3DHHC

Crystal structure of resting state toluene 4-monoxygenase hydroxylase complexed with effector protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural consequences of effector protein complex formation in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords toluene 4-monooxygenase hydroxylase alpha subunit
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3dhhC00
2RDBC 3GE3C 3DHIC 2INDC 1T0QC 1T0RC 3DHHC 2INCC 3DHGC 3Q2AC 3Q3MC 3RNCC 3N1ZC 3RNFC 3N1XC 3GE8C 3RMKC 3I63C 3RNBC 3RI7C 4P1CC 3RNEC 4P1BC 3RN9C 1T0SC 3Q14C 3N1YC 3Q3NC 3Q3OC 3I5JC 3N20C 3RNAC 3RNGC
chains in the Genus database with same CATH superfamily
2YEPB 2Q5WD 1YX5B 2BKFA 2WDVB 1G6JA 2NPTA 4OVVA 1FD6A 4AQ7A 2FIFA 4YTMB 2L32A 2Y5CA 2N9PC 2IGHA 1HE8A 2VZKB 3ZRCA 4GLSC 2W3RA 2XN9C 1L6VA 4GU2A 2J0KA 2KQSA 1UUPA 3AU5A 1JRUA 2KT7A 5GMVA 3GE3C 1F77A 2Z0DB 2DZIA 1GC7A 4W9DA 5HI1A 2FAZA 3RNCC 2WXMA 2KFKA 2BTEA 3BWUD 1DOYA 3KH0A 4M00A 3ML9A 1NEKB 5L83A 2ZVNA 3SHQA 1C77A 1FRRA 2D3BA 4A55A 2MBOA 3PREA 2L7RA 3U2SC 2JPHA 2JYEA 4DHJB 3H8HA 3VR9B 2RGFA 2W55A 2UWQA 1FEHA 1UNSA 2QCZA 1PGAA 4ZYSA 2HD5B 4B6WA 3VXWA 3PS6A 1RFKA 2IZVB 4FJZA 2DHZA 4BOZB 4XDDA 1TTNA 3DBSA 3B0AA 3NRZA 1V1PA 2DAFA 3QJZA 1QOBA 1XQQA 2C7NB 2V4LA 3SFEB 3VR8B 1D4BA 2H89B 2J0MA 4M0WB 1WZ0A 4KZ0A 2GBMA 3V6EB 2JSVX 2LHEA 4C7YA 1QZEA 1AW7A 1N5XA 4NAWA 2FCMA 2INDC 2IPKD 4GIVA 2CKHB 1JWMD 2K39A 2WHIA 3VVWB 5JH5C 4YSZB 4W9EA 2IO3B 3OWEB 1PGXA 1EF1A 3IAS1 5H8YE 1V5TA 2L3ZA 1F2RC 2REXA 3RNGC 3A1QB 3PZ7A 3AM9A 1SB3C 2G4SA 3B2GA 5E6OA 2OJRA 1EUVB 1Z5SB 3BK2A 4LNKA 2E6XA 3DWGC 4YTPB 2RMMA 4L23A 2LHDA 1EU4A 1V9JA 1FNVA 5EE9A 1EU3A 4HCNB 1NYRA 1JCKB 1GAQB 3ZW3A 1JW9D 4C4VB 1WXQA 3PV1A 4F8CB 1STEA 2LRUA 3HK0A 4KSKC 2KWVB 3Q8BA 2BYFA 2BW2A 2WU5B 4PYUA 4MACA 5AUKA 4GDLB 5TSSA 4HDOA 4IDIA 2MWSB 1KFYB 4NZLB 1M94A 4XWWA 2JRHA 3UQBA 4XC2A 3Q69A 4B0MA 3TSSA 2RPVA 3BINA 4ANWA 1DOXA 3ZYYX 4PS7A 3DBLI 4UDUC 3FILA 2C7MB 4HLEA 4GDKA 1N63A 1EWYC 2BBCA 4GXBA 3SR6A 2C9WB 2NBWB 3ZJVA 4RM9A 1I4GA 4EEWA 1RRBA 1P98A 1N60A 2K1FA 1UWMA 1UBIA 1A70A 1L4DB 4JWSC 5BYSA 2GBNA 3VRBB 4LNNA 3AEDB 2M1MA 3HM3A 5FR3A 2FBWB 1DYQA 2OHFA 3HVDA 5BMIA 2ACZB 1WMHA 2WGSA 3N9YC 4F7ZA 4RF0A 4MH8A 1FXIA 1L0YB 2W82A 3R7RA 4NAMA 4GB9A 2ZW0A 2N1VA 2LMCA 4A6QA 2G3QB 2WXQA 3A9KB 3VFKA 4W9HA 2GB1A 4WIPA 3RT3B 3RZFA 2DWQA 1YQ3B 1WGRA 4N6EB 4R3DA 2FIDA 5C3JB 2DENB 4DQOC 3IXSA 2UU7A 1HTOA 2JF5A 2CHXA 3AEAB 3TL5A 3Q8CA 2ZZPB 4US8A 3IG3A 3QAQA 1VRAB 1OEYA 1V1OA 3DOWA 3TEYA 1ET9A 3VUYA 2LD9A 4RGMA 3A33B 1P1AA 3IFWB 1E7UA 3IT6B 1VZ6A 2KC2A 1ZPSA 3HVZA 2VH2A 4W9GA 5D94A 1RYJA 1H4RA 1L4ZB 4MDKE 4MGKE 4LK0M 3MFGA 4AS1A 5I4DA 3V6CB 2HTME 1LM8B 2ZPNA 5MPOA 4OVUA 3PZDA 2WXFA 2LASA 2K22A 4YT0B 1IYFA 2R61A 3WANA 1D5XC 3RNEC 4P1BC 1WGDA 2LI5A 4WQMA 5IAAC 5GXGB 1QF6A 2V9HA 1E0ZA 2MEKA 3O13A 4L2YA 3ZRFA 3KVFB 3PSEB 2LWPA 1R4NI 2KK8A 2FCSA 2GRIA 5IO9A 3L10B 3U7ZA 1TYGB 4ANUA 3OAWA 3RNFC 3A9JB 3LJ3A 3DPDA 3APFA 4HEA1 3MC9A 1F2RI 1GOZA 3N1YC 4HJGE 2X8XX 1WE6A 2A4ZA 3R8BA 1UH6A 2QDFA 3PZ8A 4RGOS 4WAFA 3QQ8B 3V61A 2MP2A 3CSTA 1KLGD 3U7DA 3V05A 2KLGA 4WWOA 3BIID 1LQBA 1JRPA 2MQJA 3NVWA 4G0NB 1UF0A 4HPLB 3V3XA 4AJYB 2ON8A 2KWDA 4NNJB 3QCAA 3IHPC 4ZHOA 5LXHA 2N7DA 2BKRB 2XK5A 3MTNB 2J0JA 4NJCA 2I38A 3A1QA 3N1XC 1E90A 1J19A 2LUMA 3RMKC 5JZEB 2WDQB 3RI7C 2KOXA 1SEBD 1E8YA 3KWLA 3U8ZA 2MJ3A 4GDKB 1E8ZA 2R2QA 1BT0A 4US9A 4YL8A 3M62B 2G9HD 3N20C 1WGGA 1IGCA 3W1YA 1YNTE 1E7VA 2JUOA 3RNBC 2EKIA 4O1NA 2IGGA 5L95C 2PEAA 2SAKA 4IWOA 2ICIA 1L0XB 1FCLA 2RDBC 3LYYA 1BUIC 2LEKA 1VJKA 2O6VB 3ZNZB 4FBJB 3KQ4A 2K6DB 3AE2B 2J42A 3VTWA 1ZUD2 3PHXB 3HUIA 1SJHD 2JVCA 2MSED 4LNOA 1WXAA 3EC8A 4EKUA 1KTKA 2KDEB 