3DHJA

Beta 2 microglobulin mutant w60c
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDCSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title DE loop mutations affect beta2-microglobulin stability and amyloid aggregation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dhjA00
5CEYA 1TNNA 1KLGB 4L3EE 2IGFL 3CK0L 1IAKA 1HZHL 4PBVC 1BAFH 2CMRL 2X4UA 3LB6D 4ZS6C 1P6AB 3FOMA 2V7NA 5DC9B 4ZSOB 1JN6A 4BZ2H 1K5NA 1UFUA 3ARRA 5ESVA 4YHMH 1NEZG 2JTDA 4QRUA 4L5FH 3FFDB 5FA3A 1ODAA 4LGSB 2VXTL 1PDKA 3OR7A 2EDYA 1KG0A 3JWOL 4HMEA 4NNYA 2QEJA 5H94B 3RKDC 3GIVA 5KG9A 2ZUWA 3ARBB 3KXFE 4ZTPL 2ICEA 4G7YH 3KJ4C 5B8CB 4PS4L 5GISH 4Q9RL 3TBSB 4WY7H 2NX5B 3O9WA 4KU1A 3B4NA 5A2KH 3BN9D 4QRTB 3SKJL 4NT6B 1JJUA 3IDMA 3OAUH 3RTQB 5KVMC 2HJFB 1L0YA 2P1YA 1DBBH 4X6CF 4Z7WE 1A7PL 5FM5O 1E4XL 4HUVA 1TZGH 2H9GA 3QNZB 4R3SA 2A6DA 4M5YH 5CWSB 1D9KB 1D6VL 1XGYH 1A1OB 1WIOA 1V7MH 4EOWH 1UWEL 4L8DA 2W0LA 5KTEL 5B8CA 3AREC 4JE4B 3TBSA 4QYOA 4HUXB 4IMLB 2NX5A 3IDIA 3CSYB 4KDTC 2BDNH 4GW4B 1HXYB 3I75A 2DAVA 4U2YA 4XTRD 4P3DB 5MI0B 5K59F 1YJDL 1RSFA 3KXFD 3ET9F 2NXZD 3EJZC 3IKCA 4JFYB 3CFDA 3QNZA 5H37G 2BY1A 4PRIE 4AY0A 3DRTA 4OZFA 1DP0A 5C07D 3P9LA 3PGCA 3V7AE 5JXEA 4HUXA 4IMLA 6CGTA 4H5SB 1GGIH 4K71C 5JHDB 4WRLA 3F8UB 3NGBC 2GYSA 5HPMB 1WITA 3L3IB 3BH9A 4PJAE 2GFBB 1IGYB 5CZXC 5ALBH 2GTZB 4R7DA 1WT5A 3O3UN 4AEEA 1QG3A 4JFYA 3T4YA 4G6KH 4NCC1 1ZGLP 3QDMD 3MLPA 5IROA 1EAJA 3QISA 2ADJA 1NFDA 4GW1B 3Q5TA 5JPNB 3OKMA 4MS8C 4P4RA 2LAAA 2AABH 4P99A 1RY7B 1CLCA 5JHDA 4WUUD 1DEEA 1MCJA 1TJGL 5KOMC 1MFCH 3QWRA 3OGCA 1HOCB 3VFVB 1E6JH 1IGYA 1HEZB 1HKLL 4OTXH 4PRID 2Y9RT 3BPNC 1HINL 4LHUA 2XNAB 4NC1C 4R90L 3RGVA 4HJJH 3GK8H 3MOQA 1CXEA 2IAMC 3BDYL 1WAAE 4TTDD 3KPOB 4G3YH 5CEXB 1CIUA 4GW1A 3UTTA 3UTOA 5DSCA 3VRIA 4ACPA 1D5ZB 1JGLH 1U8NB 4XNXL 4HXBL 5DK2B 3IS1X 4MXVF 2UY7A 4XGZB 4XPTH 5HHXL 1LEIB 1UM5L 2DQIL 1BZQK 2KQNA 4G6AC 4CGTA 1CXIA 3O3DB 1HOCA 4C55A 4D94A 1MCPH 3QWOB 3AS0A 4HJGB 1NCWL 4JGUA 1HWHB 2ZSVB 4O02L 1ZLVH 2XA8H 4PJHE 1XR8B 3CIQA 3MJ9L 4N8VB 1TPXB 4M7LT 1F4XL 2A6JB 1A7NL 3L9RB 1HKFA 5MEPB 3DLQR 4FOMA 4HH8A 1U8NA 3HPJA 4C4KT 4KRMB 4Y88A 5DK2A 1X5KA 3QUKA 2Z91B 2VLKA 4JDZB 5FYKD 4NWTH 4PLJC 5I75B 2CXGA 1J5OL 3QWOA 4HKBB 4Y4HD 2E8YA 4HJGA 1IEAB 2XQBH 5C8JB 3PE9A 1RUKL 2L0DA 5TFSL 3CUPB 5SV4A 2JJTC 1XR8A 5CD3B 3HHRB 1YMMA 2DI7A 1MJUH 1WISA 2DQJL 4N8VA 3GI9H 5D1ZA 3T1WA 3ULUL 2VLRA 1NGQL 2FIRT 4M6NH 5LXGL 2V5SA 5D1XD 1FO0H 4PV9B 2X7LA 2FBJL 4WI8A 2LTQC 3W11D 2FZ3B 2XZQL 4KUCF 5J9PB 2Z91A 4KQ4H 4FHBD 3CX5K 3P73A 3QIBD 1W0VA 2B8OT 2A9NL 2V5RA 1JMZA 4PJ7E 5C8JA 4LPYA 4P4KB 4WTWA 1KACB 5CD3A 4XC1H 4M3JA 3T0AA 3QJFA 3NVQA 5I8OH 3LN4B 4RGMC 5DFTA 5HGGS 3HAEH 5ILTH 4PV9A 2ZNWA 5TH2B 1NUDA 2DBLH 5T3ZE 1BVLA 4KDVA 4QY8B 5EBLB 2AEPH 3UO1L 3QR2A 4DKEH 4OCNC 3RA7L 2OR9H 4M7JL 3DGCR 4NZRL 4KTDH 1NJ9A 2N56A 4FN0A 2DQEH 4O58H 1T2XA 3P3YA 4NRYA 4NQVA 3LN4A 3SDAB 5F44A 3B9KA 2CK0L 3K81A 1C5CH 4YR6B 4LLQB 4KMTL 4CMMB 2QHLA 3Q6GL 5HYQB 1T0PB 3FO2B 4QY8A 3EDFA 2ATPA 4HXAH 3SE8L 1C8PA 4UNVA 3TN0C 2PYFB 2FHBA 4WIQA 4HF5L 1F58L 1QFHA 4L8BB 3WXWL 4N1CA 2BY3A 4IRJC 4PYHA 5C2BL 5BZDB 4QT5B 4XVTL 1XGPB 4NQED 3BT2H 4LLWB 4BKLB 3RWDB 5DD3L 4FMKA 4I48A 1V3KA 4X6CE 3SDAA 3TNNB 1FAIL 3V0WL 1KBGL 1SM3H 4YR6A 4RX4A 4ETQB 3VH8B 4NNXB 5EN2B 4B50A 3G08B 3FO2A 4NHUB 4U0RC 2A74B 4AMKL 2SEBB 2H1PL 3BKYH 5BRZB 4Q97A 2W9EL 3OMZA 2HN7A 3G6JA 3UJJL 1NAKL 2NMSA 2W65B 3MLYL 4XNQA 4KHXH 3VXNB 4HWEH 2UV3A 3Q1SH 1FRGH 1FDLH 4JG0L 5C0GB 4RAHA 5F7NC 3KYMA 4QT5A 1XGPA 5DRWB 4FXKB 5DT1L 5K59E 3N0PB 4BUHA 4EI5C 1F3RB 1MFNA 4GMSH 4KZEL 5A16A 3LS5L 4YXHL 1CVSC 2FJFA 5EN2A 3G08A 4NHUA 4ZPTB 2A74A 3CDGB 4HCRL 4H0IA 4Q74A 4QXWA 4F8QA 3IXTB 4QRRB 2FX8H 4XVSH 1R3HA 3A6BL 4HHAB 5C6TH 2W65A 3QA3B 2OJZH 4HBCH 4Y1AE 4L3EB 1N4XL 4Y5VC 4R97B 4TSAL 4FQIL 5I9QC 5C0GA 1MJ7L 2HVKA 5DRWA 1DN2A 5EOQH 1X9QA 2MHAA 5ANME 1J0HA 1DDHB 2FD6H 3CDGA 4JO1H 4NQSA 3N1GC 3V5KB 4KVNH 4GRLB 4MWFB 4NHCL 5E6IC 2YD4A 5M94B 2C26A 2OL3H 4HHAA 5T33H 2UZXB 5IMOA 3UTSA 4DCQA 3QB7C 3QA3A 3AMLA 4MAYC 1FNLA 3KXFB 4NJ9H 1X5IA 5IVXE 1TFHA 1XGUB 4N0UA 4Y19D 5DJ6B 1MRFH 2IEPA 5ITBH 1CL7H 4M7LH 3MX0A 4NQDE 3QCTL 2O5ZH 3O6FC 1EX0A 4OZ4A 5HHOE 4Z7WB 3WIHH 4Y1AD 5HVFB 4GRWH 3LN9A 1S9WB 1NLBH 2JELL 1K9TA 3U82B 2AEIT 4MXVE 2KQMA 3O0RL 5DWUL 1L9MA 1OSPH 1OGTB 3GRWH 1CLZL 5BZWB 5JTWA 1YEDB 2ZCLH 3U1SL 3OJMB 5CILH 3KPNA 1OPGL 5JXAH 1VB9A 3TH3T 4C56D 5L8KB 2P7TB 2J8UE 2J12B 3QPXL 3IDNB 3HLAA 3SY0B 2Q8AH 1CGTA 3HR6A 4HD9A 1NEUA 4X5LA 1G6RA 1L6ZA 1NL0L 2MPAH 3A0OA 4H8WH 4Y5XA 4AENB 3FN0H 1D5XB 4NP4L 2W0FA 4EN3A 2AS5M 2DS4A 5I1JL 1IC5H 1WZLA 3O11B 4S0SD 5C0AD 4DQOH 4O2EB 1TENA 4LDLB 4PJAB 1RZ8A 2X4PB 1AGFA 3MLXL 4WI2A 3WSQH 1FJ1A 1S78D 1LMKA 5GGRA 1CK0H 4JVUA 4XMPL 4DGIH 5I1EH 3NTCL 4HGWB 4MA1C 1D5XA 1MPAH 1WCBB 3S4SG 1VGKA 4X5XA 2YA2A 1BREA 3ZKMC 3UTZA 4UIKL 1U42A 3Q5OA 5F7KC 5IEHA 3OXSB 1ZHLB 2OTUB 2CDEA 4KGJA 2EH8L 3D0VA 1XGRB 3DYOA 1AKJD 5CIPH 1OQXA 3RVUC 3DSNA 2JJSC 2B4CL 4Y4HB 3B9VA 3B5GA 4U1IB 1DBAL 3UPAA 3MGAA 5E5MA 4ONHA 