3DHHC

Crystal structure of resting state toluene 4-monoxygenase hydroxylase complexed with effector protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
b'SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords toluene 4-monooxygenase hydroxylase alpha subunit
publication title Structural consequences of effector protein complex formation in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3dhhC00
1T0QC 3RI7C 1T0SC 2RDBC 3DHIC 3RNGC 3Q14C 1T0RC 3GE8C 3Q3NC 3N20C 3DHGC 3Q2AC 3RNEC 3I5JC 4P1BC 3DHHC 3I63C 3Q3OC 2INCC 3RMKC 4P1CC 3RNFC 3RN9C 3N1ZC 3GE3C 3RNAC 3N1YC 2INDC 3RNCC 3N1XC 3RNBC 3Q3MC
chains in the Genus database with same CATH superfamily
2ZPNA 4LDTB 4I6PA 2NBVB 4IUMB 1TZ1A 2NTSA 1L4ZB 1YIWA 4HLEA 3RMKC 2RR9A 2JRHA 1F9JA 4FA6A 3KLSX 2JUOA 2NR2A 1GOZA 4DHZE 3OAWA 1SSNA 2KACA 1TTNA 2LXAA 4N59A 4G0NB 4IDIA 4K1RB 3PRMB 4G50A 3VR9B 3H7SA 3DVNV 3CMMB 2JZZA 2CJNA 4NJCA 2INNE 1AARA 2KLCA 1KJTA 2EMSA 3HK0A 2AQ2B 2MJ3A 1AYFA 2AQ1B 2HTHA 1SE9A 2BT6A 4F7ZA 1KLVA 1V2YA 4EFOA 3N32A 1FMAD 3EHVA 2KMAA 3X23A 2IO0B 1CMXB 2UWQA 3DVGX 1ZOYB 4MSQB 3VRAB 1GC6A 4HCNB 3VUWA 4REZA 4KSKC 2IGGA 3MC0B 3PRPB 4BKGA 1E5WA 3ABVB 2B76B 3TEZA 4HJKA 2KN4A 2ICIA 4W9JA 1ROEA 4RGNA 4NJ7A 1WJUA 1WX9A 1JQ4A 3VQIA 1ACCA 3ZXRA 3AE5B 3N3KB 4KDIC 3RNAC 3AB5A 5D2MB 5LNK1 3H7PA 3PTFC 4IC7B 4DHZB 3ZW3A 3P42A 3SDLC 3AECB 3B2FA 2O2VA 2W3RA 5FKAC 4DXGA 2MW5A 2KK8A 3SFEB 2K22A 4ANXA 1C77A 4WQMA 3ZYYX 4KSLC 1T0YA 1FNUA 1YQBA 3QARA 1FRRA 2D07B 4RMAA 1YJIA 4TSSA 1WX8A 3L13A 1HA5A 1YQ4B 3HUIA 1WJNA 2E6XA 4HKZE 1WSPA 3UQBA 1FIQA 4NY0A 2I1KA 3IT6B 3NRZA 5G2NA 1E8YA 5JH5C 5TSSA 2XEWA 1V5OA 1WMHA 2NCNA 3Q8BA 2BTEA 3U52E 1NYRA 3TL5A 3Q8FA 5DPRA 3ZIMA 1L0YB 1HEZE 2M8SA 1C3TA 5BMGA 5DPWA 5J18A 5H92C 3V61A 3ECIA 4G11A 2GBMA 3X0WA 1H4RA 1L6UA 1SE4A 4LNKA 4M8NA 1QKZA 2MBOA 1VLBA 4FN2A 4W9FA 2BYFA 4W9DA 2ZCCA 4E74A 2L0TA 3PT2B 1YOVB 2FNJB 1S3SG 3EGRA 2GI9A 2Z0EB 1C9FA 4W9GA 3AEEB 4WQOB 2KQ4X 2QEJC 3IBEA 3VH4B 4BKTA 1LQBA 3AEGB 2IGDA 3Q14C 4NQKE 3JVZX 5BMIA 4CHKA 5IO9A 1QF6A 4TQ1A 2KTRA 5EDSA 3AXCA 2ZCBA 3B1LX 1XEEA 1ZDVA 4GDKB 4KIKA 2MA9B 4WWMA 2O6VB 5EE0A 5BYRA 5HG2A 2L8JA 4WJPA 4GGQA 1QT9A 4NQLB 1TY2A 3RD2A 4M02A 2KWDA 4BOSC 4D2KA 5FR6A 2MBQA 2FCNA 3KUCB 1LM8B 4YTNB 5C3JB 3T3OA 5DPSA 2KVRA 1RLFA 2XK5B 2ONQA 5KHQA 1UD7A 3ZO5B 4IM0A 2CKHB 2N7EA 4FJZA 1WR1A 4LK0M 2W9NA 1WYGA 3EFCA 3Q8EA 2FE8A 3NJTA 3MP9A 5AZHA 2AQ3B 2DNFA 3PS6A 5CX3A 1JWAD 2LRWA 1Y56A 2MP2A 3MHSD 2KX3A 2G4SA 1CJEA 5E6OA 3P4RB 3Q8CA 2OJWA 1OQQA 3N30A 4A3OA 4YSZB 1E8ZA 1DGJA 4M0WB 2BWFA 3MFGA 1IBXA 1E7PB 4RF0A 3WAOA 1HZ6A 1D5MC 2D3CA 3B2GA 1WI0A 1B1ZA 2L52A 3APDA 4KZCA 3KVFB 3ML9A 1NDDA 3AV8A 2RDGA 2WP9B 4WURA 1WE6A 2FCMA 2KFKA 2KXJA 5JZEB 2EKIA 3RYTA 1HE8A 3ZUNA 2C60A 4R3DA 2J0MA 3A9JB 4MM3B 1NYQA 3RZWC 4MJSB 1TBEA 3Q69A 2WXLA 3VUYA 1V49A 4KVGB 3MC8A 5JXVA 1V97A 3H6NA 4L23A 1FO4A 1R4MB 4NNJB 2LD9A 4HRSA 4C00A 2ZEQA 1Z2MA 4WJNA 4GMVA 4C4VA 2WXFA 4N9F4 3JSVA 5D7GA 3N20C 3I5JC 4J6IA 3A33B 3VH3B 1C78A 2DZMA 4TV3A 4RNAA 2YLMA 2IO2B 1OEYA 2V1YA 2A5UA 1MI0A 1N62A 3KWVA 3MJWA 1HQRD 2KAJA 5GXGB 4US9A 2WXRA 2ZZPB 3A9KB 2C7HA 2LGDA 3QC8B 3SEBA 5J17A 3BWUD 4OZCA 3AEFB 1QOBA 1MHXA 4DXAB 1SEBD 2OHFA 2W82A 1WXMA 2LGXA 2KO3A 3OWEB 4KZ0A 2G45B 1E8XA 2MBBB 2QHOA 4IWOA 4MELA 1WXSA 2GBKA 1E7VA 2WDTB 2K5PA 1FM0D 3TEYA 1V1OA 1CK1A 4K7UA 1F52A 2FAZA 5EE1A 2QIEB 1TS5A 1BUIC 1N5XA 3TCAA 3LXFA 2FUHB 3ALBA 2BVCA 1ET6A 4OVUA 3ZKJC 1J7BA 3NOBA 4TMAB 1WIAA 4W9CA 2N9XA 3PSEB 3H8HA 3W9CB 3HRDD 4RGMA 4ZOHC 3I3TB 2A4ZA 3N1YC 3AE6B 1YJ1A 4B0EA 1TY0A 1JWBD 4K7SA 5MPOA 2L3ZA 5J2RA 4LTUA 3C8YA 1XO3A 1KFYB 4XE0A 3AE7B 2M17A 4MH8A 4LDTD 1KOTA 5IOIA 1ENFA 2KFKB 