5FK9C 3PO0A 4LTUA 4J3OD 2PMVA 1UGMA 1XF5L 2CJNA 4OZAA 1M4VA 3DCGA 1WH3A 3P1MA 2ZW1A 2CHZA 3ZNID 1QOAA 2BYEA 3P63A 2IYDB 4MJSB 2N1WA 1SBBB 1GB1A 4QAYA 1GC6A 2DBYA 4LLGM 4NQLB 2MBBB 3ZXRA 1QKZA 1C78A 5T8IA 4EZJA 2JZZA 4ZRKA 2FNJB 4WAAA 4M0WA 3L4PA 1WM3A 2B3AA 2ZVOA 2Y5PA 4KGSA 2XBBC 4KVGB 3RZWC 3AE8B 3R7QA 1WR6E 1WJUA 2AQ1B 2YVCA 2QILA 1HZ6A 2ASQA 1MJDA 1C3TA 3OG5A 2Z8LA 5FR6A 4LCDE 4ITKA 3EFUA 1E7PB 1FXAA 1PGBA 4WWPA 2INPE 4I6NB 3TEWA 4KKJA 1YQ4B 2OOBB 3KUZA 5EE0A 2JZ3B 4N59A 4RCOA 5D7GA 1GG3A 2Z0EB 4ASWC 4DWFA 3I9V1 5DCNA 4LJPB 3ZO5B 1FIQA 1TZOA 1XO3A 2BB6A 5DPRA 2IGDA 3GZNI 3DHHC 2I1JA 4LDTB 2HTHA 3TEZA 4HXDA 4EUTA 1OFFA 2KQ7A 4K7WA 3RCZA 1XT9B 3AEFB 5EE3A 4ZHPA 2G4DB 5KHQA 2KMMA 3U30A 1MVKA 2TSSA 4ANVA 3Q2AC 4PS3A 1Q5WB 4NPNA 1SE4A 3NZSA 2L8JA 2IO1B 4N9F4 4P16A 1D5ZC 3K9OB 4P1CC 2KFKB 2HE7A 5LNK1 1ZOYB 2DAJA 2QHOA 4MSQB 3PVLA 3I5JC 5AZFA 5HKHA 1CQVA 1XLPA 2WXHA 2K6QA 4DXGA 1QOGA 1LO5D 2KXJA 3BVMA 2PVOD 1YN5A 4KX6B 3ONSA 2XNAC 1GB4A 2NBVB 3UIOB 2C60A 3WAOA 4JE3B 4BBNF 1KOTA 4MJSA 4GDLA 2O6VA 5DPWA 4YWGG 2JY6A 2IO2B 1MPEA 1VZ8A 2NTSA 1HZ5A 4IG7B 1P3QU 1I4XA 4JGHB 2BB5A 5G55A 1KLVA 1I35A 3N30A 3AE1B 1JWUD 2KACA 2KD0A 2KJHB 2KDIA 2VH1A 5TR5A 3ABVB 2VRRB 2KHWB 3Q3OC 2KFJA 5JHAA 3QC8B 2D3CA 1NBFC 3N3KB 1CK1A 4G3XB 1J0GA 1C76A 4JX1C 1XLQA 1WJNA 5BYQA 1F9JA 1KLUD 1R4NB 3A4SC 2O2VA 1N61A 2KNBA 4EFOA 1WGKA 1TS4A 4EZLA 1C9FA 3URYA 2K8BA 3W9CB 1N5WA 2GBKA 3AV8A 4JWUC 4ACFA 1JROA 3AXCA 1FFUA 2IJ0A 4XX5A 2JT4B 2N9KA 1MHHE 1WY8A 2X38A 2KVRA 3MJWA 3I57A 3QARA 3CSFA 4RFBA 4KV2A 3HHMA 2J53A 3APDA 2BS2B 4HKQA 1SXTA 4L1BA 5C1ZA 2WQYB 3S2AA 2WU2B 4XWTA 5J18A 3N32A 1GNUA 2KC1A 3UQAA 1OGWA 3IT4B 4G11A 2ZCCA 3JVZX 4C56C 3CF6E 5J2RA 3DVGX 4F1SA 3AH7A 1NI3A 1MI0A 3AB5A 2KX0A 1TZ1A 3QIJA 3NVVA 4FJVB 3SEBA 1LGRA 4BAXA 5EDSA 1NENB 4W9IA 4H2AA 3ZLZA 3K9PB 1T5XD 3Q8AA 3Q14C 2K5PA 4HVBA 1NDDA 1IBXA 4KDLB 4NY0A 4K81A 4OZBA 4IWPA 3ZDMC 1C4AA 2FE8A 4BKTA 3ECIA 4GOCA 2KX3A 2WDRB 4I6LB 3W5VB 1V1PB 3QHTA 2JXXA 4TMAB 4C00A 4KIKB 3IVFA 1TS5A 1P7EA 2FUHB 2KMAA 3NVZA 5H92C 4LNFA 5CHWA 5AZGA 2VZKD 2MRPA 3L13A 4S0RA 1K52A 3DVNV 4ZRPA 4YTNB 4TV3A 4W9JA 1I4RA 3M63B 2O6VD 2ZJDA 4FA6A 4LNIA 1ZDVA 1TT5B 2J7QB 3ALBA 4ZRIA 1TY2A 4NJ7A 4S17A 3NUHB 5IP4D 2GBJA 3DBLB 3TMPB 3WIMA 1PQSA 3AE5B 1YJ1A 2PLPA 4IM2A 3KUCB 1MFWA 3MHSD 1E10A 1WMHB 2QSDA 2RSUA 3KWVA 3CIRB 2JYTA 3PGEA 2N0SB 1V80A 2N4FA 2UYZB 3OLMD 5E6PA 1F0ZA 1V86A 2MLBA 1NYQA 2BPSA 1I4QA 3IAM1 4CO7A 3PPAA 1S1QB 2KDFB 2LVPA 4HK2A 4K1RB 2HJ8A 2JXTA 3W5UB 4ZRJA 5IKCM 1IGDA 3O65B 1N6ZA 2BS3B 2PE9A 2ZEQA 2WLBA 2BYVE 3VTVA 2PW9A 3MC0B 1AYFA 2DYOA 4YSXB 3B1LX 4AUQC 3ZVVA 3L08A 1YOVB 2ONQA 5D2MB 4TUUA 4W9KA 2LZ6A 3VTUA 3SU8X 2WXGA 3UIPB 1ROEA 4EZKA 1Q10A 4B95A 1RM6C 4EE2A 1NVID 4BKSD 1D5MC 4J6IA 1FPYA 4W9FA 2M0XA 2LJIA 4IW0A 3M95A 1ISNA 1T0YA 2BYTA 1I42A 2Y5BB 1AWDA 3B2FA 3NG0A 5AUIA 1V8CA 1RFAA 2M19A 5HFYA 1ZXIA 2LVOA 3AEBB 1SSNA 2K8CA 2KWUB 1Q1OA 3E56A 2V0GA 1FCCC 1OQYA 2KN5A 1L0VB 2KANA 1C4PA 2IBIB 1J7BA 1WRIA 4E71A 4C7ZA 4YSYB 1WJ6A 2LGYA 1EO6A 2B76B 2QC8A 3BYYB 3CWIA 2M0AA 3P4PB 2NCNA 1CJEA 4CYEA 1K51A 3NZ3A 4GSWA 2MH7A 5JXVA 1ZW7A 2WDTB 3NHEB 2L1AA 1DOIA 2LVQA 3OJ4B 1TY0A 1ENFA 2R2OA 4AP4C 3H1UA 3ZUNA 3BVGA 2Z59B 3V60A 3E9SA 4OW0A 3GB1A 4AOFA 2OEDA 4REZA 2AWTA 1T0RC 2AQ3B 4WJOA 4WQOB 5D3IB 3VRAB 3I3TB 4NJ6A 1L6UA 2YLMA 1I4PA 3B9JA 3DWMA 3AE7B 4OHJA 1E8WA 2INNE 4TKNA 5BYRA 1B9RA 3DVNU 4IM0A 3L17A 3C19A 3SDLC 4G50A 1WX9A 2G45B 3IBEA 2M17A 2BT6A 2WS3B 4CHKA 1GJZA 1ZDXA 4FADA 1BMLC 2LGDA 2M8SA 4B9KA 1D3ZA 4MGYE 2N9LA 4P7IA 3PLUA 3UGBB 1JWBD 1VZ7A 3AU4A 2PVGC 4BZAA 3R2IA 3JYUA 2L83A 3EUB2 1WGHA 1OTRB 3H7PB 4DHJD 1MG8A 1GPXA 4FN2A 1WZ3A 