5JQ6H 2ICWJ 1EGJA 1F3DH 1FNAA 1G7QA 2NTSP 4KJPC 3V4PL 3VFMA 5L88H 2V5TA 1N6UA 2FWOB 4XPBL 5EC2B 2GK2A 1TIUA 2ZSWB 4OIBA 3UJIL 3GSXB 1QFWM 3SKNA 4FTVD 5DHYA 4PRDB 2OTWA 3E3QC 4PB0H 3C60A 4C83A 1ZHLA 2EDNA 2EECA 1S3KH 3DOSA 3U7AA 1CDJA 4KUCD 3L7EB 4JKLA 3UDWC 4ODHH 4PJHB 3OKNA 5DQDL 1BIIA 4ZUTB 3P11L 4NKDB 1NBVH 3HCVA 4JPIB 1RZ7H 1S7QB 4PRPE 1H5BB 2BVOA 5FYJD 4MB5A 1Q94B 1KJVA 4OF5A 1BZ7B 2E27L 4DVBB 1KEGH 4YHIA 1KN4L 4PRDA 1YA5A 3H2WA 5GSRA 1KB5L 1UGNA 3MNWB 1CGUA 4LCWA 5IQ9B 1LP9F 4LFHD 4J3WA 4JHBA 3X17A 2OMNA 3B2VH 3L7EA 5E8OB 2VDPL 4TPRH 3D69A 5DO2C 4M00A 4F15C 3BP6A 3S5LB 4NKDA 4JPIA 3D0LA 1H5BA 4OF8A 2EE2A 4WEBL 3RWFB 4LEOA 1IC7L 2DM7A 2DD8H 2Q76B 5MEOB 3HNSH 5D7LA 2MCPH 4LVEA 1UWGL 3SDDB 3BZDA 1L6XA 5IQ9A 4I3GA 4PJ7B 2FCBA 1EMTH 1T04B 3FAXA 3OKOB 5E8OA 4K94H 3DROA 1UT9A 2XZCH 3DXAE 3S5LA 3QO1A 1QNZL 2QJDA 3HUJA 1NGZB 5HDBF 1GZPB 1G6VK 1YPZE 5K9KA 1BJ1H 1YC7A 5D1QA 2Q7NA 2PTVA 3SN6N 3SDCC 5K33A 1EHLL 3QQ9D 4LP4A 4PJGF 2F5BH 1JGVL 1MY7A 3WKMH 2H41A 5EU3B 4LRIA 1RZKC 2ZUQB 2FH6A 1QFWI 5EO9A 2XXCB 2NY1C 4X7TB 4MD0B 4D9LH 5GRVL 2VXQL 4ODWB 5TDOB 4EDWH 2YRLA 2F53D 5GGTL 1MLCB 1VFAA 2GAZA 1MJJA 1EFQA 4YLQT 5C0IA 3GMPB 3BDBA 3F12A 1KJ3L 1BQLH 4WO4D 4P2RA 4WWKA 3LKOB 5T5FH 3PV6A 4AT6B 2AJ3B 4BQCA 4MD0A 5GRJL 4W4NA 3E1F1 5E2JA 4M3KB 2IH1B 4XP5H 3FHAA 1T2QL 3V6ZA 3SOBH 3VXUE 4DFIA 5AD0B 3GMOB 1IZJA 5T1KA 3X12B 3VGAB 4C59B 4ODWA 1TETH 4LLDA 5TDOA 1MHEB 5B38G 3CMGA 1NUGA 4WU5A 5E8EB 1KTLB 2E6QA 1JPFA 3QUXD 4E41A 3ZT5A 2R2CA 2GHWB 3QIUB 3SO5A 3P0VH 1UWXK 4XX1G 1Z6JT 1Q0XL 1LD9B 1RUMH 4FNLL 3FFCD 3OF6D 4FXLA 5JW4M 1KIUA 4YDLC 2Z92B 3EO9H 2Q7YA 4G42B 5CZVL 1NGPL 5E2TL 3I6KB 1MHHB 2OR7A 1F90L 5E8EA 3SDXF 2Q3AA 4I2XA 3MRRA 5A3ID 5JW3H 2X4RB 3JWDL 3GBML 3QIUA 4HPYH 4U7MA 3SO3C 3PDDA 3VXUD 3I6LD 4IOIB 2YXFA 1AP2B 4TUKH 4I77H 4PJXA 2ZUTA 2P5EA 5HHNA 4GSDH 1B4JH 1FNSL 5FUZH 3ECBA 1U8MB 4UT6H 4XP9H 2ZZUT 1MHHA 1I8IB 3TYFA 5LWYH 4H26A 2XIDA 3QSKB 3D18A 4JM4H 2XKNB 1QSEA 2Q86B 4PY7B 3OPZL 5D7IE 2X4RA 1KTDB 2N1KA 1F4YH 4RDQF 3IFLL 2FECI 3QHZH 1ZEAL 5IKCB 1AP2A 5FIEA 4G7VH 3FB6B 1RUAL 5IVXB 1YZZA 5CP7B 5KANG 2Z31C 1NBYA 5CINL 3T1FA 1I8IA 1DBJL 3QEHA 1NGYA 3TPKA 4JN1L 4NQDB 2VC2L 1UA6L 2Q86A 1KTDA 5HHOB 2WQ8A 3TT1L 4OFYA 4N0CC 4WTZG 3MGTB 4GKOA 5JIKA 1P6FA 3PWVA 4PPTA 4HC1A 4M6OL 1J8HE 3GSOB 2FR4A 5D7JA 1TJHL 2GUOB 4LHQB 4OCRL 5CP7A 4ZAKA 4X80L 3GIZH 1NSNL 1H3TA 4N8PA 4H88H 2MQCA 1N5YH 3SGKA 4YAQA 4BSWA 25C8H 4I18B 3M45A 5T5NF 4U4BA 1FGNL 2J8UB 1KEML 3REVA 5CHNB 3CPLB 5LAXB 5F7HA 3VXTA 1F4AA 4WU7B 4BUGA 2YBRA 3S36L 1ITCA 4JY6B 1J05A 2MJWA 5IP4A 1WFUA 4GT7A 3PNWB 4P5TA 4CMHC 4ZS6D 3DO7A 5BO1L 5T3ZL 4LNRB 1P2CB 3V5HA 4PY8I 4ZS7L 5KSAC 1MFEL 4GAGH 3NCJL 3FMGL 3MRBB 1U92B 4PGDB 3CPLA 1XH3B 3RNKA 5IQ7L 5D9SB 3DNKA 4LARH 4QCIB 1KPRA 4ALAH 1CE6A 1N0XL 4HPOL 5ESAB 4JY6A 3BFOA 1T89C 3QIWD 2P24B 3TVMD 3D48R 1CDYA 4BZYA 2AK1L 1FZJA 3PNWA 1ZT4B 4XCFL 2WQRA 3NPSB 5ACMA 2W91A 5JLZB 4LQFL 2VDQH 1Y6NR 1E6OH 5IVNA 3HG1E 4R26H 3HMXA 3VE0A 4UIMB 1I7RB 5E8NB 3RY5A 1CFBA 3MRBA 3LIZL 3OJ2C 4XZUA 3EFDH 4LSSH 2R2BB 3QEUB 1VENA 1FGVL 1GC1C 4KJWD 4UB0L 5ESAA 3PDOA 3RL1A 1T7XA 4O00A 2X1PA 4FZ8H 1ZT4A 5ETUB 2BVQA 2A38A 3MV9E 4PRAB 4WUKH 2HT2D 2WINA 3O6ML 2GJ6A 2WBJB 4QRQA 3MOBL 2GTWB 2X9XA 2Z93B 3IRPX 4KRPC 3EJZD 2RHEA 3Q2CA 4NJAH 5SWZE 1L0XA 3RWJB 4ZUSA 1IGFL 1YEHL 4PRPB 5F7DA 1CLOH 2R23A 5EOCH 3MMEB 3LN5B 2ITDB 4NC1E 1DQTA 4HEME 2I9TB 3CFCH 1V7NH 1YYLL 4UQ3B 1IAIH 4CJ1A 4CDGC 4EXPX 5E1AB 4G6JH 4I3RH 4UINL 2IF7A 4ZYKA 1YEJL 1G9MH 1YY8A 2NY3C 3CX5J 5ID0B 3QFDA 5CZXD 4NYLB 2YD3A 5BVPH 2Z93A 2PKDA 4RMWA 4UBDD 1QR4A 1DUZA 1IGIH 7CGTA 3H7BA 2BOCB 4KK8C 3MLZH 4ZFGL 2OSLB 2IPKB 1X5ZA 2ITDA 3MV9D 1DLFL 4O5LL 1C5BL 3C5SB 5F3HA 4M6ML 1E28B 3WLBA 1MEXH 2B5IB 5DUMH 4DKFL 4XT1C 2R8SH 3CLFH 5C0FA 1K4CB 1OAYL 1RU9L 4FFVC 1BJ8A 3DXAB 4P9ML 1I1FB 1J0YA 1ZE3C 4NFBA 2DDQL 3BKJL 4M1CC 3AS3A 1CFNB 1YPZB 2IAMD 4ORGA 4KROC 4K9EH 1S7VA 3Q5YA 5GGSA 1T1ZB 1IBGH 4I1NB 3MJ7A 5I18L 5F88B 1ZS8B 3QG7H 2C3WA 1S7RA 5ABDE 4OLVL 4G6AD 2VXSH 3LEYL 1OTUC 3GMRB 3CH1A 3QUXB 5I1GL 2Y06L 2EXYD 4B5EA 3MLUH 2HT4C 2DWDA 2EDXA 5FM5M 2JJWA 5TPWH 4POUB 2I24N 1INEL 5FGSA 3OAYK 4CDHA 3PGDB 2Z0BA 5L6YL 4M9PA 1B90A 1TITA 2BFVH 4N1EA 3QT2A 4QHLA 3T3PE 1BVZA 1I1AA 1N0LA 3V6BR 2R0ZL 2CGRL 1KB9K 4GMTL 1A6ZB 2AJZB 2VR9A 5H37H 5DRZB 5BS0D 4PLJD 1G7MB 2XWTB 4OCLC 2BRRL 3MA7A 4C4KO 5EZJB 1UXWA 1OP5K 2XRAL 4PUBH 3KYKH 3VXUB 4YHNA 4L8CA 5I1IH 1N3NA 5ADPH 2PF6A 1UCBH 3IVKB 4LLYA 3K74B 3QUYC 1WZ1L 5LGJB 3O4LB 1GH7A 4JQVA 1C16A 1A6ZA 5C0RH 1I7TB 2YKLL 3GHBL 4DK3A 5DRZA 3QHFH 3X13A 4RBPK 4XWOD 3WUWA 1UXSB 2CIKA 4RFEA 4KJQC 5SX5H 4Y7MA 3QRGL 4JG1L 3WHE0 1R24A 4JQIL 2PYEE 3NIDE 4PRHA 2HVJA 3PQYA 4HWNA 3JZ7A 4MDJB 4P3WA 4OD2A 2ARJQ 3C9NB 1QLRA 1U8PA 5LGJA 3O4LA 1FYHB 4ZO7A 4Y4KC 4GKZA 2X4TA 1A7RL 1UJ3B 3WBDA 2YWZA 5E08L 3BAEL 4ZFZB 1UM6L 3EHBC 1A4JA 3SJVE 1ADQL 4ZUVB 3UYOD 3VFRA 1F4HA 1NUNB 2EDDA 4MDJA 5D71H 4PREA 1W2KT 1JF5A 3GMQA 5DA4A 4FQLH 4XPHL 4FQPA 2ZOLB 1B0GB 1QVOA 2NY5L 3S96A 4HZAA 3GMNB 5BQ7A 5ADOL 5D7IB 