3DHHC

Crystal structure of resting state toluene 4-monoxygenase hydroxylase complexed with effector protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
b'SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords toluene 4-monooxygenase hydroxylase alpha subunit
molecule tags Oxidoreductase
source organism Pseudomonas mendocina
publication title Structural consequences of effector protein complex formation in a diiron hydroxylase.
pubmed doi rcsb
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3dhhC00
3N1ZC 2INDC 2INCC 3DHHC 3RNFC 2RDBC 3GE8C 3GE3C 3Q3OC 3DHGC 1T0QC 3RMKC 3Q3NC 3I5JC 3RI7C 3RN9C 3RNGC 4P1CC 1T0SC 3Q2AC 3RNAC 3N1XC 1T0RC 3N1YC 3RNCC 3N20C 3Q3MC 3RNBC 3I63C 4P1BC 3RNEC 3DHIC 3Q14C
chains in the Genus database with same CATH superfamily
3B08A 3AE7B 2M56B 1Z5SB 4JWSC 3GP7A 1F2RI 2XK5A 4EZLA 1WJ6A 4MJSA 1LM8B 1U4AA 1J7BA 2INNE 4HPPA 1V80A 2QHOA 4TV3A 3HVDA 3L10B 2MP2B 4WJQA 4OHJA 2QCZA 3QWZB 4OW0A 3VRBB 1WFYA 1V81A 2BYVE 4KGRA 2GBMA 5LLIA 2G1EA 3PT2B 4IM0A 5EE1A 2JWUA 3VDZA 2EKIA 1OTRB 4LNNA 4W9DA 1GJZA 3BK2A 2L32A 4MT5A 3AMZA 4P6VF 2JYEA 1ZPSA 4P7IA 4L23A 1YN5A 4LDTD 3BZDB 3ZLZA 2OOBB 3C0RB 4LNFA 3ETRA 2D2QA 3HIZA 4HPMB 2D3AA 1OEYA 2AEHA 1MHXA 1UBIA 3DVNU 1JQ4A 4AQ7A 2KNBA 3ZDTA 4BKGA 2D3GA 3AE5B 3AU4A 2FUHB 4EZJA 1FNWA 1R7SA 2ZW1A 1J7CA 1E90A 2BYFA 1NENB 3NHEB 4BVUC 2IO0B 4FBJB 3AE4B 2IZVB 2C7HA 4IM3A 4TMAB 4YWGG 4BBNF 4OVVA 3A9JB 2Z8LA 1WGRA 4NY0A 4KKIA 2NCNA 2O6VB 4W9LA 1HTOA 1L6UA 1WI0A 2LJIA 2NBUA 2CKHB 3WAMA 3RCZA 1DGJA 1WM3A 1E8YA 3P42A 4HKZE 3SFEB 4A55A 3ZNZB 3VAWA 1ET6A 3D32A 5MPOA 4HEA1 4DK5A 1UNSA 3CSTA 5D6JB 4E74A 1E9MA 1P7FA 5AZHA 2MWSB 1C4PA 4GDKA 4FJYA 2KD0A 1GC7A 1IBXB 1WGHA 1XT9B 2KYWA 1WE7A 4GMVA 4FA6A 3L0WB 3RNCC 1H8CA 1WH3A 3A9KB 2O6VD 2EMTA 2WXJA 3H6NA 4DHJB 3H7SA 2KC2A 4A8XC 2L83A 4MGKE 3DHHC 1HEZE 2KDIA 2Q5WD 5L95C 2IY0B 2K8HA 2LVQA 2ZW0A 2NPTB 4WJNA 1ZXHA 3TEZA 1Y8RC 2NBWB 3JVZX 3IT6B 3AM9A 1LQBA 5E6PA 3BY4B 1FXIA 4KSLC 3QQ8B 1KTKA 1J0GA 2AQ2B 3DVGX 2JZ3B 5IKCM 4PS3A 4ZOHC 1YX5B 5H8YE 2MHJA 1V97A 1WIAA 1L0VB 3I3TB 4YTNB 5KHQA 4JLCA 2PKOA 1HXYD 4MDKE 1SJED 1TS2A 4A6QA 2IY1B 3BWUD 1MJDA 1NVID 4M8MA 2LGYA 3B1LX 3QK0A 1Q0WB 3Q69A 4K7UA 3ZXVA 5G55A 2CHWA 3BIID 1VZ7A 3M63B 2KQ7A 1TKGA 3EA6A 3VFKA 3VTWA 1JWBD 1QZEA 2WDVB 4DBGA 3P4SB 3A4RA 4GU2A 4RGTA 3DVNV 1WZ3A 3ZYYX 2DYMA 3VQIA 1RM6C 4EEWA 3NG0A 2KWCA 1JROA 3NZSA 1UBQA 4WAFA 4WIPA 1D4BA 3B2GA 3BINA 5LNK1 1UUPA 3HRDD 4ZRPA 1RFKA 5HHDG 3APFA 1WXMA 2ZVNA 2G9HD 2KQSA 4FLHA 4GGQA 3AEAB 5J2RA 4KDIC 2B3AA 1TYGB 4ZHPA 4RFBA 4RF0A 1LGRA 2QIEB 2CHXA 3PPAA 2KTRB 2X38A 1WGYA 4AJWA 2WS3B 2OJWA 5GMVA 2I1KA 2J0MA 2E3TA 2KTFA 3OLMD 3WA0A 4EUTA 4LJOB 4MSQB 4LCDE 1YMHE 2JZZA 3AXCA 4OZAA 1SBBB 1L4DB 3Q3OC 2H89B 1T0QC 2JSVX 3W1SA 2N1WA 2G4DB 3IXSA 2KN4A 2GMIC 4GIVA 4KZCA 1FNUA 3TL5A 4D2KA 2DYOA 1WJUA 4KKJA 1XEEA 2JRHA 1VLBA 1L0YB 3OJ4B 3ZNID 3ZJUA 2ZPNA 3ONSA 4K7SA 3RNFC 3OWEB 2KVRA 4II3B 1SE9A 2MH7A 3VHTC 3W9CB 1IGDA 1XF5L 2CS4A 1XLQA 3V05A 4XX5A 1N5XA 1HZ5A 2DYBA 2YLMA 4K3BA 2PVGC 4YTMB 4ARCA 1SJHD 4A3PA 4HXDA 1F77A 1N6ZA 1ESFA 5E6OA 2AWTA 4FJVB 5DCNA 3O13A 3B0AA 4W9FA 3L08A 1JRPA 2V3NA 3M3JA 3T3OA 3U52E 4M02A 2Y5BB 3VTUA 4UDUC 3RI7C 1SE2A 5AZGA 3WAOA 1JWAD 4OZBA 2ON8A 4BBNC 4TQ0A 4RCOA 3PO0A 2LVPA 2XBBC 2KDMA 3E56A 1A5RA 2KWUB 2DAFA 2RGFA 3WANA 4HPLB 2WP9B 1L5PA 2MBEA 5E6NA 3AE6B 2V4IB 2LGDA 4DXGA 3WIMA 1NI2A 1GOZA 2LUMA 1PFDA 3P2BA 2GI9A 3N32A 3Q8AA 2REXA 3A1QA 1OQQA 4A3OA 2BGFA 5BYSA 3U7DA 4KGSA 1E8WA 4DHZB 2J42A 4II2B 2FBWB 4MEMA 1KM7A 4N6EB 1SEBD 3P63A 4F1SA 2EMSA 4US9A 3EUB2 5TR5A 3Q3NC 3MJWA 2C7MB 1WYGA 4JIOU 3DVGY 2K25A 1C4CA 3DPDA 5D2MB 1B9RA 4JE3B 1F52A 5H92C 2V0GA 