2C5LC 3AEGB 1D6EC 3Q3NC 2BQQA 3EA6A 1WX7A 2V3SA 2WXLA 1EF5A 2FCNA 2JZPA 3T9LA 3WALA 1ZGUB 1OQRA 2L52A 1ZXHA 1IUEA 1HXYD 1HTQA 4KSLC 1FXTB 1WWTA 1WF9A 2EKEC 2WXOA 2JU6X 1TKYA 5IN7A 2KAJA 2ZNVC 1FFVA 2RPQA 1WFYA 3RFZB 2D3GA 3ZXVA 1C1YB 4E74A 2M56B 2PJHA 4N58A 3NVYA 5CTRC 2KMCA 4A3PA 3KYDD 4DDGD 3GE8C 1WYGA 4RGNA 2CR5A 4JLCA 5C2TB 5E6NA 1XLNA 3GOEA 2YEPF 3WAPA 2KYWA 2NBUA 3C8YA 3T3OA 3FKYA 4XYCA 2KDBA 2BVCA 2DLBA 2KDMA 3QA8A 4XGAB 2MBHA 1J7AA 2L00B 1FNWA 3ZGZA 3PT2B 1WXVA 4E3CA 1FNUA 4IKGA 4KKIA 4A9AA 2NTTA 1KF6B 4HKZE 3H6NA 3UI3A 3AECB 2MHJA 4LJOB 3MHZA 3GS2A 1SJED 3EGRA 2CS4A 4MELA 3KW5B 1E9MA 2QEJC 3MJ5A 4C80A 3DBHI 3B08A 3WAMA 2KKCA 3ZNGC 3KLSX 1YMHE 1ET6A 3ML8A 1MG4A 4PS8A 2EMTA 1HQRD 3DHIC 3AE4B 4JQWC 1QLBB 1WXMA 3Q8EA 2D07B 4II2B 4KIKA 3BVZA 1XCTL 3VUWA 2WXKA 2MBQA 3P4SB 4W9CA 2DZMA 1JWSD 4BVUC 1E6EB 2PE6B 4KDIC 3FC4A 2D10A 1Y8RC 3MC8A 1SE2A 2DZKA 3UINB 3VH4B 2AYOB 3FILB 1WSPA 2CJOA 2DX5B 2LRWA 3DDCB 1UGJA 1Y56A 4WWMA 5DPSA 4XZ4A 1PFDA 4RM8A 4MEMA 2W54A 1WYWB 1IP9A 2QJLA 4RH6A 4TQ0A 1CMXB 1T3QA 3BYTB 3GZNB 3WA0A 2M4NA 2LGXA 5HHDG 2CHWA 2V1YA 3DHGC 4PYZA 1I7HA 2QMTA 4ZDVA 4HWIB 1R7SA 3LB8C 2L0TA 1WIAA 4IOIE 4FULA 5D3DA 3BY4B 1VDVA 1V6EA 4WWNA 3UF8A 4XDCA 4M02A 2ZNVB 5LXIB 1F1HA 4WH4A 1HA5A 3JW0X 2HJ1A 3GP7A 3AULA 1NI2A 2LGIA 1TS3A 3L0WB 4MGIE 2K8HA 3VQIA 1L7YA 1TS2A 4MM3A 2MJDA 2N9XA 1V2YA 2WX0A 3FAHA 3SD5A 3NS1A 3HIZA 3R3MA 1PUTA 1UWXA 4M01A 2MCNB 1YD8U 2XEWA 1VCBA 3EHVA 2IY1B 4RNAA 1J7CA 1V81A 2K3UA 5LLIA 1AN8A 4OZCA 3AI5A 2LJ5A 2GMIC 2WXJA 2KTFA 1J8CA 4MM3B 4TQ1A 3MP9A 3J9CA 4W9LA 5FKAC 1K53A 2BWES 5HG2A 3ZIMA 1FMAD 5E6JA 1RWSA 1H8CA 1CZPA 2J4XA 1TKEA 2GI9A 2D3AA 3T3NA 1R4MB 2KVZA 4IC7B 2PKOA 4M8NA 4I6PA 3AE6B 1YN3A 1Z2MA 4MGZE 2AQ2B 3RYTA 3P4QB 2CU3A 3DBRB 1X1MA 2WXIA 3ZNHB 5IA7A 1WXSA 1YX6B 2O2VB 3BZDB 1OQQA 1GUAB 2KO3A 4WJPA 2PPHA 1F52A 4OVZA 4HPPA 3NZUA 3D32A 4A3OA 4RMAA 2FCQA 1UBQA 1RLFA 3AN1A 4A20A 4GMVA 4JIOU 2KTRB 1VLBA 3M3JA 1UELA 4FLHA 1YJIA 3RNAC 1IPGA 1Q0WB 3H7SA 1LFDA 1B1ZA 3CMMB 3DBRI 1SGHA 1P7FA 2KQ4X 4URKA 3A9JA 1OEYJ 3NOBA 3L54A 4D2KA 4C4VA 1XCQL 3P42A 3C0RB 2JWUA 4DXAB 1R4MI 2MA9B 4MSMB 2BGFA 3Q8FA 2LFIA 2PIAA 4YXDB 1E8XA 1T0SC 4DDID 3JSVA 3KUDB 3Q6BA 4AWJA 2NMQA 1U4AA 1EWCA 2KTRA 5G2NA 2L05A 2QIEB 4NAWB 2JRIB 1JMLA 3I63C 4DHZE 5D6JB 4FXCA 1KRHA 1UD7A 3H9DA 2GBRA 1XXGA 4K3CA 2DYBA 2D2QA 5JHBA 2NS5A 2DZJA 5DPTA 2SEBD 5CHFA 2N9EB 1SE3A 1JWAD 4M8MA 4XE0A 1QILA 4GN1A 4BOSC 1LXDA 4FJYA 3RULA 4KGTA 1P0RA 2KZRA 4IUMB 4ARCA 2Y3AA 3NS8A 4BBNC 2BWFA 2RDHA 1PDXA 4HCPB 1YN4A 4CQNA 4PK1A 4P6VF 2IDYA 2CU1A 3RD2A 5G5HA 3OJ3A 2N7EA 1BXTA 3NY5A 1KJTA 4RF1A 4WJQA 3N1ZC 1V49A 3R2TA 2V3NA 3VH3B 4GGQA 3VUXA 2IY0B 1E5WA 3QWZB 2LGSA 2V4IB 3ZDTA 4JPSA 4NQKE 1FM0D 3AEEB 3H7PA 3RPFC 3TCAA 2D5GA 3VDZA 4ZYNA 3EECA 3ENEA 4II3B 3ZTDA 5KHOA 3TEXA 2DNFA 1HEZE 1WRDB 2W9NA 2INCC 5IOIA 2JQRB 3ZJTA 4ICUA 2K9XA 4BFRA 3EFCA 1FO4A 3RUIB 1C4CA 4DXFA 2KWCA 1VD2A 1XD3B 4IWQA 3PTFC 4FHJA 3AE3B 4AJWA 1PYWD 1WX8A 4ICVA 1ZKHA 3JSVB 5CX3A 4B0EA 4K3BA 1ZP0B 3P2BA 5C23A 2LXCA 2EELA 4K7SA 4DHZB 4JL9A 3U52E 1UZXB 1MHXA 3ZTCA 3W2DA 4HRSA 3TUOA 1V97A 4ARIA 3DQVA 4RGTA 2KJRA 2WWZA 1TIFA 2WNMA 3L16A 4ZOHC 1EM7A 4DK5A 1T0QC 3T8MA 1C79A 2JX5A 1SIJA 3V62A 4IM3A 3Q3JA 3TBLD 2C7HA 2NPTB 2V3PA 2BS4B 2DYMA 1WGYA 4HROA 4A90A 1S3SG 3DBHB 3X0WA 3A4RA 1XLOA 1AARA 1TGZB 4EOYA 2GLSA 2MX2A 3AE9B 3NJTA 2FUG1 1I4HA 3ZQ4A 2K25A 4TSSA 3VHTC 1SE9A 2WXPA 3Q3MC 2W3SA 2WYQA 2H88B 1L2NA 3WCQA 2L76A 1WM2A 1VR9A 1ACCA 1V5OA 1FRDA 2RR9A 3ZJUA 4HDQA 4USAA 2E3TA 4HJKA 1A5RA 2AL6A 2MJEA 5J17A 3VAWA 2A5UA 1ZE3D 5BMHA 5EE1A 1N62A 3LXFA 4ZRQA 2PTLA 1WI0A 2KLCA 2I2YA 4KZCA 4DBGA 2NVUI 2AEHA 1T6BX 3PRZA 