3DHHC

Crystal structure of resting state toluene 4-monoxygenase hydroxylase complexed with effector protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural consequences of effector protein complex formation in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords toluene 4-monooxygenase hydroxylase alpha subunit
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3dhhC00
3N1XC 3Q14C 2INCC 1T0QC 3N20C 3RI7C 3Q3NC 3GE8C 3RN9C 3RNBC 3RNCC 2INDC 3DHGC 2RDBC 3GE3C 3DHHC 1T0SC 3DHIC 3Q2AC 4P1CC 3N1ZC 3RNFC 3RMKC 3I63C 3I5JC 3Q3MC 3RNAC 1T0RC 4P1BC 3Q3OC 3RNEC 3RNGC 3N1YC
chains in the Genus database with same CATH superfamily
2INCC 3HM3A 3IVFA 2BYEA 2XNAC 4GDKA 4RGMA 3R7QA 4YTMB 4MACA 4K3CA 1WWTA 5HI1A 3URYA 5C2TB 3SHQA 4I6NB 1V2YA 3QJZA 4F1SA 3QX1A 3A9KA 3GOEA 2L83A 1E8WA 1CMXB 2UYZB 3KYDD 1PGAA 2MBQA 2RR9A 1C77A 4C80A 1WI0A 1TS4A 3LDZE 1FIQA 3M62B 2DHZA 5D2MB 4RFBA 2PKOA 2KTFA 2QMTA 3UQAA 2DWQA 4AP4C 2QIEB 1GAQB 3DVNV 3DBLI 1WXVA 4JGHB 2IO0B 2BWES 2OJWA 3APFA 4MGZE 4HROA 2IGGA 1PDXA 1E7UA 1UBQA 4PS3A 1L6VA 2JQRB 3B2FA 4A9AA 3VHTC 2K8CA 5IAAC 1WGYA 3BK2A 1HTQA 5AZGA 1GNUA 4JWSC 1KF6B 1GC7A 3C0RB 2I1KA 2G45B 1HEZE 1MG8A 2KFJA 4M01A 3ML9A 1IBXA 2SEBD 2V1YA 2WDRB 3VFKA 3H7PB 1NEKB 5J2RA 2AYOB 4AQ7A 3U52E 1D5XC 1F1HA 1XLNA 3K9PB 3NVZA 3TL5A 3W1SA 3UIPB 4M0WA 3EGRA 3B0AA 1GPXA 2M19A 3RNAC 3TEWA 2N9KA 1TGZB 1FEHA 1V97A 2JWUA 4OHJA 1WGGA 1Q0WB 2LGXA 2KD0A 2KANA 1TKEA 1TS2A 1V6EA 5CTRC 4C4VB 1UGMA 4A8XC 2KMAA 1HZ5A 3UF8A 4BVUC 2M0XA 4ARCA 2XBBC 4P1BC 2BVCA 1FXAA 3APDA 2PE9A 4A6QA 2WWZA 3ZO5B 2O6VA 2E3TA 2BBCA 4IG7B 5AUKA 4DQOC 1D6EC 3KVFB 1WMHA 3QAQA 1N6ZA 2UWQA 1L4DB 1NBFC 2AWTA 1E90A 2FAZA 1K8RB 3V3XA 1FNWA 4HKZE 3APCA 3P4SB 4HLEA 2KJRA 2RMMA 1FO4A 4BKGA 3H7SA 4FULA 1DOIA 4QAYA 2REXA 1TS3A 2KJHB 1Y56A 2M1MA 4URKA 1GOZA 4NPNA 2WHIA 3NS1A 2BKRB 5KHQA 4LNKA 3ECIA 4S0RA 2V4LA 2W54A 1I4HA 3RN9C 4BOZB 3MC0B 3AE5B 3MHSD 2D2QA 2PEAA 1RYJA 5J18A 4XDCA 4MELA 4R3DA 3MP9A 3RFZB 1XLOA 1ENFA 3P2BA 1DGJA 3LYYA 1HTOA 1N63A 1WRIA 1FRDA 2CHZA 2ON8A 2LHEA 1XLPA 2C7HA 4RGOS 4W9CA 2O6VB 2BWFA 4KSLC 4LNFA 2ZPYA 3HHMA 2ZVOA 1MPEA 1VCBA 2MBEA 1WGHA 2KDIA 4IWQA 2ZJDA 4J3OD 1MI0A 3D32A 4NQKE 1V1PB 3IHPC 1L0VB 1VR9A 2C9WB 2FE8A 1EU4A 2EMTA 2BW2A 2CS4A 3AMZA 3IT4B 1XO3A 5JZEB 4FADA 5E6OA 2D10A 3HK0A 3Q8AA 5FKAC 1J8CA 3T9LA 2LVQA 3Q8BA 1MHHE 1RFKA 3JSVB 3WA0A 1ZUD2 2NTSA 3DOWA 5AZHA 4RM8A 1T0SC 4JQWC 1UH6A 2WXKA 2VZKD 3PZ7A 5IO9A 1EU3A 1TYGB 3NJTA 2KN4A 1WIAA 1E8YA 1UWXA 2W9NA 3ZNGC 2WXNA 2JYTA 1HA5A 3J9CA 2IO2B 1JROA 4TMAB 4E71A 2LRUA 3L4PA 2V9HA 2IPKD 1QILA 1CZPA 4EZLA 1IGCA 5AUIA 1XD3B 2KK8A 2LD9A 3AEEB 4DHJD 4ZRJA 1PQSA 4GXBA 2YLMA 4I6PA 1I4QA 3ZW3A 4ICVA 3VTVA 1I42A 4MSQB 4YXDB 2R2QA 1N5XA 2WXMA 3TMPB 3NY5A 1D5MC 1WR1A 1E8ZA 2CR5A 2KZRA 4ZDVA 2LWPA 5BMHA 2JXTA 2MA9B 2ZW0A 1KH0A 4DXGA 3DBSA 2MQJA 3HVZA 1WGRA 4KZCA 4FJVB 3ETRA 1WF9A 4GIVA 4DHZB 1F2RI 3ZGZA 4FJYA 4GMVA 4PT5A 1TTNA 1WGDA 3FC4A 5T8IA 1OFFA 2PE6B 4AJYB 3DBRI 1V1OA 3VTWA 4BKTA 1H4RA 1FD6A 1YD8U 2BB6A 1LFDA 2AQ3B 1ZDVA 1JRUA 3AM9A 2C60A 1WXAA 3WANA 4GB9A 2IDYA 3SEBA 2IY1B 3IT6B 3BVGA 1TY0A 3SFDB 4ACFA 2KFKB 4JPSA 4K7WA 2ZW1A 4DHZE 4XYCA 4PS7A 1E0ZA 4PK1A 1KLVA 1ZXIA 2L8JA 4GDKB 1PFDA 2KWVB 3HRDD 2V3NA 3PRMB 4HPLB 3PV1A 4RF0A 2BYVE 2RPQA 1LM8B 2HJ1A 5IA7A 2GRIA 2LRWA 1GB1A 5HG2A 3M3JA 4L1BA 4YSZB 4HJKA 3AI5A 1KRHA 3I57A 1E9MA 4GDLA 3VDZA 2NBVB 2B3AA 3H6NA 2BQQA 4DXAB 3PTFC 5FR6A 5JHAA 2LEKA 3VUWA 1ZW7A 2Z59B 1M94A 1SE3A 4II2B 4IUMB 3O13A 3PSEB 2CHXA 5IN7A 3DPDA 4WJPA 3RNBC 5FR3A 1TT5B 1BMLC 1JMLA 1PYWD 2DENB 1UBIA 1WXSA 3IXSA 2MRPA 1VD2A 4ANXA 5IKCM 4ICUA 1Z2MA 4EE2A 4W9IA 4ARIA 4MH8A 1YJJA 2K8BA 1N5WA 