3DHHC

Crystal structure of resting state toluene 4-monoxygenase hydroxylase complexed with effector protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords toluene 4-monooxygenase hydroxylase alpha subunit
publication title Structural consequences of effector protein complex formation in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3dhhC00
1T0RC 3DHGC 3RI7C 3RNEC 3DHHC 3GE8C 3Q3MC 3I63C 4P1CC 3RN9C 1T0SC 3RMKC 3I5JC 3N1XC 3GE3C 3N1ZC 3RNAC 3Q2AC 3RNGC 1T0QC 3Q3OC 2RDBC 2INDC 3RNFC 3Q14C 2INCC 3RNCC 3Q3NC 3RNBC 3N1YC 3N20C 3DHIC 4P1BC
chains in the Genus database with same CATH superfamily
3HVDA 3IVFA 1UNSA 3RZFA 2MX2A 4YT0B 3HHMA 2MP2B 4C4VA 2JU6X 2IYDB 3AB5A 2KNBA 2K6DB 5CHWA 1TS2A 2PIAA 2WXLA 5EE1A 4E3CA 4G11A 3L0WB 1N62A 3KUDB 2KO3A 1Y56A 1FFVA 4WWNA 5J18A 2XN9C 2L52A 1HA5A 4ZRIA 2LGXA 2BF8B 5BYRA 3H7PB 4G3XB 1GC6A 4W9HA 2KMAA 4MGIE 2K5PA 2JSVX 2INCC 3SU8X 1T3QA 4RGMA 2WU2B 3A9JB 2YEPB 2BW2A 1HTOA 3QCAA 4MJSB 4W9KA 4EZKA 3W5VB 1XLOA 2CHXA 5C2TB 3KVFB 1I7HA 1MFWA 4LK0M 4ZHPA 5FR3A 4OZCA 4K81A 3M62B 2LI5A 1GNUA 3CIRB 1SEBD 2LMCA 4WURA 2ON8A 3WAPA 2ZVNA 4NQLB 5EE9A 4IG7B 1A70A 4EE2A 1V5TA 4NJ7A 2V3SA 3KUCB 4AP4C 4B6WA 3U7DA 3SD5A 3I9V1 4KX6B 4W9CA 4DK5A 2HTME 2JX5A 1LXDA 3AXCA 1E5WA 4NZLB 4FA6A 1J7AA 1L0VB 4HPMB 3C0RB 4ZRJA 2G4DB 4LJOB 1L6VA 4X57B 2KZRA 2B3AA 4BVUC 2JZ3B 2KFJA 1SSNA 4HXDA 3M63B 3VH4B 1R4NB 4KKIA 5EE0A 3Q3OC 1CJEA 1VJKA 1SE9A 1S1QB 1XO3A 4HLEA 1N5WA 4DHJD 2ZEQA 1YNTE 4FHKA 1D5ZC 2IO0B 2NPTB 1IBXA 3AEGB 1SE3A 1C79A 1BXTA 2IZVB 4BKTA 3HVZA 3AEBB 3RYTA 1ESFA 2MBBB 3ZYYX 3JYUA 2KJ6A 3Q8EA 2Z0EB 2K22A 4C4VB 5AUKA 5BYQA 3DVNU 2KOXA 5LNK1 2VRRB 5AUIA 5JH5C 2KLGA 4BOSC 4DHZE 4GDLA 2WDQB 2LGIA 3DBLB 1C1YB 2MBEA 2JUOA 1PGAA 1R7SA 3R7QA 3UI3A 1F9JA 5T8IA 1J19A 4M01A 2RPQA 2KC1A 5H92C 1L4DB 3VR8B 1WMHA 3B1LX 3T3NA 4BKSD 5G2NA 2RGFA 1MJDA 2IO3B 2LWPA 2MBQA 4RCOA 3APDA 5JZEB 4W9EA 3TCAA 2RPVA 2V3NA 1N63A 4KSKC 3SR6A 2X8XX 4LJPB 3AE6B 1HTQA 1MPEA 2D3BA 3WIMA 3R2TA 2KWDA 2Y5CA 3W1SA 2DAJA 2PVOD 1NYRA 3CSTA 2HD5B 4IWQA 3N1ZC 2AX5A 2JYEA 1OFFA 5JHAA 2BGFA 3WANA 4DHJB 4TMAB 2K8BA 2MBOA 4YL8A 1KLGD 1JW9D 3H9DA 4PT5A 1XLQA 2N9LA 4US8A 2M0AA 5HHDG 3DWGC 3NVVA 2WQYB 3ZUNA 1T6BX 1SBBB 3X0WA 4YSYB 1UWMA 2QDFA 1X1MA 4HPPA 2DNFA 4LNIA 4ANWA 2C7MB 2ZPYA 1PFDA 4RMAA 1QF6A 1DOXA 1ZP0B 3KQ4A 2Z8LA 2B76B 3TEZA 2RD0A 4TV3A 1AYFA 4RM9A 2KQSA 3ZXVA 4ICUA 2CJNA 3NS8A 2KANA 2FE8A 3ZNZB 4PYZA 2DENB 2GI9A 4NAWA 4A9AA 1HZ5A 1RWSA 1F1HA 1FM0D 1JRPA 1YN4A 4YWGG 4HDOA 2Z59B 3QQ8B 3PLUA 3P4QB 4XDDA 2LXCA 3V3XA 4L23A 1XT9B 3KYDD 1UBQA 2GBJA 2PTLA 2L00B 4JWSC 3P4SB 4IW0A 1UBIA 3HIZA 1TY0A 4EEWA 1IP9A 1K52A 3UF8A 1Y8RC 4NY0A 4RF0A 1FIQA 2KMMA 1LGRA 2KN4A 1UGJA 2BVCA 2PE9A 4GB9A 3NUHB 3H8HA 1ZOYB 4ANXA 4GDLB 3Q3JA 4WAAA 1WI0A 1TKEA 2YVCA 5LXHA 2LHEA 1E10A 1GPXA 3TEWA 3GOEA 4KGSA 3AU5A 1D6EC 3VRAB 1XXGA 3IAS1 1E8XA 4MH0E 2NMQA 4RGTA 2K6QA 1FCCC 5E6NA 2H88B 5D94A 3DWMA 2PMVA 3IAM1 3P63A 4ANVA 2L83A 2W3SA 2NVUI 2Y3AA 5E6OA 3DBHI 2DX5B 5AZHA 4AS1A 2DHZA 2LASA 2V4LA 2J0MA 2V4IB 1WX9A 4PS8A 2LRUA 1E90A 1DOIA 1Z5SB 3PZ7A 4XZ4A 1SXTA 2JWZA 2KJRA 2ZPNA 4A3OA 1WRDB 1YX6B 2HJ8A 2XNAC 2K0PA 4J6IA 4DXGA 3NZSA 2LD9A 1ACCA 2J7QB 2L7RA 2PEAA 3GS2A 1K50A 2XK5B 2QIEB 4RGOS 5DCNA 1Q10A 2UU7A 2E3TA 3DCGA 1T0YA 2IO1B 2JXXA 3E56A 2MBHA 1FFUA 4JPSA 2KTFA 4KV2A 1PYWD 3BYYB 2D2QA 3BY4B 3HK0A 4WH4A 2GLSA 2GBRA 3C8YA 5DPRA 4EOYA 2LUEA 1VZ6A 1TS4A 1WIAA 2EKEC 1YOVB 3Q8BA 4XC2A 4ZYNA 2KQ7A 1V81A 2FBWB 3FAHA 1PUTA 2WDRB 3WCQA 2BTEA 3L16A 4TQ1A 4XX5A 2A4ZA 3AE4B 4N59A 4JL9A 4MELA 3Q8CA 4YXDB 4FJZA 4ASWC 1WX8A 2K25A 2WX1A 3VTWA 2L32A 4Q2JA 2DYBA 4KIKB 2WXFA 3B0AA 3SDLC 2KX3A 5GXGB 