2LZ6A 1GJZA 1UZXB 3U7DA 4HPPA 3GE3C 2PTLA 2DWQA 3FILB 3JYUA 1YMHE 1NI3A 4AUQC 2D10A 2LVPA 3HVDA 3A1QA 3E56A 3MJ5A 2XNAC 2L0FA 2AL3A 4A9AA 2GOWA 3W5VB 2BPSA 1JCKB 3AEDB 1D6EC 1QLBB 4BKSD 2IGHA 1HTQA 4A8XC 4HROA 1PUTA 4WIPA 2IY1B 3U7ZA 1WGYA 4X57B 1R7SA 4J3OD 1P3QU 1EF1A 1G6JA 1EUVB 2EMTA 1GG3A 3VR8B 2LGYA 5AEKB 2ZNVB 2KJ6A 4JX1C 4BFRA 5EE3A 4RGTA 4M00A 2ASQA 4GDLA 5JHBA 2G9HD 1PGAA 3W1YA 1FEHA 1DOIA 4EE2A 2LFIA 2LI5A 5G55A 1ZKHA 3GP7A 2L32A 2KMCA 4OVVA 3VVWB 2NPTB 3W2DA 1F0ZA 2FIDA 5C23A 4YWGG 2KWUB 1J7AA 2LVOA 4WWOA 3PZ7A 1HTOA 3APFA 4YSXB 4USAA 3BYTB 1YD8U 1R4NI 5IA7A 4NAWB 3ZNHB 1UF0A 4B95A 2R61A 1RRBA 3L4PA 4AOFA 1TIFA 3DHGC 3AMZA 3ZNZB 2KVZA 1VJKA 2INCC 4XDDA 3GZNB 2K8CA 3IXSA 2WHIA 2WXGA 4DHJB 1BXTA 1LFDA 1JWUD 4S17A 1V1PA 1WGKA 4ZHOA 5TR5A 1WXAA 3M3JA 4YT0B 2V3NA 1SE3A 4TQ0A 5IKCM 2V3SA 2AWTA 2VZKB 4ZYSA 4W9LA 3GS2A 3CSFA 1N5WA 2FCSA 1WRDB 2BS2B 4AP4C 1IUEA 2RPVA 3AE4B 2RMMA 2G3QB 2N9KA 2YEPF 1JROA 3KUZA 4O1NA 3SFDB 4FXCA 4XWTA 1I7HA 4DDGD 3DBRI 4GB9A 2Z59B 2MH7A 4RFBA 5DCNA 3NZSA 1UGJA 1XT9B 3KYDD 2SEBD 1VZ7A 3RULA 3EUB2 3TMPB 4FADA 4FLHA 2NS5A 5D3DA 2LUMA 1DOXA 1EU3A 2LGSA 4DBGA 4K81A 3L0WB 3HIZA 3H1UA 4I6LB 4ICVA 4C7YA 3OJ4B 2LUEA 3PRZA 3DBSA 4AWJA 2CU3A 1RAXA 1F2RI 1GC7A 4EZKA 2I1JA 4MT5A 4HDQA 3DBLB 2WQYB 1VZ6A 4XGAB 4JWUC 2NBUA 4YSYB 3HHMA 5IN7A 1RWSA 2N9LA 4KKJA 2LHEA 1UH6A 4JIOU 4MEMA 2FBWB 1UNSA 4FJVB 5C2TB 1D5ZC 2UYZB 3TSSA 2K3UA 3AN1A 4HXDA 3I9V1 1J19A 4BOZB 1KRHA 4BVUC 2BQQA 4K3CA 2PVGC 1FNVA 4ANUA 2WX0A 3WALA 2JY6A 2G4DB 4WJOA 1Y8RC 1OGWA 4K7WA 3WIMA 4KGRA 1M94A 3Q3FA 2N7DA 4EZJA 1CQVA 2C5LC 3QAQA 3RNCC 1T3QA 1A70A 2KDIA 1ZXIA 4W9IA 1V80A 4BBNC 2KWCA 4I6NB 4GIVA 2PMVA 4ZRJA 2J0JA 2PPHA 1GPXA 4EZLA 1E0ZA 1KLGD 1SIJA 1WZ3A 4IG7B 2D2QA 3NY5A 3QK0A 2WDRB 2YVCA 3RN9C 1SBBB 1V1PB 2V4IB 1QQRA 4US8A 4PYUA 1HZ5A 4FHJA 1P7EA 4ZYNA 2Y5PA 4F8CB 3ZJVA 2M1MA 1MPEA 3NHEB 3RNGC 1EU4A 4ZRQA 2K0PA 5HKHA 1Q0WB 1T5XD 2W55A 2ACZB 3K9OB 1E7UA 1AWDA 2PLPA 2KDEB 1SF0A 2X38A 3RNBC 2M0XA 5G5GA 2N7JA 3ZRFA 3A4SC 1YN5A 1TYGB 1E6EB 2INPE 3BIID 3GB1A 1WXQA 1E9MA 4B6WA 2BWES 1UUPA 3DHHC 4ZDVA 1XCTL 4PS3A 3H7PB 1IYFA 1I4RA 2DBYA 4YL8A 2Y5BB 2O2VB 2VRRB 2J0KA 2HTME 4LLGM 1LGRA 2DYMA 2WU5B 2BW2A 2V0GA 1D5XC 2DZIA 4PK1A 3DPDA 3RNFC 3VFKA 4NJ6A 2H88B 3ONSA 3R3MA 1EWCA 5LLIA 4QAYA 4FBJB 3CIRB 2ZW1A 1TZOA 3O65B 2KNBA 4HJGE 4LNFA 2CHZA 1ZP0B 3CF6E 5E6NA 3RNEC 2JU6X 4XYCA 3A4RA 4W9KA 4ACFA 3OG5A 2J42A 3DCGA 1WMHB 2AX5A 3BY4B 3GZNI 4AQ7A 4YTPB 4L1BA 2MJEA 3VXWA 3UINB 2KD0A 1P0RA 3KQ4A 2GBNA 3BYYB 4AS1A 4PYZA 2MSED 3PV1A 4HK2A 3ZQ4A 3EA6A 2K9XA 1QOFA 3P1MA 1XLPA 2KT7A 3IAS1 3ZRCA 2HD5B 2RSUA 1MVKA 3PPAA 1TJEA 1RYJA 1EWYC 2KZRA 3LYYA 1QOGA 3ZNID 1BT0A 4L2YA 4JE3B 2D11A 4JLCA 4DWFA 5HHDG 3N1ZC 2RDHA 1J8CA 2L1AA 3PHXB 3DDCB 2PJHA 2WS3B 1YQ3B 2RD0A 2L00B 1LO5D 1FRDA 2RPQA 2WXIA 1WZ0A 3CWIA 4DK5A 2QC8A 2MX2A 2WGSA 2K1FA 1VDVA 3RT3B 1EO6A 3TBLD 1I4PA 1N61A 1C4PA 3NVYA 3PVLA 2KTRB 1XF5L 1QZEA 4RM8A 2I2YA 2CR5A 1VR9A 2KN5A 4KIKB 3N1XC 4WJQA 3R7RA 2N1VA 5AZGA 1P1AA 2MJDA 1D3ZA 1I35A 3M95A 2WYQA 3ETRA 1C4AA 1TS2A 3B9JA 4UDUC 2M0AA 4RCOA 2LXCA 4PS8A 4JPSA 3PO0A 2FUG1 1Q1OA 2D3BA 1J7CA 3AE8B 3IVFA 3DWMA 1WWTA 4JGHB 5AUIA 2L83A 4ZHPA 3KW5B 5IAAC 3P4SB 1YN4A 2IO3B 4KDLB 1L4DB 3BK2A 4WAAA 3ZVVA 3Q3NC 4P1BC 3IT4B 1K53A 2WXNA 2KJRA 2JPHA 1JRUA 2QJLA 2BS3B 4MGKE 2WDVB 3PGEA 1FD6A 1MG4A 2WXKA 2BKRB 1KH0A 1JWMD 5AZFA 4E71A 2ZVNA 1A5RA 2RDBC 2KQ7A 3S2AA 4HKQA 2MP2B 3DHIC 2WXMA 1WRIA 4BKSA 2M56B 2JZ3B 4PT5A 2INDC 4YTMB 5C1ZA 1IBXB 1XLNA 3NVZA 1KM7A 2KYWA 3TJPA 3H9DA 1TS4A 1GAQB 2NMQA 2IDYA 3AE2B 2VH2A 4GXBA 4MGIE 3EFUA 4C80A 2TSSA 2OEDA 3UIOB 2DYOA 2DYBA 2LRUA 4BAXA 1TKGA 3RCZA 1NVID 