4WJNA 1KH0A 3W1SC 4LDTD 3APCA 3AMZA 3PLVA 4A8XC 5AEKB 1K8RB 2WX1A 2RDGA 3DVGY 3P4RB 4MH0E 2AX5A 3TIXA 4Q2JA 3X23A 2MW5A 2N7JA 2NR2A 2KN4A 1QT9A 3QK0A 3LDZE 4FHKA 1L5PA 1QOFA 2K0PA 2ZPYA 2GOWA 4HPMB 2WXNA 2I1KA 3A9KA 1WE7A 3W1SA 2JWZA 5AZHA 1XEEA 2MBEA 1K50A 1QQRA 1RAXA 2L0FA 2EMSA 2ZCBA 3KYCD 1WR1A 1TJEA 1P9DU 2LXAA 1TKGA 1DGJA 1YJJA 2XK5B 1JALA 4MT5A 2WXRA 3ETRA 2D11A 3Q3FA 1JQ4A 2J52A 5BO4B 2HDEA 3QX1A 5CHVC 5G5GA 1YIWA 1ESFA 2BF8B 4X57B 1IBXB 2MP2B 2OJWA 4KGRA 5BMGA 4BKSA 2IO0B 1YQBA 2WP9B 3PRMB 1SIFA 3R66C 4WURA 3ZKJC 3SFDB 4ANXA 4BKGA 2RD0A 2AL3A 3PHWB 2G1EA 2LUEA 3HRDD 3TJPA 1KM7A 3U4EG 3HM6X 4PT5A 2KJ6A 3PRPB 3RN9C 1WJ4A 1SF0A 1TBEA 4K7UA 3BK1A
chains in the Genus database with same CATH topology
2RDBC 3GE3C 3DHIC 2INDC 1T0QC 1T0RC 3DHHC 2INCC 3DHGC 3Q2AC 3Q3MC 3RNCC 3N1ZC 3RNFC 3N1XC 3GE8C 3RMKC 3I63C 3RNBC 3RI7C 4P1CC 3RNEC 4P1BC 3RN9C 1T0SC 3Q14C 3N1YC 3Q3NC 3Q3OC 3I5JC 3N20C 3RNAC 3RNGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDB C;  3GE3 C;  3DHI C;  2IND C;  1T0Q C;  1T0R C;  3DHH C;  2INC C;  3DHG C;  3Q2A C;  3Q3M C;  3RNC C;  3N1Z C;  3RNF C;  3N1X C;  3GE8 C;  3RMK C;  3I63 C;  3RNB C;  3RI7 C;  4P1C C;  3RNE C;  4P1B C;  3RN9 C;  1T0S C;  3Q14 C;  3N1Y C;  3Q3N C;  3Q3O C;  3I5J C;  3N20 C;  3RNA C;  3RNG C; 
#chains in the Genus database with same CATH topology
 2YEP B;  2Q5W D;  1YX5 B;  2BKF A;  2WDV B;  1G6J A;  2NPT A;  4OVV A;  1FD6 A;  4AQ7 A;  2FIF A;  4YTM B;  2L32 A;  2Y5C A;  2N9P C;  2IGH A;  1HE8 A;  2VZK B;  3ZRC A;  4GLS C;  2W3R A;  2XN9 C;  1L6V A;  4GU2 A;  2J0K A;  2KQS A;  1UUP A;  3AU5 A;  1JRU A;  2KT7 A;  5GMV A;  3GE3 C;  1F77 A;  2Z0D B;  2DZI A;  1GC7 A;  4W9D A;  5HI1 A;  2FAZ A;  3RNC C;  2WXM A;  2KFK A;  2BTE A;  3BWU D;  1DOY A;  3KH0 A;  4M00 A;  3ML9 A;  1NEK B;  5L83 A;  2ZVN A;  3SHQ A;  1C77 A;  1FRR A;  2D3B A;  4A55 A;  2MBO A;  3PRE A;  2L7R A;  3U2S C;  2JPH A;  2JYE A;  4DHJ B;  3H8H A;  3VR9 B;  2RGF A;  2W55 A;  2UWQ A;  1FEH A;  1UNS A;  2QCZ A;  1PGA A;  4ZYS A;  2HD5 B;  4B6W A;  3VXW A;  3PS6 A;  1RFK A;  2IZV B;  4FJZ A;  2DHZ A;  4BOZ B;  4XDD A;  1TTN A;  3DBS A;  3B0A A;  3NRZ A;  1V1P A;  2DAF A;  3QJZ A;  1QOB A;  1XQQ A;  2C7N B;  2V4L A;  3SFE B;  3VR8 B;  1D4B A;  2H89 B;  2J0M A;  4M0W B;  1WZ0 A;  4KZ0 A;  2GBM A;  3V6E B;  2JSV X;  2LHE A;  4C7Y A;  1QZE A;  1AW7 A;  1N5X A;  4NAW A;  2FCM A;  2IND C;  2IPK D;  4GIV A;  2CKH B;  1JWM D;  2K39 A;  2WHI A;  3VVW B;  5JH5 C;  4YSZ B;  4W9E A;  2IO3 B;  3OWE B;  1PGX A;  1EF1 A;  3IAS 1;  5H8Y E;  1V5T A;  2L3Z A;  1F2R C;  2REX A;  3RNG C;  3A1Q B;  3PZ7 A;  3AM9 A;  1SB3 C;  2G4S A;  3B2G A;  5E6O A;  2OJR A;  1EUV B;  1Z5S B;  3BK2 A;  4LNK A;  2E6X A;  3DWG C;  4YTP B;  2RMM A;  4L23 A;  2LHD A;  1EU4 A;  1V9J A;  1FNV A;  5EE9 A;  1EU3 A;  4HCN B;  1NYR A;  1JCK B;  1GAQ B;  3ZW3 A;  1JW9 D;  4C4V B;  1WXQ A;  3PV1 A;  4F8C B;  1STE A;  2LRU A;  3HK0 A;  4KSK C;  2KWV B;  3Q8B A;  2BYF A;  2BW2 A;  2WU5 B;  4PYU A;  4MAC A;  5AUK A;  4GDL B;  5TSS A;  4HDO A;  4IDI A;  2MWS B;  1KFY B;  4NZL B;  1M94 A;  4XWW A;  2JRH A;  3UQB A;  4XC2 A;  3Q69 A;  4B0M A;  3TSS A;  2RPV A;  3BIN A;  4ANW A;  1DOX A;  3ZYY X;  4PS7 A;  3DBL I;  4UDU C;  3FIL A;  2C7M B;  4HLE A;  4GDK A;  1N63 A;  1EWY C;  2BBC A;  4GXB A;  3SR6 A;  2C9W B;  2NBW B;  3ZJV A;  4RM9 A;  1I4G A;  4EEW A;  1RRB A;  1P98 A;  1N60 A;  2K1F A;  1UWM A;  1UBI A;  1A70 A;  1L4D B;  4JWS C;  5BYS A;  2GBN A;  3VRB B;  4LNN A;  3AED B;  2M1M A;  3HM3 A;  5FR3 A;  2FBW B;  1DYQ A;  2OHF A;  3HVD A;  5BMI A;  2ACZ B;  1WMH A;  2WGS A;  3N9Y C;  