3W2DA 3AE9B 4HJGE 2RR9A 3AE5B 2AQ1B 3H7PA 3KYCD 5HFYA 3HUIA 2KAJA 1MHHE 1FMAD 1OEYJ 2WLBA 2AYOB 4GOCA 4LLGM 4EZLA 3PSEB 1MVKA 2KX0A 4K7WA 2TSSA 1YMHE 1KF6B 3A9JA 3UIPB 5D3IB 5KHOA 2I1KA 4MJSA 3BVMA 2KDMA 3NVWA 2FNJB 2MSED 1TTNA 1V97A 2D07B 2FUHB 1R4NI 3NHEB 3OJ3A 2KTRA 4IWOA 4A3PA 3NVYA 4HDQA 2L05A 4MSMB 3V6EB 1F0ZA 1OQYA 4HRSA 5C1ZA 4XGAB 4FXCA 3WALA 5FK9C 1V86A 2BB6A 3ML9A 1WJ6A 5IN7A 4DWFA 5FR6A 2M0XA 1WRIA 4RH6A 4A90A 1UD7A 3OAWA 4K7UA 2RDGA 3PPAA 2RMMA 4PYUA 1WGKA 3JSVA 4DHZB 3FC4A 3DBRB 3RN9C 1XCQL 2LHDA 4WIPA 2AL6A 3N1XC 2BBCA 4WWMA 1YN3A 3LYYA 4RM8A 3U52E 3VQIA 4GLSC 3ZJVA 2PKOA 3M95A 3DBLI 4NJ6A 3AI5A 1VDVA 3EECA 4MDKE 1TS3A 4KVGB 3DHGC 3TUOA 3GZNB 1TS5A 3OJ4B 3P4RB 4URKA 3OG5A 2UWQA 1KOTA 2QEJC 2ZW0A 1TGZB 3PZ8A 2FCMA 3TEYA 1DYQA 3EUB2 2FAZA 3KUZA 2LRWA 3B2FA 5EE3A 4HK2A 4LDTB 3AU4A 2ZW1A 1HZ6A 5IA7A 1P9DU 2K3UA 2KD0A 4GIVA 2NR2A 5BYSA 3IHPC 3VTUA 2SEBD 4W9LA 3PVLA 3I63C 1WXAA 4YSZB 2OEDA 2BYEA 1V8CA 4KSLC 4CYEA 3ML8A 3DOWA 3MJWA 1YN5A 4JQWC 3DVGY 4MEMA 3SHQA 4IWPA 1C76A 2D5GA 1MI0A 3RI7C 1D4BA 3B08A 2BT6A 4M0WB 2LGDA 1JRUA 2NTSA 3RFZB 3AN1A 2CJOA 3PO0A 3D32A 1CZPA 3QARA 4GGQA 3ZDTA 3ONSA 3ZKJC 2LJIA 4KDIC 2V1YA 1QOGA 4C7ZA 4JGHB 1UH6A 2JF5A 2JWUA 3DVNV 3OLMD 2LVPA 3GE8C 2KFKA 2PLPA 3VRBB 4WJQA 3GP7A 4FULA 3ZLZA 1P1AA 4EZJA 1UUPA 4GU2A 2J4XA 2DZMA 3NOBA 4LNFA 3VFKA 3CF6E 2PVGC 2Y5BB 1KTKA 1UWXA 4YTPB 2KTRB 4HJKA 3TL5A 1GUAB 1KLUD 4E71A 1XLNA 2PJHA 2O6VD 3H6NA 1FNVA 1OTRB 2QC8A 1I4GA 3JW0X 4P1CC 3AE1B 2MW5A 5CHVC 2BS2B 3DDCB 3ZDMC 5G5GA 3UGBB 3Q2AC 3PTFC 3Q69A 1WGRA 3VHTC 2WS3B 3JSVB 1NDDA 1R4MB 3LXFA 1L7YA 2JPHA 3AULA 1L4ZB 1ZKHA 4K1RB 4PS3A 2PW9A 2CR5A 3ZVVA 1TJEA 5D6JB 2JT4B 5AEKB 3KW5B 5BMGA 4B9KA 1B1ZA 4R3DA 3AEAB 2WYQA 3ZTDA 3WA0A 3AH7A 1ZGUB 3Q14C 4NNJB 1LM8B 2V0GA 2LVQA 1YD8U 4ZOHC 1F77A 1NVID 4O1NA 1P0RA 3A1QA 1CQVA 2KDEB 1VR9A 1TKYA 4ICVA 1V5OA 4BKSA 3ZTCA 3MHZA 4ARCA 3I5JC 1GB1A 1TKGA 2J0JA 2LGSA 2BYFA 2WWZA 1SE2A 4F7ZA 1I4PA 2MQJA 1M4VA 1H8CA 1F2RI 3RT3B 3Q8FA 1B9RA 1FXIA 1ZDXA 2K8HA 3DBSA 4W9JA 4C80A 1QOBA 1WXSA 3ZIMA 2NS5A 4L1BA 1K8RB 4NJCA 3FILA 1WXVA 2WGSA 3TSSA 2KMCA 4JWUC 1EM7A 1FCLA 3ZNHB 2IBIB 1N6ZA 1RLFA 3DHHC 2G4SA 3AM9A 4K7SA 3T3OA 2MCNB 4AJWA 4W9GA 1E9MA 1I4HA 3AEEB 2AEHA 1SJED 2VH1A 4N58A 2YEPF 3NRZA 1RFKA 2KFKB 1XF5L 2NTTA 4KKJA 3ZRCA 2R2QA 4RGNA 2EMTA 5GMVA 4TUUA 3KWLA 2MRPA 1MHXA 3MJ5A 3RMKC 4DQOC 2WNMA 3PREA 1QOAA 3L13A 2DZJA 2LXAA 4HPLB 2XK5A 3VVWB 4FBJB 2GBMA 1WJUA 3KWVA 3AECB 2KHWB 2BKRB 4TSSA 1WGDA 1ZDVA 3NZ3A 2C60A 2G1EA 4WWOA 3LDZE 2D10A 2IY0B 5E6PA 4OVVA 1U4AA 3ABVB 2WDTB 1E8WA 1C4PA 4XWWA 2OHFA 5G5HA 1HE8A 4IUMB 1RAXA 2NBVB 1M94A 3TMPB 4FJVB 1JROA 2N0SB 3ALBA 2FUG1 3EHVA 4E74A 5IKCM 4EKUA 5J17A 3A1QB 4D2KA 2IGGA 4KIKA 2FIFA 4I6LB 4AJYB 2WXRA 4PK1A 1WZ3A 3UINB 4KZ0A 3P1MA 3WAOA 1UGMA 2PE6B 1NI2A 2K9XA 2KACA 2NBWB 1TBEA 1J0GA 2G9HD 4JLCA 2WXMA 2J52A 4DXFA 1VZ7A 2KT7A 2N7DA 3DBRI 4EFOA 2WP9B 2MWSB 4M8NA 2QHOA 4ANUA 4TKNA 2W3RA 4IDIA 1EF1A 2XBBC 3MC0B 3U2SC 3T8MA 1NEKB 2IPKD 3FILB 4LNOA 1A5RA 2KJHB 2J42A 4ZYSA 4K3BA 4K3CA 1P7EA 1QOFA 4MACA 1V9JA 5CX3A 3NVZA 2CKHB 1TZOA 1IUEA 1CMXB 2C9WB 4BBNC 4BFRA 2IDYA 1HXYD 1LFDA 2BPSA 4ARIA 3MC9A 2KN5A 2XEWA 4I6PA 3ZNID 1RYJA 2AWTA 4P16A 5FKAC 3L4PA 2I2YA 3BK2A 4OZAA 3L10B 4MT5A 3V62A 3DHIC 3DQVA 3PRMB 1C77A 2M1MA 3A9KA 3AEDB 1L0XB 4NAMA 2JZZA 3U8ZA 1BMLC 3AMZA 1V1OA 3UQAA 2D11A 1SE4A 1SF0A 2C7NB 4LNNA 1SGHA 1TZ1A 3B9JA 3VXWA 2G45B 2A5UA 3PHXB 2KC2A 4FHJA 1QLBB 3URYA 1WJ4A 2AQ3B 3U4EG 4DXAB 3R7RA 4FJYA 3R2IA 4A20A 2BB5A 4H2AA 1WZ0A 4EUTA 2V9HA 1XCTL 3CMMB 4WJPA 3HM6X 1PDXA 3VUWA 2KXJA 3L08A 4L2YA 2OJRA 3IFWB 3N3KB 1C78A 2REXA 4USAA 4BOZB 3HRDD 4W9FA 5AZGA 