5D3IB 2BYTA 1IP9A 3Q6BA 5LXIB 2YEPB 3DBHB 2KWVB 1YN3A 2KDMA 4KV2A 1ZE3D 1WGGA 2GBRA 3AEBB 2N0SB 1CZPA 2KJHB 4OHJA 5HI1A 4EEWA 5DPTA 3BVGA 2JZPA 3ML8A 2HJ1A 3KWLA 1I4XA 3HM3A 4JQWC 3ZTDA 1ZPSA 4NPNA 1P7FA 4C4VB 3VTWA 3AE3B 3JSVB 3N9YC 1UBQA 2ON8A 3J9CA 4OVZA 5EE9A 2BKFA 4RGOS 2WX1A 2R2OA 4HWIB 4MACA 2MWSB 3NZ3A 4GSWA 2BB5A 3RPFC 2AEHA 1RM6C 1Q5WB 2MLBA 1X1MA 3EECA 2W54A 2BYEA 2WXJA 3U4EG 2ZJDA 3V62A 2JXXA 3RUIB 1ZDXA 2QILA 1K50A 1WJ6A 2JT4B 3LB8C 3NS8A 2PKOA 2J4XA 2WDQB 3WAMA 3L10B 5LXHA 4A55A 4WAFA 1WM3A 2RGFA 4HVBA 4EKUA 2DHZA 4AJYB 2E3TA 4A6QA 2BGFA 5I4DA 2V9HA 3UF8A 4MGYE 4DQOC 4M8MA 2ZVOA 3V6EB 2KDBA 4BBNF 5L95C 1PDXA 1F77A 1GB1A 2LJIA 4KGSA 1E10A 3AULA 2LWPA 2BS4B 2N9EB 1C4CA 1E90A 2J52A 4ARCA 2AYOB 2UU7A 3WAPA 4S0RA 2K39A 3D32A 2GLSA 2IO1B 1SJHD 1ISNA 3Q3OC 4WH4A 2X8XX 2KHWB 5FR3A 2LMCA 3BINA 2K6QA 1J0GA 3O13A 4XWWA 2WXOA 3C19A 3SD5A 5IP4D 3EC8A 1R4MI 1B9RA 2PW9A 3FKYA 4GLSC 5BYSA 1FXTB 1L5PA 3Q2AC 2JRIB 3P4PB 4II3B 3AE9B 2PVOD 3ZDMC 1HXYD 3MC9A 1OTRB 1VRAB 3WCQA 3A1QB 1IPGA 1FXIA 3W1SC 2BYVE 2CHWA 4W9HA 1TKEA 1NBFC 4IOIE 1PGBA 2OJRA 1D4BA 1VZ8A 4GDKA 3IG3A 2C9WB 3AU5A 3SHQA 4EOYA 4CO7A 2N4FA 2CU1A 2O6VA 3U2SC 4JWSC 1C1YB 2IZVB 2KTFA 5CHWA 3TEWA 4RH6A 1TT5B 4P7IA 3VHTC 2KMMA 2LEKA 1WR6E 4GU2A 1V5TA 3SU8X 4LJOB 5D94A 3K9PB 2K8BA 2GBJA 3RFZB 4OZBA 1Q10A 2XK5A 1WX7A 2D3AA 1L2NA 3LDZE 4LNNA 5T8IA 2Y3AA 2DAFA 1M4VA 4IW0A 1C76A 4GDLB 2W3SA 3B08A 4XDCA 2WLBA 4IWQA 3AEAB 3L16A 3Q8AA 2KX0A 1JALA 2MHJA 4HPMB 2QSDA 1EM7A 3HVZA 2K6DB 2CJOA 1FXAA 2OOBB 1F2RC 1OQRA 2PEAA 4H2AA 5CHFA 5E6JA 2JWZA 4DDID 1WGHA 2O6VD 3U8ZA 4MSMB 3JW0X 2MCNB 1OFFA 2H89B 4WWNA 4B9KA 1TKYA 1SXTA 1BMLC 2IJ0A 1WY8A 1GB4A 1T0SC 4EUTA 2L7RA 4M0WA 3PLVA 4A90A 1E8WA 2L05A 3QX1A 1AW7A 2CHXA 4N6EB 4F1SA 2MBHA 1JW9D 2EKEC 2WWZA 3U30A 1UELA 2N9PC 3L54A 3KUDB 3RI7C 2LVQA 1N60A 3DBHI 4LNIA 5KHOA 3VUXA 3R2TA 1WGDA 1JMLA 1OEYJ 4K3BA 4ITKA 4W9EA 3GE8C 4CQNA 3A9JA 4MM3A 2WXPA 4ICUA 2XBBC 4MJSA 5HFYA 3TUOA 3W1SA 2FIFA 4XX5A 4ANVA 3M63B 2BF8B 3ZJTA 4Q2JA 1T6BX 2JQRB 2QCZA 2KOXA 3ENEA 2BBCA 1ESFA 1XXGA 1P98A 3AH7A 2JXTA 2GB1A 3BZDB 1T0RC 4JL9A 3PZ8A 1I4HA 3B0AA 2L76A 3IAM1 1TGZB 1WXVA 3NVWA 4P16A 1AN8A 2GRIA 3OJ3A 3ZLZA 1MJDA 1L6VA 2HJ8A 2FCQA 1Z5SB 3SR6A 3VTUA 3QJZA 3NZUA 4KKIA 1ZXHA 2LASA 1K8RB 4P6VF 2JVCA 4GOCA 3NS1A 3PREA 3A9KA 2JWUA 1YX5B 4HCPB 1WFYA 1GUAB 3KH0A 4ZRKA 2LHDA 4ASWC 4N58A 2SAKA 3Q3JA 1T0QC 4ANWA 3AE1B 1UWXA 2ZNVC 1V86A 3URYA 2KDFB 4HEA1 1EF5A 1WH3A 1K51A 2V3PA 1JWSD 4MH0E 3DQVA 1V81A 4HDOA 1P9DU 1SIFA 3AI5A 4PS7A 4C56C 3FC4A 4KX6B 3M62B 1SB3C 4RF1A 2IYDB 1ZW7A 2IPKD 3DVGY 1F1HA 4IM2A 2NVUI 1L0VB 2ZW0A 1SE2A 3LJ3A 2D5GA 1FFVA 3FAHA 2JYEA 4RM9A 4E3CA 3P63A 3QA8A 4HPLB 2KLGA 1XLQA 1I4QA 3QHTA 2MEKA 4TUUA 1C79A 2LJ5A 1XCQL 3V60A 1R4NB 2DENB 1U4AA 3AU4A 1RFAA 2Z0DB 4LJPB 3P2BA 2REXA 1PYWD 1XLOA 3RZFA 3TEXA 2I38A 1MG8A 2KQSA 3I57A 3ZNGC 3PLUA 4M01A 1NENB 3W5UB 4OW0A 1FCLA 3HM6X 3PHWB 3QWZB 3NVVA 1GNUA 2N1WA 4FULA 3ZDTA 1OQYA 3DVNU 1PGXA 4FJYA 3UIPB 3IFWB 1SGHA 3UI3A 1YJJA 4ARIA 3FILA 1VD2A 1WF9A 4CYEA 5G5HA 3NG0A 1XQQA 2JF5A 1QILA 3V3XA 3V6CB 1V9JA 3QIJA 2DZKA 2Q5WD 2LGIA 1XD3B 2M19A 2V4LA 4C7ZA 2DAJA 2JX5A 4DXFA 1WJ4A 3VAWA 4URKA 4AJWA 2DZJA 5GMVA 2D3GA 2MBEA 3R2IA 4LNOA 1WYWB 2BB6A 2NBWB 3ZJUA 4A3PA 3DBRB 5D6JB 3WANA 2G1EA 4ZRIA 3UQAA 1L0XB 3NUHB 3DBLI 3DOWA 4NAMA 3I63C 3ZXVA 5H8YE 2HDEA 2WXHA 2Z8LA 2PE9A 3IHPC 3VDZA 1QOAA 1S1QB 4GN1A 1KTKA 4IKGA 1WM2A 1K52A 4YXDB 2VH1A 1N63A 1UGMA 3QQ8B 1FCCC 2KANA 3BVMA 1L7YA 4MDKE 2DLBA 2NPTA 3L08A 2M4NA 3Q3MC 1N6ZA 4IM3A 2J53A 1FFUA 1I42A 3ZGZA 3T8MA 2QMTA 1ZUD2 4NAWA 2CS4A 1MFWA 3R8BA 1NI2A 4P1CC 1DYQA 5BMHA 5FK9C 1YX6B 4MGZE 1LXDA 2ZPYA 