2BC4B 5DQ9B 4PG2C 3ES6B 1WWWX 1JK8B 4J1UA 1CBVH 1R0AH 1ZGLA 3RVWC 5IBUB 2N7BA 2YEZA 3WO4B 1FLTX 1WQVT 3JXAA 2J1KA 4QRSB 1X3DA 2PCPB 1C7SA 3LMJH 3HI5L 1OCWH 1YUHA 5DGQA 5FCUL 1PQZB 5J13B 3DUSB 5E2WH 3T2OA 4IRSC 4UT9L 5IIEB 3BKMH 3WFEL 3OAZH 4EJ1C 5E94B 3SJVD 4V2BA 3D85D 2H6PA 3DX9B 5EU6E 3U7YH 4MJIE 4M48H 3UC0H 2FH8A 4NBZB 7FABH 3WLWC 4HSQA 1ACYL 1J8HB 4QRSA 5JDSA 3S37H 2FO1A 2H2SC 5BV7B 4GG8B 4X98B 3NACL 2XXMB 2QHRL 4OM1L 1QFWL 2P43B 3LSOA 3MRMA 4WFGE 3MV8B 3FRUA 2BSRB 3ZO0A 4ONFH 1T0NB 2XG4A 4PJBA 1YYMH 3KJ4B 4QXTA 1A6VH 3LH2L 4ZOBA 5E94A 2CXKA 5EA0L 1GOGA 1IQDB 1CGXA 5JIIA 1LO5B 1UB5A 4RMSA 2E7BA 1ZMYA 2AW2A 2ZOKB 2VDNH 3VGHA 4QXGH 4NIKB 1TJIL 3LDBC 2BNRE 4FQ1H 4OB5L 3VA2C 5DJ8B 1MCEA 4NQCE 4NBXB 3GSQB 1BD2A 3MRLA 3MXVL 3MV8A 5EU6D 2BSRA 3AREB 5DF0A 2Y07H 2Y4SA 5DD1L 1BQUA 3EOBB 3INUL 3MRQB 1MF2H 4WTXA 4F7EB 4UAOC 4YJZL 3KJ6L 5E4EB 2IANE 2CLVB 2I07B 4RMVA 5E6ID 1OARL 3KPPB 3U30B 3PWPE 1OF2B 3M1BA 1BEYH 3C5ZC 2QSTA 4WFGD 1XR9B 3NCCB 1WEJL 5ENWA 3ARQA 3GNML 3MRNB 5CKGA 1TVBB 4PP2A 4Z76A 4N8VG 4U1MB 1TXKA 5JUEL 5BW7A 1YDPB 2YMXH 3HG1B 4UOW1 1QSZA 4ODVH 4NQXA 1TTGA 1YEKL 4PTTB 3BXNB 3NZHH 3O6FD 2DQUH 3DMMC 4Q9BA 2L4OA 2P5WE 4K71B 3ZTNL 2EDBA 2R9HC 3QDJE 5EZIH 1J12A 1JL8A 4B0MM 2F54E 5IMMA 1G7JB 2AJSL 5FGRA 1BVKB 2IQAB 2EIEA 2GSIA 1CD0A 4TQEL 3TIDA 1RQ5A 3A67H 1OAUH 3S36X 1G7PA 3ZHKA 1YNLL 4P3CL 2AEQL 4O51A 3MV9B 3HG1A 4W81A 2L7UA 3O41B 4KMQA 3PWPD 3QDGE 5ISZE 2APXA 3HFML 5SWZB 4GXUN 1H3PL 1AO7B 3FQWB 1CI5A 1HH9A 1KJ2L 1FFNB 1X5JA 5CD5D 4MNQD 1G6RH 3NABL 5GGRY 5DHVA 1Q9KA 4P9HH 1Z0NA 3EDEA 2CRZA 1KJMB 2QADC 5IT2H 3KPRE 2BSSB 2X89D 1Y6MR 1FFOB 3TBYA 3RUGF 3VXSE 1SY6A 5D6CB 3U4EA 4WW2C 4WEMB 3MQIA 3MPCA 3O81A 4X9GA 4MD4A 4P2QE 1XAUA 5EU4B 1AO7A 4H20L 3S35L 1P7KA 4LCYA 1FFNA 2VR5A 4PJ5E 4D3CL 2OTPA 1MCNA 5HGDB 3GMLA 1SYSB 5CEZD 5TQ2L 1T4KB 2ZG3A 5ISZD 3U7WH 1KJMA 1YC8A 4NQTA 2AERT 1P7QA 4E0RA 1OAXH 1FFOA 3HZKB 3MV7A 2AV7A 4ZODA 1FV1B 1T1XB 4OLEA 1HILB 1KELL 1URLA 5KVGH 3RVUD 1K3IA 3GJFK 1FFQA 3R1GL 2YPLD 4TSCH 3EYQC 3TZVC 3FAWA 1DSFH 5EULV 2DLHA 4ZO6A 4KJPD 4OT1L 4Y2OA 3V7MA 1OY3B 2VZTA 1CE1H 5DZOA 3KPMB 4LPCA 4RQQB 2VL5B 3UZVB 2ENYA 5IW1A 3FN3A 4GBXD 4QF1A 2LTQB 1IC4H 1FL6B 1FV1A 2CPCA 3EUUA 3B2UC 4U1JB 3VH8G 2Z8WC 1LE5A 4LLVA 5GHWL 1OM3H 2XN9D 4F58L 2H32A 3CSBA 1ZSDB 1HSBB 4HFUH 35C8L 5DMIH 1JWSB 4ZXBC 1U8JB 1CICA 4UMGA 5C0DA 4DK6A 5CCKL 4K7FB 3KPMA 5DR5H 3ULSB 1RIVL 1FIGL 4JLRB 1CXHA 4FZEL 4OV5B 1FG9C 2ZKHL 4KPHL 2VL5A 2HKHL 4AG4L 4RGMB 4Z7UB 1U9KA 1U36A 1A14L 1A6UH 4YHZL 4PJEA 3SDYH 1UH3A 2QLVB 5C7XH 1IEBA 1OAZH 5IB5B 4HUUB 1BFVH 4G80B 4NM8L 3BH8A 4HV8B 4Z7NE 5F96L 3O8XA 4JLRA 3JVGC 3MBED 1L7TH 2OCFD 5SWQB 1S9VB 4NOBA 4HJ0D 4QRPA 2K7QA 4Z7UA 4Z77B 1FSKC 2A77H 3ARYA 3FOLB 2E5EA 4YQXH 2HRPL 2VMFA 3CZFB 2PYEB 4LEXH 1L7IL 4NKOB 1ETZB 3AU1B 2Y7QB 2ZCKL 1QYGH 2JIXA 3TN0B 4G80A 1LQSR 1QQDB 2ITCB 1IQWL 3AVEA 4JM2A 4IRJB 1T22A 4JY4B 5SWQA 3SDCD 2WNGA 3ARSA 3WFBL 5TQ0H 3RZCC 3QCUH 3D2UD 5C0ND 4XP6H 2Z8RA 5TE7L 1T1WB 3SJVB 3PWLA 2NY1D 2G5RA 4S2SB 2CDGB 4FFYH 4BQ6A 5TE6H 4NDMB 1TVHA 1FNGB 3LKNA 3VFTB 3GKWL 3A6OA 3SGDH 4BFEA 2DIBA 4XMKL 5D5MF 3ZTJG 3QI9D 2F74B 1U3HD 4JY4A 5AZEL 4XNZB 3NFNA 4QNPF 5M95B 1LO4H 3TYGL 3MJ8A 1KCVH 2CD0A 4EI5B 4V1DE 1I9RH 2UWEE 4MCZB 1JHTB 1RJZA 2QSCL 3FQTB 2BJML 4S2SA 3K4ZA 4PJ8C 1WCQA 3ARFC 3BIBX 4HIXL 3J8F7 5ALCL 4RFNC 2GJJA 2GITA 5FGBC 3QJHB 1HYSD 2W60B 4KC3B 3FQNB 4LMQE 4Y5VB 1TZIB 5F7YC 1UZ6F 2F74A 5CJQH 4UTBH 4N9OB 5I9QB 3QHTC 3VA6A 9CGTA 3H9HA 4JN2A 3JTSB 3V7AG 5EU6B 4MJIB 2FJGB 5FHAH 2YRPA 3X3GH 1G0XA 1R3IH 2DQGL 3MRCA 2XKUA 3MLRL 2WBKA 3K2UH 4OIIH 2V17L 4FP8L 1CWVA 1A1MB 5FXCH 3V5DA 4GKNA 1JZ3A 2ZJSH 4G9FD 4OZHF 4MAYB 1UC6A 3JSSA 1TZIA 3O6KL 4RMRA 4V1DD 3OB8A 1OT2A 2WSKA 4X4XA 2CJUH 3DV4B 3EJJX 3TT3L 5GSVB 5BJTB 3H9SD 4Z8FL 3JTSA 5CLWA 4NRXB 2EEBA 3GSNB 1K8DB 4XXCA 5EU5A 1LNUB 1NCTA 4LMQI 1MREL 1JZ5A 4P46B 1MUJB 3D3VE 1KCRH 2BNRB 3SE4A 1QA9B 5E99H 5C07A 5I1LB 4DAGH 4NQCB 3RUGE 5IBLC 2BVYA 1HNFA 1I9EA 5INDB 3I2CL 1B0WA 4KQ3L 4JO3H 1I3UA 3DV4A 5BJTA 5GSVA 3R4DA 4JDVB 4NRXA 2ED7A 2HMIC 2VZUA 4PGJA 2IANB 3B5TA 5IJVB 4NO3B 4P46A 3QXDA 4F9PA 3QP3A 3W2DH 5DXWA 4RMTA 1NMAH 3QDMA 1QA9A 4XP4L 2WWMD 1KENH 4XVUC 3MRIB 1OTSD 4NQCA 3FONB 4XXDA 3KG5A 1MELA 5DHXB 1MHPH 3MA9L 5DJZB 1EV2E 4HH9A 4G6ML 4PG9B 4WUUA 2YUXA 4F9LA 4YHLH 3CNKA 3M17A 4JDVA 4CW1B 2P5WB 4HUNB 1XF4B 3P0YH 3QDJB 4LAQL 4YBHA 5I8CB 5IJVA 2XOTA 2F54B 3PGFH 1Q9WB 2BK8A 2DYPD 2X4SA 5J8OA 5KJRL 5LVEA 2PW1A 4HC1H 1R5WA 4L9DA 1U2CA 2MOVA 4QHUA 5C0JA 2QR0B 1QKZL 4APQC 3FONA 1MIEL 3PL6C 4MA1B 1C08B 2NW2A 5GGQH 3MRPA 5IEKB 3B3IB 3QDGB 4CW1A 5ISZB 2P5WA 1XF4A 1A4KB 5INCA 1IZKA 4WHDA 4JKMA 4MXWH 4FQXD 2OZ4A 3CH8A 1YNKH 1PG7X 3VFWB 1ZLSH 1ZHBB 4LSPH 1BP3B 3A6CL 3ARDC 3DX6A 2ESVA 2R0LH 4K7PL 4KK6C 5IVZA 3NIGF 2Q6WA 3REWB 4WV1C 3V4UH 3LRGA 5FA4A 2QR0A 1QACA 2D7QA 3JV0A 1AXTL 5CJ5A 3NAAL 3KPRB 1NMBL 1AGCA 3GO1L 3B5HA 5GGVH 5KSAD 5KN5B 4W4OC 3VXSB 1Z9OA 3B3IA 4PJDE 4DUVA 4XVJL 1MOEA 4XPAH 2I5YL 4P2QB 1AY1L 3VMOA 1MH5A 3TPUB 5DLML 1DQQA 