3IBEA 1JWAD 2KWUB 2JRHA 4HVBA 4G50A 4M0WA 4YSXB 2M8SA 1WGYA 4US9A 2MHJA 3AE7B 4C56C 1SJHD 2WXJA 3ZQ4A 1JWSD 1D5XC 2FCNA 4CHKA 1I35A 4MM3B 1GAQB 3ECIA 1V1PB 1JQ4A 4FLHA 4G0NB 1QT9A 2N9XA 2KVZA 4WJOA 3NG0A 1WGHA 4KGTA 1WFYA 3BZDB 3RPFC 1ROEA 3VAWA 4XE0A 3QJZA 1WX7A 5IOIA 3IG3A 4WQOB 4XWTA 4M8MA 1E8YA 4BKGA 2JQRB 2KDBA 1WJNA 3Q3NC 4PS7A 3SFEB 3N30A 1GJZA 2L76A 3ZRFA 1STEA 1RM6C 1NYQA 4P6VF 3N9YC 2KWVB 4OVZA 1DOYA 4M02A 2GBNA 2OOBB 1V2YA 3A9KB 2NCNA 3VR9B 3RNBC 3N1YC 4A55A 4LCDE 1EWCA 2CHZA 1GC7A 2NBUA 3VUXA 3M3JA 4W9IA 2D3CA 2KWCA 2DZKA 2KYWA 5IAAC 1WE7A 1BT0A 2DZIA 5E6JA 2N7EA 3JVZX 3OWEB 5G55A 1FEHA 3PT2B 2WDVB 2CU3A 2RSUA 2K8CA 4F1SA 5BMIA 1J7BA 2J53A 2WXHA 2M19A 4WAFA 4B0MA 1OEYA 2DYOA 4YTNB 4JE3B 5KHQA 4HWIB 1TY2A 4KGRA 2Q5WD 1H4RA 4B95A 4RF1A 1I4RA 1JWBD 1TYGB 3V61A 1ZW7A 3DBHB 1WSPA 2LJ5A 1K51A 1OGWA 1SIFA 2ASQA 1C3TA 2MLBA 3ZGZA 2DAFA 3VH3B 2O6VA 1T0SC 5D7GA 3MC8A 2RDBC 4HKQA 1ZXHA 4IM2A 3RNCC 1YX5B 1G6JA 4I6NB 3N20C 1AWDA 1J7CA 2IY1B 1SB3C 2FCQA 3O13A 3PV1A 2KK8A 3IT4B 4FADA 1N5XA 2WU5B 4UDUC 4C7YA 1ET9A 3NY5A 1WWTA 1ISNA 3ETRA 2WXKA 3B2GA 3APFA 4DDGD 2MEKA 1WF9A 3IXSA 2WXQA 2JY6A 1RRBA 1C4CA 1YQ4B 4IM3A 2M4NA 4DBGA 3NZUA 2ZVOA 1AN8A 3QIJA 3T9LA 2INPE 4IKGA 3HM3A 2AQ2B 5EDSA 4WJNA 3QA8A 4HCPB 5I4DA 4GMVA 2WHIA 1QZEA 2UYZB 2KLCA 3AEFB 1FNWA 2L3ZA 5D3DA 1JWUD 3PS6A 2BWFA 2JRIB 3A4RA 1KM7A 1E6EB 2WX0A 3R66C 4GSWA 2X38A 2FIDA 4ZHOA 1L0YB 3VTVA 2INNE 1UZXB 3CSFA 2ZNVB 2WXOA 2N1VA 3RNAC 4II2B 1PGBA 4P7IA 3H1UA 2QILA 2MJDA 3TIXA 3ZW3A 2OJWA 1XQQA 4NPNA 4WWPA 5HG2A 1OQRA 2M56B 2WXIA 3NJTA 4KDLB 2I38A 1ZE3D 4ZRKA 4M00A 2D3AA 1L5PA 5TSSA 1JALA 1WXQA 3BK1A 2O2VB 3O65B 1C4AA 3GB1A 2GMIC 3NS1A 3W9CB 2GBKA 4ITKA 4AUQC 2PPHA 3Q6BA 3RUIB 1GG3A 2DYMA 5JHBA 2ZNVC 2M17A 2ZCBA 1LO5D 1IGCA 4DDID 1FXTB 3QC8B 2R2OA 5JXVA 1FO4A 1UF0A 2BQQA 1GB4A 3R8BA 2RDHA 1VLBA 3EC8A 2KDFB 2O6VB 5HI1A 1E8ZA 2L8JA 1E0ZA 4N9F4 5DPSA 2L1AA 1VRAB 2BS4B 2N9KA 1AARA 2N4FA 3VDZA 2HJ1A 5H8YE 2DWQA 1NBFC 1WXMA 1DGJA 2ZZPB 3PRPB 3A33B 5TR5A 4OVUA 2N9EB 1T5XD 4C00A 3QAQA 3L54A 4HKZE 4KZCA 1I42A 1VD2A 1QKZA 3R3MA 4IC7B 3AE2B 1D3ZA 3PRZA 2FCSA 4ZDVA 3PHWB 5HKHA 2MJEA 3U7ZA 2HE7A 2HTHA 2N7JA 1L2NA 4HEA1 3ZXRA 4HROA 1FD6A 1NI3A 2QJLA 3RNGC 1JMLA 1HQRD 4GXBA 2I1JA 1EU3A 3EGRA 4YTMB 3APCA 3CWIA 3V05A 1KRHA 3EFCA 2ZJDA 3A4SC 5L95C 4B0EA 3MP9A 1NENB 3RNEC 1S3SG 1P98A 4BAXA 3UIOB 4J3OD 3Q8AA 3ZNGC 5J2RA 3N32A 3J9CA 1TIFA 1J8CA 3EFUA 3PLVA 2QSDA 1P7FA 2CHWA 3VUYA 4NQKE 1FRRA 5DPWA 1K53A 1EO6A 1FXAA 3BINA 3MTNB 2ICIA 1VCBA 1YQBA 3RD2A 1LQBA 2KVRA 2G3QB 3GE3C 5DPTA 2KDIA 1HEZE 2JZPA 2D3GA 4QAYA 3V6CB 4XDCA 1FRDA 1T0QC 1IBXB 1JCKB 3AV8A 2GOWA 4JX1C 2WXNA 3MHSD 1YJJA 1Z2MA 4MM3A 2BYTA 1WM3A 1V1PA 3BIID 1D5MC 1N61A 2ONQA 3AE8B 2K1FA 2CS4A 4ZRPA 4CQNA 2IJ0A 3PZDA 1SIJA 4IM0A 3P42A 4AWJA 4II3B 1WH3A 2JYTA 4FN2A 1EF5A 1E7UA 2N1WA 5C23A 3GZNI 1ENFA 3L17A 1I4QA 3TJPA 1JWMD 1XEEA 1V6EA 1KH0A 4MSQB 2J0KA 4GDKA 2Y5PA 4S0RA 1WMHB 2L0FA 1YJIA 3SEBA 1YQ3B 5AZFA 5C3JB 1WR1A 2LGYA 1V49A 1WYGA 2SAKA 1Q0WB 3RZWC 5CHFA 1F52A 4S17A 1RFAA 2W55A 2LZ6A 4N6EB 1TT5B 2MA9B 2LUMA 1PGXA 1OQQA 1GOZA 1EU4A 1FPYA 2EMSA 3AE3B 2VZKD 3W5UB 4A6QA 3PGEA 1L6UA 3H7SA 2IGHA 4LTUA 2Z0DB 2QCZA 2EKIA 2VH2A 3WAMA 3C19A 3X23A 4JIOU 1E7PB 3ZJTA 3RULA 2AL3A 3E9SA 1IGDA 4OHJA 1V80A 2ZCCA 1EWYC 3P4PB 3ZJUA 3KH0A 3I3TB 2YLMA 4OZBA 5MPOA 1KLVA 2KQ4X 1F2RC 1MG8A 2R61A 3EA6A 1ZXIA 3RCZA 1N60A 1BUIC 4LNKA 1PQSA 3U30A 3IT6B 4AQ7A 3W1SC 2BWES 1WY8A 2MP2A 2W9NA 1MG4A 4BBNF 1E7VA 2LVOA 5BMHA 1KFYB 2C5LC 1YIWA 1WGGA 4NAWB 5BO4B 2GB1A 1R4MI 3I57A 2GRIA 3BVZA 2WXPA 3QWZB 4ACFA 5LXIB 1Q5WB 2INDC 2JVCA 2V3PA 3DPDA 1IPGA 4A8XC 1WR6E 4XYCA 1I4XA 4LDTD 