3CSTA 3PZDA 1NEKB 5JHAA 1MHHE 3MHZA 1V6EA 2DX5B 2WNMA 4BZAA 1STEA 3VRBB 4G3XB 3QCAA 1WE7A 2C7NB 3AM9A 4OZAA 4LCDE 2KFJA 2AL6A 3C0RB 2WXQA 4KGTA 2Y5CA 3P4QB 1FNWA 3GOEA 2K8HA 1I4GA 3APCA 2IY0B 3WA0A 2JSVX 5L83A 1VCBA 1KLUD 3BVZA 2KC2A 2C7MB 4WWPA 3UGBB 1UWMA 2NTTA 5CTRC 4II2B 3ZTCA 2XN9C 5E6PA 2HE7A 4NZLB 1H8CA 3L17A 3R7QA 5BO4B 1YNTE 1FPYA 5BYQA 2MRPA 2EELA 1SJED 1ZGUB 4B0MA 3T9LA 1JRPA 2IBIB 4DHJD 1PFDA 2B3AA 3OLMD 4A20A 2GMIC 2QDFA 2PIAA 4XC2A 2J7QB 2VZKD 3DWGC 3V05A 2K25A 3KYCD 1KF6B 4TKNA 1WGRA 3TIXA 3MTNB 4XZ4A 1RFKA 4ZRPA 2PE6B 4FHKA 5CHVC 1IGDA 1PQSA 2R2QA 2KC1A 3E9SA 3T3NA 1DOYA 5AUKA 3R66C 4IWPA 3BK1A 2KKCA 2MQJA 3VTVA 1TS3A 2WU2B 1UBIA 1V8CA 1IGCA 2JYTA 1ET9A
chains in the Genus database with same CATH topology
1T0QC 3RI7C 1T0SC 2RDBC 3DHIC 3RNGC 3Q14C 1T0RC 3GE8C 3Q3NC 3N20C 3DHGC 3Q2AC 3RNEC 3I5JC 4P1BC 3DHHC 3I63C 3Q3OC 2INCC 3RMKC 4P1CC 3RNFC 3RN9C 3N1ZC 3GE3C 3RNAC 3N1YC 2INDC 3RNCC 3N1XC 3RNBC 3Q3MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0Q C;  3RI7 C;  1T0S C;  2RDB C;  3DHI C;  3RNG C;  3Q14 C;  1T0R C;  3GE8 C;  3Q3N C;  3N20 C;  3DHG C;  3Q2A C;  3RNE C;  3I5J C;  4P1B C;  3DHH C;  3I63 C;  3Q3O C;  2INC C;  3RMK C;  4P1C C;  3RNF C;  3RN9 C;  3N1Z C;  3GE3 C;  3RNA C;  3N1Y C;  2IND C;  3RNC C;  3N1X C;  3RNB C;  3Q3M C; 
#chains in the Genus database with same CATH topology
 2ZPN A;  4LDT B;  4I6P A;  2NBV B;  4IUM B;  1TZ1 A;  2NTS A;  1L4Z B;  1YIW A;  4HLE A;  3RMK C;  2RR9 A;  2JRH A;  1F9J A;  4FA6 A;  3KLS X;  2JUO A;  2NR2 A;  1GOZ A;  4DHZ E;  3OAW A;  1SSN A;  2KAC A;  1TTN A;  2LXA A;  4N59 A;  4G0N B;  4IDI A;  4K1R B;  3PRM B;  4G50 A;  3VR9 B;  3H7S A;  3DVN V;  3CMM B;  2JZZ A;  2CJN A;  4NJC A;  2INN E;  1AAR A;  2KLC A;  1KJT A;  2EMS A;  3HK0 A;  2AQ2 B;  2MJ3 A;  1AYF A;  2AQ1 B;  2HTH A;  1SE9 A;  2BT6 A;  4F7Z A;  1KLV A;  1V2Y A;  4EFO A;  3N32 A;  1FMA D;  3EHV A;  2KMA A;  3X23 A;  2IO0 B;  1CMX B;  2UWQ A;  3DVG X;  1ZOY B;  4MSQ B;  3VRA B;  1GC6 A;  4HCN B;  3VUW A;  4REZ A;  4KSK C;  2IGG A;  3MC0 B;  3PRP B;  4BKG A;  1E5W A;  3ABV B;  2B76 B;  3TEZ A;  4HJK A;  2KN4 A;  2ICI A;  4W9J A;  1ROE A;  4RGN A;  4NJ7 A;  1WJU A;  1WX9 A;  1JQ4 A;  3VQI A;  1ACC A;  3ZXR A;  3AE5 B;  3N3K B;  4KDI C;  3RNA C;  3AB5 A;  5D2M B;  5LNK 1;  3H7P A;  3PTF C;  4IC7 B;  4DHZ B;  3ZW3 A;  3P42 A;  3SDL C;  3AEC B;  3B2F A;  2O2V A;  2W3R A;  5FKA C;  4DXG A;  2MW5 A;  2KK8 A;  3SFE B;  2K22 A;  4ANX A;  1C77 A;  4WQM A;  3ZYY X;  4KSL C;  1T0Y A;  1FNU A;  1YQB A;  3QAR A;  1FRR A;  2D07 B;  4RMA A;  1YJI A;  4TSS A;  1WX8 A;  3L13 A;  1HA5 A;  1YQ4 B;  3HUI A;  1WJN A;  2E6X A;  4HKZ E;  1WSP A;  3UQB A;  1FIQ A;  4NY0 A;  2I1K A;  3IT6 B;  3NRZ A;  5G2N A;  1E8Y A;  5JH5 C;  5TSS A;  2XEW A;  1V5O A;  1WMH A;  2NCN A;  3Q8B A;  2BTE A;  3U52 E;  1NYR A;  3TL5 A;  3Q8F A;  5DPR A;  3ZIM A;  1L0Y B;  1HEZ E;  2M8S A;  1C3T A;  5BMG A;  5DPW A;  5J18 A;  5H92 C;  3V61 A;  3ECI A;  4G11 A;  2GBM A;  3X0W A;  1H4R A;  1L6U A;  1SE4 A;  4LNK A;  4M8N A;  1QKZ A;  2MBO A;  1VLB A;  4FN2 A;  4W9F A;  2BYF A;  4W9D A;  2ZCC A;  4E74 A;  2L0T A;  3PT2 B;  1YOV B;  2FNJ B;  1S3S G;  3EGR A;  2GI9 A;  2Z0E B;  1C9F A;  4W9G A;  3AEE B;  4WQO B;  2KQ4 X;  2QEJ C;  3IBE A;  3VH4 B;  4BKT A;  1LQB A;  3AEG B;  2IGD A;  3Q14 C;  4NQK E;  3JVZ X;  5BMI A;  4CHK A;  5IO9 A;  1QF6 A;  4TQ1 A;  2KTR A;  5EDS A;  3AXC A;  2ZCB A;  3B1L X;  1XEE A;  1ZDV A;  4GDK B;  4KIK A;  2MA9 B;  4WWM A;  2O6V B;  5EE0 A;  5BYR A;  5HG2 A;  2L8J A;  4WJP A;  4GGQ A;  1QT9 A;  4NQL B;  1TY2 A;  3RD2 A;  4M02 A;  2KWD A;  4BOS