4F7Z A;  4RF0 A;  4MH8 A;  1FXI A;  1L0Y B;  2W82 A;  3R7R A;  4NAM A;  4GB9 A;  2ZW0 A;  2N1V A;  2LMC A;  4A6Q A;  2G3Q B;  2WXQ A;  3A9K B;  3VFK A;  4W9H A;  2GB1 A;  4WIP A;  3RT3 B;  3RZF A;  2DWQ A;  1YQ3 B;  1WGR A;  4N6E B;  4R3D A;  2FID A;  5C3J B;  2DEN B;  4DQO C;  3IXS A;  2UU7 A;  1HTO A;  2JF5 A;  2CHX A;  3AEA B;  3TL5 A;  3Q8C A;  2ZZP B;  4US8 A;  3IG3 A;  3QAQ A;  1VRA B;  1OEY A;  1V1O A;  3DOW A;  3TEY A;  1ET9 A;  3VUY A;  2LD9 A;  4RGM A;  3A33 B;  1P1A A;  3IFW B;  1E7U A;  3IT6 B;  1VZ6 A;  2KC2 A;  1ZPS A;  3HVZ A;  2VH2 A;  4W9G A;  5D94 A;  1RYJ A;  1H4R A;  1L4Z B;  4MDK E;  4MGK E;  4LK0 M;  3MFG A;  4AS1 A;  5I4D A;  3V6C B;  2HTM E;  1LM8 B;  2ZPN A;  5MPO A;  4OVU A;  3PZD A;  2WXF A;  2LAS A;  2K22 A;  4YT0 B;  1IYF A;  2R61 A;  3WAN A;  1D5X C;  3RNE C;  4P1B C;  1WGD A;  2LI5 A;  4WQM A;  5IAA C;  5GXG B;  1QF6 A;  2V9H A;  1E0Z A;  2MEK A;  3O13 A;  4L2Y A;  3ZRF A;  3KVF B;  3PSE B;  2LWP A;  1R4N I;  2KK8 A;  2FCS A;  2GRI A;  5IO9 A;  3L10 B;  3U7Z A;  1TYG B;  4ANU A;  3OAW A;  3RNF C;  3A9J B;  3LJ3 A;  3DPD A;  3APF A;  4HEA 1;  3MC9 A;  1F2R I;  1GOZ A;  3N1Y C;  4HJG E;  2X8X X;  1WE6 A;  2A4Z A;  3R8B A;  1UH6 A;  2QDF A;  3PZ8 A;  4RGO S;  4WAF A;  3QQ8 B;  3V61 A;  2MP2 A;  3CST A;  1KLG D;  3U7D A;  3V05 A;  2KLG A;  4WWO A;  3BII D;  1LQB A;  1JRP A;  2MQJ A;  3NVW A;  4G0N B;  1UF0 A;  4HPL B;  3V3X A;  4AJY B;  2ON8 A;  2KWD A;  4NNJ B;  3QCA A;  3IHP C;  4ZHO A;  5LXH A;  2N7D A;  2BKR B;  2XK5 A;  3MTN B;  2J0J A;  4NJC A;  2I38 A;  3A1Q A;  3N1X C;  1E90 A;  1J19 A;  2LUM A;  3RMK C;  5JZE B;  2WDQ B;  3RI7 C;  2KOX A;  1SEB D;  1E8Y A;  3KWL A;  3U8Z A;  2MJ3 A;  4GDK B;  1E8Z A;  2R2Q A;  1BT0 A;  4US9 A;  4YL8 A;  3M62 B;  2G9H D;  3N20 C;  1WGG A;  1IGC A;  3W1Y A;  1YNT E;  1E7V A;  2JUO A;  3RNB C;  2EKI A;  4O1N A;  2IGG A;  5L95 C;  2PEA A;  2SAK A;  4IWO A;  2ICI A;  1L0X B;  1FCL A;  2RDB C;  3LYY A;  1BUI C;  2LEK A;  1VJK A;  2O6V B;  3ZNZ B;  4FBJ B;  3KQ4 A;  2K6D B;  3AE2 B;  2J42 A;  3VTW A;  1ZUD 2;  3PHX B;  3HUI A;  1SJH D;  2JVC A;  2MSE D;  4LNO A;  1WXA A;  3EC8 A;  4EKU A;  1KTK A;  2KDE B;  5FK9 C;  3PO0 A;  4LTU A;  4J3O D;  2PMV A;  1UGM A;  1XF5 L;  2CJN A;  4OZA A;  1M4V A;  3DCG A;  1WH3 A;  3P1M A;  2ZW1 A;  2CHZ A;  3ZNI D;  1QOA A;  2BYE A;  3P63 A;  2IYD B;  4MJS B;  2N1W A;  1SBB B;  1GB1 A;  4QAY A;  1GC6 A;  2DBY A;  4LLG M;  4NQL B;  2MBB B;  3ZXR A;  1QKZ A;  1C78 A;  5T8I A;  4EZJ A;  2JZZ A;  4ZRK A;  2FNJ B;  4WAA A;  4M0W A;  3L4P A;  1WM3 A;  2B3A A;  2ZVO A;  2Y5P A;  4KGS A;  2XBB C;  4KVG B;  3RZW C;  3AE8 B;  3R7Q A;  1WR6 E;  1WJU A;  2AQ1 B;  2YVC A;  2QIL A;  1HZ6 A;  2ASQ A;  1MJD A;  1C3T A;  3OG5 A;  2Z8L A;  5FR6 A;  4LCD E;  4ITK A;  3EFU A;  1E7P B;  1FXA A;  1PGB A;  4WWP A;  2INP E;  4I6N B;  3TEW A;  4KKJ A;  1YQ4 B;  2OOB B;  3KUZ A;  5EE0 A;  2JZ3 B;  4N59 A;  4RCO A;  5D7G A;  1GG3 A;  2Z0E B;  4ASW C;  4DWF A;  3I9V 1;  5DCN A;  4LJP B;  3ZO5 B;  1FIQ A;  1TZO A;  1XO3 A;  2BB6 A;  5DPR A;  2IGD A;  3GZN I;  3DHH C;  2I1J A;  4LDT B;  2HTH A;  3TEZ A;  4HXD A;  4EUT A;  1OFF A;  2KQ7 A;  4K7W A;  3RCZ A;  1XT9 B;  3AEF B;  5EE3 A;  4ZHP A;  2G4D B;  5KHQ A;  2KMM A;  3U30 A;  1MVK A;  2TSS A;  4ANV A;  3Q2A C;  4PS3 A;  1Q5W B;  4NPN A;  1SE4 A;  3NZS A;  2L8J A;  2IO1 B;  4N9F 4;  4P16 A;  1D5Z C;  3K9O B;  4P1C C;  2KFK B;  2HE7 A;  5LNK 1;  1ZOY B;  2DAJ A;  2QHO A;  4MSQ B;  3PVL A;  3I5J C;  5AZF A;  5HKH A;  1CQV A;  1XLP A;  2WXH A;  2K6Q A;  4DXG A;  1QOG A;  1LO5 D;  2KXJ A;  3BVM A;  2PVO D;  1YN5 A;  4KX6 B;  