZOY B;  5E6O A;  1H8C A;  3NZ3 A;  2PMV A;  4LNF A;  5JH5 C;  3RNG C;  3U8Z A;  1V5T A;  4ZRJ A;  3L17 A;  2G1E A;  1U4A A;  2Z8L A;  4NJC A;  1SE2 A;  1EWC A;  1SEB D;  3VR8 B;  4BZA A;  1OEY J;  2X8X X;  4WIP A;  4LDT D;  3VRB B;  3DPD A;  4KGT A;  1M4V A;  2IBI B;  4DQO C;  2M1M A;  1DYQ A;  1CZP A;  1L0V B;  3U7Z A;  1WR6 E;  2GOW A;  2W82 A;  3WAL A;  3T9L A;  1PFD A;  2N9P C;  4GDL A;  5E6J A;  1RM6 C;  4LNI A;  4GDK A;  1WZ3 A;  1ZE3 D;  2IY0 B;  3GB1 A;  1NI2 A;  1FXA A;  3HHM A;  1FIQ A;  2RDH A;  3JVZ X;  4RCO A;  4O1N A;  1N5X A;  1UF0 A;  2OOB B;  2ZZP B;  1WE6 A;  1R4M I;  3M3J A;  2FCN A;  1C4P A;  4ICU A;  1SGH A;  2BWF A;  2JX5 A;  3V3X A;  1IBX B;  3IAS 1;  3HM3 A;  4EZK A;  2LVO A;  4ZHP A;  4KIK A;  1WX9 A;  4WWM A;  4ANV A;  4C00 A;  4BKT A;  4W9F A;  2N9K A;  4WH4 A;  1SE3 A;  2EEL A;  3EC8 A;  3ZJU A;  3VUX A;  3ETR A;  1ZXI A;  1P0R A;  4A6Q A;  1ET9 A;  2LGX A;  3IBE A;  3APC A;  4BKS A;  3U52 E;  1VDV A;  1P3Q U;  2TSS A;  2BVC A;  2K6Q A;  1X1M A;  1GJZ A;  3AE1 B;  4HPM B;  1WGH A;  3R3M A;  1C3T A;  3ZTD A;  4A8X C;  3Q3J A;  5KHQ A;  2MX2 A;  1EUV B;  2AX5 A;  4WWO A;  5AEK B;  2IGH A;  1OEY A;  1A5R A;  3C19 A;  4ITK A;  2L8J A;  2IPK D;  1RFK A;  2VZK D;  3ONS A;  2N9L A;  1KOT A;  1WWT A;  1ET6 A;  1YQ4 B;  3ZNZ B;  4A55 A;  4K7U A;  3M95 A;  4NAW A;  1V49 A;  2D10 A;  2IO2 B;  4ACF A;  3CST A;  3ZIM A;  1AW7 A;  4P1B C;  1YN5 A;  4TKN A;  1F0Z A;  1XCT L;  3RT3 B;  1IPG A;  3RMK C;  1V6E A;  2ZCB A;  2H89 B;  3W5V B;  2L05 A;  1CJE A;  4RGT A;  1UWX A;  3DOW A;  1N61 A;  1N6Z A;  1Q5W B;  2PW9 A;  4MGI E;  2VH2 A;  1XCQ L;  3AE7 B;  4IG7 B;  1SJE D;  1YOV B;  4NPN A;  2BYF A;  2M4N A;  2D3A A;  3ZLZ A;  4AUQ C;  1MG4 A;  2RR9 A;  2I1K A;  2PPH A;  1WXA A;  3B0A A;  4DXG A;  2YVC A;  2NS5 A;  3AEB B;  3L54 A;  4CYE A;  1JW9 D;  3PS6 A;  2J4X A;  1LQB A;  1JQ4 A;  1WIA A;  1BXT A;  1C78 A;  1CMX B;  4S17 A;  1YIW A;  2CU3 A;  3L4P A;  4IM2 A;  3V60 A;  2BKR B;  2JT4 B;  1F52 A;  4W9E A;  1XXG A;  4A90 A;  2MJ3 A;  1IUE A;  5BYS A;  1LO5 D;  1WXQ A;  4IM3 A;  5D7G A;  5IP4 D;  3IT6 B;  3KLS X;  1V9J A;  3MP9 A;  4FLH A;  1E6E B;  1F1H A;  1NYR A;  4N6E B;  2O2V B;  1R4N B;  4NJ7 A;  2IDY A;  3AMZ A;  3PT2 B;  2K0P A;  1UZX B;  1D5M C;  3L10 B;  1HE8 A;  2LRU A;  4HCN B;  2L3Z A;  2CR5 A;  2V1Y A;  3MHS D;  3ZKJ C;  3R7R A;  