3FQXA 3ALXA 2R1YA 3VFWA 3QUMB 4JFFE 4PJ5B 2DMKA 3EDKA 1BBDL 4IIQA 3MSPA 3HE7B 1M71B 1T5WB 5GRUL 1U58B 4OV6F 5IFJA 3DVIA 2XACC 3L1OL 4G8GD 3CC5A 4L4VE 4FQQB 4RIRA 4TRPL 5D1XA 2D3VA 4HT1H 4S1QH 4U1NB 3GB7B 4PJFA 3RWIB 2EO1A 4QWWC 3ROLB 3TJEL 1X6LA 3VXSA 1HHKA 3QIBA 1JRHH 1PLGL 3FB5B 5JW4R 4F8TA 1U6AL 4P2QA 1FZMA 2AAVA 5C2UB 4POZD 2FB4L 4JPKH 2VYRE 1I3GL 3IS0X 1A9BB 4HIHA 2DQDH 4JFEE 1UM4H 3HE7A 3WIIH 5IB1B 1KGCD 4DOHE 1XCTA 3FQUB 4FQQA 3O9WC 5FHBH 4OLYL 1H3WM 4U1NA 4XHQA 3VFGH 1KB9J 3ROLA 4RAUB 4UUJB 4JJ5B 4Q6IA 4Z0XB 1EEYB 3VFSB 1WFNA 1A3RH 2NLJA 1WFOA 4L4VD 5C0EA 2UYLB 1A7BA 4CADA 4JRYB 2VXUH 3FCTB 5IB1A 5EFIA 4L1DA 1MJ8H 4TULH 2NY6C 5B8CC 4OI8A 3QXWA 3FQUA 4TSBL 3S35X 1BQHB 3MO1A 1VACA 4F33A 2J4WH 4MJ5B 3ZKNC 2PTUA 4ZUUA 1Q72H 1CLYH 4UUJA 2NY3D 1TVDA 3VFSA 3VMPA 3ARPA 5HYJE 4JFED 5IFHH 1CZ8L 3MLTB 1UZ6E 5EUOF 3NPZB 4JRYA 3FCTA 2ATKB 3MREB 4NQEA 1HZHH 3IJHB 3IFOA 4OFVA 2CMRH 3C8HA 4L4TA 5JXEC 5GGSY 5LGHL 3V6OA 1WT5C 5HHQA 2VXTH 4OZHE 3EZ8A 1YN6B 2C3VB 4D0DB 1DN0B 3KPSE 4QHMA 5C9JA 1XFPA 3JWOH 3WN5B 1CN4A 5IROC 3GJFB 2VUOA 2CLZB 4XPGL 5L7XL 2ATKA 3U48A 1HSAA 4MA8L 2AXJA 1UQSB 4Q9RH 4Z78A 4ESKA 1KT2B 5E9DE 5FO8A 3SKJH 4RZCB 1QBBA 2XTJC 1N2RA 1OTUD 4X6DE 3V6FA 1PG7W 3L3JB 3QH3B 3UPCA 1A7PH 3L95B 3U9PL 3RGVC 5GJTL 5C0BE 5F7FA 3WN5A 4QOKD 3SCMD 5FDYA 1D6VH 3WJJA 2MSPA 2HG5B 1UWEH 5C08E 5KTEH 1F4WL 1HCFX 4M4PA 5EZLB 3K8KA 4YDLB 5DA0B 1LO0H 4U1KB 3AAZA 2J88H 1JMXA 4JHWL 4W6WB 1G7LB 2UWEB 4IOFC 3L3JA 3QH3A 5ICYA 2DLFH 1YJDH 4Y16D 3ZMRA 5I1HL 2YOCA 2P45B 4XI5C 3RVTC 3IJYA 4HKXB 4QO1A 3OZ9L 1BLNB 2HG5A 3BP7B 2O93L 4XCEA 3T0XA 3QUYD 2YN5A 4IS6A 1SBSL 3BJ91 3SEPA 4U1KA 3AB0C 2FHCA 2DLEA 4H25B 1EHAA 2HFEB 5DJDB 1HHHB 3LPGA 3QUML 4BH7A 3ZT7A 4TVPE 4X7DC 4MLIA 1TPXC 3UAJD 5D1ZC 4HKXA 1A6WL 1OT1A 1BLNA 1RIHL 3OJDB 4MZ2A 3JV4A 1OVZA 5DMKA 2VZSA 2Z31B 4Y4KD 1NFIB 4LPVA 3FTGA 3TBTB 4H25A 2YD5A 2HFEA 4C56A 3U0WL 1HHHA 1HKLH 3D3VB 3O2DA 4LIQL 5J1AA 2GK0B 1HINH 3PWUA 2JCCF 1KTRL 4AIZB 3GBLA 1MRDL 4YFLF 1AFVL 2C4FT 3BDYH 1DBKH 4KI5C 5LCVL 1BFOA 1G9NC 3JTTA 3K1KC 5F6HI 4XNXH 4HXBH 3C08L 4Z7OF 1NFIA 3BZFA 3KGRA 2Q1EA 3TBVB 5HHXH 4JFDD 4P57B 1UM5H 2EE9A 4OAWA 4WI6A 1QLEL 4TVPD 5E8PB 5FDWB 1DJSA 3MRHA 2EH7L 3D3VA 2DQHL 1LK3L 5K93A 3RVWD 4R0LA 4AIZA 5FO9A 3TA3D 3MJ9H 4NWUL 4OKVB 4GJTB 1A7NH 5HY9A 3LKQB 4JKPL 3R06B 4I5BB 4GLRH 5HYIA 4IRSD 4M61A 3QFJB 2NTFB 4H0GA 3QUZB 3RRQA 4D9RE 2EEDA 5JIPA 4CMHB 3IFPA 2OXGA 3MFFB 1J5OH 3W0WE 1T20B 3O45B 1RZKL 2RBLA 4FQJL 1XGTA 1RUKH 1BFTA 5TFSH 2A6KA 1U8IB 2H2SD 4OKVA 1GGTA 2DQJH 4I3SL 3KHOA 3ULUH 2XFXB 1NGQH 5GJSH 4OZIA 2I25N 4O9HL 1CTOA 1IL1A 4OLUL 3QXVA 2YPVL 5LXGH 5HXMA 3SDAC 3O3BB 4YO0B 3TEUA 3VI4F 2FBJH 1CXLA 3QFJA 3RWCB 1MCDA 3QUZA 4FTVA 3OKDA 2XZQH 4OZGE 4X4ZA 3EYSH 2BNUA 5F9JB 4JCMA 3U46A 2A9NH 3LKSB 3S98A 2X40A 4UDTB 4DZBB 4AEIL 2GKIA 4HLZG 4JFQA 4LVNC 4YIQA 1CXFA 1U8IA 4QHKI 2W0PA 5CFHA 2R0WL 5IHZA 4D9RD 4X7EC 4KV5F 3W0WD 1QD0A 1PGRB 3VFUB 3F7VA 2IMNA 4PJDB 1Q1JL 2WIIA 5JORB 3UO1H 4QTIL 4G6FD 5TDNB 3SHSA 1JIBA 1S5HA 4UDTA 3RA7H 4RA0C 1CU4H 4NZUL 4B7LA 4M7JH 4JFFB 1VPOH 3MACL 4KKBC 4AQOA 1YEGL 4GRWE 2P42B 4KRPB 1DTUA 4IBLT 2WWKO 3MBXL 4L4VB 4EVNA 5L2KE 5ITFB 4CL7A 4ZQKB 1ONQB 2YA1A 2CK0H 5GS1A 2YC1B 4KMTH 4PJDA 5HTSA 3D87B 3Q6GH 5FUOL 1N7ML 1IM3A 4XNMB 3SE8H 4E42A 5JORA 2EDOA 3OL2A 5DMGC 4Q7DA 2R9HD 5GRYA 5DC4B 2O5YL 3MNZB 1HI6B 4UV7L 5GS0C 1CGVA 2C3XA 1XIWB 2NY3B 5AYQA 4HF5H 1CL7I 1F58H 3WXWH 4CNIA 2D7TL 4P5KA 4JFEB 5KS9E 5C2BH 3CVIL 4DOHB 4XVTH 3HC0B 3UTPD 4ONGH 3UBXI 1J1XL 4K7PX 5DD3H 4OI7A 1CD1B 1FAIH 5EIQA 3V0WH 4DVRL 1H15A 1KBGH 3TP4A 3SKMB 2HLFC 4MB3A 3WDJA 1WWBX 4LBEB 1VADB 3VFPA 4XNMA 3ULVC 5IESL 2VE6B 3DUUB 3PP3H 1D5IL 2O61A 2H1PH 3MNZA 5E2VL 1P53A 1SJXA 5T1LD 1R3JB 2BNQE 2W9EH 5ID1B 1XIWA 1KNOA 2XKSA 1NAKH 1GOFA 4H1LB 3UJJH 5BVJB 4MJ4A 4DW2L 2AXFA 1EIBA 1QSFE 3RDTB 1F6AB 4ENEC 4JG0H 3RP1A 4PR5A 2F53A 4ODSL 5DHVH 2FSEA 4GRMA 4N90E 3CVHL 4K8RD 3RWHA 5DT1H 3V4VL 1YECL 4KROB 5I17B 4KZEH 2QADD 1OAKH 3LS5H 4YXHH 2R69L 3DGGA 1WF5A 5B39A 1VADA 4HCRH 2XWBA 2HFFB 3BDXA 3QBTB 5HYJB 5CJOL 2VE6A 5CJBA 2EEAA 4AYFA 2WANA 3A6BH 4KVCL 3F6IA 4KTEL 3BUYB 5BVJA 3VGGA 1N4XH 4Y5XC 3FT4B 4DEPB 1N6QH 1B88A 4CVWA 3RDTA 3OKLB 4U0QB 4TSAH 4FQIH 2JK5B 3UMTA 1MJ7H 4EN3C 3MROB 4X6FB 2IPTL 4BYHA 5AG8A 1J1PL 3QEQE 5I17A 4PLKD 1C1EL 1XGQA 2IBZX 2VISA 4Y5YB 4GQ9L 2DQCL 5DD0L 2HFFA 3VD7A 5HYJA 4NHCH 2EKSB 3KPSB 5F7WC 3NH7L 3FFCA 4J3OC 4ZNEA 3OF6A 2G2RA 3H9ZA 1A47A 2OMBA 1T3FB 3EYQD 3NCBB 3TZVD 4Z7VF 5IBUG 1AJ7L 1D5BA 4LSVL 2JK5A 4WFFD 1PSKL 2VKXA 1JNHB 1OGAD 5E9DB 1G7HB 3BX7C 3WD5L 3TIEA 3WFHA 5GZOC 5IK3A 4JB9H 2JCCE 3QCTH 1U93B 5C0CD 4X6DB 1ZA6B 4U6VL 4NKMB 5GZND 3IKKA 3BMVA 3ZZ1A 5C0BB 3VXOA 2JELH 43CAA 3FO9B 4Z7OE 1BGXL 3FT3B 1T3FA 5IV2A 5C08B 1MI5E 2H32H 3O0RH 4ZD3L 5CSZB 1CLZH 5D96C 2CK2A 1U0QA 4M6AA 3T3MF 4F7PA 3L5HA 3HMWL 3U1SH 3QQ4B 3I02A 1OPGH 3C60C 1ZA6A 4L5FL 3IU3B 3MUGB 4JHAL 4BFIB 1S7TA 3QPXH 5C0BA 1NL0H 3FO9A 1JHKL 1FNEB 3FT3A 1GC1L 1PKQA 1S9XA 4G7YL 4JRWA 4NP4H 1ZXQA 1JZ2A 2RB8A 4XNUL 