3IAS1 2W82A 1CK1A 4NJCA 2WXIA 2LVOA 3ZNGC 1VRAB 3RMKC 3IHPC 3FILA 4URKA 2W55A 3R7RA 1IP9A 2KXJA 2A4ZA 1ACCA 3RNBC 1QQRA 5D3IB 4IDIA 3NS1A 3IFWB 2X8XX 1JWSD 4P16A 5KHOA 1LO5D 2BB6A 1QOBA 1JRUA 3ML8A 2LGIA 2HD5B 1TS4A 3APCA 1XLPA 4LNOA 2M1MA 3SFDB 2W3RA 4IOIE 1MVKA 3C19A 1NYQA 3PGEA 1XD3B 2R2OA 1QILA 1I4XA 5BMGA 1TIFA 2JUOA 4W9HA 3L16A 4AOFA 4LDTB 2KMAA 5DPSA 3X0WA 2WXNA 2PTLA 4DXAB 3DHIC 2ZPYA 4W9GA 2D3BA 2LEKA 1PGBA 3L13A 4MELA 2TSSA 3MJ5A 1Q1OA 4WJOA 5CHFA 3URYA 2N9LA 1MI0A 2MRPA 3A9KA 4ICVA 4ZYSA 4ZYNA 2L0TA 1NDDA 1V8CA 2KVZA 4HROA 3N30A 1C79A 2SEBD 2K1FA 4NZLB 1ZGUB 4BKSA 2INDC 1WJNA 1L2NA 4REZA 2FE8A 3SU8X 1XO3A 1BXTA 2LWPA 2KZRA 5JZEB 1BMLC 1H4RA 2WDQB 1AN8A 3NRZA 2KQ4X 2UU7A 3DBSA 2O2VA 1XLOA 3AE2B 1GPXA 1CZPA 4GDLA 2YVCA 1FFVA 1I4PA 2GBJA 2KOXA 4MACA 4LJPB 3AEFB 3U2SC 4RGMA 2HDEA 1S1QB 1E7VA 3UGBB 2J0JA 1STEA 3TSSA 4XWTA 1R4MI 2R61A 2L76A 2BPSA 4AS1A 1C9FA 4LLGM 1JMLA 5BYQA 1DYQA 4LTUA 1UELA 2L3ZA 3ZJVA 2JQRB 2RPVA 2XK5B 1GC6A 4CQNA 3UQAA 4IWOA 1HE8A 3PLVA 1C76A 1X1MA 2MBBB 2RSUA 1D6EC 3E9SA 4AUQC 2C7NB 4IWPA 1ROEA 3ZTCA 1FEHA 4W9JA 2N7EA 3JSVA 1P9DU 1R4NI 2GBNA 2L52A 2RPQA 4RMAA 2IGDA 2K39A 3DBLB 5JHBA 3GZNB 1UGMA 1V1PA 4YXDB 3NVVA 2ZEQA 2YEPF 4KIKA 1IBXA 3APDA 1YX6B 2RDBC 2BB5A 4USAA 2KDFB 2G45B 2MBOA 2D3CA 1WRDB 2AQ3B 3L17A 4DDGD 3EFUA 2XEWA 1JWUD 5DPTA 5FR3A 4WWMA 1TKYA 2EKEC 4KGTA 1KJTA 4IWQA 3I57A 1YJIA 1GUAB 4FADA 4OZCA 2INPE 3RULA 5AUIA 2NTTA 1WR6E 3TEXA 3TCAA 1C4AA 3LYYA 5HI1A 4IG7B 3RNAC 3VUYA 1K8RB 2KFKA 2O2VB 3MC9A 4C80A 4PYUA 4WJPA 4BAXA 2CJNA 2IBIB 2BW2A 5FR6A 2BF8B 1S3SG 2WXRA 2WXMA 2PPHA 5EE0A 2VZKD 1QKZA 4HCPB 4ANXA 4FJZA 1YN3A 3RZFA 1C1YB 5AEKB 5IO9A 4NNJB 1YNTE 2GBRA 3ZJTA 2MLBA 4NPNA 3ECIA 3ZKJC 3HVZA 4PS7A 1KOTA 3KUDB 1F0ZA 3EECA 1VZ8A 3QX1A 3OJ3A 4MJSB 2FAZA 2OEDA 2WXQA 4OVUA 3BYTB 3VUXA 2PJHA 4GXBA 2MSED 4A9AA 4HDQA 4RF1A 5J18A 4N58A 2IGHA 3MHSD 5D94A 4P1BC 1UF0A 5JH5C 2ONQA 1OEYJ 2KDBA 1TTNA 4FN2A 4MH0E 4XC2A 3GE8C 2WXHA 1M4VA 3JYUA 4X57B 4DHZE 3P4PB 1XCTL 3J9CA 1XQQA 3DBHI 2FCMA 1WMHA 1K50A 3H7PB 4B0MA 2MA9B 3V3XA 2BS4B 2GLSA 2L8JA 4GLSC 2DZKA 3DCGA 4O1NA 2SAKA 1I4GA 2MX2A 2KLCA 5IAAC 2N1VA 2KO3A 2QSDA 1L0XB 4NJ7A 3QA8A 5FKAC 1EWYC 1HQRD 3M95A 1D3ZA 1V1PB 2KANA 1R4NB 4RGNA 2QDFA 4S0RA 4W9EA 1P7EA 4J3OD 4BFRA 2MEKA 3A1QB 5IN7A 2LRUA 3GZNI 4TUUA 4PK1A 1AYFA 2G4SA 1L7YA 2MBQA 3H9DA 3KQ4A 3PHXB 4KV2A 2LJ5A 4WWOA 1YIWA 3AN1A 3TJPA 2LFIA 2MBHA 3CIRB 1K51A 2CU1A 2KX3A 2MJ3A 1TZ1A 5T8IA 5HG2A 5D3DA 3H8HA 1FPYA 2W3SA 2RR9A 2PLPA 3A4SC 4CO7A 2ZNVC 4NJ6A 3P1MA 1D5MC 2M4NA 3ZW3A 3RNEC 2LGSA 2RDGA 2MQJA 2KMCA 2Z0EB 2PIAA 2C9WB 1GB1A 1LXDA 2ZJDA 3V62A 2DBYA 4BZAA 3HUIA 4TKNA 3B9JA 3VR8B 3T8MA 2NTSA 3N3KB 3O65B 4GN1A 1ET9A 4MM3B 1WGKA 4ICUA 2CHZA 3AH7A 3DBRB 2VRRB 3N20C 2M19A 4F7ZA 2N0SB 3MTNB 1EM7A 3RUIB 1N60A 2IDYA 2WXFA 1EF1A 2WU5B 3T3NA 3Q8EA 2WXOA 3VR9B 1YJJA 3WAPA 1F1HA 3RNGC 2J7QB 1T0RC 1V5OA 3IT4B 4KSKC 5CX3A 2JT4B 2KT7A 2PE9A 1MG8A 2KFKB 1TY2A 2EELA 2WGSA 4G50A 5IOIA 1I4HA 4GOCA 1N62A 2IPKD 2KMMA 3RD2A 4HLEA 3ML9A 4W9IA 4RH6A 3NZ3A 3Q2AC 1FXAA 3SHQA 1OQYA 1VD2A 3V6EB 1MFWA 3R66C 4K1RB 1AARA 1FO4A 2INCC 1I42A 4HK2A 3AE8B 4XYCA 2MJEA 4P1CC 1TBEA 3TEYA 4H2AA 1HTQA 1IGCA 2D10A 1FFUA 1NI3A 2JU6X 3QC8B 3BVZA 2WXGA 4WWNA 4GDLB 1E10A 2K8BA 4M0WB 3X23A 3FAHA 3SR6A 1TGZB 3KYCD 3EFCA 2N7JA 2BWFA 2FCQA 3I5JC 1C77A 2DLBA 4W9CA 2AL6A 2WDTB 3N9YC 1JWMD 2XN9C 3U8ZA 2DZJA 1ZXIA 2L05A 2QC8A 4YTPB 5GXGB 1SB3C 3RFZB 3SEBA 2IGGA 5TSSA 1WSPA 1C3TA 1GNUA 3AEBB 3WALA 2CJOA 2VH2A 4I6PA 2L0FA 2O6VA 2W9NA 5LXIB 2JYTA 2MCNB 3K9OB 5HFYA 3Q8CA 1P1AA 1WYWB 1V2YA 4ZHOA 4DDID 3DOWA 4ANUA 4J6IA 3ZUNA 2WXLA 4YSYB 3A9JA 3RYTA 5EE9A 2KTRA 2LUEA 4PT5A 1TY0A 1MPEA 3VH3B 