2D3CA 3V6EB 1J7CA 3WCQA 4LJOB 4MGYE 2CJNA 2N7JA 2C5LC 3ZNHB 3RMKC 2J53A 4W9DA 2Y5PA 1D4BA 4XX5A 4BFRA 3CF6E 4RMAA 1A70A 4GDLB 3A4SC 1FMAD 4BBNC 1KFYB 1TKGA 1WXMA 1OTRB 4NAMA 1C79A 4YT0B 2MHJA 4KGSA 5BO4B 3QQ8B 2JRHA 2G3QB 4M8NA 1WX7A 3L54A 5DPSA 2WLBA 1BUIC 1L0XB 3UIOB 1V80A 3AEBB 4NJ7A 3B2GA 1YQBA 2JU6X 4FXCA 4MDKE 1SBBB 3VAWA 3DDCB 3ZLZA 1K52A 5C23A 2BS2B 2DAFA 4AS1A 3DBHB 1ZXHA 2NMQA 2JT4B 2SAKA 4EOYA 4RH6A 2VZKB 4WAAA 2QC8A 3L17A 3ALBA 4TKNA 3BYTB 3GS2A 3ZKJC 4ZYSA 3H8HA 3QWZB 1TKYA 2UU7A 2PVOD 3KUZA 2LI5A 1R4NB 3CSFA 4E3CA 4F8CB 2GLSA 1C1YB 1I4GA 2GBJA 2JZZA 4K81A 3QARA 2LGDA 4DHJB 3OWEB 2MW5A 3N20C 1ZKHA 2ICIA 4BKSD 1XCQL 3RUIB 4B0MA 4XWWA 1B1ZA 4RCOA 3H7PA 3NZSA 2TSSA 2JX5A 2RDHA 2GBNA 2KO3A 1JWUD 3ENEA 3PHXB 3BWUD 5KHOA 2L7RA 3Q8EA 2Y3AA 4EEWA 1GC6A 1YMHE 2KC2A 3NVWA 3EFUA 3VRBB 4ZYNA 4XC2A 4M00A 1F77A 1JWAD 5EE1A 4MGKE 2BT6A 2LVOA 2RD0A 1XCTL 3MC9A 3KLSX 4ANWA 2IO1B 3PREA 1NYQA 3P42A 4EKUA 3ZXVA 2J0JA 4US9A 2KVRA 1P3QU 2WXQA 3KWVA 1P7FA 1KTKA 1ZDXA 3BIID 3AB5A 4NAWA 2PPHA 1EO6A 2WDQB 2KDFB 3ZTCA 2FCMA 3N32A 3I5JC 2WQYB 1KLGD 2Y5CA 5EDSA 2ACZB 2FIDA 2J0MA 2MP2B 5BYRA 4G3XB 3AN1A 3N9YC 3L08A 4ANUA 3E56A 4RNAA 3Q8CA 1RWSA 4KDIC 2ZCBA 3JVZX 4IC7B 2ZNVB 4KKJA 1WX9A 1YOVB 4IM3A 2I2YA 2K6QA 1Q10A 2DBYA 3FKYA 3VR9B 1F9JA 1SE9A 4HKQA 3T8MA 3VH3B 4EUTA 1IYFA 4CYEA 3H1UA 1NVID 5AZFA 2GB1A 2V3SA 1JALA 4EFOA 2N4FA 3V05A 3PVLA 4W9LA 2KYWA 2WXRA 1AN8A 2WXOA 4A55A 3OLMD 3DBLB 4OVUA 3CIRB 1OQYA 1ISNA 2IY0B 1SJED 4ZHPA 3A9KB 1V5OA 3BVZA 4IM2A 1WZ0A 1N61A 2IBIB 1EF5A 2IJ0A 1SJHD 1UD7A 1YIWA 2K0PA 3DVNU 2MEKA 3MJWA 2QCZA 1WFYA 4M02A 3OG5A 1N62A 4DDGD 3L13A 3ZVVA 4G0NB 5GMVA 3ZNID 3AE6B 1MFWA 1TZ1A 2AL6A 4MSMB 2XK5A 2KN5A 1BXTA 3V62A 4A3OA 3U2SC 2DYBA 4WURA 2KWUB 2EKIA 3IBEA 4ZRKA 4GLSC 3BYYB 3Q69A 2KQ7A 1C78A 1JW9D 2K39A 1WE7A 3ZQ4A 1P7EA 4WIPA 1V81A 4KDLB 1T0QC 2WXFA 1PGXA 2DZKA 4FJZA 4MH0E 2PVGC 1XXGA 4W9KA 1YN4A 3U7DA 2JSVX 3ABVB 1T5XD 1XT9B 2CU1A 2GBKA 1WZ3A 3DBHI 4W9JA 4ITKA 1R7SA 3QA8A 2K1FA 4UDUC 2JY6A 3Q3MC 1I35A 2AX5A 2KX3A 4RGTA 3KH0A 2L0FA 2WX1A 3OJ3A 2BYFA 2J42A 4NNJB 2A5UA 4ANVA 1CQVA 2YEPF 4EZJA 4IW0A 3A1QB 3IG3A 2D3AA 3ZJUA 4NAWB 1QKZA 4A3PA 1ZP0B 1UUPA 2PJHA 3B1LX 4BZAA 4BBNF 1AWDA 4HDOA 5JHBA 3RZFA 3HVDA 3GB1A 4GSWA 1DYQA 1JRPA 2MLBA 3GE8C 1IUEA 4M8MA 1XF5L 1SSNA 2WXLA 2WXHA 1JWSD 1CK1A 2JZPA 4WQOB 4AWJA 3MTNB 1N60A 4TV3A 2Z0EB 5C1ZA 2H88B 3AV8A 4ZRQA 1HQRD 2OEDA 3FILB 4HVBA 2AQ2B 2D07B 3T3NA 4GN1A 2HTME 4LDTD 4DBGA 3DVGY 5CX3A 3GZNI 1NDDA 1P9DU 3ZXRA 1DOYA 1LGRA 1WM3A 1FXIA 1SIFA 2YEPB 1V9JA 3RCZA 3ZJTA 2Y5BB 3AXCA 4H2AA 1Z5SB 2FUG1 3KW5B 5D94A 3N1YC 1VRAB 4OZAA 2L05A 1V86A 4WAFA 2K8HA 1AARA 3DWMA 4DK5A 1WYGA 3E9SA 4C4VA 4O1NA 1S3SG 1IP9A 1QOBA 2HDEA 3P4PB 3PZ8A 4LLGM 3AEDB 5G5HA 2N9PC 3SD5A 4G11A 5JH5C 1WM2A 2MBBB 1GUAB 1EWYC 1EUVB 4ZRIA 1ET6A 4OZCA 2JWZA 3W1YA 4FA6A 4IM0A 5CHFA 2ZCCA 4D2KA 1QQRA 4J6IA 3LB8C 1DOXA 1UNSA 3NOBA 4ASWC 3VQIA 2J52A 3VUYA 2I38A 2C7MB 2WU2B 4JE3B 4X57B 2W55A 1T3QA 2N7DA 3AULA 1NYRA 3O65B 3ZDMC 3Q3JA 5BMGA 2GI9A 4C7ZA 1V49A 2LXCA 1AYFA 3NS8A 3EHVA 4B95A 1SE4A 4FBJB 2NPTB 4FLHA 1VJKA 2LMCA 3CMMB 4HEA1 1JWBD 3NHEB 3AE3B 2WP9B 4K7SA 2KDMA 4P16A 4MEMA 2O2VB 4YSXB 1I4RA 3C19A 1YNTE 1I4XA 3N1XC 4RM9A 1TY2A 3NZUA 1WH3A 5H8YE 2L52A 3P4RB 3R66C 2RDBC 4WWOA 1YJIA 3DHHC 4WQMA 1X1MA 1E7VA 2O2VA 2M8SA 2KHWB 2WDVB 2WS3B 2R2OA 1ZOYB 2OOBB 1WRDB 2EMSA 3NG0A 4G50A 2WXJA 3HM6X 4C00A 3Q6BA 4IDIA 2C7NB 2Z8LA 3MFGA 1MHXA 4LTUA 4ZRPA 2LZ6A 3V60A 5E6PA 3EUB2 4L2YA 1TS5A 3X23A 4REZA 2ZNVC 1FCCC 1UGJA 2L0TA 2MP2A 4P6VF 2D5GA 2MWSB 1UELA 4GOCA 4FHKA 3ZIMA 2N9EB 3T3OA 3A9JA 2INNE 2O6VD 2QSDA 3Q3OC 3RNEC 3PRPB 4A90A 3PT2B 1P98A 