2P8LA 4JDTH 5I1AB 2CUHA 3CX2A 3QCVL 3HAEB 1FO0A 2I9LB 1AGDB 3CFJA 1A7OL 1QFOA 3TO4B 5BMFL 4BFIA 3HI6L 4XBGB 4KGLA 1TZGL 1ZLWH 2C1PA 3BN3B 1FYTE 3VI4E 4M5YL 4XMPH 2FYYB 5EWIL 1H5BC 3C8KB 3FB7B 3B8SA 3MYJA 4X99A 3DSFL 3DWTA 3G5XB 4UIKH 5GS2D 5I1AA 4IRZL 3HAEA 4IRSB 1FN4B 1AGDA 4HULB 4LKCA 2GEEA 1FBIH 5F8RC 3TO4A 4Q2ZA 3IDUA 1ZANL 3NA9H 3F5WB 4N5UA 1BFSA 1U8KA 2CQVA 5AWNL 4KV5E 3PHOB 1I7ZA 1T7VA 1DBAH 4MSWB 5E5UB 5IBTH 3BWAB 3C8KA 3V4PH 1U91B 5KBNC 3IU4H 3HRZA 1NGXA 5D1QC 4MQTB 4XPBH 3IDJB 3KDMA 3MRGA 1HQRB 2D7NA 3G5XA 2QTEA 1MQKL 3T65A 2PXYD 1JGUL 1R5IB 4MDIB 3SDDC 4BK4A 4JFHE 5F7MC 4LRIC 2Y23A 2XZAL 1RULL 4E5XA 2AK4D 3FJTA 1TMCB 3UPRA 2R4RL 5DQDH 4G6KL 4JQXA 3PHQB 1MFBL 3P11H 3RVVC 4F2MB 3ARFD 3QIWA 3OXRA 3TVMA 4NUJB 3CMOH 4X8JA 2AABL 3SQOL 1T7YA 4Y4FB 1RK1B 1KN4H 4MAUL 1KB5H 1H9VA 1R5IA 1E4WL 3W0WB 4WWKC 5D6DA 4YEFA 1E6JL 5EZOL 2ZUQC 4NGHH 1HE7A 4G43B 2E6PA 2ZG1A 2VDPH 1LP9A 2VRAA 5D2NA 4UAOB 2HTKC 1VHPA 3PIQA 3GK8L 5DD6B 4ELKB 1JTOA 2PO6D 1KLUA 3ARWA 4WEBH 3EGSB 4LPWA 3C5ZB 2ZCHL 2H3NA 1IC7H 4N5EC 1V5JA 5I0DA 1JGLL 4EUPA 2MKLC 4MYWB 4Y4FA 3L3DB 4OZGB 5DJYB 3WDIA 1UWGH 3EOYG 4HWZA 5C09D 5B3NA 1OLLA 1MFDL 3DX8B 3FZUC 4B53A 4PB9L 2A73A 5FKPB 2V2XA 1S9YB 1IM9D 3TNMA 3DMMB 2CH8A 5D2LB 2OL3B 5DD6A 4AH2B 1QNZH 1IEHA 1U8LA 5EH1A 4UNTA 1BM3L 1OWRM 5IBLD 5HGHB 4NO0B 4ZTOL 4XCNB 4NRZB 1GGYA 2FNBA 5SWSE 3L3DA 1EHLH 2DM4A 1JGVH 3P77B 3DX8A 3QIUC 4EIGB 4PJGA 3I50L 4XH2B 5SX4I 2OYPA 3UBXB 3ZTJH 3RU8H 2XPGA 1T83A 3EOTL 4HKJB 5D2LA 1CF8H 2OL3A 2Y1VA 4GRWB 3VXME 1CG9A 5T1LB 2J2ZA 4RA3A 1CD9B 1GGCH 2VXQH 3QXTA 4WFHD 5L2KB 4LF3A 4NO0A 2I26N 5GGTH 3H9YA 1EEUA 2C4FU 5F72S 1OOAA 1MCQA 1KCKA 1NBZB 1QLFA 1S8DB 4JFOA 3P4MB 1OP3H 1I8MB 5HI5C 1SJVA 4Z7VE 4IMKA 4NC0B 2LV4A 3V0VA 2DL9A 2YSSB 5GRJH 3P4OB 4KI5F 3VXPA 4WW2B 1T2QH 3RVXD 5KS9B 1F13A 1Y0LA 2GT9A 2IAMA 3L7FA 2BRQA 5L2KA 4BH8A 5I8OL 3AS1A 5JMOC 3PL6D 3GMMA 1A5FH 3GRWA 2EIZA 3KWWB 2AGJL 3DV6B 4PRBB 4RRPA 2ENSA 1N6VA 3S3SA 4D9QD 3VFNA 1YNTB 4TVPL 3T2NL 3VU2A 2BNQB 4NKQB 2YSSA 2DQFB 2ADIB 4KTDL 3T3ME 3ARDD 5D7JC 1QSFB 3BW9A 4KHTL 4Z18A 5HJ3B 1QZ1A 2BOBB 5A2LH 5CZVH 1NGPH 5E2TH 4ZAKC 1DQJA 1CDIA 2CLRB 1F90H 3WL9B 3KWWA 3VXQB 5DZLA 3SGKC 1IAIM 5BS0A 4PRBA 3O3EB 3JWDH 4P23D 3SDXA 3GBMH 4G8FA 5FYKH 4KKNA 1Q8MA 2AI0L 2X4QB 3IDXL 3LEXA 4HK3J 2WP3T 4XC3L 3Q3GB 5CIPB 4UTAL 5T1MA 2KUTA 4U6YA 5IF0A 1KIRB 5FYLE 1FNSH 3FO1A 3C6LD 1EERB 2X09A 4R6UA 4XCYB 2VLLB 5B21A 3BQUD 4P5TC 1TCRB 1OP9A 4RNRB 4U2ZA 3QEQB 4ZXBB 1FVEB 3I6GA 1SM3L 4JGMA 3WL9A 5IG7A 4ZUWA 1GAFL 4QWWD 5ICZB 2YD9A 2PR4L 4N0YL 3HS0A 2NY0B 3IFLH 1P9MA 3BKYL 5JO5B 1ZEAH 3TCLA 1FPTL 1H8OA 3HZYB 4YWGH 1RUAH 4KHXL 4WJ5B 1VFUA 3Q1SL 5LG1A 1BX2B 1MCIA 1KIRA 4XCYA 3OG4B 2VLLA 1ERNA 4JZNB 3DX7A 5CINH 1FVCB 1DBJH 2KL6A 2VC2H 1UA6H 4YXKL 1C5DA 3LV3A 3ARUA 5ICZA 3NIFF 3TT1H 4LVHC 1ED3B 2FL5A 1H0DB 4FMFA 5FYLD 1P4BL 4M6OH 4HBCL 1TJHH 4WJ5A 1I9IL 1A02N 1U2HA 1MI5B 2D0FA 1UEYA 4OCRH 4M1GL 3ARBD 2WBWB 3DYPA 5I8EB 3MRKA 4A2LA 5J6HA 2MQ3A 2NY6D 4JZNA 4X80H 1FC1A 3NPSC 2D03L 1NSNH 2YK1L 2NX5D 3CFKB 3FQRA 4OQTL 3TCXA 3NZ8B 4K23H 5HYSA 1NFDE 1YEEL 3RTQD 1MVUB 4M8VA 1FGNH 1KEMH 4KVNL 1U3ZA 4CVUA 5JHDE 3RZCB 2XTJE 5LBSH 3OB0K 1IAII 4WVRA 1YY9C 3S36H 2BCKA 1D9KD 3G5YA 4BA8A 5T3ZH 4NO5B 5BO1H 4JFZL 3CFKA 1CL7L 2M1KA 2A2QT 4ZS7H 2PTTA 3D85A 3UTTE 2R1XA 1BZ9A 1MFEH 3NCJH 3G6AB 3FMGH 1W72L 5DK0B 5ERWB 3WIHL 4J3XA 4AL8L 3HR5A 1FYTB 3MOAL 4Y8AA 3WHXA 1EFXA 4L1HA 4LSUH 1N0XH 1WV7T 5KSBA 4HPOH 2ILLA 3V2AR 5EO1A 5EPMB 4PJ8B 4XCFH 4HMCA 1PZ5B 1KN2L 2YA0A 3P4NA 1JZ8A 1I8KB 4RFNB 1DUYB 4LQFH 3BKCL 1S7SB 5JHDD 1JF1B 2GIYA 1JGDA 2XTJD 5CILL 1FE8L 1MSPA 1OW0A 1C12B 3LIZH 5J1TC 1AQKL 2VLKE 5HGAB 2Q8AL 3VXRB 4XHJC 4WWID 1FGVH 2A6IB 3HPLB 4IHOB 4DZ8B 2EO9A 3EOAA 3H3KA 1XEDA 3UTTD 1PZ5A 1YMME 4ZFOB 4KI1A 1IC5L 5F89B 4NPYA 4XCCL 2VLRE 5A1AA 2A83B 1X4YA 1J7VR 2WAHA 1D5MA 2XZZA 3C2AL 3MCKB 1GYAA 5H8DA 3MOBH 4BZ1L 1SVZA 4MD5B 3U0TA 4OM0L 3VXRA 5KSVB 3EFFA 4OQ1A 3ELAT 3EYUL 4PGBB 4DZ8A 2HLAB 5D72L 43C9B 5K9JH 1EO7A 1JPGA 3OWEA 3RAJL 1XF3B 3V95A 1YEIL 5FO7B 4LSQL 1YYLH 4PJAF 5F89A 2P44B 3DPBA 1A1NA 3MJGX 1I1AC 1MY5A 4UINH 2EYTB 6FABH 4JY5H 1DQML 3DI3B 5EOTA 4NM4L 3UXFA 2Q8BL 3F7QA 4N8CH 3CLEL 3P9MB 3DETD 1NC4B 8FABB 1FZOB 4PBXA 3GM8A 5KSVA 4AEFA 2R29L 3GUTB 1ORSA 1QBLL 3SGEH 4ZFGH 2OR8A 3F58L 3ZDXE 1QEWB 1FLRL 3DECA 1HXMB 4MXQC 4PJ9A 1DLFH 3MR9B 5FO7A 5JA9A 1C5BH 5I19L 1ZT7B 2G9HA 3ARTA 4HIIA 4JQVC 4M6MH 1K8IB 4D8PB 4DKFH 1RK0B 1JWUB 1WBYA 1SHMA 1JI2A 4YHYC 4YFDB 1RJYB 4F3FA 2NR6D 4ODHL 5GRZA 8FABA 1FZOA 1OAYH 1WIUA 1WAAF 5KSUA 2W59A 4P9MH 3TFKD 2YD1A 3ARZA 3E2HC 2V7HB 1KIQB 1RZ7L 2DDQH 4MNQA 4AK1A 3WFDL 1SYVA 4KI5D 2C4XA 3O3AA 3OSKA 3MR9A 2YD6A 1R5VB 5SWSB 3EO0A 5I18H 3FT2B 4NUGL 4UU9A 4APQB 2X89A 4MLSA 4YPGA 3WNMA 3VRJA 3PL6B 1BQSA 1NC2B 5FYKU 4OLVH 1WTLA 3HI1B 3C8DA 3BI9X 4D8PA 3LEYH 4CKVX 3G6DL 1JWUA 5HDQL 1K2DB 3HE6B 3MRJA 5I1GH 3U79A 3P2TA 3STLB 5F7LB 4P4KD 1ROWA 3VXMB 1INEH 2XQYG 3JV6A 5L6YH 3G6JE 3ETBF 4XBEH 1QRKA 4CVZB 1R5VA 3BGMA 1JV5B 1LWRA 5IOPA 2E9JA 