3ONS A;  2XNA C;  1GB4 A;  2NBV B;  3UIO B;  2C60 A;  3WAO A;  4JE3 B;  4BBN F;  1KOT A;  4MJS A;  4GDL A;  2O6V A;  5DPW A;  4YWG G;  2JY6 A;  2IO2 B;  1MPE A;  1VZ8 A;  2NTS A;  1HZ5 A;  4IG7 B;  1P3Q U;  1I4X A;  4JGH B;  2BB5 A;  5G55 A;  1KLV A;  1I35 A;  3N30 A;  3AE1 B;  1JWU D;  2KAC A;  2KD0 A;  2KJH B;  2KDI A;  2VH1 A;  5TR5 A;  3ABV B;  2VRR B;  2KHW B;  3Q3O C;  2KFJ A;  5JHA A;  3QC8 B;  2D3C A;  1NBF C;  3N3K B;  1CK1 A;  4G3X B;  1J0G A;  1C76 A;  4JX1 C;  1XLQ A;  1WJN A;  5BYQ A;  1F9J A;  1KLU D;  1R4N B;  3A4S C;  2O2V A;  1N61 A;  2KNB A;  4EFO A;  1WGK A;  1TS4 A;  4EZL A;  1C9F A;  3URY A;  2K8B A;  3W9C B;  1N5W A;  2GBK A;  3AV8 A;  4JWU C;  4ACF A;  1JRO A;  3AXC A;  1FFU A;  2IJ0 A;  4XX5 A;  2JT4 B;  2N9K A;  1MHH E;  1WY8 A;  2X38 A;  2KVR A;  3MJW A;  3I57 A;  3QAR A;  3CSF A;  4RFB A;  4KV2 A;  3HHM A;  2J53 A;  3APD A;  2BS2 B;  4HKQ A;  1SXT A;  4L1B A;  5C1Z A;  2WQY B;  3S2A A;  2WU2 B;  4XWT A;  5J18 A;  3N32 A;  1GNU A;  2KC1 A;  3UQA A;  1OGW A;  3IT4 B;  4G11 A;  2ZCC A;  3JVZ X;  4C56 C;  3CF6 E;  5J2R A;  3DVG X;  4F1S A;  3AH7 A;  1NI3 A;  1MI0 A;  3AB5 A;  2KX0 A;  1TZ1 A;  3QIJ A;  3NVV A;  4FJV B;  3SEB A;  1LGR A;  4BAX A;  5EDS A;  1NEN B;  4W9I A;  4H2A A;  3ZLZ A;  3K9P B;  1T5X D;  3Q8A A;  3Q14 C;  2K5P A;  4HVB A;  1NDD A;  1IBX A;  4KDL B;  4NY0 A;  4K81 A;  4OZB A;  4IWP A;  3ZDM C;  1C4A A;  2FE8 A;  4BKT A;  3ECI A;  4GOC A;  2KX3 A;  2WDR B;  4I6L B;  3W5V B;  1V1P B;  3QHT A;  2JXX A;  4TMA B;  4C00 A;  4KIK B;  3IVF A;  1TS5 A;  1P7E A;  2FUH B;  2KMA A;  3NVZ A;  5H92 C;  4LNF A;  5CHW A;  5AZG A;  2VZK D;  2MRP A;  3L13 A;  4S0R A;  1K52 A;  3DVN V;  4ZRP A;  4YTN B;  4TV3 A;  4W9J A;  1I4R A;  3M63 B;  2O6V D;  2ZJD A;  4FA6 A;  4LNI A;  1ZDV A;  1TT5 B;  2J7Q B;  3ALB A;  4ZRI A;  1TY2 A;  4NJ7 A;  4S17 A;  3NUH B;  5IP4 D;  2GBJ A;  3DBL B;  3TMP B;  3WIM A;  1PQS A;  3AE5 B;  1YJ1 A;  2PLP A;  4IM2 A;  3KUC B;  1MFW A;  3MHS D;  1E10 A;  1WMH B;  2QSD A;  2RSU A;  3KWV A;  3CIR B;  2JYT A;  3PGE A;  2N0S B;  1V80 A;  2N4F A;  2UYZ B;  3OLM D;  5E6P A;  1F0Z A;  1V86 A;  2MLB A;  1NYQ A;  2BPS A;  1I4Q A;  3IAM 1;  4CO7 A;  3PPA A;  1S1Q B;  2KDF B;  2LVP A;  4HK2 A;  4K1R B;  2HJ8 A;  2JXT A;  3W5U B;  4ZRJ A;  5IKC M;  1IGD A;  3O65 B;  1N6Z A;  2BS3 B;  2PE9 A;  2ZEQ A;  2WLB A;  2BYV E;  3VTV A;  2PW9 A;  3MC0 B;  1AYF A;  2DYO A;  4YSX B;  3B1L X;  4AUQ C;  3ZVV A;  3L08 A;  1YOV B;  2ONQ A;  5D2M B;  4TUU A;  4W9K A;  2LZ6 A;  3VTU A;  3SU8 X;  2WXG A;  3UIP B;  1ROE A;  4EZK A;  1Q10 A;  4B95 A;  1RM6 C;  4EE2 A;  1NVI D;  4BKS D;  1D5M C;  4J6I A;  1FPY A;  4W9F A;  2M0X A;  2LJI A;  4IW0 A;  3M95 A;  1ISN A;  1T0Y A;  2BYT A;  1I42 A;  2Y5B B;  1AWD A;  3B2F A;  3NG0 A;  5AUI A;  1V8C A;  1RFA A;  2M19 A;  5HFY A;  1ZXI A;  2LVO A;  3AEB B;  1SSN A;  2K8C A;  2KWU B;  1Q1O A;  3E56 A;  2V0G A;  1FCC C;  1OQY A;  2KN5 A;  1L0V B;  2KAN A;  1C4P A;  2IBI B;  1J7B A;  1WRI A;  4E71 A;  4C7Z A;  4YSY B;  1WJ6 A;  2LGY A;  1EO6 A;  2B76 B;  2QC8 A;  3BYY B;  3CWI A;  2M0A A;  3P4P B;  2NCN A;  1CJE A;  4CYE A;  1K51 A;  3NZ3 A;  4GSW A;  2MH7 A;  5JXV A;  1ZW7 A;  2WDT B;  3NHE B;  2L1A A;  1DOI A;  2LVQ A;  3OJ4 B;  1TY0 A;  1ENF A;  2R2O A;  4AP4 C;  3H1U A;  3ZUN A;  3BVG A;  2Z59 B;  3V60 A;  3E9S A;  4OW0 A;  3GB1 A;  4AOF A;  2OED A;  4REZ A;  2AWT A;  1T0R C;  2AQ3 B;  4WJO A;  4WQO B;  5D3I B;  3VRA B;  3I3T B;  4NJ6 A;  1L6U A;  2YLM A;  1I4P A;  3B9J A;  3DWM A;  3AE7 B;  4OHJ A;  1E8W A;  2INN E;  4TKN A;  5BYR A;  1B9R A;  3DVN U;  4IM0 A;  3L17 A;  3C19 A;  