2G4DB 3DHGC 3PLVA 2OJRA 3PPAA 3SR6A 2D3GA 5IP4D 3UQBA 3KUDB 2KDEB 2PMVA 5E6NA 4P1CC 2V4IB 1NENB 3BZDB 2FUHB 5BYSA 1XQQA 2G9HD 2FCNA 4DDID 1PUTA 2FNJB 3U8ZA 3ZJVA 1EM7A 3RI7C 3DQVA 4XGAB 3ZRFA 4L23A 3KQ4A 3BK1A 3IAS1 5L95C 2PTLA 1OQRA 3DHIC 2WDTB 5FK9C 5LNK1 4LNIA 2AQ1B 4OVVA 2XEWA 3I3TB 1Y8RC 2BYTA 5DCNA 3RYTA 1FM0D 1E7PB 1H8CA 1C4CA 2K25A 2JZ3B 4KZ0A 1VDVA 3FILA 2N9LA 2GMIC 4KIKB 3SFEB 1WYWB 1J0GA 4WJNA 3VUXA 4JLCA 2KLGA 4NZLB 2IO3B 3ZYYX 3GP7A 2N1WA 3ZDTA 1F2RC 3PO0A 1ZE3D 2K9XA 4W9FA 3P1MA 4KGRA 3P63A 2KACA 3IFWB 2KKCA 3CWIA 4XZ4A 4ZHOA 5E6JA 2XK5B 4TUUA 4HCPB 5BYQA 4II3B 4K3BA 2LGYA 2IYDB 4PS8A 3MHZA 3BY4B 2LJIA 1WMHB 3R7RA 2JRIB 3WAPA 2KWCA 4IWPA 4KGTA 1LQBA 2WU5B 3AU4A 1SIJA 2AL3A 2KNBA 1QF6A 1VZ8A 3RULA 4BAXA 4CO7A 4AUQC 3UINB 3L16A 2WGSA 1MVKA 1UWMA 3R8BA 2BS3B 3QIJA 4GU2A 2N0SB 2MBOA 3HIZA 2JYEA 1SB3C 2E6XA 4A20A 3TJPA 1L6UA 2J7QB 2M56B 3R3MA 2LFIA 2QJLA 3KYCD 2KAJA 2HJ8A 3TCAA 3X0WA 2K3UA 3AE1B 2EELA 2FCSA 2KXJA 3PZDA 4WJOA 2W3SA 2G1EA 2BGFA 3ZUNA 2KOXA 2CJOA 2LGIA 3L0WB 4W9HA 1SE2A 4ZOHC 1WX8A 4LNOA 2NR2A 1L2NA 3UI3A 1FRRA 2LHDA 1ESFA 2QHOA 3VR8B 1EF1A 2A4ZA 3W9CB 3AH7A 3R2IA 5DPWA 4NY0A 3ZTDA 3AE4B 1OGWA 2PW9A 2BPSA 2M0AA 4BKSA 2NVUI 4W9EA 4N59A 2XN9C 2N7EA 3MC8A 5D7GA 2MSED 1P1AA 1M4VA 3L10B 1Q5WB 3A4RA 4OW0A 2DX5B 2WXGA 1GG3A 2DYOA 4FN2A 3ONSA 3W5UB 3KUCB 2CU3A 2LUEA 2Q5WD 2ZZPB 2WX0A 3N3KB 5CHVC 4KV2A 4NQLB 2NBWB 3B08A 4KVGB 4M0WB 5L83A 4HPMB 1FCLA 4B6WA 2J4XA 1K51A 3A1QA 1KLUD 4BOSC 5LXIB 4WWPA 3AE9B 5H92C 3C8YA 3TEZA 4OVZA 2KFKA 3GZNB 4RF1A 4F7ZA 3ZNZB 1FXTB 3QHTA 1RLFA 1F0ZA 5TR5A 2BB5A 3RT3B 2JVCA 4WJQA 4TSSA 1WGKA 3BVMA 2K22A 1SXTA 2BKFA 5G55A 5BMIA 2LASA 2HTHA 2IGHA 4PYUA 5AEKB 2RDGA 1QZEA 1C76A 1L5PA 1YQ3B 2I1JA 2KJ6A 2ZVNA 5J17A 2M4NA 2DZIA 1E10A 1R4MI 1V1PA 2LXAA 4HJGE 4HCNB 2WYQA 3B9JA 4LNNA 5MPOA 3WIMA 1HZ6A 4US8A 1E5WA 2FIFA 4IOIE 4JIOU 1TZOA 2KMMA 1P0RA 2M17A 4MJSB 4P7IA 4GGQA 3AEGB 1C9FA 4OZBA 3VTUA 1JCKB 5D3DA 2CHWA 1NI2A 3EC8A 5LXHA 2RGFA 4E74A 3AECB 1E6EB 4XDDA 1QOFA 1RFAA 4CQNA 5HFYA 3RPFC 3BINA 1CJEA 3AE7B 3RD2A 2FCQA 5C3JB 2L32A 4MGIE 2GBRA 2VRRB 4HDQA 4WWMA 2L3ZA 2V0GA 4LCDE 2OHFA 4XE0A 4KIKA 3M63B 4KSKC 1FNVA 1WJ4A 2HD5B 2VH1A 1L0YB 3RNFC 3R2TA 2JPHA 3DWGC 5GXGB 1YQ4B 1T0RC 2QDFA 3AE2B 1F52A 2KTRB 3IAM1 2D11A 5IOIA 1A5RA 2J0KA 4N9F4 1IGDA 2G4SA 1FFUA 2CKHB 3N30A 1L7YA 2GOWA 4PYZA 1LO5D 1YJ1A 2B76B 2L76A 4AJWA 2L00B 3U30A 3I63C 2W3RA 2LGSA 3CSTA 2NTTA 5HHDG 2BF8B 1QOGA 2ASQA 1K53A 3P4QB 3QK0A 5DPTA 1UF0A 4NJ6A 4IKGA 2MCNB 3DBRB 1QLBB 1TBEA 3QC8B 4YWGG 2Z0DB 5G2NA 5LLIA 1E8XA 2IZVB 3SDLC 1C3TA 2X8XX 1J7BA 3W5VB 1KOTA 5D6JB 4B9KA 4YSYB 2V3PA 5HKHA 4EZKA 3Q14C 1JWMD 1VLBA 3EA6A 2N1VA 2DNFA 2QEJC 4N6EB 2INDC 1KM7A 3NUHB 2ZEQA 4WH4A 1FFVA 1L4ZB 3AEFB 5DPRA 2PIAA 2R61A 1B9RA 1IBXB 3TEYA 3M95A 1ACCA 2DYMA 2MJ3A 2KT7A 4S17A 4USAA 1MG4A 4K1RB 3JSVA 3UGBB 2KC1A 2ONQA 5I4DA 4XWTA 4HPPA 1NI3A 3FAHA 3TBLD 1T6BX 3GE3C 5TSSA 2AEHA 1WJUA 4C56C 1WR6E 1QOAA 4KKIA 3VVWB 1ZPSA 1IPGA 5EE3A 5EE9A 2RSUA 3TEXA 1VZ7A 2KWDA 3PLUA 2MH7A 1R4MB 3RNGC 5CHWA 2IGDA 2LVPA 1ZGUB 1HXYD 2X38A 3TUOA 1FNUA 1LXDA 1K50A 3EFCA 2KQ4X 3TSSA 3N1ZC 4TQ0A 1ET9A 3AU5A 1AW7A 1PGBA 3ML8A 3V6CB 1VZ6A 3NVVA 3DVGX 3W2DA 3SU8X 4K7UA 2D3BA 4MJSA 2HE7A 3DCGA 1S1QB 4HRSA 2NCNA 3JW0X 2KTRA 1YN3A 3K9OB 3VH4B 1GJZA 1OEYJ 1YX6B 3I9V1 3LXFA 1FPYA 4LJPB 2MJEA 4HXDA 2FBWB 3PS6A 2VH2A 1TJEA 4AOFA 5JXVA 4JL9A 1OEYA 1STEA 1WJ6A 2KLCA 2DZJA 2N9XA 4C7YA 4MT5A 1R4NI 3A33B 2JUOA 2ZPNA 2MJDA 1SGHA 3AEAB 1SEBD 4HWIB 1V5TA 4DWFA 1UZXB 3VXWA 4Q2JA 4CHKA 1WE6A 2DAJA 3WAOA 1KJTA 5G5GA 3ZRCA 4YTNB 1I7HA 3QCAA 1U4AA 3MJ5A 2KDBA 3Q3FA 2JF5A 3KWLA 1J19A 2EKEC 3WALA 2BS4B 4W9GA 1EWCA 