5HGBA 1NCDL 3FT2A 2R0ZH 2FRGP 4GMTH 3QXAB 3DIFB 5DVMA 1BQHG 4Z7VB 2VITB 1EMTL 2BRRH 3HE6A 1DFBL 2EC8A 1A21A 1M6OA 2XRAH 4RGNC 2LE9A 3PWJB 2YPLA 3VXMA 4D0CA 4U1HB 5DURB 3HZMB 4OKDA 4YHPB 1AGEA 1BOGB 4BM7A 3NIFE 3SPVA 1NAML 1GGBL 4CVZA 3SDAD 4WHYG 1JV5A 4MNHB 2CKBA 2H8PA 1IAKB 3H7LA 2X4UB 4LCUA 3GHBH 4GBXA 4FFWC 3FOMB 5F1OB 5IVOA 2V7NB 3S7GA 1K5NB 4UI2A 1J0ZA 2VDKL 3WO4C 1VESA 1JVKA 2XN9A 4JG1H 4QRUB 5BCAA 1MCOL 5FA3B 2BVPA 3PWJA 4JQIH 5T3XE 4L9LA 3EYFA 1YMHB 5EIIA 2IBGA 3OR7B 1BOGA 1J1OL 3UTSE 4L3CA 4NNYB 4OCYL 2H26A 3GIVB 5KG9B 5FYJH 4MNHA 5KZCD 2ICEB 4NN6C 5I16A 2FO4A 2Z8SA 1A7RH 3CSPA 4N0UE 5JQHC 3O9WB 5E08H 5DVKA 4LGRB 5T5FL 4LSRL 3BAEH 4CJ0A 1UM6H 3IDMB 3ZDZF 4CU8A 4S1DD 5BRZD 3BGAA 3MNVA 2H2PC 4LLUB 2B1HL 3BEWA 5IB2A 1IGTA 4XP5L 4MNGA 1LO2L 4KKBD 3ULVE 4HUKB 3VCLA 1EEZA 3SOBL 2DWEA 5BV7C 4PJCA 1YMHA 1F11A 4HUVB 2H9GB 4ZFOL 1AXSB 4R3SB 2EC9T 4XPHH 2A6DB 1AQDA 3MBEA 2NY5H 5CBAA 2OI9B 1PBYA 4L8DB 3BP4A 2NY6B 5ADOH 1AE6L 4QYOB 3IDIB 5B4MC 1LO3H 2NY4C 4QRRD 4DTGL 2VIRA 5GS0D 1EJOL 1OB1B 3I75B 4LLUA 4LU5H 2AJUL 2UUDK 1RV6X 2VZOA 3HKFA 4OFPA 4L3ED 3EO9L 3IKCB 3K8MA 4ELMA 3CFDB 1AXSA 1G7IA 1NDGA 2R0KL 4UT9H 1Q0YL 2VL4A 3WFEH 3DRTB 4OZFB 4PGZA 3N1FC 5BW7C 1A6PA 2HLFD 3LS4H 5JW3L 3P9LB 3PGCB 3WNPA 5J11C 1MWAL 3D2UA 1QO3B 4PGCB 1DE4B 2MWCA 5E4EC 4GRLD 1NBQA 4TUKL 1OB1A 3BH9B 5CUSL 3U30C 4HS8L 4R7DB 5F1IB 4L29A 4ENED 3NACH 2QHRH 4OM1H 3RJDA 3T4YB 3QI9A 3D5OF 1LDPH 5LWYL 1U3HA 2GJZA 1PX3A 2ADJB 4YDIL 1NFDB 3LH2H 2F5AL 5EA0H 3OKMB 4P4RB 1FL3A 5FAAA 4BQ9A 1QO3A 4PGCA 1DE4A 1WBXA 2XTJB 3ESVF 4HWBL 5JZ7C 5K9QI 1DEEB 3MUZ1 5EORH 3OGCB 1TJIH 5F1IA 4LHUB 2WM0A 3RGVB 5ACZA 1NEZA 2DTML 3MXVH 2DBJA 4WENB 4KK5D 3UTTB 5DD1H 5DSCB 3VRIB 3INUH 3ILPA 1PG7H 1QPPA 2JLLA 4WFEE 4KUZL 1UVQA 5IVXF 1DLHA 4U33A 2P8PB 3CDYA 3OGOE 1TQCB 4KJYA 3ARGB 4G9FA 5GQBA 1MAKA 1XF1A 3L3GA 5JUEH 2HH0L 4WEUD 3H9SA 1VEPA 1YEKH 3GHEH 1UG9A 3HPJB 4HS6A 1S7UA 1QBML 1CGSH 5I15L 3QUKB 2VLKB 3AB0B 4ZPVA 5FOBB 5HSFA 4Y89A 4LCWE 3EO1B 1P7HL 2P8PA 2E9BA 1AGBA 2AJSH 1ZLUK 1RVFL 4A6YL 4O2FA 3T09A 3ARGA 3KPLA 3GZKA 4TQEH 2G75B 1YMMB 1ZT1B 5D1ZB 1MCBA 4P3CH 2VLRB 2J8UF 3SKOB 2FEDC 3ZKXC 3HB3C 3ORJA 4FFZL 3C60D 3ZSSA 3MGOB 4FABL 2X7LB 4JO4L 4TNVF 5D7LE 4XB7A 5FOBA 4LARL 3U4BH 3SBWA 1EBAA 1H3PH 3P73B 4ZNCD 3EO1A 4XBPA 1W0VB 2FGWL 3LD8B 2XI9A 1RZJC 1KJ2H 3NABH 3KLAB 1N5AA 1ZVYA 1AD9A 1CICC 2DIJA 2G75A 1GPOL 1ZT1A 3G5VA 3K0WA 1AI1L 3HUJE 3QJFB 2Y6SC 3GSUA 3SKOA 3PHSA 2X1QA 4ZOAA 3MGOA 4TVSa 3L5WA 4PTUA 4XRCA 4K3JH 1BVLB 2DYPA 3SE9L 2NYYD 4LSSL 5FYLL 3L5IA 1FG2A 4WI3A 3S35H 4D3CH 3KLAA 4FZ8L 1QHOA 1MCFA 1CT8A 2Y5TA 1P4LA 3E6HB 5CGYC 3EZJB 4OGAC 3KR3L 4MJ6A 1GRWA 1NJ9B 2FJHA 3O8XC 5E95B 3LRSA 2QQKL 5F6IC 2K3TA 4OI9A 2F8OA 4AM0A 1FL5A 4NRYB 4NQVB 4OJFL 3B9KB 4DUWA 1AR1D 1GCFA 4J8RB 4FQXA 1KELH 5DEFA 4YBQD 4J3TA 2ATPB 4P2RE 3IJSA 1I3RA 3BPOC 1RZFL 1S7XB 4HIJA 4JO2L 2FX7L 3LVEA 1MCHA 1NKOA 4OT1H 5FYJU 3E6HA 1II4E 4JM2C 3MODH 5D1QD 1IAIL 3ZDZE 4W6XB 2X70B 1Y6KR 1K3ZA 3MV01 1HCVA 4I48B 5F8QC 3SDDD 5DZNA 3SGDI 4J8RA 5FK9A 1UWXH 4E41E 4GO6B 5GHWH 3F65A 4F58H 3RVVD 1A7QH 4MZ3A 2P46B 35C8H 1S7XA 5IR1B 2HN7B 5JPMA 3G6JB 2P8MA 3G5ZA 4CU6A 4LVNB 2MMXA 4XNQB 4XWGL 1CR9H 2XG5A 2IADB 4G8GA 4H1LG 5CCKH 4Q6YA 1PEWA 2VR4A 1SVCP 2X70A 4FZEH 3KYMB 4M7KH 1MEXL 2ZKHH 5T3ZD 4KPHH 2HKHH 4AG4H 5KZCB 4LVOC 4P2RD 4GKSA 1A14H 2BXYA 5A16B 1QRNB 4I2XE 2FJFB 4YDKL 3D25B 1N59B 2Z8VC 4F7TA 2V9TA 1R3HB 1TQBC 3NFSL 5IR1A 2NW3A 2Q3ZA 5T1KD 3GGWA 4NNPL 5IHUL 1B3JA 2IADA 2APVA 5F96H 4N5ED 3PJSA 1IBGL 4PJXE 4KKLD 2P5EE 3AROA 4KXZH 3QG7L 4XNZC 4EUPH 1DVFB 4XB8A 2HVKB 3GM0A 5IFAH 3LOWA 2IFFL 3FZUD 4UILL 5DYOA 2FIKA 1QSEE 1DQDH 1QRNA 2MHAB 3BHBA 3L3KB 1JTPA 3MFGB 3IXAA 3BMWA 1YPZF 3D25A 1N59A 4NQSB 4K2UL 4J6RH 1L7IH 4TNVK 3U6RA 2ZCKH 2VABB 5IMOB 3E8UL 2NZ9D 2G60L 1IQWH 2HKFL 3UTSB 4DCQB 1B4RA 3OX8A 5M7QA 1WUNT 4N0UB 1DVFA 1I1RA 1MFAH 4QGTA 3WFBH 5I2IB 5DRXA 4XTRC 4XXCC 3WXVL 2EDHA 3QIUD 3DTXA 5TE7H 3BSZL 3L3KA 2EICA 12E8L 1D7FA 2NXZC 2OQJB 1HQ4A 4OZ4B 5CMAA 2VTFA 1KFAL 3SE4C 4G9DA 5F1NB 5DMYA 5I1IL 5HBBA 2F9BT 4FXGB 3VWJA 2VABA 3ESUF 5HDLA 1Z0MA 4XMKH 5JW5A 2K9UA 2EXWD 2X44D 4KZDL 5AZEH 1A3LL 5D5MA 3TYGH 5I2IA 2F58L 5HI5D 3V52H 2W1NA 4P46C 2QSCH 2YZ1A 3KPNB 3OBAA 2OQJA 1JCKA 1T1YB 2BJMH 1INQA 2DICA 4F9PC 2GW5A 5LQBL 5F1NA 3K46A 5ALCH 3HLAB 4FXGA 2ZPKL 3MRDA 1PYWA 4RWYL 1G6RB 4Y5XB 3WDHA 1G9NL 2KKQA 2W0FB 4J3SA 4EN3B 3LAFA 4F9LC 1RUQL 1PJ9A 2DQGH 4OFYD 3HNTH 1RZ8B 1T1YA 3MLRH 4KKAD 1VA9A 2GY7B 4ZDHB 4QOKA 4HQQH 2V17H 5HHME 4Q9QL 2GI7A 2EDEA 2W9DL 1AGFB 3SCMA 1N26A 3EYOA 1IFHL 4TTDC 1FJ1B 5GGRB 3IGAA 4UQ2A 1LDSA 2WUBL 2E6JA 2JB5L 3O6KH 1ZWIB 1EXUB 4NQDD 3TT3H 4YXLL 4GXUM 4K3EH 4Z8FH 1VGKB 2YRZA 4X5XB 5HHOD 5AYUL 3UTZB 1MREH 1R0AL 5IEHB 2EIBA 4Y16A 1GIGL 1EO5A 2CDEB 3D0VB 2RIKA 4ZDHA 1K6QL 2I27N 4OCWL 3JV5A 4Z0BL 4M1DL 4CUCA 2R4SL 3S3PA 1FCCA 1JP5A 5E2WL 4MQSB 3LY6A 4U7KA 2IG2L 5D7IF 2WP3O 3QUYA 4ODUA 4U6XB 5E5MB 4ONHB 1G7QB 1EXUA 1ZWIA 2FLBT 3I2CH 3VFMB 4KQ3H 4Z7QF 1D6EB 5T1DL 3EDDA 3TESA 5D96B 4JRXE 