1FIQA 4N9F4 1QF6A 1WRIA 1N61A 2CU3A 3QIJA 4LK0M 4XWWA 4ZRQA 3IG3A 2N7DA 3C8YA 4KDLB 3UIPB 2OHFA 1Q10A 3MC8A 5EDSA 5CHWA 2HTME 4MGIE 3AU5A 1WM2A 1ZKHA 4ZRIA 1L4ZB 1DOYA 3UF8A 1I7HA 1SE3A 1MHHE 3UI3A 2V9HA 2KX0A 3AECB 3L4PA 4MGZE 3P4RB 3PHWB 1QLBB 1CQVA 2KK8A 1V6EA 4BKTA 4WH4A 4AJYB 3BVGA 1IYFA 3NJTA 2BWES 3TMPB 4L1BA 3A33B 2JWZA 2JZPA 3ZXRA 1WX8A 3FILB 1SE4A 3QAQA 1IUEA 3PZDA 1WF9A 1EF5A 1SIFA 2QMTA 3HK0A 2WX0A 4L2YA 3PS6A 3NY5A 1ENFA 3KWVA 5DPRA 1RYJA 3VTVA 2BKFA 3AE3B 2H88B 2NPTA 4I6NB 2J53A 3ZNHB 3NVYA 1HZ6A 4S17A 1TJEA 4B0EA 1L6VA 1ZUD2 1EU4A 4YSZB 2LRWA 5JHAA 3KH0A 5LXHA 3Q3JA 1UH6A 1Q5WB 3PRMB 2ASQA 4W9KA 1T6BX 3ZDMC 2FNJB 3VVWB 1KF6B 2HJ1A 3Q3FA 3JSVB 1FRRA 4KX6B 3JW0X 2WU2B 1YN4A 1T0SC 3KVFB 4JQWC 2HJ8A 1E0ZA 2I1JA 3U4EG 4I6LB 1OQRA 1V1OA 2LMCA 3RZWC 4TQ1A 1WY8A 4KIKB 1K52A 2WNMA 4A20A 4EZKA 3KYDD 4EKUA 4CHKA 4KZ0A 1J19A 3QARA 1PGXA 2DWQA 3ZRCA 2WLBA 3N1XC 3Q8BA 3NS8A 2IJ0A 2K5PA 2M0XA 4K3CA 1PQSA 2KACA 2Y5CA 2N9EB 5BMIA 2ICIA 3W5UB 2ZVOA 2N9KA 3CMMB 1E8ZA 2K22A 2IO1B 2JXTA 3FKYA 3NVWA 5BMHA 1E7PB 4GB9A 2Y5PA 1GB4A 3DQVA 2RDHA 3PV1A 1VR9A 2KAJA 4JX1C 3HHMA 1QOGA 4DQOC 3BVMA 2DENB 2Z0DB 4RM9A 4HRSA 2I38A 3N1ZC 1HA5A 5DPWA 3MC0B 2AYOB 4NAWB 4OVZA 5BYRA 1XLNA 4EFOA 4GSWA 4MM3A 4PS8A 1KLVA 3PZ7A 2KJRA 3LXFA 5JXVA 4AP4C 5HKHA 3Q8FA 2NBVB 1KLUD 2Z59B 1M94A 4C7ZA 4HJKA 2BS2B 1TS3A 2WYQA 1V9JA 1WMHB 3H7PA 3R2IA 4G3XB 3V60A 2L1AA 3TUOA 2QILA 1UD7A 1SGHA 2DAJA 2JF5A 4FHJA 1GAQB 2N9XA 1C78A 4NAWA 2L00B 4WAAA 3PREA 3PVLA 2AX5A 3SD5A 3BK1A 2J0KA 4ASWC 1ZE3D 4HWIB 2K6QA 1I4RA 1WE6A 3AEGB 1UWXA 1V49A 1JALA 3TIXA 3DBRI 4E71A 2KJHB 2CR5A 2K8CA 2VZKB 5E6JA 1CMXB 2LGXA 2J52A 4B9KA 2FIFA 1I4QA 4WQOB 3W1YA 4IUMB 1NYRA 5C3JB 1DOIA 1WWTA 3GS2A 1CJEA 1QOAA 2GB1A 1TS5A 3W1SC 4DWFA 4GDKB 1FD6A 3LB8C 5G5HA 3WCQA 2XNAC 3NZUA 2V3SA 3N1YC 2WDRB 1OFFA 4HJGE 3CSFA 5AUKA 1E6EB 3NOBA 4QAYA 3AI5A 3KWLA 3OG5A 4MH8A 1PUTA 1P98A 3OAWA 4ZRKA 1K53A 3ABVB 1B1ZA 2JX5A 1ZOYB 1E5WA 1YQ3B 2DNFA 1SIJA 4ZRJA 5CTRC 3VUWA 1WXAA 2LHEA 2N9PC 2N4FA 1KLGD 4M8NA 4HCNB 5AZFA 3SDLC 3ENEA 1RRBA 2KHWB 4JPSA 2DZIA 2PE6B 1NBFC 1TT5B 3DHGC 2LXCA 5BO4B 1EUVB 5I4DA 4IM2A 3CF6E 2NS5A 4ITKA 4RGOS 2RD0A 1R4MB 3IVFA 1ZP0B 2FCSA 3PLUA 2ZZPB 3H1UA 3UQBA 1SSNA 2VH1A 3R3MA 1XXGA 3S2AA 1FXTB 4ACFA 2KLGA 3ALBA 3MFGA 1YJ1A 4G11A 1PGAA 2JPHA 4PYZA 3Q14C 4BOZB 5IP4D 2QJLA 4Q2JA 1J8CA 3KW5B 2IYDB 2M0AA 3HM3A 1EO6A 2BS3B 4JL9A 1N5WA 2LXAA 2M8SA 1AWDA 3AE9B 3EGRA 3U30A 2PMVA 1SXTA 3ZTDA 3KUZA 3ZQ4A 1TKEA 3K9PB 4DXFA 2JXXA 3L54A 2FIDA 3DWMA 4R3DA 1J7AA 1KRHA 3GE3C 4HVBA 4HDOA 1KH0A 1VDVA 4NQLB 1WR1A 2OJRA 3W2DA 4IC7B 4C4VA 1YD8U 1I35A 2V1YA 1D5ZC 3AEEB 2W54A 4LNKA 1P3QU 3AB5A 1WXQA 3AE1B 1NEKB 1N63A 1KFYB 2L7RA 1Y56A 3AV8A 4M01A 2MJDA 2BYEA 1VCBA 3EHVA 1BT0A 2HTHA 1QOFA 2WXPA 2BT6A 3ZGZA 4RM8A 1WJ4A 3R2TA 2RMMA 5IA7A 2BVCA 3Q6BA 2GBKA 3MP9A 3MHZA 3NUHB 1T0YA 2MW5A 2KJ6A 5G2NA 2ZCBA 2KDEB 3B2FA 1RFAA 2B76B 1G6JA 3AEDB 4CYEA 2BKRB 3I9V1 2K6DB 1F2RC 3KLSX 3GB1A 4NAMA 4M00A 2Y3AA 1E8XA 3TEWA 1QT9A 2YEPB 2JRIB 1JW9D 3IAM1 1ZDXA 1T5XD 1YOVB 1FRDA 1RLFA 2WX1A 3TBLD 2JY6A 1XCQL 2KN5A 2FCNA 2BYTA 1F9JA 4K81A 4YT0B 4B95A 4MGYE 2KFJA 3M62B 1Z2MA 2BQQA 3DDCB 4WURA 2KWVB 3R7QA 2C5LC 3IBEA 4JGHB 1UGJA 3PTFC 4RNAA 3T9LA 4B6WA 2KC1A 4C4VB 2J4XA 2GRIA 1ZDVA 3DBHB 1EWCA 4EE2A 5G5GA 4US8A 1EU3A 4WQMA 4A90A 1MG4A 1OGWA 1WGGA 2PEAA 1VZ6A 2AQ1B 4ANWA 2V4LA 4EOYA 1FCLA 2DHZA 2K3UA 3PRPB 2FUG1 2MP2A 2LZ6A 4FHKA 3ZO5B 1FMAD 1BUIC 2BTEA 2D5GA 4XZ4A 3V6CB 2WQYB 4G0NB 4N59A 2PW9A 4C00A 1RAXA 2AL3A 4IW0A 4ARIA 4DHJD 1SF0A 1GG3A 3RPFC 4BKSD 4M0WA 2E6XA 3FC4A 2C60A 2UYZB 1VJKA 3DWGC 2NVUI 4FULA 2NMQA 3CWIA 2ZCCA 1YQ4B 5CHVC 1PYWD 4WWPA 2HE7A 3BYYB 4XDDA 