1TIFA 3Q8FA 2RPVA 3OJ4B 3U7ZA 1RRBA 2WXPA 1MJDA 1YX5B 2K5PA 1QT9A 1OQQA 1RAXA 1I4PA 3S2AA 3NVYA 4HK2A 3VRAB 4N58A 1J7AA 2WNMA 4B0EA 1YN5A 4MM3A 1C4AA 1Q1OA 4MM3B 4WWNA 1C4PA 2KQSA 2KMCA 1HE8A 2JXXA 2DZMA 1RM6C 4YTPB 3PGEA 2NPTA 4JWUC 3LJ3A 3W1SC 3PRZA 1G6JA 4DXFA 3H9DA 3OAWA 5EE0A 1D5ZC 2INPE 4YL8A 3JYUA 2KVZA 1T0YA 3HUIA 2QILA 3U4EG 2W82A 2L1AA 4LDTB 3Q3NC 2K6DB 1SF0A 4RGNA 1WSPA 2WXIA 3EECA 1WJNA 1XEEA 2BTEA 2KX0A 3Q2AC 2LJ5A 2DLBA 2MX2A 1BT0A 1GB4A 3V61A 3NRZA 1JQ4A 1XLQA 4KX6B 3WAMA 1V8CA 2LUMA 4LK0M 2NBUA 3RNCC 2GBMA 4NJCA 1WXQA 2NS5A 2YVCA 1D3ZA 4JX1C 3RZWC 3AE8B 3PHWB 2MBHA 4I6LB 5D3IB 1ROEA 1WY8A 2H89B 3A9JB 3NZ3A 4FHJA 3TIXA 2PLPA 4TQ1A 4IWOA
chains in the Genus database with same CATH topology
3N1XC 3Q14C 2INCC 1T0QC 3N20C 3RI7C 3Q3NC 3GE8C 3RN9C 3RNBC 3RNCC 2INDC 3DHGC 2RDBC 3GE3C 3DHHC 1T0SC 3DHIC 3Q2AC 4P1CC 3N1ZC 3RNFC 3RMKC 3I63C 3I5JC 3Q3MC 3RNAC 1T0RC 4P1BC 3Q3OC 3RNEC 3RNGC 3N1YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1X C;  3Q14 C;  2INC C;  1T0Q C;  3N20 C;  3RI7 C;  3Q3N C;  3GE8 C;  3RN9 C;  3RNB C;  3RNC C;  2IND C;  3DHG C;  2RDB C;  3GE3 C;  3DHH C;  1T0S C;  3DHI C;  3Q2A C;  4P1C C;  3N1Z C;  3RNF C;  3RMK C;  3I63 C;  3I5J C;  3Q3M C;  3RNA C;  1T0R C;  4P1B C;  3Q3O C;  3RNE C;  3RNG C;  3N1Y C; 
#chains in the Genus database with same CATH topology
 2INC C;  3HM3 A;  3IVF A;  2BYE A;  2XNA C;  4GDK A;  4RGM A;  3R7Q A;  4YTM B;  4MAC A;  4K3C A;  1WWT A;  5HI1 A;  3URY A;  5C2T B;  3SHQ A;  4I6N B;  1V2Y A;  3QJZ A;  4F1S A;  3QX1 A;  3A9K A;  3GOE A;  2L83 A;  1E8W A;  1CMX B;  2UYZ B;  3KYD D;  1PGA A;  2MBQ A;  2RR9 A;  1C77 A;  4C80 A;  1WI0 A;  1TS4 A;  3LDZ E;  1FIQ A;  3M62 B;  2DHZ A;  5D2M B;  4RFB A;  2PKO A;  2KTF A;  2QMT A;  3UQA A;  2DWQ A;  4AP4 C;  2QIE B;  1GAQ B;  3DVN V;  3DBL I;  1WXV A;  4JGH B;  2IO0 B;  2BWE S;  2OJW A;  3APF A;  4MGZ E;  4HRO A;  2IGG A;  1PDX A;  1E7U A;  1UBQ A;  4PS3 A;  1L6V A;  2JQR B;  3B2F A;  4A9A A;  3VHT C;  2K8C A;  5IAA C;  1WGY A;  3BK2 A;  1HTQ A;  5AZG A;  1GNU A;  4JWS C;  1KF6 B;  1GC7 A;  3C0R B;  2I1K A;  2G45 B;  1HEZ E;  1MG8 A;  2KFJ A;  4M01 A;  3ML9 A;  1IBX A;  2SEB D;  2V1Y A;  2WDR B;  3VFK A;  3H7P B;  1NEK B;  5J2R A;  2AYO B;  4AQ7 A;  3U52 E;  1D5X C;  1F1H A;  1XLN A;  3K9P B;  3NVZ A;  3TL5 A;  3W1S A;  3UIP B;  4M0W A;  3EGR A;  3B0A A;  1GPX A;  2M19 A;  3RNA C;  3TEW A;  2N9K A;  1TGZ B;  1FEH A;  1V97 A;  2JWU A;  4OHJ A;  1WGG A;  1Q0W B;  2LGX A;  2KD0 A;  2KAN A;  1TKE A;  1TS2 A;  1V6E A;  5CTR C;  4C4V B;  1UGM A;  4A8X C;  2KMA A;  1HZ5 A;  3UF8 A;  4BVU C;  2M0X A;  4ARC A;  2XBB C;  4P1B C;  2BVC A;  1FXA A;  3APD A;  2PE9 A;  4A6Q A;  2WWZ A;  3ZO5 B;  2O6V A;  2E3T A;  2BBC A;  4IG7 B;  5AUK A;  4DQO C;  1D6E C;  3KVF B;  1WMH A;  3QAQ A;  1N6Z A;  2UWQ A;  1L4D B;  1NBF C;  2AWT A;  1E90 A;  2FAZ A;  1K8R B;  3V3X A;  1FNW A;  4HKZ E;  3APC A;  3P4S B;  4HLE A;  2KJR A;  2RMM A;  1FO4 A;  4BKG A;  3H7S A;  4FUL A;  1DOI A;  4QAY A;  2REX A;  1TS3 A;  2KJH B;  1Y56 A;  2M1M A;  4URK A;  1GOZ A;  4NPN A;  2WHI A;  3NS1 A;  2BKR B;  5KHQ A;  4LNK A;  3ECI A;  4S0R A;  2V4L A;  2W54 A;  1I4H A;  3RN9 C;  4BOZ B;  3MC0 B;  3AE5 B;  3MHS D;  2D2Q A;  2PEA A;  1RYJ A;  5J18 A;  4XDC A;  4MEL A;  4R3D A;  3MP9 A;  3RFZ B;  1XLO A;  1ENF A;  3P2B A;  1DGJ A;  3LYY A;  1HTO A;  1N63 A;  1WRI A;  1FRD A;  2CHZ A;  2ON8 A;  2LHE A;  1XLP A;  2C7H A;  4RGO S;  4W9C A;  2O6V B;  2BWF A;  4KSL C;  4LNF A;  2ZPY A;  3HHM A;  2ZVO A;  1MPE A;  1VCB A;  2MBE A;  1WGH A;  2KDI A;  4IWQ A;  2ZJD A;  4J3O D;  1MI0 A;  3D32 A;  