4PIRF 1QOKA 4M48L 3SKNB 5DHYB 2OTWB 3E6FA 4QXUL 4NSKB 3C60B 4C83B 1FCGA 3AXLA 3S37L 1R3KB 2GJ6E 4XP4H 4IIQC 1F8TL 3O6LH 3K3QA 3OKNB 4XP1L 1JRHI 3S3JA 1BIIB 5F3BB 3HCVB 4U6XA 1BMGA 4PP1D 5D1XC 2RR3A 3MA9H 3W11C 2BVOB 4G6MH 1D6EA 2EC9U 3BISA 3DBXA 5EO0A 1ZVSA 1KJVB 4LAQH 3QIBC 1AD0B 4UV4L 1NANH 4YHIB 3G9AB 3PF2A 4NSKA 5GSRB 4LCWB 4OGYL 4JPVL 5KJRH 1RD6A 1KUMA 1R3KA 3RKPA 1FC2D 4FQ1L 1UZ8A 3EW3B 5ICXB 3UTQA 5AAWA 3HE7C 3D69B 4NN7B 1N8ZA 3BP6B 5B3JE 1MIEH 5F3BA 3D0LB 4JEGB 3P40A 1JPTL 4ONOA 2WW8A 4LEOB 5JDJA 4JFDA 1UH4A 2HT3D 3WIFA 3BZ4A 1AD0A 4Q6IC 5D7LB 4X6BA 3FHQA 3MXWL 4OUOA 3QNYA 5T3XL 4QEGA 2VH5H 5GS0L 3GBNL 3TA3A 5FF6A 1YY9D 4O4YL 2QKIA 4P5MA 5ICXA 3DROB 5CSBA 3QO1B 2JJVA 4MVBD 1AXTH 4EXKA 3NAAH 3HUJB 3VW3L 3AY4A 3BD3A 3RWEA 3GO1H 1J0KA 5K9KB 1RZGA 3LZFL 5D1QB 3TO2A 1SJHA 4XVJH 4I0PA 4GXVH 2MKWA 2WBJD 3ULVL 1AY1H 3LKPA 5DLMH 5DK3A 1INDL 2ZUVA 4GAYA 3MLWL 5DJXA 3H42L 4LCCA 4U1LA 5EO9B 4PRPD 1BBDH 3OAYH 3UBXG 5GRUH 3L1OH 3O2VL 2VDOL 2IBZY 2OJEB 2E3VA 3IETA 2EZ0C 2E7LC 5HPOA 2D0HA 4FQHB 1VFAB 2GAZB 1MJJB 2AJVL 1B0RA 4LLAA 5C0IB 1U6AH 4Z95L 3V6OC 3F12B 3ZE1E 4P2RB 1I7UA 4WWKB 1CDUA 1I1YA 1A3QA 2FATL 1OP5H 3PV6B 4EIZC 1I3GH 4XHJD 1MCRA 1HNGA 1S9KC 1RURL 1G6RL 3TGXA 3V6ZB 5DD5H 2OJEA 5T1KB 4LSDA 4OLYH 2Z35B 4LLDB 2R1WA 2NXYB 4JFXB 3U36B 1MLBA 4WU5B 4FQHA 1JPFB 4RBPH 2VXVL 4E41B 1S5IL 3ZYOA 1JHLL 3VWKB 2R2EA 3H3PH 3IDGB 3DXAD 3G04B 3WN5C 4LPXA 3IAPA 3LEVH 3WJJC 2FX9L 1ZGLM 2QQLL 4GS7C 1MHCB 2M8XA 5EB9A 4YH6A 4B7IA 4TSBH 4FA8A 2UZIL 4URTB 4PRHE 3PQYE 3LHPL 2Q7YB 2Z35A 1I1AD 3VI3E 4MB4A 4JFXA 1SMOA 5HHVL 3U36A 3R0NA 4X4YA 4KKCC 5GXBB 3AM8A 3O4LE 4I2XB 3NFPA 3MRRB 3LCYA 3HNVL 1F45A 1CZ8H 3VWKA 3IDGA 4WDIA 3G04A 5IM7A 3IFNL 3ZDYE 1DBML 1MHCA 2IPUG 3STBA 1EGJL 4PJXB 1E0OB 5EUOA 1EEQA 2P5EB 5HHNB 3B9AA 4PJIA 3ECBB 5IB3A 3RFZC 3QULA 3TYFB 1TTFA 4H26B 4IDJL 1IC4L 3D18B 4ODTH 4U1GB 1QSEB 4C57C 4MX7B 4F7CB 3DVGA 3QG6B 4NKIL 4HFUL 4PRHD 3C6SA 4XPGH 5L7XH 3ZYJA 2HTLD 4RGNE 5DR5L 4RFOL 3O4LD 4PJEF 1NBYB 1L0QA 3T1FB 3QEHB 1NGYB 2BERA 2B0SL 1A6UL 2ARJA 4M43H 4MX7A 3U9PH 4F7CA 1XZ0B 5B38B 1XT5A 4BFBD 1KTKE 1OAZL 4DUXA 4KRNA 3QG6A 4Z7QE 3T3PF 4ZO8A 3PWVB 2R39A 1F4WH 5D7JB 2FR4B 4Z5RA 3ULUE 3KLHC 4Z7UF 1RAMA 5CEZH 1L7TL 1U8QA 4YDVB 3T2QA 4ZAKB 2J7LA 5L0QB 1RHHB 5DJAB 4N68A 4PJBE 4GLRI 4X0KB 4YAQB 4BSWB 5I1HH 4MCYA 4R0LC 4J7RA 1XZ0A 5B38A 3REVB 4JM2F 1HK6A 3VXTB 3VRLF 5I1KL 3LQAH 3OZ9H 2AKRA 3KVQA 2YBRB 1OGAA 5GGUA 2EE6A 5DFWH 4P2OA 1J05B 1SBSH 4YDVA 3WFZA 2CKBH 4P5TB 5C0CA 3DO7B 4FFWD 1BD2E 4M7ZC 4YHOL 1RHHA 3MV8E 5DJAA 4XP6L 3VGFA 3NIDF 4MMXC 3SQBA 3V5HB 1KCLA 3OR6A 5I1DA 3H0TA 4X0KA 3QUMH 3P0GB 5TE6L 2VN4A 5HHMB 5MHSE 2LAGB 4X5WA 4YE4L 2HJLA 3RNKB 5CP3H 1A6WH 2BMKA 1KPRB 1RIHH 3NCMA 1CE6B 4G8EA 4RSVA 5KOVC 1QFUL 3PWNA 1KPVA 2B39A 2LU4A 3QUZC 1FZJB 3GJEB 5A2JH 5LGKA 5EUKB 3U0WH 4KMLB 2B1AL 4LIQH 3VE0B 5D70H 2H2PD 2CUIA 1J8HD 4LVHB 4F7MA 1MRDH 4K3DL 2RCSL 1SEBB 2E9IA 4X7SL 1AFVH 1AHWA 4LLMA 5HVGB 1U95A 4XZUB 1WZMA 2ORBL 5CS7A 5DFVC 5LCVH 5J7CC 3WFCL 3RKDD 3RL1B 3PDOB 3JVGA 3ME0A 3MV8D 2DLTA 3FB8B 2R56L 3C08H 4QGYA 5HYEA 3GJEA 4JRXB 4KY1L 3AC0A 1B9ZA 2BVQB 5B4MD 1KSRA 1R3IL 5EUKA 2NY4D 2EH7H 3PABA 2DQHH 1LK3H 4N0FA 5F1KC 2D9CA 2WINB 3KNBA 2GJ6B 2JB6A 4QRQB 5E8DL 1SEBA 4ERSL 1HYRC 3OKKB 2XY1A 4OUUA 4ZUSB 3DURB 4JKPH 1Z9SA 1ZK9A 4MQ7A 5F7DB 3CFEB 2IALB 2R23B 2YPKA 2WUCL 2CJUL 3FB8A 5DJ0A 5GS1C 4WTZA 5FEBA 1LEGB 2HJKA 4DN4H 1VKXA 1EZVY 3ARED 2H45A 4ODBD 1J8KA 4JRXA 3FO0H 5H35B 1S7WA 1NH6A 4HK0B 2YD7A 4FQJH 3VD4A 3F7RA 4ZYKB 1YY8B 4WHYH 1EAPB 3QFDB 5J4MA 3OKKA 3DURA 2J6EA 4DAGL 1DUZB 3BD4A 3L3HB 1NAMA 4O9HH 4OLUH 3H7BB 1AO7E 3CFEA 2YPVH 2IALA 5FKAB 4HK3N 4JO3L 1LEGA 1I8LA 3HG1D 3QQ9C 3IF1A 2PXYA 1XF5B 5ECJE 5J3HC 4WNQA 5F3HB 2AK4A 5H35A 4MA7L 5C71A 4HK0A 3WLBB 4XAKE 4AEIH 3MV7E 4OF6A 1CGWA 1XIWC 1EAPA 4L8SB 3GJFH 1MAMH 1YN7A 5C0FB 2IBBA 5CGMA 1WK0A 4OCSL 1NCNA 2R0WH 1KCSL 3L3HA 3S37X 5FKAA 1HH6B 4ORGB 1T80A 5JIHA 1S7VB 5C3TA 2DL2A 1IGCL 1Q1JH 1JI1A 1XF5A 4U31A 4MS8D 5GGSB 3MJ7B 3V9FA 1BWWA 4QTIH 3V8OA 1S7RB 1QP1A 5SWZD 4NZUH 4YPJA 1KULA 3CH1B 3MACH 4L8SA 1AO7D 1YEGH 4HC1L 3QEGL 2YUVA 1MRCL 2DWDB 3RDTC 2PO6A 4LAJH 1GL4B 1O0VA 4Y2DB 3MBXH 1T5XB 1JYNA 2ID5A 5AZ2H 5E5RB 4V2CB 1LK2A 1HH6A 4LDOB 5DVOA 4FQCL 4R7NA 4QHLB 2VLME 4HFWA 1I1AB 2BHUA 2O5YH 4UV7H 3ZYIA 4O2CA 1YNKL 3SE3C 3T0EA 2D7TH 4PJEE 3MA7B 4DEPC 1UXWB 3CVIH 2EYSA 3IDYC 4Y2DA 15C8L 1T5XA 4YHNB 1J1XH 1IGJA 1QTYT 4L8CB 3DUHA 3R8QA 1N3NB 1VEMA 5L2JB 4LLYB 5A3IC 3FN9A 2FEDD 3HB3D 5C9KA 2VDMH 4Y5YC 5IESH 1SEQL 4K3GA 1C16B 1D5IH 5E2VH 3PXJA 4PRNB 4QRPE 3X13B 1U3JA 4Z7UE 3WUWB 2HWZL 4YHYB 2XYCA 1JF6A 1UJTA 2CIKB 4DW2H 4RFEB 3B9EA 4UDUB 4KAQH 4BJLA 1BOYA 3E2HB 1CICD 1OTTC 1R24B 4JR9L 4PRHB 3CVHH 2HVJB 3PQYB 5I74C 4G5ZL 2ADFL 5L2JA 2XWJA 4OD2B 3KLDA 2BSED 5I6XC 1U8OA 5TF1L 1QLRB 1U8PB 4QLRA 2MQ0A 3VRLE 3HMXL 3TV3L 1CYGA 3QNXA 4GKZB 2X4TB 1YQVL 4R4BA 3KAAA 3GKZA 4PRNA 4KVCH 5F9DC 4JPKL 1EO8L 4UDUA 1A4JB 1UM4L 4F80A 4NN5C 5IHBA 3VFRB 3N1MC 5CGYD 1KPUA 2IPTH 3O8XD 1J1PH 4PREB 3GMQB 