2LEKA 4HCNB 4OW0A 3K9OB 3QX1A 3KLSX 4GN1A 3S2AA 4MGKE 1ZUD2 2H89B 2EELA 2QMTA 2VZKB 2BS3B 1P3QU 3ZO5B 3BYTB 4GDKB 2JXTA 5LLIA 4WQMA 1IYFA 2DBYA 1WM2A 2CU1A 4ZRQA 4RNAA 1C9FA 4RFBA 4CO7A 3QHTA 1WYWB 3W1YA 2W54A 4AOFA 2K39A 3RNFC 2DLBA 1AW7A 3QK0A 1ZPSA 2BKFA 2MH7A 3UQBA 4REZA 1T0RC 1QQRA 2C7HA 3BVGA 1KJTA 2L0TA 3Q3MC 4F8CB 3ENEA 2MJ3A 2IO2B 3BWUD 4MGYE 2W82A 1FNUA 1WE6A 3MFGA 2HDEA 3SFDB 4IOIE 4TQ0A 5IO9A 1EUVB 4BZAA 2BYVE 1YJ1A 4MGZE 5CTRC 2IGDA 3TEXA 1XD3B 2KKCA 4W9DA 4P1BC 3DVGX 1XLPA 2E6XA 3V60A 2O2VA 2ACZB 1QILA 5IP4D 3TBLD 1UELA 2NPTA 5L83A 3K9PB 3FKYA 1ET6A 2LFIA 1CK1A 2N9PC 5D2MB 3LB8C 3LJ3A 4MH8A 1VZ8A 1Q1OA 3Q3FA 2WXGA 3P2BA
chains in the Genus database with same CATH topology
1T0RC 3DHGC 3RI7C 3RNEC 3DHHC 3GE8C 3Q3MC 3I63C 4P1CC 3RN9C 1T0SC 3RMKC 3I5JC 3N1XC 3GE3C 3N1ZC 3RNAC 3Q2AC 3RNGC 1T0QC 3Q3OC 2RDBC 2INDC 3RNFC 3Q14C 2INCC 3RNCC 3Q3NC 3RNBC 3N1YC 3N20C 3DHIC 4P1BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0R C;  3DHG C;  3RI7 C;  3RNE C;  3DHH C;  3GE8 C;  3Q3M C;  3I63 C;  4P1C C;  3RN9 C;  1T0S C;  3RMK C;  3I5J C;  3N1X C;  3GE3 C;  3N1Z C;  3RNA C;  3Q2A C;  3RNG C;  1T0Q C;  3Q3O C;  2RDB C;  2IND C;  3RNF C;  3Q14 C;  2INC C;  3RNC C;  3Q3N C;  3RNB C;  3N1Y C;  3N20 C;  3DHI C;  4P1B C; 
#chains in the Genus database with same CATH topology
 3HVD A;  3IVF A;  1UNS A;  3RZF A;  2MX2 A;  4YT0 B;  3HHM A;  2MP2 B;  4C4V A;  2JU6 X;  2IYD B;  3AB5 A;  2KNB A;  2K6D B;  5CHW A;  1TS2 A;  2PIA A;  2WXL A;  5EE1 A;  4E3C A;  4G11 A;  3L0W B;  1N62 A;  3KUD B;  2KO3 A;  1Y56 A;  1FFV A;  4WWN A;  5J18 A;  2XN9 C;  2L52 A;  1HA5 A;  4ZRI A;  2LGX A;  2BF8 B;  5BYR A;  3H7P B;  4G3X B;  1GC6 A;  4W9H A;  2KMA A;  4MGI E;  2K5P A;  2JSV X;  2INC C;  3SU8 X;  1T3Q A;  4RGM A;  2WU2 B;  3A9J B;  2YEP B;  2BW2 A;  1HTO A;  3QCA A;  4MJS B;  4W9K A;  4EZK A;  3W5V B;  1XLO A;  2CHX A;  5C2T B;  3KVF B;  1I7H A;  1MFW A;  4LK0 M;  4ZHP A;  5FR3 A;  4OZC A;  4K81 A;  3M62 B;  2LI5 A;  1GNU A;  3CIR B;  1SEB D;  2LMC A;  4WUR A;  2ON8 A;  3WAP A;  2ZVN A;  4NQL B;  5EE9 A;  4IG7 B;  1A70 A;  4EE2 A;  1V5T A;  4NJ7 A;  2V3S A;  3KUC B;  4AP4 C;  4B6W A;  3U7D A;  3SD5 A;  3I9V 1;  4KX6 B;  4W9C A;  4DK5 A;  2HTM E;  2JX5 A;  1LXD A;  3AXC A;  1E5W A;  4NZL B;  4FA6 A;  1J7A A;  1L0V B;  4HPM B;  3C0R B;  4ZRJ A;  2G4D B;  4LJO B;  1L6V A;  4X57 B;  2KZR A;  2B3A A;  4BVU C;  2JZ3 B;  2KFJ A;  1SSN A;  4HXD A;  3M63 B;  3VH4 B;  1R4N B;  4KKI A;  5EE0 A;  3Q3O C;  1CJE A;  1VJK A;  1SE9 A;  1S1Q B;  1XO3 A;  4HLE A;  1N5W A;  4DHJ D;  2ZEQ A;  1YNT E;  4FHK A;  1D5Z C;  2IO0 B;  2NPT B;  1IBX A;  3AEG B;  1SE3 A;  1C79 A;  1BXT A;  2IZV B;  4BKT A;  3HVZ A;  3AEB B;  3RYT A;  1ESF A;  2MBB B;  3ZYY X;  3JYU A;  2KJ6 A;  3Q8E A;  2Z0E B;  2K22 A;  4C4V B;  5AUK A;  5BYQ A;  3DVN U;  2KOX A;  5LNK 1;  2VRR B;  5AUI A;  5JH5 C;  2KLG A;  4BOS C;  4DHZ E;  4GDL A;  2WDQ B;  2LGI A;  3DBL B;  1C1Y B;  2MBE A;  2JUO A;  1PGA A;  1R7S A;  3R7Q A;  3UI3 A;  1F9J A;  5T8I A;  1J19 A;  4M01 A;  2RPQ A;  2KC1 A;  5H92 C;  1L4D B;  3VR8 B;  1WMH A;  3B1L X;  3T3N A;  4BKS D;  5G2N A;  2RGF A;  1MJD A;  2IO3 B;  2LWP A;  2MBQ A;  4RCO A;  3APD A;  5JZE B;  4W9E A;  3TCA A;  2RPV A;  2V3N A;  1N63 A;  4KSK C;  3SR6 A;  2X8X X;  4LJP B;  3AE6 B;  1HTQ A;  1MPE A;  2D3B A;  3WIM A;  3R2T A;  2KWD A;  2Y5C A;  3W1S A;  2DAJ A;  2PVO D;  1NYR A;  3CST A;  2HD5 B;  4IWQ A;  3N1Z C;  2AX5 A;  2JYE A;  1OFF A;  5JHA A;  2BGF A;  3WAN A;  4DHJ B;  4TMA B;  2K8B A;  2MBO A;  4YL8 A;  1KLG D;  1JW9 D;  3H9D A;  4PT5 A;  1XLQ A;  2N9L A;  4US8 