4NQK E;  1V1P B;  3IHP C;  1L0V B;  1VR9 A;  2C9W B;  2FE8 A;  1EU4 A;  2EMT A;  2BW2 A;  2CS4 A;  3AMZ A;  3IT4 B;  1XO3 A;  5JZE B;  4FAD A;  5E6O A;  2D10 A;  3HK0 A;  3Q8A A;  5FKA C;  1J8C A;  3T9L A;  2LVQ A;  3Q8B A;  1MHH E;  1RFK A;  3JSV B;  3WA0 A;  1ZUD 2;  2NTS A;  3DOW A;  5AZH A;  4RM8 A;  1T0S C;  4JQW C;  1UH6 A;  2WXK A;  2VZK D;  3PZ7 A;  5IO9 A;  1EU3 A;  1TYG B;  3NJT A;  2KN4 A;  1WIA A;  1E8Y A;  1UWX A;  2W9N A;  3ZNG C;  2WXN A;  2JYT A;  1HA5 A;  3J9C A;  2IO2 B;  1JRO A;  4TMA B;  4E71 A;  2LRU A;  3L4P A;  2V9H A;  2IPK D;  1QIL A;  1CZP A;  4EZL A;  1IGC A;  5AUI A;  1XD3 B;  2KK8 A;  2LD9 A;  3AEE B;  4DHJ D;  4ZRJ A;  1PQS A;  4GXB A;  2YLM A;  4I6P A;  1I4Q A;  3ZW3 A;  4ICV A;  3VTV A;  1I42 A;  4MSQ B;  4YXD B;  2R2Q A;  1N5X A;  2WXM A;  3TMP B;  3NY5 A;  1D5M C;  1WR1 A;  1E8Z A;  2CR5 A;  2KZR A;  4ZDV A;  2LWP A;  5BMH A;  2JXT A;  2MA9 B;  2ZW0 A;  1KH0 A;  4DXG A;  3DBS A;  2MQJ A;  3HVZ A;  1WGR A;  4KZC A;  4FJV B;  3ETR A;  1WF9 A;  4GIV A;  4DHZ B;  1F2R I;  3ZGZ A;  4FJY A;  4GMV A;  4PT5 A;  1TTN A;  1WGD A;  3FC4 A;  5T8I A;  1OFF A;  2PE6 B;  4AJY B;  3DBR I;  1V1O A;  3VTW A;  4BKT A;  1H4R A;  1FD6 A;  1YD8 U;  2BB6 A;  1LFD A;  2AQ3 B;  1ZDV A;  1JRU A;  3AM9 A;  2C60 A;  1WXA A;  3WAN A;  4GB9 A;  2IDY A;  3SEB A;  2IY1 B;  3IT6 B;  3BVG A;  1TY0 A;  3SFD B;  4ACF A;  2KFK B;  4JPS A;  4K7W A;  2ZW1 A;  4DHZ E;  4XYC A;  4PS7 A;  1E0Z A;  4PK1 A;  1KLV A;  1ZXI A;  2L8J A;  4GDK B;  1PFD A;  2KWV B;  3HRD D;  2V3N A;  3PRM B;  4HPL B;  3PV1 A;  4RF0 A;  2BYV E;  2RPQ A;  1LM8 B;  2HJ1 A;  5IA7 A;  2GRI A;  2LRW A;  1GB1 A;  5HG2 A;  3M3J A;  4L1B A;  4YSZ B;  4HJK A;  3AI5 A;  1KRH A;  3I57 A;  1E9M A;  4GDL A;  3VDZ A;  2NBV B;  2B3A A;  3H6N A;  2BQQ A;  4DXA B;  3PTF C;  5FR6 A;  5JHA A;  2LEK A;  3VUW A;  1ZW7 A;  2Z59 B;  1M94 A;  1SE3 A;  4II2 B;  4IUM B;  3O13 A;  3PSE B;  2CHX A;  5IN7 A;  3DPD A;  4WJP A;  3RNB C;  5FR3 A;  1TT5 B;  1BML C;  1JML A;  1PYW D;  2DEN B;  1UBI A;  1WXS A;  3IXS A;  2MRP A;  1VD2 A;  4ANX A;  5IKC M;  4ICU A;  1Z2M A;  4EE2 A;  4W9I A;  4ARI A;  4MH8 A;  1YJJ A;  2K8B A;  1N5W A;  2D3C A;  3V6E B;  1J7C A;  3WCQ A;  4LJO B;  4MGY E;  2CJN A;  2N7J A;  2C5L C;  3ZNH B;  3RMK C;  2J53 A;  4W9D A;  2Y5P A;  1D4B A;  4XX5 A;  4BFR A;  3CF6 E;  4RMA A;  1A70 A;  4GDL B;  3A4S C;  1FMA D;  4BBN C;  1KFY B;  1TKG A;  1WXM A;  1OTR B;  4NAM A;  1C79 A;  4YT0 B;  2MHJ A;  4KGS A;  5BO4 B;  3QQ8 B;  2JRH A;  2G3Q B;  4M8N A;  1WX7 A;  3L54 A;  5DPS A;  2WLB A;  1BUI C;  1L0X B;  3UIO B;  1V80 A;  3AEB B;  4NJ7 A;  3B2G A;  1YQB A;  2JU6 X;  4FXC A;  4MDK E;  1SBB B;  3VAW A;  3DDC B;  3ZLZ A;  1K52 A;  5C23 A;  2BS2 B;  2DAF A;  4AS1 A;  3DBH B;  1ZXH A;  2NMQ A;  2JT4 B;  2SAK A;  4EOY A;  4RH6 A;  2VZK B;  4WAA A;  2QC8 A;  3L17 A;  3ALB A;  4TKN A;  3BYT B;  3GS2 A;  3ZKJ C;  4ZYS A;  3H8H A;  3QWZ B;  1TKY A;  2UU7 A;  2PVO D;  3KUZ A;  2LI5 A;  1R4N B;  3CSF A;  4E3C A;  4F8C B;  2GLS A;  1C1Y B;  1I4G A;  2GBJ A;  2JZZ A;  4K81 A;  3QAR A;  2LGD A;  4DHJ B;  3OWE B;  2MW5 A;  3N20 C;  1ZKH A;  2ICI A;  4BKS D;  1XCQ L;  3RUI B;  4B0M A;  4XWW A;  1B1Z A;  4RCO A;  3H7P A;  3NZS A;  2TSS A;  2JX5 A;  2RDH A;  2GBN A;  2KO3 A;  1JWU D;  3ENE A;  3PHX B;  3BWU D;  5KHO A;  2L7R A;  3Q8E A;  2Y3A A;  4EEW A;  1GC6 A;  1YMH E;  2KC2 A;  3NVW A;  3EFU A;  3VRB B;  4ZYN A;  4XC2 A;  4M00 A;  1F77 A;  1JWA D;  5EE1 A;  4MGK E;  2BT6 A;  2LVO A;  2RD0 A;  1XCT L;  3MC9 A;  3KLS X;  4ANW A;  2IO1 B;  3PRE A;  1NYQ A;  3P42 A;  4EKU A;  3ZXV A;  2J0J A;  4US9 A;  