4OF7A 1X4XA 1QVOB 3VFOA 2DQCH 5DD0H 4WGVB 3S96B 2ICWI 5BQ7B 1E27A 3HC4L 5L9DL 4J1UB 2K7PA 3NH7H 1BECA 1ZGLB 2EDWA 1CFVL 2YEZB 2JIXD 3I9GL 1AJ7H 4LSVH 5E6YA 4RGNB 1PSKH 4AIXA 3WD5H 1YUHB 1UKQA 5J57B 2Y36H 3CCHA 2YR3A 3WO3B 5C6WH 2P47B 4JPWL 4P23A 4U6VH 5TDPA 5F1SA 1H8SA 4OZFG 4S1RL 4YK4B 5I76B 3TO4C 4Z9KB 3BEVB 2H6PB 1MCKA 2AQ2A 4ODXA 4A6YA 3DVFA 2PYED 1BGXH 1N64L 3MJ9A 4OD1L 3C6LA 3I3DA 3TN0D 5JDSB 4ZD3H 4DGVL 3BQUA 5JR1L 3HC3L 1X7QA 2C9AA 3R0MA 4IRJD 2VLJA 1IRAY 3MLSL 3HMWH 4JAMA 5D7SL 3LSOB 3MRMB 3J7HA 3FRUB 4NN6B 4PJBB 4LASL 4QXTB 5BOPA 4N9GB 3KYOA 5CAYB 5I76A 1BWMA 4JHAH 5BXFA 3BEVA 4Z7NF 3MCLL 4JQXC 1JHKH 1KLGA 1UB5B 3QIWC 3TVMC 1X5AA 1GC1H 4B41A 2PW2B 2DJ4A 5KVDL 1Z5LB 2CDFB 3K2MC 1MCWM 4XNUH 2OXHA 4ZSOA 4LHUG 5C07E 3QCVH 4FQ2H 1ZTXL 1BD2B 3MRLB 1A7OH 4LP5A 1TLKA 5D6DC 4EI5D 4XMLH 3FFDA 3K7UA 4GG6B 4N9GA 3QQNA 5BMFH 3HI6H 3GI8L 5D2NC 5TE4H 2NY4B 5A2FA 4KJWC 2I60L 5H94A 5E1HB 5EWIH 3ARBA 5I71C 4BQ8A 2WK2A 2MFNA 2PW2A 3M1BB 4XPFH 1Z5LA 3QDME 2CDFA 3DSFH 5ENWB 1LO0L 4QRTA 2NY7L 4Y4FC 4IRZH 3NOIA 4NT6A 1IILE 1JFQL 2J88L 3RTQA 2HT2C 4PP2B 4Z76B 4BSVB 2ARWA 4HIEB 2HJFA 4MJID 3BGFC 2DLFL 3THML 4GG6A 4WW1B 4NQXB 4WUUE 1ZANH 5J11B 1IT9L 5FOJA 5AWNH 4JGJA 4W68A 3X11B 1REIA 5CWSA 1D9KA 1PD6A 1A1OA 5IMMB 2MCG1 1RMFL 2VKWA 4MAYD 2GSIB 1RHFA 3CSYA 2UWEF 3TIDB 4GW4A 1MQKH 1DANU 1G7PB 1JGUH 2AV1B 2DM2A 1HXYA 4BSVA 4HIEA 4P3DA 4O51B 4LCIH 2XZAH 1RULH 4I0KA 4EQ3A 3S88H 1J0JA 4H1LH 4P46D 4WW1A 4UBDC 2VSCA 1IKFL 1T83C 2OM5A 2R4RH 2A1WL 2BNRD 1OQOA 1MFBH 1I1CA 3X11A 5C1MB 4HX1B 4NQCD 4JKWA 1HH9B 5JOPE 2ESVE 5DHVB 1Q9KB 2VDLL 3SQOH 1J88A 4H5SA 4MAUH 5HPMA 2AV1A 4P49A 1E4WH 3L3IA 4S11A 1B2WL 2GFBA 5EZOH 2GTZA 2IAND 4IMKC 1A6TB 4BQBA 2XQYK 5FYKE 3TBYB 2E7MA 4S1SL 3U4EB 4OFDA 2EE3A 4HX1A 4MD4B 3N50A 4LDEB 1DBKL 4F57H 2X42A 2ZCHH 5MENB 4LL9A 1P7KB 4LCYB 5JPNA 3C2SA 3P30L 4LQ1A 2FECL 3U83A 3GMLB 1DQLL 4KTYA 3TJHC 1MFDH 1J0IA 2P5WD 4PB9H 3QDJD 3VFVA 4E0RB 1P7QB 1E4KA 3BUTA 1HEZA 4PJFE 4HCRA 2EXYC 1A6TA 3MV7B 2F54D 2M26A 2XNAA 4IJ3B 2AV7B 4K07A 5JOPD 2ESVD 1BM3H 4H8WC 3KPOA 5CEXA 2C5DC 3T8XB 5MENA 4ZTOH 1D5ZA 3DO3A 4XGZA 5I30H 1LEIA 3ZKMD 3QDGD 3O3DA 4QHNB 2F19L 3ZKXB 5IW1B 3I50H 1UENA 2P4AB 2ZSVA 4R2GB 1EVUA 1KYOK 4QF1B 3EOTH 4OZIF 2DQTL 3I84A 4OLXL 3WEXB 2A6JA 3L9RA 5GJSL 1LE5B 4LLVB 1U8HB 3T8XA 5MEPA 2H32B 2NY2B 2KH2B 3RQ3A 1R3LB 3KPRD 1CICB 3WUZA 5C0DB 2HA1A 4JDZA 4NBYB 3ZKQD 4WHTB 3CXHK 3VXSD 2CR3A 3EYSL 4XWOC 5FB8B 4QHNA 4HKBA 1P9MC 1IEAA 4YZFE 4P2QD 5IGXH 3JUZA 1Q9LB 3CUPA 3D39B 4PJEB 1NFKA 2D4FA 4PJ5D 3WEXA 3BYYA 3HE7D 5BV7L 1U8HA 1IEBB 1O7SA 5E56A 3ARXA 5CJXA 4JRYE 4J4PC 1R3LA 2FZ3A 2AGJH 3BH8B 4NQEE 5J9PA 5L8LB 1JZ6A 3O8XB 4WHTA 4L4TE 5F6IB 5FECB 5FB8A 2NY0C 1X6NA 4TVPH 3T2NH 4QRPB 5KAQG 1CU4L 3KS0H 4P4KA 1Q9LA 4OGXL 1VPOL 3D39A 4AZ8A 1P4IL 4KHTH 4OD3L 3RY6A 3VGDA 4OCXL 3V6OE 2O26U 5DO2D 4PY8J 3BPOB 2ICWB 4PJDF 2YUZA 2JIXB 3CXDL 3BD5A 5TH2A 4LRNH 2X2YA 2CRMA 4JM2B 2LVCA 5EBLA 5FECA 1T22B 3BRGC 1OWWA 2AI0H 3IDXH 5JOFB 1DCLA 4HAGA 3KYAA 2PN5A 4YX2L 4P2CG 4XC3H 3W9EB 2OK0L 2BZDA 4UTAH 3PWLB 4JRYD 1WJ3A 2BHYA 3SGJA 4YGAB 1TVHB 2ICWA 4ONGL 3LKNB 2AJYL 4L4TD 1DEDA 3JWNC 4EQ2A 3N1PC 4JZJB 1I85A 2EZ0D 4LLQA 1GAFH 4C58B 4CMMA 5HYQA 5A40E 4UT7H 1IGMH 2PR4H 4N0YH 4F37F 3NFNB 5JOFA 3MJ8B 1FPTH 4LVOB 3W9EA 2PYFA 3WV0A 3FRPA 4M62L 5J12C 4K94C 4L8BA 2VZVA 2J8OA 1EHNA 3BPLC 1RJZB 2CO7B 1W8OA 1V3JA 1ZHKB 5BZDA 4LLWA 1M7XA 4BKLA 1I4FB 3RWDA 2XICA 4EBQL 3TNNA 2DTSA 1TQBB 2GITB 4JZJA 1OAKL 3GEWB 3VH8A 4ETQA 4YXKH 4Y19E 4NNXA 3RPKA 1OW0C 1KB5B 5K9QG 1IKNA 2SEBA 3H9HB 1SY6L 4JN2B 5BRZA 1OD9A 1P4BH 3VXNA 1I9IH 1N6QL 3MRCB 4M1GH 1ZHKA 5CJ8A 5F97E 1UYWL 1I4FA 4FXKA 3RHWF 1RUPL 2D03H 2YK1H 3V5DB 4GKNB 4OQTH 1KV3A 3S34H 1HDMB 1H3VA 1YEEH 4HGKC 4ZPTA 2XY2A 4KKCD 1KB5A 4X4XB 3IXTA 4QRRA 5J0BA 1Z3GH 5EU5B 4C56E 4L3EA 4LPUA 2NXZB 4YHKH 4ZFFB 3ZL4H 2DKMA 1D3CA 2DRUA 2OP4H 2ZWLT 4YNYB 3VD9A 4JFZH 5C07B 5HYFA 4JB9L 2EYRB 3D9AH 4NQUA 5KW9L 1HDMA 1DDHA 4KFZC 3SGEI 3UYRL 1W72H 2E7CA 3V5KA 2YS4A 2V9QA 4GRLA 4MWFA 4AL8H 5C0AE 3TM6A 3MOAH 4S0TD 1I9JL 4YC2B 1UEMA 3WHE1 1AXIB 3KXFA 1FORL 4ZFFA 1RZJL 3QXDB 1XGUA 3QDMB 3RGHA 4PJ9C 4YNYA 1YEFL 1KN2H 4I4WB 5DJ6A 4X6DF 2N7AA 1U41A 3BKCH 4WCYH 4K8RH 2EYRA 2GQHA 1IARB 4XXDB 1FE8H 3N9GL 4Z7WA 4HH9B 4WUUB 3WS6A 1AC6A 3M17B 1AQKH 4TOYL 1S9WA 5I8KH 1UH2A 1GHFL 4GH7B 3K4AA 4PRIB 5CD5C 5FUCE 3QPQC 2X4SB 1OGTA 2ZP0T 2PW1B 4OSUH 4I4WA 5BZWA 4Y0GA 3KLHD 1R5WB 1YEDA 4JDTL 4QHUB 2Z31D 4XCCH 5GGTA 5C0JB 4OLZL 4OZIE 3VDAA 3C2AH 4R8WL 5JNYB 2NW2B 2P7TA 3QFJE 3ZT6A 4FTVE 3MRPB 4BZ1H 3D3VD 4H0HB 3IDNA 3SY0A 4OM0H 4ZMAT 4P59L 2W0KA 5INCB 4HAFA 1W8NA 2FEEI 4PRIA 3EYUH 4N0CD 3TH2T 1NCAL 4F37K 3C09B 4IM8A 5D72H 4AENA 2BSTB 3RBGA 1PY9A 3F7PC 2JF1A 3RAJH 3OQ3B 3DX6B 2ESVB 2Q6WB 5IVZB 1YEIH 4LSQH 4POYA 3EAKA 3O11A 3UZQA 2J3SA 5FA4B 1PKOA 1WFTA 5FYJE 1DQMH 4O2EA 3S5LG 4PJAA 2QBWA 4NM4H 2Q8BH 2X4PA 1AGCB 5JNYA 1FBIL 3CLEH 5IJKA 3HE6C 3NA9L 5GGVY 1RFDH 2DMCA 2R29H 3LQAC 2NCMA 1QBLH 1MH5B 1VGEL 5IBTL 4HGWA 3F58H 2ZUYA 1DQQB 2BSTA