2NR2A 1AW7A 5C2TB 3QHTA 4YSXB 1IPGA 3RT3B 3HM6X 4ZDVA 1D5XC 3LJ3A 1PDXA 3QJZA 3VXWA 1FCCC 5D7GA 2K9XA 2WWZA 4FXCA 1RWSA 2V3PA 4AWJA 5J17A 2LD9A 1FNVA 3Q3MC 4LNIA 3UINB 3QCAA 1P0RA 4NQKE 2D11A 1E7UA 2I2YA 1WXSA 2IO2B 4K7WA 3VRAB 2IO3B 2LI5A 1ISNA 5C23A 5EE3A 1WZ0A 1WGDA 3P4QB 3V61A 4BOSC 1LFDA 4XDCA 1UZXB 3I63C 2ACZB 4YL8A 2LHDA 1TZOA 4IKGA 2KKCA 3ZVVA 1T3QA 3EC8A 5FK9C 5L83A 4C56C 3DBLI 1YQBA 1A70A 4E3CA 1JCKB 2WXKA 3NVZA 3GOEA 3PZ8A 4ANVA 2ZNVB 2R2QA 2DX5B 4C7YA 3VH4B 4JWUC 4TSSA 4MSMB 1ZW7A 3LDZE 1WX7A 3PRZA 1WXVA 4F8CB 1V5TA 2GOWA 2M17A 2DZMA 1WX9A 4XGAB 3PSEB 3KUCB 3U7ZA 3R8BA 4XE0A 1UWMA 2BBCA 2WHIA 5C1ZA 4HKQA 3ZRFA 2KWDA 3AULA 1DOXA 3ZIMA 2G3QB 2QEJC 3UIOB 3RN9C 2A5UA 2JVCA 1FM0D 2D07B 2UWQA 2LASA 2K0PA 3W5VB 4KVGB 2PVOD 1V86A
chains in the Genus database with same CATH topology
3N1ZC 2INDC 2INCC 3DHHC 3RNFC 2RDBC 3GE8C 3GE3C 3Q3OC 3DHGC 1T0QC 3RMKC 3Q3NC 3I5JC 3RI7C 3RN9C 3RNGC 4P1CC 1T0SC 3Q2AC 3RNAC 3N1XC 1T0RC 3N1YC 3RNCC 3N20C 3Q3MC 3RNBC 3I63C 4P1BC 3RNEC 3DHIC 3Q14C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1Z C;  2IND C;  2INC C;  3DHH C;  3RNF C;  2RDB C;  3GE8 C;  3GE3 C;  3Q3O C;  3DHG C;  1T0Q C;  3RMK C;  3Q3N C;  3I5J C;  3RI7 C;  3RN9 C;  3RNG C;  4P1C C;  1T0S C;  3Q2A C;  3RNA C;  3N1X C;  1T0R C;  3N1Y C;  3RNC C;  3N20 C;  3Q3M C;  3RNB C;  3I63 C;  4P1B C;  3RNE C;  3DHI C;  3Q14 C; 
#chains in the Genus database with same CATH topology
 3B08 A;  3AE7 B;  2M56 B;  1Z5S B;  4JWS C;  3GP7 A;  1F2R I;  2XK5 A;  4EZL A;  1WJ6 A;  4MJS A;  1LM8 B;  1U4A A;  1J7B A;  2INN E;  4HPP A;  1V80 A;  2QHO A;  4TV3 A;  3HVD A;  3L10 B;  2MP2 B;  4WJQ A;  4OHJ A;  2QCZ A;  3QWZ B;  4OW0 A;  3VRB B;  1WFY A;  1V81 A;  2BYV E;  4KGR A;  2GBM A;  5LLI A;  2G1E A;  3PT2 B;  4IM0 A;  5EE1 A;  2JWU A;  3VDZ A;  2EKI A;  1OTR B;  4LNN A;  4W9D A;  1GJZ A;  3BK2 A;  2L32 A;  4MT5 A;  3AMZ A;  4P6V F;  2JYE A;  1ZPS A;  4P7I A;  4L23 A;  1YN5 A;  4LDT D;  3BZD B;  3ZLZ A;  2OOB B;  3C0R B;  4LNF A;  3ETR A;  2D2Q A;  3HIZ A;  4HPM B;  2D3A A;  1OEY A;  2AEH A;  1MHX A;  1UBI A;  3DVN U;  1JQ4 A;  4AQ7 A;  2KNB A;  3ZDT A;  4BKG A;  2D3G A;  3AE5 B;  3AU4 A;  2FUH B;  4EZJ A;  1FNW A;  1R7S A;  2ZW1 A;  1J7C A;  1E90 A;  2BYF A;  1NEN B;  3NHE B;  4BVU C;  2IO0 B;  4FBJ B;  3AE4 B;  2IZV B;  2C7H A;  4IM3 A;  4TMA B;  4YWG G;  4BBN F;  4OVV A;  3A9J B;  2Z8L A;  1WGR A;  4NY0 A;  4KKI A;  2NCN A;  2O6V B;  4W9L A;  1HTO A;  1L6U A;  1WI0 A;  2LJI A;  2NBU A;  2CKH B;  3WAM A;  3RCZ A;  1DGJ A;  1WM3 A;  1E8Y A;  3P42 A;  4HKZ E;  3SFE B;  4A55 A;  3ZNZ B;  3VAW A;  1ET6 A;  3D32 A;  5MPO A;  4HEA 1;  4DK5 A;  1UNS A;  3CST A;  5D6J B;  4E74 A;  1E9M A;  1P7F A;  5AZH A;  2MWS B;  1C4P A;  4GDK A;  4FJY A;  2KD0 A;  1GC7 A;  1IBX B;  1WGH A;  1XT9 B;  2KYW A;  1WE7 A;  4GMV A;  4FA6 A;  3L0W B;  3RNC C;  1H8C A;  1WH3 A;  3A9K B;  2O6V D;  2EMT A;  2WXJ A;  3H6N A;  4DHJ B;  3H7S A;  2KC2 A;  4A8X C;  2L83 A;  4MGK E;  3DHH C;  1HEZ E;  2KDI A;  2Q5W D;  5L95 C;  2IY0 B;  2K8H A;  2LVQ A;  2ZW0 A;  2NPT B;  4WJN A;  1ZXH A;  3TEZ A;  1Y8R C;  2NBW B;  3JVZ X;  3IT6 B;  3AM9 A;  1LQB A;  5E6P A;  3BY4 B;  1FXI A;  4KSL C;  3QQ8 B;  1KTK A;  1J0G A;  2AQ2 B;  3DVG X;  2JZ3 B;  5IKC M;  4PS3 A;  4ZOH C;  1YX5 B;  5H8Y E;  2MHJ A;  1V97 A;  1WIA A;  1L0V B;  3I3T B;  4YTN B;  5KHQ A;  4JLC A;  2PKO A;  1HXY D;  4MDK E;  1SJE D;  1TS2 A;  4A6Q A;  2IY1 B;  3BWU D;  1MJD A;  1NVI D;  4M8M A;  2LGY A;  3B1L X;  3QK0 A;  1Q0W B;  3Q69 A;  4K7U A;  3ZXV A;  5G55 A;  2CHW A;  3BII D;  1VZ7 A;  3M63 B;  2KQ7 A;  1TKG A;  3EA6 A;  3VFK A;  3VTW A;  1JWB