C;  4D2K A;  5FR6 A;  2MBQ A;  2FCN A;  3KUC B;  1LM8 B;  4YTN B;  5C3J B;  3T3O A;  5DPS A;  2KVR A;  1RLF A;  2XK5 B;  2ONQ A;  5KHQ A;  1UD7 A;  3ZO5 B;  4IM0 A;  2CKH B;  2N7E A;  4FJZ A;  1WR1 A;  4LK0 M;  2W9N A;  1WYG A;  3EFC A;  3Q8E A;  2FE8 A;  3NJT A;  3MP9 A;  5AZH A;  2AQ3 B;  2DNF A;  3PS6 A;  5CX3 A;  1JWA D;  2LRW A;  1Y56 A;  2MP2 A;  3MHS D;  2KX3 A;  2G4S A;  1CJE A;  5E6O A;  3P4R B;  3Q8C A;  2OJW A;  1OQQ A;  3N30 A;  4A3O A;  4YSZ B;  1E8Z A;  1DGJ A;  4M0W B;  2BWF A;  3MFG A;  1IBX A;  1E7P B;  4RF0 A;  3WAO A;  1HZ6 A;  1D5M C;  2D3C A;  3B2G A;  1WI0 A;  1B1Z A;  2L52 A;  3APD A;  4KZC A;  3KVF B;  3ML9 A;  1NDD A;  3AV8 A;  2RDG A;  2WP9 B;  4WUR A;  1WE6 A;  2FCM A;  2KFK A;  2KXJ A;  5JZE B;  2EKI A;  3RYT A;  1HE8 A;  3ZUN A;  2C60 A;  4R3D A;  2J0M A;  3A9J B;  4MM3 B;  1NYQ A;  3RZW C;  4MJS B;  1TBE A;  3Q69 A;  2WXL A;  3VUY A;  1V49 A;  4KVG B;  3MC8 A;  5JXV A;  1V97 A;  3H6N A;  4L23 A;  1FO4 A;  1R4M B;  4NNJ B;  2LD9 A;  4HRS A;  4C00 A;  2ZEQ A;  1Z2M A;  4WJN A;  4GMV A;  4C4V A;  2WXF A;  4N9F 4;  3JSV A;  5D7G A;  3N20 C;  3I5J C;  4J6I A;  3A33 B;  3VH3 B;  1C78 A;  2DZM A;  4TV3 A;  4RNA A;  2YLM A;  2IO2 B;  1OEY A;  2V1Y A;  2A5U A;  1MI0 A;  1N62 A;  3KWV A;  3MJW A;  1HQR D;  2KAJ A;  5GXG B;  4US9 A;  2WXR A;  2ZZP B;  3A9K B;  2C7H A;  2LGD A;  3QC8 B;  3SEB A;  5J17 A;  3BWU D;  4OZC A;  3AEF B;  1QOB A;  1MHX A;  4DXA B;  1SEB D;  2OHF A;  2W82 A;  1WXM A;  2LGX A;  2KO3 A;  3OWE B;  4KZ0 A;  2G45 B;  1E8X A;  2MBB B;  2QHO A;  4IWO A;  4MEL A;  1WXS A;  2GBK A;  1E7V A;  2WDT B;  2K5P A;  1FM0 D;  3TEY A;  1V1O A;  1CK1 A;  4K7U A;  1F52 A;  2FAZ A;  5EE1 A;  2QIE B;  1TS5 A;  1BUI C;  1N5X A;  3TCA A;  3LXF A;  2FUH B;  3ALB A;  2BVC A;  1ET6 A;  4OVU A;  3ZKJ C;  1J7B A;  3NOB A;  4TMA B;  1WIA A;  4W9C A;  2N9X A;  3PSE B;  3H8H A;  3W9C B;  3HRD D;  4RGM A;  4ZOH C;  3I3T B;  2A4Z A;  3N1Y C;  3AE6 B;  1YJ1 A;  4B0E A;  1TY0 A;  1JWB D;  4K7S A;  5MPO A;  2L3Z A;  5J2R A;  4LTU A;  3C8Y A;  1XO3 A;  1KFY B;  4XE0 A;  3AE7 B;  2M17 A;  4MH8 A;  4LDT D;  1KOT A;  5IOI A;  1ENF A;  2KFK B;  2LZ6 A;  1GJZ A;  1UZX B;  3U7D A;  4HPP A;  3GE3 C;  2PTL A;  2DWQ A;  3FIL B;  3JYU A;  1YMH E;  1NI3 A;  4AUQ C;  2D10 A;  2LVP A;  3HVD A;  3A1Q A;  3E56 A;  3MJ5 A;  2XNA C;  2L0F A;  2AL3 A;  4A9A A;  2GOW A;  3W5V B;  2BPS A;  1JCK B;  3AED B;  1D6E C;  1QLB B;  4BKS D;  2IGH A;  1HTQ A;  4A8X C;  4HRO A;  1PUT A;  4WIP A;  2IY1 B;  3U7Z A;  1WGY A;  4X57 B;  1R7S A;  4J3O D;  1P3Q U;  1EF1 A;  1G6J A;  1EUV B;  2EMT A;  1GG3 A;  3VR8 B;  2LGY A;  5AEK B;  2ZNV B;  2KJ6 A;  4JX1 C;  4BFR A;  5EE3 A;  4RGT A;  4M00 A;  2ASQ A;  4GDL A;  5JHB A;  2G9H D;  1PGA A;  3W1Y A;  1FEH A;  1DOI A;  4EE2 A;  2LFI A;  2LI5 A;  5G55 A;  1ZKH A;  3GP7 A;  2L32 A;  2KMC A;  4OVV A;  3VVW B;  2NPT B;  3W2D A;  1F0Z A;  2FID A;  5C23 A;  4YWG G;  2KWU B;  1J7A A;  2LVO A;  4WWO A;  3PZ7 A;  1HTO A;  3APF A;  4YSX B;  4USA A;  3BYT B;  1YD8 U;  1R4N I;  5IA7 A;  4NAW B;  3ZNH B;  1UF0 A;  4B95 A;  2R61 A;  1RRB A;  3L4P A;  4AOF A;  1TIF A;  3DHG C;  3AMZ A;  3ZNZ B;  2KVZ A;  1VJK A;  2INC C;  4XDD A;  3GZN B;  2K8C A;  3IXS A;  2WHI A;  2WXG A;  4DHJ B;  1BXT A;  1LFD A;  1JWU D;  4S17 A;  1V1P A;  1WGK A;  4ZHO A;  5TR5 A;  1WXA A;  3M3J A;  4YT0 B;  2V3N A;  1SE3 A;  4TQ0 A;  5IKC M;  2V3S A;  2AWT A;  2VZK B;  4ZYS A;  4W9L A;  3GS2 A;  3CSF A;  1N5W A;  2FCS A;  1WRD B;  2BS2 B;  4AP4 C;  1IUE A;  2RPV A;  3AE4 B;  2RMM A;  2G3Q B;  2N9K A;  2YEP F;  1JRO A;  3KUZ A;  4O1N A;  3SFD B;  4FXC A;  4XWT