A;  2M0A A;  5HHD G;  3DWG C;  3NVV A;  2WQY B;  3ZUN A;  1T6B X;  1SBB B;  3X0W A;  4YSY B;  1UWM A;  2QDF A;  1X1M A;  4HPP A;  2DNF A;  4LNI A;  4ANW A;  2C7M B;  2ZPY A;  1PFD A;  4RMA A;  1QF6 A;  1DOX A;  1ZP0 B;  3KQ4 A;  2Z8L A;  2B76 B;  3TEZ A;  2RD0 A;  4TV3 A;  1AYF A;  4RM9 A;  2KQS A;  3ZXV A;  4ICU A;  2CJN A;  3NS8 A;  2KAN A;  2FE8 A;  3ZNZ B;  4PYZ A;  2DEN B;  2GI9 A;  4NAW A;  4A9A A;  1HZ5 A;  1RWS A;  1F1H A;  1FM0 D;  1JRP A;  1YN4 A;  4YWG G;  4HDO A;  2Z59 B;  3QQ8 B;  3PLU A;  3P4Q B;  4XDD A;  2LXC A;  3V3X A;  4L23 A;  1XT9 B;  3KYD D;  1UBQ A;  2GBJ A;  2PTL A;  2L00 B;  4JWS C;  3P4S B;  4IW0 A;  1UBI A;  3HIZ A;  1TY0 A;  4EEW A;  1IP9 A;  1K52 A;  3UF8 A;  1Y8R C;  4NY0 A;  4RF0 A;  1FIQ A;  2KMM A;  1LGR A;  2KN4 A;  1UGJ A;  2BVC A;  2PE9 A;  4GB9 A;  3NUH B;  3H8H A;  1ZOY B;  4ANX A;  4GDL B;  3Q3J A;  4WAA A;  1WI0 A;  1TKE A;  2YVC A;  5LXH A;  2LHE A;  1E10 A;  1GPX A;  3TEW A;  3GOE A;  4KGS A;  3AU5 A;  1D6E C;  3VRA B;  1XXG A;  3IAS 1;  1E8X A;  4MH0 E;  2NMQ A;  4RGT A;  2K6Q A;  1FCC C;  5E6N A;  2H88 B;  5D94 A;  3DWM A;  2PMV A;  3IAM 1;  3P63 A;  4ANV A;  2L83 A;  2W3S A;  2NVU I;  2Y3A A;  5E6O A;  3DBH I;  2DX5 B;  5AZH A;  4AS1 A;  2DHZ A;  2LAS A;  2V4L A;  2J0M A;  2V4I B;  1WX9 A;  4PS8 A;  2LRU A;  1E90 A;  1DOI A;  1Z5S B;  3PZ7 A;  4XZ4 A;  1SXT A;  2JWZ A;  2KJR A;  2ZPN A;  4A3O A;  1WRD B;  1YX6 B;  2HJ8 A;  2XNA C;  2K0P A;  4J6I A;  4DXG A;  3NZS A;  2LD9 A;  1ACC A;  2J7Q B;  2L7R A;  2PEA A;  3GS2 A;  1K50 A;  2XK5 B;  2QIE B;  4RGO S;  5DCN A;  1Q10 A;  2UU7 A;  2E3T A;  3DCG A;  1T0Y A;  2IO1 B;  2JXX A;  3E56 A;  2MBH A;  1FFU A;  4JPS A;  2KTF A;  4KV2 A;  1PYW D;  3BYY B;  2D2Q A;  3BY4 B;  3HK0 A;  4WH4 A;  2GLS A;  2GBR A;  3C8Y A;  5DPR A;  4EOY A;  2LUE A;  1VZ6 A;  1TS4 A;  1WIA A;  2EKE C;  1YOV B;  3Q8B A;  4XC2 A;  4ZYN A;  2KQ7 A;  1V81 A;  2FBW B;  3FAH A;  1PUT A;  2WDR B;  3WCQ A;  2BTE A;  3L16 A;  4TQ1 A;  4XX5 A;  2A4Z A;  3AE4 B;  4N59 A;  4JL9 A;  4MEL A;  3Q8C A;  4YXD B;  4FJZ A;  4ASW C;  1WX8 A;  2K25 A;  2WX1 A;  3VTW A;  2L32 A;  4Q2J A;  2DYB A;  4KIK B;  2WXF A;  3B0A A;  3SDL C;  2KX3 A;  5GXG B;  3W2D A;  3AE9 B;  4HJG E;  2RR9 A;  3AE5 B;  2AQ1 B;  3H7P A;  3KYC D;  5HFY A;  3HUI A;  2KAJ A;  1MHH E;  1FMA D;  1OEY J;  2WLB A;  2AYO B;  4GOC A;  4LLG M;  4EZL A;  3PSE B;  1MVK A;  2KX0 A;  4K7W A;  2TSS A;  1YMH E;  1KF6 B;  3A9J A;  3UIP B;  5D3I B;  5KHO A;  2I1K A;  4MJS A;  3BVM A;  2KDM A;  3NVW A;  2FNJ B;  2MSE D;  1TTN A;  1V97 A;  2D07 B;  2FUH B;  1R4N I;  3NHE B;  3OJ3 A;  2KTR A;  4IWO A;  4A3P A;  3NVY A;  4HDQ A;  2L05 A;  4MSM B;  3V6E B;  1F0Z A;  1OQY A;  4HRS A;  5C1Z A;  4XGA B;  4FXC A;  3WAL A;  5FK9 C;  1V86 A;  2BB6 A;  3ML9 A;  1WJ6 A;  5IN7 A;  4DWF A;  5FR6 A;  2M0X A;  1WRI A;  4RH6 A;  4A90 A;  1UD7 A;  3OAW A;  4K7U A;  2RDG A;  3PPA A;  2RMM A;  4PYU A;  1WGK A;  3JSV A;  4DHZ B;  3FC4 A;  3DBR B;  3RN9 C;  1XCQ L;  2LHD A;  4WIP A;  2AL6 A;  3N1X C;  2BBC A;  4WWM A;  1YN3 A;  3LYY A;  4RM8 A;  3U52 E;  3VQI A;  4GLS C;  3ZJV A;  2PKO A;  3M95 A;  3DBL I;  4NJ6 A;  3AI5 A;  1VDV A;  3EEC A;  4MDK E;  1TS3 A;  4KVG B;  3DHG C;  3TUO A;  3GZN B;  1TS5 A;  3OJ4 B;  3P4R B;  4URK A;  3OG5 A;  2UWQ A;  1KOT A;  2QEJ C;  2ZW0 A;  1TGZ B;  3PZ8 A;  2FCM A;  3TEY A;  1DYQ A;  3EUB 2;  2FAZ A;  3KUZ A;  2LRW A;  3B2F A;  5EE3 A;  4HK2 A;  4LDT B;  3AU4 A;  2ZW1 A;  1HZ6 A;  5IA7 A;  1P9D U;  2K3U A;  2KD0 A;  4GIV A;  2NR2 A;  5BYS A;  3IHP C;  3VTU A;  2SEB D;  4W9L A;  3PVL A;  3I63 C;  1WXA A;  4YSZ B;  2OED A;  