D;  1QZE A;  2WDV B;  4DBG A;  3P4S B;  3A4R A;  4GU2 A;  4RGT A;  3DVN V;  1WZ3 A;  3ZYY X;  2DYM A;  3VQI A;  1RM6 C;  4EEW A;  3NG0 A;  2KWC A;  1JRO A;  3NZS A;  1UBQ A;  4WAF A;  4WIP A;  1D4B A;  3B2G A;  3BIN A;  5LNK 1;  1UUP A;  3HRD D;  4ZRP A;  1RFK A;  5HHD G;  3APF A;  1WXM A;  2ZVN A;  2G9H D;  2KQS A;  4FLH A;  4GGQ A;  3AEA B;  5J2R A;  4KDI C;  2B3A A;  1TYG B;  4ZHP A;  4RFB A;  4RF0 A;  1LGR A;  2QIE B;  2CHX A;  3PPA A;  2KTR B;  2X38 A;  1WGY A;  4AJW A;  2WS3 B;  2OJW A;  5GMV A;  2I1K A;  2J0M A;  2E3T A;  2KTF A;  3OLM D;  3WA0 A;  4EUT A;  4LJO B;  4MSQ B;  4LCD E;  1YMH E;  2JZZ A;  3AXC A;  4OZA A;  1SBB B;  1L4D B;  3Q3O C;  2H89 B;  1T0Q C;  2JSV X;  3W1S A;  2N1W A;  2G4D B;  3IXS A;  2KN4 A;  2GMI C;  4GIV A;  4KZC A;  1FNU A;  3TL5 A;  4D2K A;  2DYO A;  1WJU A;  4KKJ A;  1XEE A;  2JRH A;  1VLB A;  1L0Y B;  3OJ4 B;  3ZNI D;  3ZJU A;  2ZPN A;  3ONS A;  4K7S A;  3RNF C;  3OWE B;  2KVR A;  4II3 B;  1SE9 A;  2MH7 A;  3VHT C;  3W9C B;  1IGD A;  1XF5 L;  2CS4 A;  1XLQ A;  3V05 A;  4XX5 A;  1N5X A;  1HZ5 A;  2DYB A;  2YLM A;  4K3B A;  2PVG C;  4YTM B;  4ARC A;  1SJH D;  4A3P A;  4HXD A;  1F77 A;  1N6Z A;  1ESF A;  5E6O A;  2AWT A;  4FJV B;  5DCN A;  3O13 A;  3B0A A;  4W9F A;  3L08 A;  1JRP A;  2V3N A;  3M3J A;  3T3O A;  3U52 E;  4M02 A;  2Y5B B;  3VTU A;  4UDU C;  3RI7 C;  1SE2 A;  5AZG A;  3WAO A;  1JWA D;  4OZB A;  2ON8 A;  4BBN C;  4TQ0 A;  4RCO A;  3PO0 A;  2LVP A;  2XBB C;  2KDM A;  3E56 A;  1A5R A;  2KWU B;  2DAF A;  2RGF A;  3WAN A;  4HPL B;  2WP9 B;  1L5P A;  2MBE A;  5E6N A;  3AE6 B;  2V4I B;  2LGD A;  4DXG A;  3WIM A;  1NI2 A;  1GOZ A;  2LUM A;  1PFD A;  3P2B A;  2GI9 A;  3N32 A;  3Q8A A;  2REX A;  3A1Q A;  1OQQ A;  4A3O A;  2BGF A;  5BYS A;  3U7D A;  4KGS A;  1E8W A;  4DHZ B;  2J42 A;  4II2 B;  2FBW B;  4MEM A;  1KM7 A;  4N6E B;  1SEB D;  3P63 A;  4F1S A;  2EMS A;  4US9 A;  3EUB 2;  5TR5 A;  3Q3N C;  3MJW A;  2C7M B;  1WYG A;  4JIO U;  3DVG Y;  2K25 A;  1C4C A;  3DPD A;  5D2M B;  1B9R A;  4JE3 B;  1F52 A;  5H92 C;  2V0G A;  3IAS 1;  2W82 A;  1CK1 A;  4NJC A;  2WXI A;  2LVO A;  3ZNG C;  1VRA B;  3RMK C;  3IHP C;  3FIL A;  4URK A;  2W55 A;  3R7R A;  1IP9 A;  2KXJ A;  2A4Z A;  1ACC A;  3RNB C;  1QQR A;  5D3I B;  4IDI A;  3NS1 A;  3IFW B;  2X8X X;  1JWS D;  4P16 A;  5KHO A;  1LO5 D;  2BB6 A;  1QOB A;  1JRU A;  3ML8 A;  2LGI A;  2HD5 B;  1TS4 A;  3APC A;  1XLP A;  4LNO A;  2M1M A;  3SFD B;  2W3R A;  4IOI E;  1MVK A;  3C19 A;  1NYQ A;  3PGE A;  1XD3 B;  2R2O A;  1QIL A;  1I4X A;  5BMG A;  1TIF A;  2JUO A;  4W9H A;  3L16 A;  4AOF A;  4LDT B;  2KMA A;  5DPS A;  3X0W A;  2WXN A;  2PTL A;  4DXA B;  3DHI C;  2ZPY A;  4W9G A;  2D3B A;  2LEK A;  1PGB A;  3L13 A;  4MEL A;  2TSS A;  3MJ5 A;  1Q1O A;  4WJO A;  5CHF A;  3URY A;  2N9L A;  1MI0 A;  2MRP A;  3A9K A;  4ICV A;  4ZYS A;  4ZYN A;  2L0T A;  1NDD A;  1V8C A;  2KVZ A;  4HRO A;  3N30 A;  1C79 A;  2SEB D;  2K1F A;  4NZL B;  1ZGU B;  4BKS A;  2IND C;  1WJN A;  1L2N A;  4REZ A;  2FE8 A;  3SU8 X;  1XO3 A;  1BXT A;  2LWP A;  2KZR A;  5JZE B;  1BML C;  1H4R A;  2WDQ B;  1AN8 A;  3NRZ A;  2KQ4 X;  2UU7 A;  3DBS A;  2O2V A;  1XLO A;  3AE2 B;  1GPX A;  1CZP A;  4GDL A;  2YVC A;  1FFV A;  1I4P A;  2GBJ A;  2KOX A;  4MAC A;  4LJP B;  3AEF B;  3U2S C;  4RGM A;  2HDE A;  1S1Q B;  1E7V A;  3UGB B;  2J0J A;  1STE A;  3TSS A;  4XWT A;  1R4M I;  2R61 A;  2L76 A;  2BPS A;  4AS1 A;  1C9F A;  4LLG M;  1JML A;  5BYQ A;  1DYQ A;  4LTU A;  1UEL A;  2L3Z A;  3ZJV A;  2JQR B;  2RPV A;  2XK5 B;  1GC6 A;  4CQN A;  3UQA A;  4IWO A;  1HE8 A;  3PLV A;  1C76 A;  1X1M A;  2MBB B;  2RSU A;  1D6E C;  3E9S A;  4AUQ C;  2C7N B;  4IWP A;  1ROE A;  3ZTC A;  1FEH A;  4W9J A;  2N7E A;  3JSV A;  1P9D U;  1R4N I;  2GBN A;  2L52 A;  2RPQ A;  4RMA A;  2IGD A;  2K39 A;  3DBL B;  5JHB A;  3GZN B;  1UGM A;  1V1P A;  4YXD B;  3NVV A;  2ZEQ A;  2YEP F;  4KIK A;  1IBX A;  3APD A;  1YX6 B;  2RDB C;  2BB5 A;  4USA A;  2KDF B;  2G45 B;  2MBO A;  2D3C A;  1WRD B;  2AQ3 B;  3L17 A;  4DDG D;  3EFU A;  2XEW A;  1JWU D;  5DPT A;  5FR3 A;  4WWM A;  1TKY A;  2EKE C;  4KGT A;  1KJT A;  4IWQ A;  3I57 A;  1YJI A;  1GUA B;  4FAD A;  4OZC A;  2INP E;  3RUL A;  5AUI A;  2NTT A;  1WR6 E;  3TEX A;  3TCA A;  1C4A A;  3LYY A;  5HI1 A;  4IG7 B;  3RNA C;  3VUY A;  1K8R B;  2KFK A;  2O2V B;  3MC9 A;  4C80 A;  4PYU A;  4WJP A;  4BAX A;  2CJN A;  2IBI B;  2BW2 A;  5FR6 A;  2BF8 B;  1S3S G;  2WXR A;  2WXM A;  2PPH A;  5EE0 A;  2VZK D;  1QKZ A;  4HCP B;  4ANX A;  4FJZ A;  1YN3 A;  3RZF A;  1C1Y B;  5AEK B;  5IO9 A;  4NNJ B;  1YNT E;  2GBR A;  3ZJT A;  2MLB A;  4NPN A;  3ECI A;  3ZKJ C;  3HVZ A;  4PS7 A;  1KOT A;  3KUD B;  1F0Z A;  3EEC A;  1VZ8 A;  3QX1 A;  3OJ3 A;  4MJS B;  2FAZ A;  2OED A;  2WXQ A;  4OVU A;  3BYT B;  3VUX A;  2PJH A;  4GXB A;  2MSE D;  4A9A A;  4HDQ A;  4RF1 A;  5J18 A;  4N58 A;  2IGH A;  3MHS D;  5D94 A;  4P1B C;  1UF0 A;  5JH5 C;  2ONQ A;  1OEY J;  2KDB A;  1TTN A;  4FN2 A;  4MH0 E;  4XC2 A;  3GE8 C;  2WXH A;  1M4V A;  3JYU A;  4X57 B;  4DHZ E;  3P4P B;  1XCT L;  3J9C A;  1XQQ A;  3DBH I;  2FCM A;  1WMH A;  1K50 A;  3H7P B;  4B0M A;  2MA9 B;  3V3X A;  2BS4 B;  2GLS A;  2L8J A;  4GLS C;  2DZK A;  3DCG A;  4O1N A;  2SAK A;  1I4G A;  2MX2 A;  2KLC A;  5IAA C;  2N1V A;  2KO3 A;  2QSD A;  1L0X B;  4NJ7 A;  3QA8 A;  5FKA C;  1EWY C;  1HQR D;  3M95 A;  1D3Z A;  1V1P B;  2KAN A;  1R4N B;  4RGN A;  2QDF A;  4S0R A;  4W9E A;  1P7E A;  4J3O D;  4BFR A;  2MEK A;  3A1Q B;  5IN7 A;  2LRU A;  3GZN I;  4TUU A;  4PK1 A;  1AYF A;  2G4S A;  1L7Y A;  2MBQ A;  3H9D A;  3KQ4 A;  3PHX B;  4KV2 A;  2LJ5 A;  4WWO A;  1YIW A;  3AN1 A;  3TJP A;  2LFI A;  2MBH A;  3CIR B;  1K51 A;  2CU1 A;  2KX3 A;  2MJ3 A;  1TZ1 A;  5T8I A;  5HG2 A;  5D3D A;  3H8H A;  1FPY A;  2W3S A;  2RR9 A;  2PLP A;  3A4S C;  4CO7 A;  2ZNV C;  4NJ6 A;  3P1M A;  1D5M C;  2M4N A;  3ZW3 A;  3RNE C;  2LGS A;  2RDG A;  2MQJ A;  2KMC A;  2Z0E B;  2PIA A;  2C9W B;  1GB1 A;  1LXD A;  2ZJD A;  3V62 A;  2DBY A;  4BZA A;  3HUI A;  4TKN A;  3B9J A;  3VR8 B;  3T8M A;  2NTS A;  3N3K B;  3O65 B;  4GN1 A;  1ET9 A;  4MM3 B;  1WGK A;  4ICU A;  2CHZ A;  3AH7 A;  3DBR B;  2VRR B;  3N20 C;  2M19 A;  4F7Z A;  2N0S B;  3MTN B;  1EM7 A;  3RUI B;  1N60 A;  2IDY A;  2WXF A;  1EF1 A;  2WU5 B;  3T3N A;  3Q8E A;  2WXO A;  3VR9 B;  1YJJ A;  3WAP A;  1F1H A;  3RNG C;  2J7Q B;  1T0R C;  1V5O A;  3IT4 B;  4KSK C;  5CX3 A;  2JT4 B;  2KT7 A;  2PE9 A;  1MG8 A;  2KFK B;  1TY2 A;  2EEL A;  2WGS A;  4G50 A;  5IOI A;  1I4H A;  4GOC A;  1N62 A;  2IPK D;  2KMM A;  3RD2 A;  4HLE A;  3ML9 A;  4W9I A;  4RH6 A;  3NZ3 A;  3Q2A C;  1FXA A;  3SHQ A;  1OQY A;  1VD2 A;  3V6E B;  1MFW A;  3R66 C;  4K1R B;  1AAR A;  1FO4 A;  2INC C;  1I42 A;  4HK2 A;  3AE8 B;  4XYC A;  2MJE A;  4P1C C;  1TBE A;  3TEY A;  4H2A A;  1HTQ A;  1IGC A;  2D10 A;  1FFU A;  1NI3 A;  2JU6 X;  3QC8 B;  3BVZ A;  2WXG A;  4WWN A;  4GDL B;  1E10 A;  2K8B A;  4M0W B;  3X23 A;  3FAH A;  3SR6 A;  1TGZ B;  3KYC D;  3EFC A;  2N7J A;  2BWF A;  2FCQ A;  3I5J C;  1C77 A;  2DLB A;  4W9C A;  2AL6 A;  2WDT B;  3N9Y C;  1JWM D;  2XN9 C;  3U8Z A;  2DZJ A;  1ZXI A;  2L05 A;  2QC8 A;  4YTP B;  5GXG B;  1SB3 C;  3RFZ B;  3SEB A;  2IGG A;  5TSS A;  1WSP A;  1C3T A;  1GNU A;  3AEB B;  3WAL A;  2CJO A;  2VH2 A;  4I6P A;  2L0F A;  2O6V A;  