2KVR A;  1P3Q U;  2WXQ A;  3KWV A;  1P7F A;  1KTK A;  1ZDX A;  3BII D;  3AB5 A;  4NAW A;  2PPH A;  1EO6 A;  2WDQ B;  2KDF B;  3ZTC A;  2FCM A;  3N32 A;  3I5J C;  2WQY B;  1KLG D;  2Y5C A;  5EDS A;  2ACZ B;  2FID A;  2J0M A;  2MP2 B;  5BYR A;  4G3X B;  3AN1 A;  3N9Y C;  3L08 A;  4ANU A;  3E56 A;  4RNA A;  3Q8C A;  1RWS A;  4KDI C;  2ZCB A;  3JVZ X;  4IC7 B;  2ZNV B;  4KKJ A;  1WX9 A;  1YOV B;  4IM3 A;  2I2Y A;  2K6Q A;  1Q10 A;  2DBY A;  3FKY A;  3VR9 B;  1F9J A;  1SE9 A;  4HKQ A;  3T8M A;  3VH3 B;  4EUT A;  1IYF A;  4CYE A;  3H1U A;  1NVI D;  5AZF A;  2GB1 A;  2V3S A;  1JAL A;  4EFO A;  2N4F A;  3V05 A;  3PVL A;  4W9L A;  2KYW A;  2WXR A;  1AN8 A;  2WXO A;  4A55 A;  3OLM D;  3DBL B;  4OVU A;  3CIR B;  1OQY A;  1ISN A;  2IY0 B;  1SJE D;  4ZHP A;  3A9K B;  1V5O A;  3BVZ A;  4IM2 A;  1WZ0 A;  1N61 A;  2IBI B;  1EF5 A;  2IJ0 A;  1SJH D;  1UD7 A;  1YIW A;  2K0P A;  3DVN U;  2MEK A;  3MJW A;  2QCZ A;  1WFY A;  4M02 A;  3OG5 A;  1N62 A;  4DDG D;  3L13 A;  3ZVV A;  4G0N B;  5GMV A;  3ZNI D;  3AE6 B;  1MFW A;  1TZ1 A;  2AL6 A;  4MSM B;  2XK5 A;  2KN5 A;  1BXT A;  3V62 A;  4A3O A;  3U2S C;  2DYB A;  4WUR A;  2KWU B;  2EKI A;  3IBE A;  4ZRK A;  4GLS C;  3BYY B;  3Q69 A;  2KQ7 A;  1C78 A;  1JW9 D;  2K39 A;  1WE7 A;  3ZQ4 A;  1P7E A;  4WIP A;  1V81 A;  4KDL B;  1T0Q C;  2WXF A;  1PGX A;  2DZK A;  4FJZ A;  4MH0 E;  2PVG C;  1XXG A;  4W9K A;  1YN4 A;  3U7D A;  2JSV X;  3ABV B;  1T5X D;  1XT9 B;  2CU1 A;  2GBK A;  1WZ3 A;  3DBH I;  4W9J A;  4ITK A;  1R7S A;  3QA8 A;  2K1F A;  4UDU C;  2JY6 A;  3Q3M C;  1I35 A;  2AX5 A;  2KX3 A;  4RGT A;  3KH0 A;  2L0F A;  2WX1 A;  3OJ3 A;  2BYF A;  2J42 A;  4NNJ B;  2A5U A;  4ANV A;  1CQV A;  2YEP F;  4EZJ A;  4IW0 A;  3A1Q B;  3IG3 A;  2D3A A;  3ZJU A;  4NAW B;  1QKZ A;  4A3P A;  1ZP0 B;  1UUP A;  2PJH A;  3B1L X;  4BZA A;  4BBN F;  1AWD A;  4HDO A;  5JHB A;  3RZF A;  3HVD A;  3GB1 A;  4GSW A;  1DYQ A;  1JRP A;  2MLB A;  3GE8 C;  1IUE A;  4M8M A;  1XF5 L;  1SSN A;  2WXL A;  2WXH A;  1JWS D;  1CK1 A;  2JZP A;  4WQO B;  4AWJ A;  3MTN B;  1N60 A;  4TV3 A;  2Z0E B;  5C1Z A;  2H88 B;  3AV8 A;  4ZRQ A;  1HQR D;  2OED A;  3FIL B;  4HVB A;  2AQ2 B;  2D07 B;  3T3N A;  4GN1 A;  2HTM E;  4LDT D;  4DBG A;  3DVG Y;  5CX3 A;  3GZN I;  1NDD A;  1P9D U;  3ZXR A;  1DOY A;  1LGR A;  1WM3 A;  1FXI A;  1SIF A;  2YEP B;  1V9J A;  3RCZ A;  3ZJT A;  2Y5B B;  3AXC A;  4H2A A;  1Z5S B;  2FUG 1;  3KW5 B;  5D94 A;  3N1Y C;  1VRA B;  4OZA A;  2L05 A;  1V86 A;  4WAF A;  2K8H A;  1AAR A;  3DWM A;  4DK5 A;  1WYG A;  3E9S A;  4C4V A;  4O1N A;  1S3S G;  1IP9 A;  1QOB A;  2HDE A;  3P4P B;  3PZ8 A;  4LLG M;  3AED B;  5G5H A;  2N9P C;  3SD5 A;  4G11 A;  5JH5 C;  1WM2 A;  2MBB B;  1GUA B;  1EWY C;  1EUV B;  4ZRI A;  1ET6 A;  4OZC A;  2JWZ A;  3W1Y A;  4FA6 A;  4IM0 A;  5CHF A;  2ZCC A;  4D2K A;  1QQR A;  4J6I A;  3LB8 C;  1DOX A;  1UNS A;  3NOB A;  4ASW C;  3VQI A;  2J52 A;  3VUY A;  2I38 A;  2C7M B;  2WU2 B;  4JE3 B;  4X57 B;  2W55 A;  1T3Q A;  2N7D A;  3AUL A;  1NYR A;  3O65 B;  3ZDM C;  3Q3J A;  5BMG A;  2GI9 A;  4C7Z A;  1V49 A;  2LXC A;  1AYF A;  3NS8 A;  3EHV A;  4B95 A;  1SE4 A;  4FBJ B;  2NPT B;  4FLH A;  1VJK A;  2LMC A;  3CMM B;  4HEA 1;  1JWB D;  3NHE B;  3AE3 B;  2WP9 B;  4K7S A;  2KDM A;  4P16 A;  4MEM A;  2O2V B;  4YSX B;  1I4R A;  3C19 A;  1YNT E;  1I4X A;  3N1X C;  4RM9 A;  1TY2 A;  3NZU A;  1WH3 A;  5H8Y E;  2L52 A;  3P4R B;  3R66 C;  2RDB C;  4WWO A;  1YJI A;  3DHH C;  4WQM A;  1X1M A;  1E7V A;  2O2V A;  2M8S A;  2KHW B;  2WDV B;  2WS3 B;  2R2O A;  1ZOY B;  2OOB B;  1WRD B;  2EMS A;  3NG0 A;  4G50 A;  2WXJ A;  3HM6 X;  4C00 A;  3Q6B A;  4IDI A;  2C7N B;  2Z8L A;  3MFG A;  1MHX A;  4LTU A;  4ZRP A;  2LZ6 A;  3V60 A;  5E6P A;  3EUB 2;  4L2Y A;  1TS5 A;  3X23 A;  4REZ A;  2ZNV C;  1FCC C;  1UGJ A;  2L0T A;  2MP2 A;  4P6V F;  2D5G A;  2MWS B;  1UEL A;  4GOC A;  4FHK A;  3ZIM A;  2N9E B;  3T3O A;  3A9J A;  2INN E;  2O6V D;  2QSD A;  3Q3O C;  3RNE C;  3PRP B;  4A90 A;  3PT2 B;  1P98 A;  2G4D B;  3DHG C;  3PLV A;  2OJR A;  3PPA A;  3SR6 A;  2D3G A;  5IP4 D;  3UQB A;  3KUD B;  2KDE B;  2PMV A;  5E6N A;  4P1C C;  2V4I B;  1NEN B;  3BZD B;  2FUH B;  5BYS A;  1XQQ A;  2G9H D;  2FCN A;  4DDI D;  1PUT A;  2FNJ B;  3U8Z A;  3ZJV A;  1EM7 A;  3RI7 C;  3DQV A;  4XGA B;  3ZRF A;  4L23 A;  3KQ4 A;  3BK1 A;  3IAS 1;  5L95 C;  2PTL A;  1OQR A;  3DHI C;  2WDT B;  5FK9 C;  5LNK 1;  4LNI A;  2AQ1 B;  4OVV A;  2XEW A;  3I3T B;  1Y8R C;  2BYT A;  5DCN A;  3RYT A;  1FM0 D;  1E7P B;  1H8C A;  1C4C A;  2K25 A;  2JZ3 B;  4KZ0 A;  1VDV A;  3FIL A;  2N9L A;  2GMI C;  4KIK B;  3SFE B;  1WYW B;  1J0G A;  4WJN A;  3VUX A;  4JLC A;  2KLG A;  4NZL B;  2IO3 B;  3ZYY X;  3GP7 A;  2N1W A;  3ZDT A;  1F2R C;  3PO0 A;  1ZE3 D;  2K9X A;  4W9F A;  3P1M A;  4KGR A;  3P63 A;  2KAC A;  3IFW B;  2KKC A;  3CWI A;  4XZ4 A;  4ZHO A;  5E6J A;  2XK5 B;  4TUU A;  4HCP B;  5BYQ A;  4II3 B;  4K3B A;  2LGY A;  2IYD B;  4PS8 A;  3MHZ A;  3BY4 B;  2LJI A;  1WMH B;  3R7R A;  2JRI B;  3WAP A;  2KWC A;  4IWP A;  4KGT A;  1LQB A;  2WU5 B;  3AU4 A;  1SIJ A;  2AL3 A;  2KNB A;  1QF6 A;  1VZ8 A;  3RUL A;  4BAX A;  4CO7 A;  4AUQ C;  3UIN B;  3L16 A;  2WGS A;  1MVK A;  1UWM A;  3R8B A;  2BS3 B;  3QIJ A;  4GU2 A;  2N0S B;  2MBO A;  3HIZ A;  2JYE A;  1SB3 C;  2E6X A;  4A20 A;  3TJP A;  1L6U A;  2J7Q B;  2M56 B;  3R3M A;  2LFI A;  2QJL A;  3KYC D;  2KAJ A;  2HJ8 A;  3TCA A;  3X0W A;  2K3U A;  3AE1 B;  2EEL A;  2FCS A;  2KXJ A;  3PZD A;  4WJO A;  2W3S A;  2G1E A;  2BGF A;  3ZUN A;  2KOX A;  2CJO A;  2LGI A;  3L0W B;  4W9H A;  1SE2 A;  4ZOH C;  1WX8 A;  4LNO A;  2NR2 A;  1L2N A;  3UI3 A;  1FRR A;  2LHD A;  1ESF A;  2QHO A;  3VR8 B;  1EF1 A;  2A4Z A;  3W9C B;  3AH7 A;  3R2I A;  5DPW A;  4NY0 A;  3ZTD A;  3AE4 B;  1OGW A;  2PW9 A;  2BPS A;  2M0A A;  4BKS A;  2NVU I;  4W9E A;  4N59 A;  2XN9 C;  2N7E A;  3MC8 A;  5D7G A;  2MSE D;  1P1A A;  1M4V A;  3L10 B;  1Q5W B;  3A4R A;  4OW0 A;  2DX5 B;  2WXG A;  1GG3 A;  2DYO A;  4FN2 A;  3ONS A;  3W5U B;  3KUC B;  2CU3 A;  2LUE A;  2Q5W D;  2ZZP B;  2WX0 A;  3N3K B;  5CHV C;  4KV2 A;  4NQL B;  2NBW B;  3B08 A;  4KVG B;  4M0W B;  5L83 A;  4HPM B;  1FCL A;  4B6W A;  2J4X A;  1K51 A;  3A1Q A;  1KLU D;  4BOS C;  5LXI B;  4WWP A;  3AE9 B;  5H92 C;  3C8Y A;  3TEZ A;  4OVZ A;  2KFK A;  3GZN B;  4RF1 A;  4F7Z A;  3ZNZ B;  1FXT B;  3QHT A;  1RLF A;  1F0Z A;  5TR5 A;  2BB5 A;  3RT3 B;  2JVC A;  4WJQ A;  4TSS A;  1WGK A;  3BVM A;  2K22 A;  1SXT A;  2BKF A;  5G55 A;  5BMI A;  2LAS A;  2HTH A;  2IGH A;  4PYU A;  5AEK B;  2RDG A;  1QZE A;  1C76 A;  1L5P A;  1YQ3 B;  2I1J A;  2KJ6 A;  2ZVN A;  5J17 A;  2M4N A;  2DZI A;  1E10 A;  1R4M I;  1V1P A;  2LXA A;  4HJG E;  4HCN B;  2WYQ A;  3B9J A;  4LNN A;  5MPO A;  3WIM A;  1HZ6 A;  4US8 A;  1E5W A;  2FIF A;  4IOI E;  4JIO U;  1TZO A;  2KMM A;  1P0R A;  2M17 A;  4MJS B;  4P7I A;  4GGQ A;  3AEG B;  1C9F A;  4OZB A;  3VTU A;  1JCK B;  5D3D A;  2CHW A;  1NI2 A;  3EC8 A;  5LXH A;  2RGF A;  4E74 A;  3AEC B;  1E6E B;  4XDD A;  1QOF A;  1RFA A;  4CQN A;  5HFY A;  3RPF C;  3BIN A;  1CJE A;  3AE7 B;  3RD2 A;  2FCQ A;  5C3J B;  2L32 A;  4MGI E;  2GBR A;  2VRR B;  4HDQ A;  4WWM A;  2L3Z A;  2V0G A;  4LCD E;  2OHF A;  4XE0 A;  4KIK A;  3M63 B;  4KSK C;  1FNV A;  1WJ4 A;  2HD5 B;  2VH1 