A;  1I7H A;  4DDG D;  3DBR I;  4GB9 A;  2Z59 B;  2MH7 A;  4RFB A;  5DCN A;  3NZS A;  1UGJ A;  1XT9 B;  3KYD D;  2SEB D;  1VZ7 A;  3RUL A;  3EUB 2;  3TMP B;  4FAD A;  4FLH A;  2NS5 A;  5D3D A;  2LUM A;  1DOX A;  1EU3 A;  2LGS A;  4DBG A;  4K81 A;  3L0W B;  3HIZ A;  3H1U A;  4I6L B;  4ICV A;  4C7Y A;  3OJ4 B;  2LUE A;  3PRZ A;  3DBS A;  4AWJ A;  2CU3 A;  1RAX A;  1F2R I;  1GC7 A;  4EZK A;  2I1J A;  4MT5 A;  4HDQ A;  3DBL B;  2WQY B;  1VZ6 A;  4XGA B;  4JWU C;  2NBU A;  4YSY B;  3HHM A;  5IN7 A;  1RWS A;  2N9L A;  4KKJ A;  2LHE A;  1UH6 A;  4JIO U;  4MEM A;  2FBW B;  1UNS A;  4FJV B;  5C2T B;  1D5Z C;  2UYZ B;  3TSS A;  2K3U A;  3AN1 A;  4HXD A;  3I9V 1;  1J19 A;  4BOZ B;  1KRH A;  4BVU C;  2BQQ A;  4K3C A;  2PVG C;  1FNV A;  4ANU A;  2WX0 A;  3WAL A;  2JY6 A;  2G4D B;  4WJO A;  1Y8R C;  1OGW A;  4K7W A;  3WIM A;  4KGR A;  1M94 A;  3Q3F A;  2N7D A;  4EZJ A;  1CQV A;  2C5L C;  3QAQ A;  3RNC C;  1T3Q A;  1A70 A;  2KDI A;  1ZXI A;  4W9I A;  1V80 A;  4BBN C;  2KWC A;  4I6N B;  4GIV A;  2PMV A;  4ZRJ A;  2J0J A;  2PPH A;  1GPX A;  4EZL A;  1E0Z A;  1KLG D;  1SIJ A;  1WZ3 A;  4IG7 B;  2D2Q A;  3NY5 A;  3QK0 A;  2WDR B;  2YVC A;  3RN9 C;  1SBB B;  1V1P B;  2V4I B;  1QQR A;  4US8 A;  4PYU A;  1HZ5 A;  4FHJ A;  1P7E A;  4ZYN A;  2Y5P A;  4F8C B;  3ZJV A;  2M1M A;  1MPE A;  3NHE B;  3RNG C;  1EU4 A;  4ZRQ A;  2K0P A;  5HKH A;  1Q0W B;  1T5X D;  2W55 A;  2ACZ B;  3K9O B;  1E7U A;  1AWD A;  2PLP A;  2KDE B;  1SF0 A;  2X38 A;  3RNB C;  2M0X A;  5G5G A;  2N7J A;  3ZRF A;  3A4S C;  1YN5 A;  1TYG B;  1E6E B;  2INP E;  3BII D;  3GB1 A;  1WXQ A;  1E9M A;  4B6W A;  2BWE S;  1UUP A;  3DHH C;  4ZDV A;  1XCT L;  4PS3 A;  3H7P B;  1IYF A;  1I4R A;  2DBY A;  4YL8 A;  2Y5B B;  2O2V B;  2VRR B;  2J0K A;  2HTM E;  4LLG M;  1LGR A;  2DYM A;  2WU5 B;  2BW2 A;  2V0G A;  1D5X C;  2DZI A;  4PK1 A;  3DPD A;  3RNF C;  3VFK A;  4NJ6 A;  2H88 B;  3ONS A;  3R3M A;  1EWC A;  5LLI A;  4QAY A;  4FBJ B;  3CIR B;  2ZW1 A;  1TZO A;  3O65 B;  2KNB A;  4HJG E;  4LNF A;  2CHZ A;  1ZP0 B;  3CF6 E;  5E6N A;  3RNE C;  2JU6 X;  4XYC A;  3A4R A;  4W9K A;  4ACF A;  3OG5 A;  2J42 A;  3DCG A;  1WMH B;  2AX5 A;  3BY4 B;  3GZN I;  4AQ7 A;  4YTP B;  4L1B A;  2MJE A;  3VXW A;  3UIN B;  2KD0 A;  1P0R A;  3KQ4 A;  2GBN A;  3BYY B;  4AS1 A;  4PYZ A;  2MSE D;  3PV1 A;  4HK2 A;  3ZQ4 A;  3EA6 A;  2K9X A;  1QOF A;  3P1M A;  1XLP A;  2KT7 A;  3IAS 1;  3ZRC A;  2HD5 B;  2RSU A;  1MVK A;  3PPA A;  1TJE A;  1RYJ A;  1EWY C;  2KZR A;  3LYY A;  1QOG A;  3ZNI D;  1BT0 A;  4L2Y A;  4JE3 B;  2D11 A;  4JLC A;  4DWF A;  5HHD G;  3N1Z C;  2RDH A;  1J8C A;  2L1A A;  3PHX B;  3DDC B;  2PJH A;  2WS3 B;  1YQ3 B;  2RD0 A;  2L00 B;  1LO5 D;  1FRD A;  2RPQ A;  2WXI A;  1WZ0 A;  3CWI A;  4DK5 A;  2QC8 A;  2MX2 A;  2WGS A;  2K1F A;  1VDV A;  3RT3 B;  1EO6 A;  3TBL D;  1I4P A;  1N61 A;  1C4P A;  3NVY A;  3PVL A;  2KTR B;  1XF5 L;  1QZE A;  4RM8 A;  2I2Y A;  2CR5 A;  1VR9 A;  2KN5 A;  4KIK B;  3N1X C;  4WJQ A;  3R7R A;  2N1V A;  5AZG A;  1P1A A;  2MJD A;  1D3Z A;  1I35 A;  3M95 A;  2WYQ A;  3ETR A;  1C4A A;  1TS2 A;  3B9J A;  4UDU C;  2M0A A;  4RCO A;  2LXC A;  4PS8 A;  4JPS A;  3PO0 A;  2FUG 1;  1Q1O A;  2D3B A;  1J7C A;  3AE8 B;  3IVF A;  3DWM A;  1WWT A;  4JGH B;  5AUI A;  2L83 A;  4ZHP A;  3KW5 B;  5IAA C;  3P4S B;  1YN4 A;  2IO3 B;  4KDL B;  1L4D B;  3BK2 A;  4WAA A;  3ZVV A;  3Q3N C;  4P1B C;  3IT4 B;  1K53 A;  2WXN A;  2KJR A;  2JPH A;  1JRU A;  2QJL A;  2BS3 B;  4MGK E;  2WDV B;  3PGE A;  1FD6 A;  1MG4 A;  2WXK A;  2BKR B;  1KH0 A;  1JWM D;  5AZF A;  4E71 A;  2ZVN A;  1A5R A;  2RDB C;  2KQ7 A;  3S2A A;  4HKQ A;  2MP2 B;  