2W9N A;  5LXI B;  2JYT A;  2MCN B;  3K9O B;  5HFY A;  3Q8C A;  1P1A A;  1WYW B;  1V2Y A;  4ZHO A;  4DDI D;  3DOW A;  4ANU A;  4J6I A;  3ZUN A;  2WXL A;  4YSY B;  3A9J A;  3RYT A;  5EE9 A;  2KTR A;  2LUE A;  4PT5 A;  1TY0 A;  1MPE A;  3VH3 B;  1FIQ A;  4N9F 4;  1QF6 A;  1WRI A;  1N61 A;  2CU3 A;  3QIJ A;  4LK0 M;  4XWW A;  4ZRQ A;  3IG3 A;  2N7D A;  3C8Y A;  4KDL B;  3UIP B;  2OHF A;  1Q10 A;  3MC8 A;  5EDS A;  5CHW A;  2HTM E;  4MGI E;  3AU5 A;  1WM2 A;  1ZKH A;  4ZRI A;  1L4Z B;  1DOY A;  3UF8 A;  1I7H A;  1SE3 A;  1MHH E;  3UI3 A;  2V9H A;  2KX0 A;  3AEC B;  3L4P A;  4MGZ E;  3P4R B;  3PHW B;  1QLB B;  1CQV A;  2KK8 A;  1V6E A;  4BKT A;  4WH4 A;  4AJY B;  3BVG A;  1IYF A;  3NJT A;  2BWE S;  3TMP B;  4L1B A;  3A33 B;  2JWZ A;  2JZP A;  3ZXR A;  1WX8 A;  3FIL B;  1SE4 A;  3QAQ A;  1IUE A;  3PZD A;  1WF9 A;  1EF5 A;  1SIF A;  2QMT A;  3HK0 A;  2WX0 A;  4L2Y A;  3PS6 A;  3NY5 A;  1ENF A;  3KWV A;  5DPR A;  1RYJ A;  3VTV A;  2BKF A;  3AE3 B;  2H88 B;  2NPT A;  4I6N B;  2J53 A;  3ZNH B;  3NVY A;  1HZ6 A;  4S17 A;  1TJE A;  4B0E A;  1L6V A;  1ZUD 2;  1EU4 A;  4YSZ B;  2LRW A;  5JHA A;  3KH0 A;  5LXH A;  3Q3J A;  1UH6 A;  1Q5W B;  3PRM B;  2ASQ A;  4W9K A;  1T6B X;  3ZDM C;  2FNJ B;  3VVW B;  1KF6 B;  2HJ1 A;  3Q3F A;  3JSV B;  1FRR A;  4KX6 B;  3JW0 X;  2WU2 B;  1YN4 A;  1T0S C;  3KVF B;  4JQW C;  2HJ8 A;  1E0Z A;  2I1J A;  3U4E G;  4I6L B;  1OQR A;  1V1O A;  2LMC A;  3RZW C;  4TQ1 A;  1WY8 A;  4KIK B;  1K52 A;  2WNM A;  4A20 A;  4EZK A;  3KYD D;  4EKU A;  4CHK A;  4KZ0 A;  1J19 A;  3QAR A;  1PGX A;  2DWQ A;  3ZRC A;  2WLB A;  3N1X C;  3Q8B A;  3NS8 A;  2IJ0 A;  2K5P A;  2M0X A;  4K3C A;  1PQS A;  2KAC A;  2Y5C A;  2N9E B;  5BMI A;  2ICI A;  3W5U B;  2ZVO A;  2N9K A;  3CMM B;  1E8Z A;  2K22 A;  2IO1 B;  2JXT A;  3FKY A;  3NVW A;  5BMH A;  1E7P B;  4GB9 A;  2Y5P A;  1GB4 A;  3DQV A;  2RDH A;  3PV1 A;  1VR9 A;  2KAJ A;  4JX1 C;  3HHM A;  1QOG A;  4DQO C;  3BVM A;  2DEN B;  2Z0D B;  4RM9 A;  4HRS A;  2I38 A;  3N1Z C;  1HA5 A;  5DPW A;  3MC0 B;  2AYO B;  4NAW B;  4OVZ A;  5BYR A;  1XLN A;  4EFO A;  4GSW A;  4MM3 A;  4PS8 A;  1KLV A;  3PZ7 A;  2KJR A;  3LXF A;  5JXV A;  4AP4 C;  5HKH A;  3Q8F A;  2NBV B;  1KLU D;  2Z59 B;  1M94 A;  4C7Z A;  4HJK A;  2BS2 B;  1TS3 A;  2WYQ A;  1V9J A;  1WMH B;  3H7P A;  3R2I A;  4G3X B;  3V60 A;  2L1A A;  3TUO A;  2QIL A;  1UD7 A;  1SGH A;  2DAJ A;  2JF5 A;  4FHJ A;  1GAQ B;  2N9X A;  1C78 A;  4NAW A;  2L00 B;  4WAA A;  3PRE A;  3PVL A;  2AX5 A;  3SD5 A;  3BK1 A;  2J0K A;  4ASW C;  1ZE3 D;  4HWI B;  2K6Q A;  1I4R A;  1WE6 A;  3AEG B;  1UWX A;  1V49 A;  1JAL A;  3TIX A;  3DBR I;  4E71 A;  2KJH B;  2CR5 A;  2K8C A;  2VZK B;  5E6J A;  1CMX B;  2LGX A;  2J52 A;  4B9K A;  2FIF A;  1I4Q A;  4WQO B;  3W1Y A;  4IUM B;  1NYR A;  5C3J B;  1DOI A;  1WWT A;  3GS2 A;  1CJE A;  1QOA A;  2GB1 A;  1TS5 A;  3W1S C;  4DWF A;  4GDK B;  1FD6 A;  3LB8 C;  5G5H A;  3WCQ A;  2XNA C;  3NZU A;  2V3S A;  3N1Y C;  2WDR B;  1OFF A;  4HJG E;  3CSF A;  5AUK A;  1E6E B;  3NOB A;  4QAY A;  3AI5 A;  3KWL A;  3OG5 A;  4MH8 A;  1PUT A;  1P98 A;  3OAW A;  4ZRK A;  1K53 A;  3ABV B;  1B1Z A;  2JX5 A;  1ZOY B;  1E5W A;  1YQ3 B;  2DNF A;  1SIJ A;  4ZRJ A;  5CTR C;  3VUW A;  1WXA A;  2LHE A;  2N9P C;  2N4F A;  1KLG D;  4M8N A;  4HCN B;  5AZF A;  3SDL C;  3ENE A;  1RRB A;  2KHW B;  4JPS A;  2DZI A;  2PE6 B;  1NBF C;  1TT5 B;  3DHG C;  2LXC A;  5BO4 B;  1EUV B;  5I4D A;  4IM2 A;  3CF6 E;  2NS5 A;  4ITK A;  4RGO S;  2RD0 A;  1R4M B;  3IVF A;  1ZP0 B;  2FCS A;  3PLU A;  2ZZP B;  3H1U A;  3UQB A;  1SSN A;  2VH1 A;  3R3M A;  1XXG A;  3S2A A;  1FXT B;  4ACF A;  2KLG A;  3ALB A;  