2BYE A;  1V8C A;  4KSL C;  4CYE A;  3ML8 A;  3DOW A;  3MJW A;  1YN5 A;  4JQW C;  3DVG Y;  4MEM A;  3SHQ A;  4IWP A;  1C76 A;  2D5G A;  1MI0 A;  3RI7 C;  1D4B A;  3B08 A;  2BT6 A;  4M0W B;  2LGD A;  1JRU A;  2NTS A;  3RFZ B;  3AN1 A;  2CJO A;  3PO0 A;  3D32 A;  1CZP A;  3QAR A;  4GGQ A;  3ZDT A;  3ONS A;  3ZKJ C;  2LJI A;  4KDI C;  2V1Y A;  1QOG A;  4C7Z A;  4JGH B;  1UH6 A;  2JF5 A;  2JWU A;  3DVN V;  3OLM D;  2LVP A;  3GE8 C;  2KFK A;  2PLP A;  3VRB B;  4WJQ A;  3GP7 A;  4FUL A;  3ZLZ A;  1P1A A;  4EZJ A;  1UUP A;  4GU2 A;  2J4X A;  2DZM A;  3NOB A;  4LNF A;  3VFK A;  3CF6 E;  2PVG C;  2Y5B B;  1KTK A;  1UWX A;  4YTP B;  2KTR B;  4HJK A;  3TL5 A;  1GUA B;  1KLU D;  4E71 A;  1XLN A;  2PJH A;  2O6V D;  3H6N A;  1FNV A;  1OTR B;  2QC8 A;  1I4G A;  3JW0 X;  4P1C C;  3AE1 B;  2MW5 A;  5CHV C;  2BS2 B;  3DDC B;  3ZDM C;  5G5G A;  3UGB B;  3Q2A C;  3PTF C;  3Q69 A;  1WGR A;  3VHT C;  2WS3 B;  3JSV B;  1NDD A;  1R4M B;  3LXF A;  1L7Y A;  2JPH A;  3AUL A;  1L4Z B;  1ZKH A;  4K1R B;  4PS3 A;  2PW9 A;  2CR5 A;  3ZVV A;  1TJE A;  5D6J B;  2JT4 B;  5AEK B;  3KW5 B;  5BMG A;  4B9K A;  1B1Z A;  4R3D A;  3AEA B;  2WYQ A;  3ZTD A;  3WA0 A;  3AH7 A;  1ZGU B;  3Q14 C;  4NNJ B;  1LM8 B;  2V0G A;  2LVQ A;  1YD8 U;  4ZOH C;  1F77 A;  1NVI D;  4O1N A;  1P0R A;  3A1Q A;  1CQV A;  2KDE B;  1VR9 A;  1TKY A;  4ICV A;  1V5O A;  4BKS A;  3ZTC A;  3MHZ A;  4ARC A;  3I5J C;  1GB1 A;  1TKG A;  2J0J A;  2LGS A;  2BYF A;  2WWZ A;  1SE2 A;  4F7Z A;  1I4P A;  2MQJ A;  1M4V A;  1H8C A;  1F2R I;  3RT3 B;  3Q8F A;  1B9R A;  1FXI A;  1ZDX A;  2K8H A;  3DBS A;  4W9J A;  4C80 A;  1QOB A;  1WXS A;  3ZIM A;  2NS5 A;  4L1B A;  1K8R B;  4NJC A;  3FIL A;  1WXV A;  2WGS A;  3TSS A;  2KMC A;  4JWU C;  1EM7 A;  1FCL A;  3ZNH B;  2IBI B;  1N6Z A;  1RLF A;  3DHH C;  2G4S A;  3AM9 A;  4K7S A;  3T3O A;  2MCN B;  4AJW A;  4W9G A;  1E9M A;  1I4H A;  3AEE B;  2AEH A;  1SJE D;  2VH1 A;  4N58 A;  2YEP F;  3NRZ A;  1RFK A;  2KFK B;  1XF5 L;  2NTT A;  4KKJ A;  3ZRC A;  2R2Q A;  4RGN A;  2EMT A;  5GMV A;  4TUU A;  3KWL A;  2MRP A;  1MHX A;  3MJ5 A;  3RMK C;  4DQO C;  2WNM A;  3PRE A;  1QOA A;  3L13 A;  2DZJ A;  2LXA A;  4HPL B;  2XK5 A;  3VVW B;  4FBJ B;  2GBM A;  1WJU A;  3KWV A;  3AEC B;  2KHW B;  2BKR B;  4TSS A;  1WGD A;  1ZDV A;  3NZ3 A;  2C60 A;  2G1E A;  4WWO A;  3LDZ E;  2D10 A;  2IY0 B;  5E6P A;  4OVV A;  1U4A A;  3ABV B;  2WDT B;  1E8W A;  1C4P A;  4XWW A;  2OHF A;  5G5H A;  1HE8 A;  4IUM B;  1RAX A;  2NBV B;  1M94 A;  3TMP B;  4FJV B;  1JRO A;  2N0S B;  3ALB A;  2FUG 1;  3EHV A;  4E74 A;  5IKC M;  4EKU A;  5J17 A;  3A1Q B;  4D2K A;  2IGG A;  4KIK A;  2FIF A;  4I6L B;  4AJY B;  2WXR A;  4PK1 A;  1WZ3 A;  3UIN B;  4KZ0 A;  3P1M A;  3WAO A;  1UGM A;  2PE6 B;  1NI2 A;  2K9X A;  2KAC A;  2NBW B;  1TBE A;  1J0G A;  2G9H D;  4JLC A;  2WXM A;  2J52 A;  4DXF A;  1VZ7 A;  2KT7 A;  2N7D A;  3DBR I;  4EFO A;  2WP9 B;  2MWS B;  4M8N A;  2QHO A;  4ANU A;  4TKN A;  2W3R A;  4IDI A;  1EF1 A;  2XBB C;  3MC0 B;  3U2S C;  3T8M A;  1NEK B;  2IPK D;  3FIL B;  4LNO A;  1A5R A;  2KJH B;  2J42 A;  4ZYS A;  4K3B A;  4K3C A;  1P7E A;  1QOF A;  4MAC A;  1V9J A;  5CX3 A;  3NVZ A;  2CKH B;  1TZO A;  1IUE A;  1CMX B;  2C9W B;  4BBN C;  4BFR A;  2IDY A;  1HXY D;  1LFD A;  2BPS A;  4ARI A;  3MC9 A;  2KN5 A;  2XEW A;  4I6P A;  3ZNI D;  1RYJ A;  2AWT A;  4P16 A;  5FKA C;  3L4P A;  2I2Y A;  3BK2 A;  4OZA A;  3L10 B;  4MT5 A;  3V62 A;  3DHI C;  3DQV A;  3PRM B;  1C77 A;  2M1M A;  3A9K A;  3AED B;  1L0X B;  4NAM A;  2JZZ A;  3U8Z A;  1BML C;  3AMZ A;  1V1O A;  3UQA A;  2D11 A;  1SE4 A;  1SF0 A;  2C7N B;  4LNN A;  1SGH