3DHI C;  2WXM A;  1WRI A;  4BKS A;  2M56 B;  2JZ3 B;  4PT5 A;  2IND C;  4YTM B;  5C1Z A;  1IBX B;  1XLN A;  3NVZ A;  1KM7 A;  2KYW A;  3TJP A;  3H9D A;  1TS4 A;  1GAQ B;  2NMQ A;  2IDY A;  3AE2 B;  2VH2 A;  4GXB A;  4MGI E;  3EFU A;  4C80 A;  2TSS A;  2OED A;  3UIO B;  2DYO A;  2DYB A;  2LRU A;  4BAX A;  1TKG A;  3RCZ A;  1NVI D;  5D3I B;  2BYT A;  1IP9 A;  3Q6B A;  5LXI B;  2YEP B;  3DBH B;  2KWV B;  1YN3 A;  2KDM A;  4KV2 A;  1ZE3 D;  1WGG A;  2GBR A;  3AEB B;  2N0S B;  1CZP A;  2KJH B;  4OHJ A;  5HI1 A;  4EEW A;  5DPT A;  3BVG A;  2JZP A;  3ML8 A;  2HJ1 A;  3KWL A;  1I4X A;  3HM3 A;  4JQW C;  3ZTD A;  1ZPS A;  4NPN A;  1P7F A;  4C4V B;  3VTW A;  3AE3 B;  3JSV B;  3N9Y C;  1UBQ A;  2ON8 A;  3J9C A;  4OVZ A;  5EE9 A;  2BKF A;  4RGO S;  2WX1 A;  2R2O A;  4HWI B;  4MAC A;  2MWS B;  3NZ3 A;  4GSW A;  2BB5 A;  3RPF C;  2AEH A;  1RM6 C;  1Q5W B;  2MLB A;  1X1M A;  3EEC A;  2W54 A;  2BYE A;  2WXJ A;  3U4E G;  2ZJD A;  3V62 A;  2JXX A;  3RUI B;  1ZDX A;  2QIL A;  1K50 A;  1WJ6 A;  2JT4 B;  3LB8 C;  3NS8 A;  2PKO A;  2J4X A;  2WDQ B;  3WAM A;  3L10 B;  5LXH A;  4A55 A;  4WAF A;  1WM3 A;  2RGF A;  4HVB A;  4EKU A;  2DHZ A;  4AJY B;  2E3T A;  4A6Q A;  2BGF A;  5I4D A;  2V9H A;  3UF8 A;  4MGY E;  4DQO C;  4M8M A;  2ZVO A;  3V6E B;  2KDB A;  4BBN F;  5L95 C;  1PDX A;  1F77 A;  1GB1 A;  2LJI A;  4KGS A;  1E10 A;  3AUL A;  2LWP A;  2BS4 B;  2N9E B;  1C4C A;  1E90 A;  2J52 A;  4ARC A;  2AYO B;  2UU7 A;  3WAP A;  4S0R A;  2K39 A;  3D32 A;  2GLS A;  2IO1 B;  1SJH D;  1ISN A;  3Q3O C;  4WH4 A;  2X8X X;  2KHW B;  5FR3 A;  2LMC A;  3BIN A;  2K6Q A;  1J0G A;  3O13 A;  4XWW A;  2WXO A;  3C19 A;  3SD5 A;  5IP4 D;  3EC8 A;  1R4M I;  1B9R A;  2PW9 A;  3FKY A;  4GLS C;  5BYS A;  1FXT B;  1L5P A;  3Q2A C;  2JRI B;  3P4P B;  4II3 B;  3AE9 B;  2PVO D;  3ZDM C;  1HXY D;  3MC9 A;  1OTR B;  1VRA B;  3WCQ A;  3A1Q B;  1IPG A;  1FXI A;  3W1S C;  2BYV E;  2CHW A;  4W9H A;  1TKE A;  1NBF C;  4IOI E;  1PGB A;  2OJR A;  1D4B A;  1VZ8 A;  4GDK A;  3IG3 A;  2C9W B;  3AU5 A;  3SHQ A;  4EOY A;  4CO7 A;  2N4F A;  2CU1 A;  2O6V A;  3U2S C;  4JWS C;  1C1Y B;  2IZV B;  2KTF A;  5CHW A;  3TEW A;  4RH6 A;  1TT5 B;  4P7I A;  3VHT C;  2KMM A;  2LEK A;  1WR6 E;  4GU2 A;  1V5T A;  3SU8 X;  4LJO B;  5D94 A;  3K9P B;  2K8B A;  2GBJ A;  3RFZ B;  4OZB A;  1Q10 A;  2XK5 A;  1WX7 A;  2D3A A;  1L2N A;  3LDZ E;  4LNN A;  5T8I A;  2Y3A A;  2DAF A;  1M4V A;  4IW0 A;  1C76 A;  4GDL B;  2W3S A;  3B08 A;  4XDC A;  2WLB A;  4IWQ A;  3AEA B;  3L16 A;  3Q8A A;  2KX0 A;  1JAL A;  2MHJ A;  4HPM B;  2QSD A;  1EM7 A;  3HVZ A;  2K6D B;  2CJO A;  1FXA A;  2OOB B;  1F2R C;  1OQR A;  2PEA A;  4H2A A;  5CHF A;  5E6J A;  2JWZ A;  4DDI D;  1WGH A;  2O6V D;  3U8Z A;  4MSM B;  3JW0 X;  2MCN B;  1OFF A;  2H89 B;  4WWN A;  4B9K A;  1TKY A;  1SXT A;  1BML C;  2IJ0 A;  1WY8 A;  1GB4 A;  1T0S C;  4EUT A;  2L7R A;  4M0W A;  3PLV A;  4A90 A;  1E8W A;  2L05 A;  3QX1 A;  1AW7 A;  2CHX A;  4N6E B;  4F1S A;  2MBH A;  1JW9 D;  2EKE C;  2WWZ A;  3U30 A;  1UEL A;  2N9P C;  3L54 A;  3KUD B;  3RI7 C;  2LVQ A;  1N60 A;  3DBH I;  4LNI A;  5KHO A;  3VUX A;  3R2T A;  1WGD A;  1JML A;  1OEY J;  4K3B A;  4ITK A;  4W9E A;  3GE8 C;  4CQN A;  3A9J A;  4MM3 A;  2WXP A;  4ICU A;  2XBB C;  4MJS A;  5HFY A;  3TUO A;  3W1S A;  2FIF A;  4XX5 A;  4ANV A;  3M63 B;  2BF8 B;  3ZJT A;  4Q2J A;  1T6B X;  2JQR B;  2QCZ A;  2KOX A;  3ENE A;  2BBC A;  1ESF A;  1XXG A;  1P98 A;  3AH7 A;  2JXT A;  2GB1 A;  3BZD B;  1T0R C;  4JL9 A;  3PZ8 A;  1I4H A;  3B0A A;  2L76 A;  3IAM 1;  1TGZ B;  1WXV A;  3NVW A;  4P16 A;  1AN8 A;  2GRI A;  3OJ3 A;  3ZLZ A;  1MJD A;  1L6V