3MFG A;  1YJ1 A;  4G11 A;  1PGA A;  2JPH A;  4PYZ A;  3Q14 C;  4BOZ B;  5IP4 D;  2QJL A;  4Q2J A;  1J8C A;  3KW5 B;  2IYD B;  2M0A A;  3HM3 A;  1EO6 A;  2BS3 B;  4JL9 A;  1N5W A;  2LXA A;  2M8S A;  1AWD A;  3AE9 B;  3EGR A;  3U30 A;  2PMV A;  1SXT A;  3ZTD A;  3KUZ A;  3ZQ4 A;  1TKE A;  3K9P B;  4DXF A;  2JXX A;  3L54 A;  2FID A;  3DWM A;  4R3D A;  1J7A A;  1KRH A;  3GE3 C;  4HVB A;  4HDO A;  1KH0 A;  1VDV A;  4NQL B;  1WR1 A;  2OJR A;  3W2D A;  4IC7 B;  4C4V A;  1YD8 U;  1I35 A;  2V1Y A;  1D5Z C;  3AEE B;  2W54 A;  4LNK A;  1P3Q U;  3AB5 A;  1WXQ A;  3AE1 B;  1NEK B;  1N63 A;  1KFY B;  2L7R A;  1Y56 A;  3AV8 A;  4M01 A;  2MJD A;  2BYE A;  1VCB A;  3EHV A;  1BT0 A;  2HTH A;  1QOF A;  2WXP A;  2BT6 A;  3ZGZ A;  4RM8 A;  1WJ4 A;  3R2T A;  2RMM A;  5IA7 A;  2BVC A;  3Q6B A;  2GBK A;  3MP9 A;  3MHZ A;  3NUH B;  1T0Y A;  2MW5 A;  2KJ6 A;  5G2N A;  2ZCB A;  2KDE B;  3B2F A;  1RFA A;  2B76 B;  1G6J A;  3AED B;  4CYE A;  2BKR B;  3I9V 1;  2K6D B;  1F2R C;  3KLS X;  3GB1 A;  4NAM A;  4M00 A;  2Y3A A;  1E8X A;  3TEW A;  1QT9 A;  2YEP B;  2JRI B;  1JW9 D;  3IAM 1;  1ZDX A;  1T5X D;  1YOV B;  1FRD A;  1RLF A;  2WX1 A;  3TBL D;  2JY6 A;  1XCQ L;  2KN5 A;  2FCN A;  2BYT A;  1F9J A;  4K81 A;  4YT0 B;  4B95 A;  4MGY E;  2KFJ A;  3M62 B;  1Z2M A;  2BQQ A;  3DDC B;  4WUR A;  2KWV B;  3R7Q A;  2C5L C;  3IBE A;  4JGH B;  1UGJ A;  3PTF C;  4RNA A;  3T9L A;  4B6W A;  2KC1 A;  4C4V B;  2J4X A;  2GRI A;  1ZDV A;  3DBH B;  1EWC A;  4EE2 A;  5G5G A;  4US8 A;  1EU3 A;  4WQM A;  4A90 A;  1MG4 A;  1OGW A;  1WGG A;  2PEA A;  1VZ6 A;  2AQ1 B;  4ANW A;  2V4L A;  4EOY A;  1FCL A;  2DHZ A;  2K3U A;  3PRP B;  2FUG 1;  2MP2 A;  2LZ6 A;  4FHK A;  3ZO5 B;  1FMA D;  1BUI C;  2BTE A;  2D5G A;  4XZ4 A;  3V6C B;  2WQY B;  4G0N B;  4N59 A;  2PW9 A;  4C00 A;  1RAX A;  2AL3 A;  4IW0 A;  4ARI A;  4DHJ D;  1SF0 A;  1GG3 A;  3RPF C;  4BKS D;  4M0W A;  2E6X A;  3FC4 A;  2C60 A;  2UYZ B;  1VJK A;  3DWG C;  2NVU I;  4FUL A;  2NMQ A;  3CWI A;  2ZCC A;  1YQ4 B;  5CHV C;  1PYW D;  4WWP A;  2HE7 A;  3BYY B;  4XDD A;  2NR2 A;  1AW7 A;  5C2T B;  3QHT A;  4YSX B;  1IPG A;  3RT3 B;  3HM6 X;  4ZDV A;  1D5X C;  3LJ3 A;  1PDX A;  3QJZ A;  3VXW A;  1FCC C;  5D7G A;  2K9X A;  2WWZ A;  4FXC A;  1RWS A;  2V3P A;  4AWJ A;  5J17 A;  2LD9 A;  1FNV A;  3Q3M C;  4LNI A;  3UIN B;  3QCA A;  1P0R A;  4NQK E;  2D11 A;  1E7U A;  2I2Y A;  1WXS A;  2IO2 B;  4K7W A;  3VRA B;  2IO3 B;  2LI5 A;  1ISN A;  5C23 A;  5EE3 A;  1WZ0 A;  1WGD A;  3P4Q B;  3V61 A;  4BOS C;  1LFD A;  4XDC A;  1UZX B;  3I63 C;  2ACZ B;  4YL8 A;  2LHD A;  1TZO A;  4IKG A;  2KKC A;  3ZVV A;  1T3Q A;  3EC8 A;  5FK9 C;  5L83 A;  4C56 C;  3DBL I;  1YQB A;  1A70 A;  4E3C A;  1JCK B;  2WXK A;  3NVZ A;  3GOE A;  3PZ8 A;  4ANV A;  2ZNV B;  2R2Q A;  2DX5 B;  4C7Y A;  3VH4 B;  4JWU C;  4TSS A;  4MSM B;  1ZW7 A;  3LDZ E;  1WX7 A;  3PRZ A;  1WXV A;  4F8C B;  1V5T A;  2GOW A;  2M17 A;  2DZM A;  1WX9 A;  4XGA B;  3PSE B;  3KUC B;  3U7Z A;  3R8B A;  4XE0 A;  1UWM A;  2BBC A;  2WHI A;  5C1Z A;  4HKQ A;  3ZRF A;  2KWD A;  3AUL A;  1DOX A;  3ZIM A;  2G3Q B;  2QEJ C;  3UIO B;  3RN9 C;  2A5U A;  2JVC A;  1FM0 D;  2D07 B;  2UWQ A;  2LAS A;  2K0P A;  3W5V B;  4KVG B;  2PVO D;  1V86 A; 
#chains in the Genus database with same CATH homology
 3N1Z C;  2IND C;  2INC C;  3DHH C;  3RNF C;  2RDB C;  3GE8 C;  3GE3 C;  3Q3O C;  3DHG C;  1T0Q C;  3RMK C;  3Q3N C;  3I5J C;  3RI7 C;  3RN9 C;  3RNG C;  4P1C C;  1T0S C;  3Q2A C;  3RNA C;  3N1X C;  1T0R C;  3N1Y C;  3RNC C;  3N20 C;  3Q3M C;  3RNB C;  3I63 C;  4P1B C;  3RNE C;  3DHI C;  3Q14 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...