A;  1TZ1 A;  3B9J A;  3VXW A;  2G45 B;  2A5U A;  3PHX B;  2KC2 A;  4FHJ A;  1QLB B;  3URY A;  1WJ4 A;  2AQ3 B;  3U4E G;  4DXA B;  3R7R A;  4FJY A;  3R2I A;  4A20 A;  2BB5 A;  4H2A A;  1WZ0 A;  4EUT A;  2V9H A;  1XCT L;  3CMM B;  4WJP A;  3HM6 X;  1PDX A;  3VUW A;  2KXJ A;  3L08 A;  4L2Y A;  2OJR A;  3IFW B;  3N3K B;  1C78 A;  2REX A;  4USA A;  4BOZ B;  3HRD D;  4W9F A;  5AZG A;  3IBE A;  1JWA D;  2KWU B;  2JRH A;  4HVB A;  4G50 A;  4M0W A;  4YSX B;  2M8S A;  1WGY A;  4US9 A;  2MHJ A;  3AE7 B;  4C56 C;  1SJH D;  2WXJ A;  3ZQ4 A;  1JWS D;  1D5X C;  2FCN A;  4CHK A;  1I35 A;  4MM3 B;  1GAQ B;  3ECI A;  1V1P B;  1JQ4 A;  4FLH A;  4G0N B;  1QT9 A;  2N9X A;  2KVZ A;  4WJO A;  3NG0 A;  1WGH A;  4KGT A;  1WFY A;  3BZD B;  3RPF C;  1ROE A;  3VAW A;  4XE0 A;  3QJZ A;  1WX7 A;  5IOI A;  3IG3 A;  4WQO B;  4XWT A;  4M8M A;  1E8Y A;  4BKG A;  2JQR B;  2KDB A;  1WJN A;  3Q3N C;  4PS7 A;  3SFE B;  3N30 A;  1GJZ A;  2L76 A;  3ZRF A;  1STE A;  1RM6 C;  1NYQ A;  4P6V F;  3N9Y C;  2KWV B;  4OVZ A;  1DOY A;  4M02 A;  2GBN A;  2OOB B;  1V2Y A;  3A9K B;  2NCN A;  3VR9 B;  3RNB C;  3N1Y C;  4A55 A;  4LCD E;  1EWC A;  2CHZ A;  1GC7 A;  2NBU A;  3VUX A;  3M3J A;  4W9I A;  2D3C A;  2KWC A;  2DZK A;  2KYW A;  5IAA C;  1WE7 A;  1BT0 A;  2DZI A;  5E6J A;  2N7E A;  3JVZ X;  3OWE B;  5G55 A;  1FEH A;  3PT2 B;  2WDV B;  2CU3 A;  2RSU A;  2K8C A;  4F1S A;  5BMI A;  1J7B A;  2J53 A;  2WXH A;  2M19 A;  4WAF A;  4B0M A;  1OEY A;  2DYO A;  4YTN B;  4JE3 B;  5KHQ A;  4HWI B;  1TY2 A;  4KGR A;  2Q5W D;  1H4R A;  4B95 A;  4RF1 A;  1I4R A;  1JWB D;  1TYG B;  3V61 A;  1ZW7 A;  3DBH B;  1WSP A;  2LJ5 A;  1K51 A;  1OGW A;  1SIF A;  2ASQ A;  1C3T A;  2MLB A;  3ZGZ A;  2DAF A;  3VH3 B;  2O6V A;  1T0S C;  5D7G A;  3MC8 A;  2RDB C;  4HKQ A;  1ZXH A;  4IM2 A;  3RNC C;  1YX5 B;  1G6J A;  4I6N B;  3N20 C;  1AWD A;  1J7C A;  2IY1 B;  1SB3 C;  2FCQ A;  3O13 A;  3PV1 A;  2KK8 A;  3IT4 B;  4FAD A;  1N5X A;  2WU5 B;  4UDU C;  4C7Y A;  1ET9 A;  3NY5 A;  1WWT A;  1ISN A;  3ETR A;  2WXK A;  3B2G A;  3APF A;  4DDG D;  2MEK A;  1WF9 A;  3IXS A;  2WXQ A;  2JY6 A;  1RRB A;  1C4C A;  1YQ4 B;  4IM3 A;  2M4N A;  4DBG A;  3NZU A;  2ZVO A;  1AN8 A;  3QIJ A;  3T9L A;  2INP E;  4IKG A;  3HM3 A;  2AQ2 B;  5EDS A;  4WJN A;  3QA8 A;  4HCP B;  5I4D A;  4GMV A;  2WHI A;  1QZE A;  2UYZ B;  2KLC A;  3AEF B;  1FNW A;  2L3Z A;  5D3D A;  1JWU D;  3PS6 A;  2BWF A;  2JRI B;  3A4R A;  1KM7 A;  1E6E B;  2WX0 A;  3R66 C;  4GSW A;  2X38 A;  2FID A;  4ZHO A;  1L0Y B;  3VTV A;  2INN E;  1UZX B;  3CSF A;  2ZNV B;  2WXO A;  2N1V A;  3RNA C;  4II2 B;  1PGB A;  4P7I A;  3H1U A;  2QIL A;  2MJD A;  3TIX A;  3ZW3 A;  2OJW A;  1XQQ A;  4NPN A;  4WWP A;  5HG2 A;  1OQR A;  2M56 B;  2WXI A;  3NJT A;  4KDL B;  2I38 A;  1ZE3 D;  4ZRK A;  4M00 A;  2D3A A;  1L5P A;  5TSS A;  1JAL A;  1WXQ A;  3BK1 A;  2O2V B;  3O65 B;  1C4A A;  3GB1 A;  2GMI C;  3NS1 A;  3W9C B;  2GBK A;  4ITK A;  4AUQ C;  2PPH A;  3Q6B A;  3RUI B;  1GG3 A;  2DYM A;  5JHB A;  2ZNV C;  2M17 A;  2ZCB A;  1LO5 D;  1IGC A;  4DDI D;  1FXT B;  3QC8 B;  2R2O A;  5JXV A;  1FO4 A;  1UF0 A;  2BQQ A;  1GB4 A;  3R8B A;  2RDH A;  1VLB A;  3EC8 A;  2KDF B;  2O6V B;  5HI1 A;  1E8Z A;  2L8J A;  1E0Z A;  4N9F 4;  5DPS A;  2L1A A;  1VRA B;  2BS4 B;  2N9K A;  1AAR A;  2N4F A;  3VDZ A;  2HJ1 A;  5H8Y E;  2DWQ A;  1NBF C;  1WXM A;  1DGJ A;  2ZZP B;  3PRP B;  3A33 B;  5TR5 A;  4OVU A;  2N9E B;  1T5X D;  4C00 A;  3QAQ A;  3L54 A;  4HKZ E;  4KZC A;  1I42 A;  1VD2 A;  1QKZ A;  3R3M A;  4IC7 B;  3AE2 B;  1D3Z A;  3PRZ A;  2FCS A;  4ZDV A;  3PHW B;  5HKH A;  2MJE A;  3U7Z A;  2HE7 A;  2HTH A;  