3SDL C;  4G50 A;  1WX9 A;  2G45 B;  3IBE A;  2M17 A;  2BT6 A;  2WS3 B;  4CHK A;  1GJZ A;  1ZDX A;  4FAD A;  1BML C;  2LGD A;  2M8S A;  4B9K A;  1D3Z A;  4MGY E;  2N9L A;  4P7I A;  3PLU A;  3UGB B;  1JWB D;  1VZ7 A;  3AU4 A;  2PVG C;  4BZA A;  3R2I A;  3JYU A;  2L83 A;  3EUB 2;  1WGH A;  1OTR B;  3H7P B;  4DHJ D;  1MG8 A;  1GPX A;  4FN2 A;  1WZ3 A;  2C5L C;  3AEG B;  1D6E C;  3Q3N C;  2BQQ A;  3EA6 A;  1WX7 A;  2V3S A;  2WXL A;  1EF5 A;  2FCN A;  2JZP A;  3T9L A;  3WAL A;  1ZGU B;  1OQR A;  2L52 A;  1ZXH A;  1IUE A;  1HXY D;  1HTQ A;  4KSL C;  1FXT B;  1WWT A;  1WF9 A;  2EKE C;  2WXO A;  2JU6 X;  1TKY A;  5IN7 A;  2KAJ A;  2ZNV C;  1FFV A;  2RPQ A;  1WFY A;  3RFZ B;  2D3G A;  3ZXV A;  1C1Y B;  4E74 A;  2M56 B;  2PJH A;  4N58 A;  3NVY A;  5CTR C;  2KMC A;  4A3P A;  3KYD D;  4DDG D;  3GE8 C;  1WYG A;  4RGN A;  2CR5 A;  4JLC A;  5C2T B;  5E6N A;  1XLN A;  3GOE A;  2YEP F;  3WAP A;  2KYW A;  2NBU A;  3C8Y A;  3T3O A;  3FKY A;  4XYC A;  2KDB A;  2BVC A;  2DLB A;  2KDM A;  3QA8 A;  4XGA B;  2MBH A;  1J7A A;  2L00 B;  1FNW A;  3ZGZ A;  3PT2 B;  1WXV A;  4E3C A;  1FNU A;  4IKG A;  4KKI A;  4A9A A;  2NTT A;  1KF6 B;  4HKZ E;  3H6N A;  3UI3 A;  3AEC B;  2MHJ A;  4LJO B;  3MHZ A;  3GS2 A;  1SJE D;  3EGR A;  2CS4 A;  4MEL A;  3KW5 B;  1E9M A;  2QEJ C;  3MJ5 A;  4C80 A;  3DBH I;  3B08 A;  3WAM A;  2KKC A;  3ZNG C;  3KLS X;  1YMH E;  1ET6 A;  3ML8 A;  1MG4 A;  4PS8 A;  2EMT A;  1HQR D;  3DHI C;  3AE4 B;  4JQW C;  1QLB B;  1WXM A;  3Q8E A;  2D07 B;  4II2 B;  4KIK A;  3BVZ A;  1XCT L;  3VUW A;  2WXK A;  2MBQ A;  3P4S B;  4W9C A;  2DZM A;  1JWS D;  4BVU C;  1E6E B;  2PE6 B;  4KDI C;  3FC4 A;  2D10 A;  1Y8R C;  3MC8 A;  1SE2 A;  2DZK A;  3UIN B;  3VH4 B;  2AYO B;  3FIL B;  1WSP A;  2CJO A;  2DX5 B;  2LRW A;  3DDC B;  1UGJ A;  1Y56 A;  4WWM A;  5DPS A;  4XZ4 A;  1PFD A;  4RM8 A;  4MEM A;  2W54 A;  1WYW B;  1IP9 A;  2QJL A;  4RH6 A;  4TQ0 A;  1CMX B;  1T3Q A;  3BYT B;  3GZN B;  3WA0 A;  2M4N A;  2LGX A;  5HHD G;  2CHW A;  2V1Y A;  3DHG C;  4PYZ A;  1I7H A;  2QMT A;  4ZDV A;  4HWI B;  1R7S A;  3LB8 C;  2L0T A;  1WIA A;  4IOI E;  4FUL A;  5D3D A;  3BY4 B;  1VDV A;  1V6E A;  4WWN A;  3UF8 A;  4XDC A;  4M02 A;  2ZNV B;  5LXI B;  1F1H A;  4WH4 A;  1HA5 A;  3JW0 X;  2HJ1 A;  3GP7 A;  3AUL A;  1NI2 A;  2LGI A;  1TS3 A;  3L0W B;  4MGI E;  2K8H A;  3VQI A;  1L7Y A;  1TS2 A;  4MM3 A;  2MJD A;  2N9X A;  1V2Y A;  2WX0 A;  3FAH A;  3SD5 A;  3NS1 A;  3HIZ A;  3R3M A;  1PUT A;  1UWX A;  4M01 A;  2MCN B;  1YD8 U;  2XEW A;  1VCB A;  3EHV A;  2IY1 B;  4RNA A;  1J7C A;  1V81 A;  2K3U A;  5LLI A;  1AN8 A;  4OZC A;  3AI5 A;  2LJ5 A;  2GMI C;  2WXJ A;  2KTF A;  1J8C A;  4MM3 B;  4TQ1 A;  3MP9 A;  3J9C A;  4W9L A;  5FKA C;  1K53 A;  2BWE S;  5HG2 A;  3ZIM A;  1FMA D;  5E6J A;  1RWS A;  1H8C A;  1CZP A;  2J4X A;  1TKE A;  2GI9 A;  2D3A A;  3T3N A;  1R4M B;  2KVZ A;  4IC7 B;  2PKO A;  4M8N A;  4I6P A;  3AE6 B;  1YN3 A;  1Z2M A;  4MGZ E;  2AQ2 B;  3RYT A;  3P4Q B;  2CU3 A;  3DBR B;  1X1M A;  2WXI A;  3ZNH B;  5IA7 A;  1WXS A;  1YX6 B;  2O2V B;  3BZD B;  1OQQ A;  1GUA B;  2KO3 A;  4WJP A;  2PPH A;  1F52 A;  4OVZ A;  4HPP A;  3NZU A;  3D32 A;  4A3O A;  4RMA A;  2FCQ A;  1UBQ A;  1RLF A;  3AN1 A;  4A20 A;  4GMV A;  4JIO U;  2KTR B;  1VLB A;  3M3J A;  1UEL A;  4FLH A;  1YJI A;  3RNA C;  1IPG A;  1Q0W B;  3H7S A;  1LFD A;  1B1Z A;  3CMM B;  3DBR I;  1SGH A;  1P7F A;  2KQ4 X;  4URK A;  3A9J A;  1OEY J;  3NOB A;  3L54 A;  4D2K A;  4C4V A;  1XCQ L;  3P42 A;  3C0R B;  2JWU A;  4DXA B;  1R4M I;  2MA9 B;  4MSM B;  2BGF A;  3Q8F A;  2LFI A;  2PIA A;  4YXD B;  1E8X A;  1T0S C;  4DDI D;  3JSV A;  