A;  1L0Y B;  3RNF C;  3R2T A;  2JPH A;  3DWG C;  5GXG B;  1YQ4 B;  1T0R C;  2QDF A;  3AE2 B;  1F52 A;  2KTR B;  3IAM 1;  2D11 A;  5IOI A;  1A5R A;  2J0K A;  4N9F 4;  1IGD A;  2G4S A;  1FFU A;  2CKH B;  3N30 A;  1L7Y A;  2GOW A;  4PYZ A;  1LO5 D;  1YJ1 A;  2B76 B;  2L76 A;  4AJW A;  2L00 B;  3U30 A;  3I63 C;  2W3R A;  2LGS A;  3CST A;  2NTT A;  5HHD G;  2BF8 B;  1QOG A;  2ASQ A;  1K53 A;  3P4Q B;  3QK0 A;  5DPT A;  1UF0 A;  4NJ6 A;  4IKG A;  2MCN B;  3DBR B;  1QLB B;  1TBE A;  3QC8 B;  4YWG G;  2Z0D B;  5G2N A;  5LLI A;  1E8X A;  2IZV B;  3SDL C;  1C3T A;  2X8X X;  1J7B A;  3W5V B;  1KOT A;  5D6J B;  4B9K A;  4YSY B;  2V3P A;  5HKH A;  4EZK A;  3Q14 C;  1JWM D;  1VLB A;  3EA6 A;  2N1V A;  2DNF A;  2QEJ C;  4N6E B;  2IND C;  1KM7 A;  3NUH B;  2ZEQ A;  4WH4 A;  1FFV A;  1L4Z B;  3AEF B;  5DPR A;  2PIA A;  2R61 A;  1B9R A;  1IBX B;  3TEY A;  3M95 A;  1ACC A;  2DYM A;  2MJ3 A;  2KT7 A;  4S17 A;  4USA A;  1MG4 A;  4K1R B;  3JSV A;  3UGB B;  2KC1 A;  2ONQ A;  5I4D A;  4XWT A;  4HPP A;  1NI3 A;  3FAH A;  3TBL D;  1T6B X;  3GE3 C;  5TSS A;  2AEH A;  1WJU A;  4C56 C;  1WR6 E;  1QOA A;  4KKI A;  3VVW B;  1ZPS A;  1IPG A;  5EE3 A;  5EE9 A;  2RSU A;  3TEX A;  1VZ7 A;  2KWD A;  3PLU A;  2MH7 A;  1R4M B;  3RNG C;  5CHW A;  2IGD A;  2LVP A;  1ZGU B;  1HXY D;  2X38 A;  3TUO A;  1FNU A;  1LXD A;  1K50 A;  3EFC A;  2KQ4 X;  3TSS A;  3N1Z C;  4TQ0 A;  1ET9 A;  3AU5 A;  1AW7 A;  1PGB A;  3ML8 A;  3V6C B;  1VZ6 A;  3NVV A;  3DVG X;  3W2D A;  3SU8 X;  4K7U A;  2D3B A;  4MJS A;  2HE7 A;  3DCG A;  1S1Q B;  4HRS A;  2NCN A;  3JW0 X;  2KTR A;  1YN3 A;  3K9O B;  3VH4 B;  1GJZ A;  1OEY J;  1YX6 B;  3I9V 1;  3LXF A;  1FPY A;  4LJP B;  2MJE A;  4HXD A;  2FBW B;  3PS6 A;  2VH2 A;  1TJE A;  4AOF A;  5JXV A;  4JL9 A;  1OEY A;  1STE A;  1WJ6 A;  2KLC A;  2DZJ A;  2N9X A;  4C7Y A;  4MT5 A;  1R4N I;  3A33 B;  2JUO A;  2ZPN A;  2MJD A;  1SGH A;  3AEA B;  1SEB D;  4HWI B;  1V5T A;  4DWF A;  1UZX B;  3VXW A;  4Q2J A;  4CHK A;  1WE6 A;  2DAJ A;  3WAO A;  1KJT A;  5G5G A;  3ZRC A;  4YTN B;  1I7H A;  3QCA A;  1U4A A;  3MJ5 A;  2KDB A;  3Q3F A;  2JF5 A;  3KWL A;  1J19 A;  2EKE C;  3WAL A;  2BS4 B;  4W9G A;  1EWC A;  1TIF A;  3Q8F A;  2RPV A;  3OJ4 B;  3U7Z A;  1RRB A;  2WXP A;  1MJD A;  1YX5 B;  2K5P A;  1QT9 A;  1OQQ A;  1RAX A;  1I4P A;  3S2A A;  3NVY A;  4HK2 A;  3VRA B;  4N58 A;  1J7A A;  2WNM A;  4B0E A;  1YN5 A;  4MM3 A;  1C4A A;  1Q1O A;  4MM3 B;  4WWN A;  1C4P A;  2KQS A;  2KMC A;  1HE8 A;  2JXX A;  2DZM A;  1RM6 C;  4YTP B;  3PGE A;  2NPT A;  4JWU C;  3LJ3 A;  3W1S C;  3PRZ A;  1G6J A;  4DXF A;  3H9D A;  3OAW A;  5EE0 A;  1D5Z C;  2INP E;  4YL8 A;  3JYU A;  2KVZ A;  1T0Y A;  3HUI A;  2QIL A;  3U4E G;  2W82 A;  2L1A A;  4LDT B;  3Q3N C;  2K6D B;  1SF0 A;  4RGN A;  1WSP A;  2WXI A;  3EEC A;  1WJN A;  1XEE A;  2BTE A;  2KX0 A;  3Q2A C;  2LJ5 A;  2DLB A;  2MX2 A;  1BT0 A;  1GB4 A;  3V61 A;  3NRZ A;  1JQ4 A;  1XLQ A;  4KX6 B;  3WAM A;  1V8C A;  2LUM A;  4LK0 M;  2NBU A;  3RNC C;  2GBM A;  4NJC A;  1WXQ A;  2NS5 A;  2YVC A;  1D3Z A;  4JX1 C;  3RZW C;  3AE8 B;  3PHW B;  2MBH A;  4I6L B;  5D3I B;  1ROE A;  1WY8 A;  2H89 B;  3A9J B;  3NZ3 A;  4FHJ A;  3TIX A;  2PLP A;  4TQ1 A;  4IWO A; 
#chains in the Genus database with same CATH homology
 3N1X C;  3Q14 C;  2INC C;  1T0Q C;  3N20 C;  3RI7 C;  3Q3N C;  3GE8 C;  3RN9 C;  3RNB C;  3RNC C;  2IND C;  3DHG C;  2RDB C;  3GE3 C;  3DHH C;  1T0S C;  3DHI C;  3Q2A C;  4P1C C;  3N1Z C;  3RNF C;  3RMK C;  3I63 C;  3I5J C;  3Q3M C;  3RNA C;  1T0R C;  4P1B C;  3Q3O C;  3RNE C;  3RNG C;  3N1Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...