2N7J A;  1L2N A;  4HEA 1;  3ZXR A;  4HRO A;  1FD6 A;  1NI3 A;  2QJL A;  3RNG C;  1JML A;  1HQR D;  4GXB A;  2I1J A;  1EU3 A;  3EGR A;  4YTM B;  3APC A;  3CWI A;  3V05 A;  1KRH A;  3EFC A;  2ZJD A;  3A4S C;  5L95 C;  4B0E A;  3MP9 A;  1NEN B;  3RNE C;  1S3S G;  1P98 A;  4BAX A;  3UIO B;  4J3O D;  3Q8A A;  3ZNG C;  5J2R A;  3N32 A;  3J9C A;  1TIF A;  1J8C A;  3EFU A;  3PLV A;  2QSD A;  1P7F A;  2CHW A;  3VUY A;  4NQK E;  1FRR A;  5DPW A;  1K53 A;  1EO6 A;  1FXA A;  3BIN A;  3MTN B;  2ICI A;  1VCB A;  1YQB A;  3RD2 A;  1LQB A;  2KVR A;  2G3Q B;  3GE3 C;  5DPT A;  2KDI A;  1HEZ E;  2JZP A;  2D3G A;  4QAY A;  3V6C B;  4XDC A;  1FRD A;  1T0Q C;  1IBX B;  1JCK B;  3AV8 A;  2GOW A;  4JX1 C;  2WXN A;  3MHS D;  1YJJ A;  1Z2M A;  4MM3 A;  2BYT A;  1WM3 A;  1V1P A;  3BII D;  1D5M C;  1N61 A;  2ONQ A;  3AE8 B;  2K1F A;  2CS4 A;  4ZRP A;  4CQN A;  2IJ0 A;  3PZD A;  1SIJ A;  4IM0 A;  3P42 A;  4AWJ A;  4II3 B;  1WH3 A;  2JYT A;  4FN2 A;  1EF5 A;  1E7U A;  2N1W A;  5C23 A;  3GZN I;  1ENF A;  3L17 A;  1I4Q A;  3TJP A;  1JWM D;  1XEE A;  1V6E A;  1KH0 A;  4MSQ B;  2J0K A;  4GDK A;  2Y5P A;  4S0R A;  1WMH B;  2L0F A;  1YJI A;  3SEB A;  1YQ3 B;  5AZF A;  5C3J B;  1WR1 A;  2LGY A;  1V49 A;  1WYG A;  2SAK A;  1Q0W B;  3RZW C;  5CHF A;  1F52 A;  4S17 A;  1RFA A;  2W55 A;  2LZ6 A;  4N6E B;  1TT5 B;  2MA9 B;  2LUM A;  1PGX A;  1OQQ A;  1GOZ A;  1EU4 A;  1FPY A;  2EMS A;  3AE3 B;  2VZK D;  3W5U B;  4A6Q A;  3PGE A;  1L6U A;  3H7S A;  2IGH A;  4LTU A;  2Z0D B;  2QCZ A;  2EKI A;  2VH2 A;  3WAM A;  3C19 A;  3X23 A;  4JIO U;  1E7P B;  3ZJT A;  3RUL A;  2AL3 A;  3E9S A;  1IGD A;  4OHJ A;  1V80 A;  2ZCC A;  1EWY C;  3P4P B;  3ZJU A;  3KH0 A;  3I3T B;  2YLM A;  4OZB A;  5MPO A;  1KLV A;  2KQ4 X;  1F2R C;  1MG8 A;  2R61 A;  3EA6 A;  1ZXI A;  3RCZ A;  1N60 A;  1BUI C;  4LNK A;  1PQS A;  3U30 A;  3IT6 B;  4AQ7 A;  3W1S C;  2BWE S;  1WY8 A;  2MP2 A;  2W9N A;  1MG4 A;  4BBN F;  1E7V A;  2LVO A;  5BMH A;  1KFY B;  2C5L C;  1YIW A;  1WGG A;  4NAW B;  5BO4 B;  2GB1 A;  1R4M I;  3I57 A;  2GRI A;  3BVZ A;  2WXP A;  3QWZ B;  4ACF A;  5LXI B;  1Q5W B;  2IND C;  2JVC A;  2V3P A;  3DPD A;  1IPG A;  4A8X C;  1WR6 E;  4XYC A;  1I4X A;  4LDT D;  2LEK A;  4HCN B;  4OW0 A;  3K9O B;  3QX1 A;  3KLS X;  4GN1 A;  3S2A A;  4MGK E;  1ZUD 2;  2H89 B;  2EEL A;  2QMT A;  2VZK B;  2BS3 B;  1P3Q U;  3ZO5 B;  3BYT B;  4GDK B;  2JXT A;  5LLI A;  4WQM A;  1IYF A;  2DBY A;  1WM2 A;  2CU1 A;  4ZRQ A;  4RNA A;  1C9F A;  4RFB A;  4CO7 A;  3QHT A;  1WYW B;  3W1Y A;  2W54 A;  4AOF A;  2K39 A;  3RNF C;  2DLB A;  1AW7 A;  3QK0 A;  1ZPS A;  2BKF A;  2MH7 A;  3UQB A;  4REZ A;  1T0R C;  1QQR A;  2C7H A;  3BVG A;  1KJT A;  2L0T A;  3Q3M C;  4F8C B;  3ENE A;  2MJ3 A;  2IO2 B;  3BWU D;  4MGY E;  2W82 A;  1FNU A;  1WE6 A;  3MFG A;  2HDE A;  3SFD B;  4IOI E;  4TQ0 A;  5IO9 A;  1EUV B;  4BZA A;  2BYV E;  1YJ1 A;  4MGZ E;  5CTR C;  2IGD A;  3TEX A;  1XD3 B;  2KKC A;  4W9D A;  4P1B C;  3DVG X;  1XLP A;  2E6X A;  3V60 A;  2O2V A;  2ACZ B;  1QIL A;  5IP4 D;  3TBL D;  1UEL A;  2NPT A;  5L83 A;  3K9P B;  3FKY A;  1ET6 A;  2LFI A;  1CK1 A;  2N9P C;  5D2M B;  3LB8 C;  3LJ3 A;  4MH8 A;  1VZ8 A;  1Q1O A;  3Q3F A;  2WXG A;  3P2B A; 
#chains in the Genus database with same CATH homology
 1T0R C;  3DHG C;  3RI7 C;  3RNE C;  3DHH C;  3GE8 C;  3Q3M C;  3I63 C;  4P1C C;  3RN9 C;  1T0S C;  3RMK C;  3I5J C;  3N1X C;  3GE3 C;  3N1Z C;  3RNA C;  3Q2A C;  3RNG C;  1T0Q C;  3Q3O C;  2RDB C;  2IND C;  3RNF C;  3Q14 C;  2INC C;  3RNC C;  3Q3N C;  3RNB C;  3N1Y C;  3N20 C;  3DHI C;  4P1B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...