3KUD B;  3Q6B A;  4AWJ A;  2NMQ A;  1U4A A;  1EWC A;  2KTR A;  5G2N A;  2L05 A;  2QIE B;  4NAW B;  2JRI B;  1JML A;  3I63 C;  4DHZ E;  5D6J B;  4FXC A;  1KRH A;  1UD7 A;  3H9D A;  2GBR A;  1XXG A;  4K3C A;  2DYB A;  2D2Q A;  5JHB A;  2NS5 A;  2DZJ A;  5DPT A;  2SEB D;  5CHF A;  2N9E B;  1SE3 A;  1JWA D;  4M8M A;  4XE0 A;  1QIL A;  4GN1 A;  4BOS C;  1LXD A;  4FJY A;  3RUL A;  4KGT A;  1P0R A;  2KZR A;  4IUM B;  4ARC A;  2Y3A A;  3NS8 A;  4BBN C;  2BWF A;  2RDH A;  1PDX A;  4HCP B;  1YN4 A;  4CQN A;  4PK1 A;  4P6V F;  2IDY A;  2CU1 A;  3RD2 A;  5G5H A;  3OJ3 A;  2N7E A;  1BXT A;  3NY5 A;  1KJT A;  4RF1 A;  4WJQ A;  3N1Z C;  1V49 A;  3R2T A;  2V3N A;  3VH3 B;  4GGQ A;  3VUX A;  2IY0 B;  1E5W A;  3QWZ B;  2LGS A;  2V4I B;  3ZDT A;  4JPS A;  4NQK E;  1FM0 D;  3AEE B;  3H7P A;  3RPF C;  3TCA A;  2D5G A;  3VDZ A;  4ZYN A;  3EEC A;  3ENE A;  4II3 B;  3ZTD A;  5KHO A;  3TEX A;  2DNF A;  1HEZ E;  1WRD B;  2W9N A;  2INC C;  5IOI A;  2JQR B;  3ZJT A;  4ICU A;  2K9X A;  4BFR A;  3EFC A;  1FO4 A;  3RUI B;  1C4C A;  4DXF A;  2KWC A;  1VD2 A;  1XD3 B;  4IWQ A;  3PTF C;  4FHJ A;  3AE3 B;  4AJW A;  1PYW D;  1WX8 A;  4ICV A;  1ZKH A;  3JSV B;  5CX3 A;  4B0E A;  4K3B A;  1ZP0 B;  3P2B A;  5C23 A;  2LXC A;  2EEL A;  4K7S A;  4DHZ B;  4JL9 A;  3U52 E;  1UZX B;  1MHX A;  3ZTC A;  3W2D A;  4HRS A;  3TUO A;  1V97 A;  4ARI A;  3DQV A;  4RGT A;  2KJR A;  2WWZ A;  1TIF A;  2WNM A;  3L16 A;  4ZOH C;  1EM7 A;  4DK5 A;  1T0Q C;  3T8M A;  1C79 A;  2JX5 A;  1SIJ A;  3V62 A;  4IM3 A;  3Q3J A;  3TBL D;  2C7H A;  2NPT B;  2V3P A;  2BS4 B;  2DYM A;  1WGY A;  4HRO A;  4A90 A;  1S3S G;  3DBH B;  3X0W A;  3A4R A;  1XLO A;  1AAR A;  1TGZ B;  4EOY A;  2GLS A;  2MX2 A;  3AE9 B;  3NJT A;  2FUG 1;  1I4H A;  3ZQ4 A;  2K25 A;  4TSS A;  3VHT C;  1SE9 A;  2WXP A;  3Q3M C;  2W3S A;  2WYQ A;  2H88 B;  1L2N A;  3WCQ A;  2L76 A;  1WM2 A;  1VR9 A;  1ACC A;  1V5O A;  1FRD A;  2RR9 A;  3ZJU A;  4HDQ A;  4USA A;  2E3T A;  4HJK A;  1A5R A;  2AL6 A;  2MJE A;  5J17 A;  3VAW A;  2A5U A;  1ZE3 D;  5BMH A;  5EE1 A;  1N62 A;  3LXF A;  4ZRQ A;  2PTL A;  1WI0 A;  2KLC A;  2I2Y A;  4KZC A;  4DBG A;  2NVU I;  2AEH A;  1T6B X;  3PRZ A;  4WJN A;  1KH0 A;  3W1S C;  4LDT D;  3APC A;  3AMZ A;  3PLV A;  4A8X C;  5AEK B;  1K8R B;  2WX1 A;  2RDG A;  3DVG Y;  3P4R B;  4MH0 E;  2AX5 A;  3TIX A;  4Q2J A;  3X23 A;  2MW5 A;  2N7J A;  2NR2 A;  2KN4 A;  1QT9 A;  3QK0 A;  3LDZ E;  4FHK A;  1L5P A;  1QOF A;  2K0P A;  2ZPY A;  2GOW A;  4HPM B;  2WXN A;  2I1K A;  3A9K A;  1WE7 A;  3W1S A;  2JWZ A;  5AZH A;  1XEE A;  2MBE A;  1K50 A;  1QQR A;  1RAX A;  2L0F A;  2EMS A;  2ZCB A;  3KYC D;  1WR1 A;  1TJE A;  1P9D U;  2LXA A;  1TKG A;  1DGJ A;  1YJJ A;  2XK5 B;  1JAL A;  4MT5 A;  2WXR A;  3ETR A;  2D11 A;  3Q3F A;  1JQ4 A;  2J52 A;  5BO4 B;  2HDE A;  3QX1 A;  5CHV C;  5G5G A;  1YIW A;  1ESF A;  2BF8 B;  4X57 B;  1IBX B;  2MP2 B;  2OJW A;  4KGR A;  5BMG A;  4BKS A;  2IO0 B;  1YQB A;  2WP9 B;  3PRM B;  1SIF A;  3R66 C;  4WUR A;  3ZKJ C;  3SFD B;  4ANX A;  4BKG A;  2RD0 A;  2AL3 A;  3PHW B;  2G1E A;  2LUE A;  3HRD D;  3TJP A;  1KM7 A;  3U4E G;  3HM6 X;  4PT5 A;  2KJ6 A;  3PRP B;  3RN9 C;  1WJ4 A;  1SF0 A;  1TBE A;  4K7U A;  3BK1 A; 
#chains in the Genus database with same CATH homology
 2RDB C;  3GE3 C;  3DHI C;  2IND C;  1T0Q C;  1T0R C;  3DHH C;  2INC C;  3DHG C;  3Q2A C;  3Q3M C;  3RNC C;  3N1Z C;  3RNF C;  3N1X C;  3GE8 C;  3RMK C;  3I63 C;  3RNB C;  3RI7 C;  4P1C C;  3RNE C;  4P1B C;  3RN9 C;  1T0S C;  3Q14 C;  3N1Y C;  3Q3N C;  3Q3O C;  3I5J C;  3N20 C;  3RNA C;  3RNG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...