1CQV A;  3RUL A;  3R66 C;  3DWG C;  3E56 A;  5HI1 A;  5FR3 A;  2MBE A;  3N32 A;  3Q2A C;  4XDD A;  4BBN F;  3X0W A;  2Z0E B;  2B76 B;  2DWQ A;  4G11 A;  1WYW B;  2WXN A;  2GBM A;  4HJG E;  2H88 B;  3WCQ A;  3C8Y A;  2N7D A;  3BIN A;  3SHQ A;  4RH6 A;  3NVW A;  2MCN B;  1JRU A;  3PHW B;  1V5O A;  4JWU C;  2QC8 A;  5IO9 A;  3MFG A;  3SU8 X;  2HJ1 A;  4BKG A;  1JRO A;  3E9S A;  4KSL C;  2OJR A;  4YWG G;  2QIL A;  4KX6 B;  3N1Y C;  3ZDT A;  3BWU D;  4RF1 A;  3ZRC A;  3P1M A;  3VQI A;  3SDL C;  2MBB B;  2J52 A;  4JE3 B;  3JW0 X;  2K8H A;  4LNK A;  3A4R A;  4FHJ A;  2J0M A;  2JSV X;  4I6N B;  3QC8 B;  2K25 A;  3MC9 A;  1D4B A;  3ZVV A;  1T0Y A;  2N7E A;  4US9 A;  4NQK E;  3AM9 A;  2KT7 A;  3W1S C;  2L0T A;  2DAJ A;  3RNB C;  3B2F A;  3BVZ A;  1Z5S B;  3WIM A;  4RGO S;  2HTM E;  4DHJ B;  2M56 B;  5BYQ A;  3RNF C;  2NTT A;  1D5Z C;  3RPF C;  4K3B A;  2V4I B;  3AED B;  1OQR A;  3FKY A;  1FMA D;  2DZJ A;  2ONQ A;  4ARI A;  1I7H A;  3NVZ A;  1N62 A;  2NR2 A;  1P98 A;  2Y3A A;  2KMC A;  2J7Q B;  2FCS A;  2PVO D;  3U2S C;  3L08 A;  4L1B A;  2WYQ A;  2BF8 B;  4BBN C;  1RWS A;  2EMS A;  5AUI A;  3RI7 C;  4MGZ E;  3TSS A;  5LNK 1;  4MGY E;  4IW0 A;  3MHZ A;  4DK5 A;  4A9A A;  1KLV A;  1LFD A;  3UF8 A;  1T3Q A;  5L83 A;  3SR6 A;  1TYG B;  1FM0 D;  3P4R B;  1YQB A;  2MQJ A;  2J53 A;  4IM0 A;  1I35 A;  3I57 A;  3U7D A;  2Y5C A;  1VRA B;  4ZRP A;  4L23 A;  1QQR A;  4EEW A;  3AEA B;  4E3C A;  5LLI A;  1QT9 A;  2KJH B;  3BYT B;  3Q3F A;  4L2Y A;  1FCL A;  5D3D A;  2K22 A;  1EF1 A;  1TY2 A;  2D3B A;  4F7Z A;  4WJP A;  3DVG X;  3NG0 A;  1AN8 A;  5CHV C;  2LHD A;  3A1Q B;  2IZV B;  1VJK A;  1GPX A;  4C56 C;  1XLQ A;  2W3R A;  2ZCC A;  4WQM A;  3ZNI D;  5DPW A;  3EA6 A;  3IT4 B;  4A3P A;  4W9J A;  3OLM D;  4KVG B;  3EFC A;  4GXB A;  4A20 A;  1E10 A;  3N20 C;  2JXT A;  3N1Z C;  1SIJ A;  2Y5B B;  3FAH A;  1NBF C;  2JXX A;  2JRI B;  5E6P A;  1HXY D;  2UYZ B;  1FD6 A;  4US8 A;  1EO6 A;  3VTW A;  4CHK A;  4IWQ A;  5C1Z A;  1M94 A;  2BQQ A;  2KHW B;  3AE6 B;  4DHZ B;  3ZJV A;  1WYG A;  3A9K A;  4USA A;  3P4P B;  3RFZ B;  4IOI E;  3KUD B;  1VD2 A;  3AXC A;  2B3A A;  1PGB A;  1K51 A;  1YNT E;  4LLG M;  2N9X A;  1HTO A;  1HEZ E;  2O6V D;  1E0Z A;  3NZU A;  1R4N I;  1L5P A;  4RNA A;  1YQ3 B;  3D32 A;  1JCK B;  3P4Q B;  4JGH B;  2V9H A;  2I1J A;  4NZL B;  2E3T A;  4EUT A;  3DBR B;  1L4D B;  