A;  2HJ8 A;  2FCQ A;  1Z5S B;  3SR6 A;  3VTU A;  3QJZ A;  3NZU A;  4KKI A;  1ZXH A;  2LAS A;  1K8R B;  4P6V F;  2JVC A;  4GOC A;  3NS1 A;  3PRE A;  3A9K A;  2JWU A;  1YX5 B;  4HCP B;  1WFY A;  1GUA B;  3KH0 A;  4ZRK A;  2LHD A;  4ASW C;  4N58 A;  2SAK A;  3Q3J A;  1T0Q C;  4ANW A;  3AE1 B;  1UWX A;  2ZNV C;  1V86 A;  3URY A;  2KDF B;  4HEA 1;  1EF5 A;  1WH3 A;  1K51 A;  2V3P A;  1JWS D;  4MH0 E;  3DQV A;  1V81 A;  4HDO A;  1P9D U;  1SIF A;  3AI5 A;  4PS7 A;  4C56 C;  3FC4 A;  4KX6 B;  3M62 B;  1SB3 C;  4RF1 A;  2IYD B;  1ZW7 A;  2IPK D;  3DVG Y;  1F1H A;  4IM2 A;  2NVU I;  1L0V B;  2ZW0 A;  1SE2 A;  3LJ3 A;  2D5G A;  1FFV A;  3FAH A;  2JYE A;  4RM9 A;  4E3C A;  3P63 A;  3QA8 A;  4HPL B;  2KLG A;  1XLQ A;  1I4Q A;  3QHT A;  2MEK A;  4TUU A;  1C79 A;  2LJ5 A;  1XCQ L;  3V60 A;  1R4N B;  2DEN B;  1U4A A;  3AU4 A;  1RFA A;  2Z0D B;  4LJP B;  3P2B A;  2REX A;  1PYW D;  1XLO A;  3RZF A;  3TEX A;  2I38 A;  1MG8 A;  2KQS A;  3I57 A;  3ZNG C;  3PLU A;  4M01 A;  1NEN B;  3W5U B;  4OW0 A;  1FCL A;  3HM6 X;  3PHW B;  3QWZ B;  3NVV A;  1GNU A;  2N1W A;  4FUL A;  3ZDT A;  1OQY A;  3DVN U;  1PGX A;  4FJY A;  3UIP B;  3IFW B;  1SGH A;  3UI3 A;  1YJJ A;  4ARI A;  3FIL A;  1VD2 A;  1WF9 A;  4CYE A;  5G5H A;  3NG0 A;  1XQQ A;  2JF5 A;  1QIL A;  3V3X A;  3V6C B;  1V9J A;  3QIJ A;  2DZK A;  2Q5W D;  2LGI A;  1XD3 B;  2M19 A;  2V4L A;  4C7Z A;  2DAJ A;  2JX5 A;  4DXF A;  1WJ4 A;  3VAW A;  4URK A;  4AJW A;  2DZJ A;  5GMV A;  2D3G A;  2MBE A;  3R2I A;  4LNO A;  1WYW B;  2BB6 A;  2NBW B;  3ZJU A;  4A3P A;  3DBR B;  5D6J B;  3WAN A;  2G1E A;  4ZRI A;  3UQA A;  1L0X B;  3NUH B;  3DBL I;  3DOW A;  4NAM A;  3I63 C;  3ZXV A;  5H8Y E;  2HDE A;  2WXH A;  2Z8L A;  2PE9 A;  3IHP C;  3VDZ A;  1QOA A;  1S1Q B;  4GN1 A;  1KTK A;  4IKG A;  1WM2 A;  1K52 A;  4YXD B;  2VH1 A;  1N63 A;  1UGM A;  3QQ8 B;  1FCC C;  2KAN A;  3BVM A;  1L7Y A;  4MDK E;  2DLB A;  2NPT A;  3L08 A;  2M4N A;  3Q3M C;  1N6Z A;  4IM3 A;  2J53 A;  1FFU A;  1I42 A;  3ZGZ A;  3T8M A;  2QMT A;  1ZUD 2;  4NAW A;  2CS4 A;  1MFW A;  3R8B A;  1NI2 A;  4P1C C;  1DYQ A;  5BMH A;  5FK9 C;  1YX6 B;  4MGZ E;  1LXD A;  2ZPY A;  3CST A;  3PZD A;  1NEK B;  5JHA A;  1MHH E;  3MHZ A;  1V6E A;  2DX5 B;  2WNM A;  4BZA A;  1STE A;  3VRB B;  4G3X B;  3QCA A;  1WE7 A;  2C7N B;  3AM9 A;  4OZA A;  4LCD E;  2KFJ A;  2AL6 A;  3C0R B;  2WXQ A;  4KGT A;  2Y5C A;  3P4Q B;  1FNW A;  3GOE A;  2K8H A;  1I4G A;  3APC A;  2IY0 B;  3WA0 A;  2JSV X;  5L83 A;  1VCB A;  1KLU D;  3BVZ A;  2KC2 A;  2C7M B;  4WWP A;  3UGB B;  1UWM A;  2NTT A;  5CTR C;  4II2 B;  3ZTC A;  2XN9 C;  5E6P A;  2HE7 A;  4NZL B;  1H8C A;  3L17 A;  3R7Q A;  5BO4 B;  1YNT E;  1FPY A;  5BYQ A;  2MRP A;  2EEL A;  1SJE D;  1ZGU B;  4B0M A;  3T9L A;  1JRP A;  2IBI B;  4DHJ D;  1PFD A;  2B3A A;  3OLM D;  4A20 A;  2GMI C;  2QDF A;  2PIA A;  4XC2 A;  2J7Q B;  2VZK D;  3DWG C;  3V05 A;  2K25 A;  3KYC D;  1KF6 B;  4TKN A;  1WGR A;  3TIX A;  3MTN B;  4XZ4 A;  1RFK A;  4ZRP A;  2PE6 B;  4FHK A;  5CHV C;  1IGD A;  1PQS A;  2R2Q A;  2KC1 A;  3E9S A;  3T3N A;  1DOY A;  5AUK A;  3R66 C;  4IWP A;  3BK1 A;  2KKC A;  2MQJ A;  3VTV A;  1TS3 A;  2WU2 B;  1UBI A;  1V8C A;  1IGC A;  2JYT A;  1ET9 A; 
#chains in the Genus database with same CATH homology
 1T0Q C;  3RI7 C;  1T0S C;  2RDB C;  3DHI C;  3RNG C;  3Q14 C;  1T0R C;  3GE8 C;  3Q3N C;  3N20 C;  3DHG C;  3Q2A C;  3RNE C;  3I5J C;  4P1B C;  3DHH C;  3I63 C;  3Q3O C;  2INC C;  3RMK C;  4P1C C;  3RNF C;  3RN9 C;  3N1Z C;  3GE3 C;  3RNA C;  3N1Y C;  2IND C;  3RNC C;  3N1X C;  3RNB C;  3Q3M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...