5JHA A;  1WJU A;  1HA5 A;  3QQ8 B;  4AJY B;  3JSV B;  3MJ5 A;  2LWP A;  2IJ0 A;  3LB8 C;  2XK5 A;  3Q8C A;  2WNM A;  1WRD B;  5D6J B;  4NY0 A;  2MJE A;  2YEP F;  2KDF B;  3RNE C;  2M8S A;  4KKJ A;  1ZW7 A;  2NBU A;  2FBW B;  1P7E A;  2QSD A;  1AWD A;  4OW0 A;  2KDI A;  5IKC M;  2MLB A;  1FXT B;  2CJO A;  2CKH B;  3VFK A;  4TMA B;  1I42 A;  4URK A;  2LVP A;  2G3Q B;  5HG2 A;  3AE3 B;  2L7R A;  4NJ6 A;  1KLU D;  2R2O A;  3RCZ A;  2K39 A;  1LGR A;  1Q1O A;  3IVF A;  4PS3 A;  3UQB A;  2I38 A;  1K50 A;  2NPT B;  1ZGU B;  3RZF A;  3Q8A A;  1PGA A;  1UNS A;  2PLP A;  3Q14 C;  2WHI A;  2AEH A;  1STE A;  3QAR A;  3EGR A;  3R2T A;  4HRS A;  5G5G A;  2NTS A;  5DCN A;  4F8C B;  2KAJ A;  1UBQ A;  1MPE A;  2FIF A;  1DGJ A;  4MSM B;  1E8Z A;  4TQ0 A;  1RFA A;  4JL9 A;  1FPY A;  5IN7 A;  4AS1 A;  2L00 B;  2KN4 A;  1ENF A;  1E8X A;  2C5L C;  1I4H A;  4EZL A;  1GB1 A;  2N9E B;  4LJO B;  4PK1 A;  4HWI B;  2WXF A;  2K8C A;  3AN1 A;  1WMH B;  3Q6B A;  5AZF A;  2LI5 A;  5AZG A;  3W9C B;  4YTN B;  4FBJ B;  3A9J A;  1DOX A;  3DBS A;  3NVY A;  5CTR C;  1C4C A;  2LJI A;  3AEC B;  5KHO A;  4M0W A;  2WDT B;  1UH6 A;  1I4G A;  1V2Y A;  4WWN A;  4C4V B;  4LNO A;  3VUY A;  1TY0 A;  1F77 A;  2SAK A;  1V1P B;  3NY5 A;  1KF6 B;  2JQR B;  4KV2 A;  2LXA A;  4P16 A;  2KYW A;  4K1R B;  2MBO A;  4MH0 E;  4ANX A;  1FFU A;  2KKC A;  4K7S A;  1YJI A;  5BO4 B;  3NVV A;  4XWT A;  1GUA B;  2WU2 B;  4WJN A;  2KX3 A;  2K8B A;  1AAR A;  4HK2 A;  2FCQ A;  2DLB A;  3VAW A;  2BWE S;  1S3S G;  4K7W A;  4HCP B;  1JWA D;  1G6J A;  4M02 A;  2KDB A;  2M0X A;  2ZEQ A;  1UWM A;  1SE9 A;  1C79 A;  2AQ2 B;  2BB6 A;  3TUO A;  5JZE B;  2LUE A;  3N1X C;  2J0J A;  3V05 A;  1SIF A;  3ZJT A;  1XD3 B;  2W3S A;  4CQN A;  4PT5 A;  3RUI B;  2WXG A;  3H6N A;  1JML A;  4GLS C;  4XYC A;  3HRD D;  4B9K A;  2YLM A;  2NMQ A;  2GRI A;  4Q2J A;  1GNU A;  2IND C;  2PTL A;  2ZPY A;  2UWQ A;  1WJ6 A;  3GS2 A;  4II2 B;  2WXH A;  3I5J C;  3DCG A;  1IGD A;  2RPV A;  3AE2 B;  1YJJ A;  3H1U A;  5GMV A;  4GGQ A;  3A4S C;  2LVQ A;  4BFR A;  2LHE A;  3OJ4 B;  1RYJ A;  5C2T B;  3WAN A;  2JY6 A;  3U4E G;  5DPT A;  3A1Q A;  3IHP C;  3LXF A;  2CS4 A;  2KTR A;  3AB5 A;  2KTF A;  4JX1 C;  4G50 A;  4HLE A;  4DWF A;  1YN3 A;  2KX0 A;  2LUM A;  3DBR I;  3UIP B;  4WQO B;  2SEB D;  3NJT A;  1EU4 A;  4LDT B;  4JQW C;  2KQ7 A;  5LXH A;  3PLU A;  3CWI A;  4HXD A;  1WM3 A;  1TZ1 A;  2INN E;  2ZVN A;  3B9J A;  4HDO A;  1OGW A;  5C23 A;  5HFY A;  4WAA A;  4OVV A;  5L95 C;  2FUG 1;  2UU7 A;  3ZDM C;  1R7S A;  2ZPN A;  1JWU D;  1QLB B;  2X38 A;  5FR6 A;  3H7P B;  3BVG A;  2A5U A;  1JAL A;  4DDI D;  2GI9 A;  1QOF A;  3ZUN A;  2EKE C;  3PPA A;  3PTF C;  4XX5 A;  3TEZ A;  2W9N A;  1XO3 A;  3QJZ A;  1HQR D;  2KFK B;  2OED A;  3HK0 A;  2YEP B;  2GBJ A;  3OAW A;  2ASQ A;  4MGK E;  1HZ5 A;  1D3Z A;  4MJS A;  1WM2 A;  1KJT A;  3TL5 A;  1QOB A;  1WGK A;  2K5P A;  2M19 A;  4WUR A;  5CHW A;  3W1S A;  2RMM A;  2MSE D;  3VH3 B;  3KH0 A;  2E6X A;  2FCM A;  1YD8 U;  2KC1 A;  4BKS D;  1ZUD 2;  2KWD A;  4ZHO A;  3UIO B;  2WXJ A;  1L0X B;  4GN1 A;  2MJD A;  3IG3 A;  3W1Y A;  1F2R C;  5IA7 A;  3FIL B;  3UQA A;  2EKI A;  1JWS D;  2BTE A;  4TSS A;  2LMC A;  2IGG A;  2HDE A;  1TS4 A;  3KYC D;  5CX3 A;  4AJW A;  2DAF A;  1GC6 A;  4P1C C;  2KQS A;  2LGD A;  3DQV A;  2VZK B;  3SFE B;  2A4Z A;  1TS3 A;  3APF A;  2ZW1 A;  2BS4 B;  2N1W A;  4C7Z A;  3OWE B;  2DYB A;  3SD5 A;  1K53 A;  4XZ4 A;  3QK0 A;  5EDS A;  4FUL A;  2RDG A;  4BOS C;  1OTR B;  2ZNV C;  2AQ1 B;  3PO0 A;  5DPR A;  1GB4 A;  2INC C;  1Q0W B;  2IY1 B;  3DHI C;  1XQQ A;  1GOZ A;  3HIZ A;  2ZJD A;  2JYT A;  2WDQ B;  2WLB A;  2IYD B;  1MFW A;  4GDL B;  1P1A A;  4GDK B;  4M8M A;  2WQY B;  3AEE B;  4MM3 A;  3LYY A;  3MJW A;  3DVN V;  4XE0 A;  2K3U A;  2FAZ A;  4ZYN A;  2C7H A;  4R3D A;  2JWU A;  3OJ3 A;  3GP7 A;  2KLC A;  1J7B A;  1N5W A;  5H8Y E;  3SEB A;  3J9C A;  1IGC A;  3DHG C;  1WGR A;  4M00 A;  1E7U A;  3PZD A;  3EHV A;  1L0Y B;  2BS2 B;  3Q3O C;  1FXI A;  1GC7 A;  2DX5 B;  3GZN B;  3QIJ A;  3R8B A;  2WXO A;  4KIK B;  5D3I B;  1E8W A;  3Q3M C;  1YX5 B;  4HPL B;  3ABV B;  1C1Y B;  2L0F A;  4B95 A;  4IDI A;  4IWO A;  2W54 A;  2MRP A;  4W9H A;  1TKY A;  3Q8B A;  4KKI A;  2C9W B;  1OQQ A;  2BYV E;  4B6W A;  1C76 A;  4I6L B;  1LXD A;  1L4Z B;  2GLS A;  2JWZ A;  3DVG Y;  3AI5 A; 
#chains in the Genus database with same CATH homology
 3RNF C;  3N20 C;  2RDB C;  3N1Z C;  3RNG C;  3N1Y C;  3GE3 C;  4P1B C;  3Q3O C;  3RNB C;  1T0S C;  1T0Q C;  3I63 C;  3RMK C;  3RNC C;  2IND C;  4P1C C;  3Q14 C;  3N1X C;  2INC C;  3Q3M C;  3I5J C;  3RNA C;  3Q3N C;  3Q2A C;  3DHI C;  3RN9 C;  1T0R C;  3DHH C;  3GE8 C;  3RI7 C;  3RNE C;  3DHG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...