3DHJA

Beta 2 microglobulin mutant w60c
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
b'MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDCSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title DE loop mutations affect beta2-microglobulin stability and amyloid aggregation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dhjA00
3NPSB 3REVB 3L3JB 1MIEL 4HX1B 1LMKA 3HR5A 2VLRE 5D7IF 1B2WH 1OGAA 1A6VL 4L9DA 2YD6A 3RWJB 4O58H 2AJSL 5SWSB 4JZJC 1HINH 5C0RH 3T77B 1OM3H 1MRFL 1NBYB 2FYYB 2FO4A 4MJIA 4D8PA 5IEKB 5E6ZA 5DJ8A 1U8KB 2VXSL 3QHFL 4NQDD 1RZGB 3MRMA 4QRRB 5C0FA 3LV3A 2BMKB 4OZFG 5IM7A 3N1MC 3OX8A 4PJFF 3WIHL 4XPAH 3C60A 4JKWA 3EAKA 1Q0XL 1JHLH 3ALXA 4QCIB 2A1WL 1S9YB 4KAQH 3BMWA 1VKXB 1FAIH 1NL0L 5J1AA 4GAGH 5IBLD 3RKDD 4HIEB 4GS7C 3B8SA 3T09A 4X6BB 4NKMA 4KK6C 2QHRH 4PJ9C 1M71B 2BSED 5D1QD 4WW1A 1YEIL 1VERA 3QEHB 5JR1L 4RGMC 1L4IA 1V3LA 4EN3B 4Q74A 4TRPH 5BRZB 1T1XB 5LQBL 4Y5YB 8FABA 5K93A 3HE7C 4K94C 5DVKA 5JPMA 4Q2ZB 3CVHH 5C2UB 2HJLA 4X4ME 4XHJD 4OGXH 4XNXH 2C3VA 1HH9A 1OSZB 5EO9B 1B6DA 1MCNA 2EEDA 2WLZA 4P3WA 5IMLB 5LGHH 2W07A 3GSNL 4JFZL 4PRIB 5BCAA 1KB5L 1IAIH 2CIKA 2AK4E 3ESVF 3ZT5A 2QEJA 3QH3B 4G43B 4UV4L 4ZNEE 3MLPA 4P3CL 4UOW0 25C8L 3PXHA 4MAUL 3LHPL 4JFDD 4MMXC 4KJWD 3DO7B 1XGUA 4JRXA 5LBSL 1P6AB 1I9EA 3EFDL 4MJ4A 4PJHB 4Z7UA 5FUOH 5MENA 4M7LT 5CD5C 4Q6IA 5H35A 3PL6D 1OD7A 3KPTA 5L8JB 1J1OH 3KR3L 4G80A 1XIWC 1YA5A 3Q6GL 4XNMA 1J88A 3WEXB 4HS6B 1J87A 5I71B 4OF6A 3UJIL 4NO5A 3OF6D 4MD5B 4KZEH 4HZAA 4U6VH 1FLRL 4HC1A 3L3IB 1AGEA 3HI5L 4JREC 4Y4KD 3UBXI 4WUUB 1HHHA 1KTKE 5IIEA 1P4IH 2HG5B 4O2CA 2UUDK 1TJHH 5B21A 4OD1H 2Z8WC 2Z92A 3MRFA 1MCKA 3VGFA 4OCYL 3ECBA 1NDGB 3JV5A 4R26L 4E9LA 3OHXB 2NW2A 2VLKB 2DQEH 1FFPA 3OXSB 1BFOB 1FFQA 4RQQB 2P5WB 3VFNA 3U9PL 4AH2B 4X7TA 3M8OL 5CEZH 3IU4H 4YK4B 2QSVA 4XVTH 1OF2A 4PJXF 3TP4A 3LKOA 4ZQKB 2XTJC 1AD9A 3QI9A 4HGKC 5E6ID 1EUTA 5FYJU 4ESKA 1RURL 5FO8A 4Y19E 2H1PH 2ITDB 4PV9A 3O4OB 4GKZA 4L9LA 5DQ9B 3K2UH 5HDLA 2Z31B 2GTWB 4N0RA 5D7JD 3P9MA 2B5IC 1ADQA 1GZPB 4TN9A 5GGUA 5CILL 3SKMA 2X1WL 3FJTA 2X4SA 1JL8A 4CJ0A 2JKXA 2W9EL 4D0DA 4E41E 1SJEB 1J0JA 5TGBB 2EZ0D 3F7QA 4OZ4B 4UNVA 5I76A 3TO4C 4ZFOL 4UB0H 5D8JL 4NWUH 3FO2A 3ZTJG 3O3EA 4XC1H 1I9JH 4ZOBA 2ZG2A 3C6LB 3RVXC 5ANMA 1FFNA 3QP3A 2J5LC 4FA8A 3L3DA 5BO1H 4K3EH 4OB5H 1B88A 1O0VA 1IT9L 3MYZA 5E9DB 4IEFB 1MRDH 4S0SD 3OKOB 4JPKL 2IAMA 1ZSDA 4QY8B 2DKMA 4UINH 3RI5K 3MCKB 2R2CA 4YDVA 3D39A 1E4JA 4R97B 3G5YB 4CBPA 3H9SB 2HTKD 4FQJH 1I1FB 2HMID 2A0LC 4GH7B 1VESA 4KKCC 3UP1A 4QHNB 3IFNH 2IQAA 1N6VA 3AU1A 5DK0B 2Z35A 2AJ3A 1CDIA 1ZMYA 1FJ1A 1UB6A 1Z9MA 2A6IA 1WC7A 3EUUA 3HB3C 2ORBL 1L0QA 1MCBA 2GJ6D 1FO0H 1ZE3C 1DLHB 1FIGL 3C09C 3T4YA 4RISH 1A6UL 1C7TA 4BQBA 3KLAB 1G9NH 1WCQA 5E00A 4EJ1C 1AR1D 5HHQA 4OQTH 5D1ZD 3QCUL 4KQ3H 2VXUH 3ZDYF 3TBYA 2DIBA 1DQLH 4YDJA 3V5DB 3P4NA 4R96A 5I17A 4XCEA 1C5DB 4GRMB 1ZWIA 3OKEB 5EA0H 4Z7OF 1GOFA 3OXRB 3TF7C 2E6QA 2VKWA 1XGPB 2ICEB 1MI5D 5L9DH 2ZUUA 5EZJA 5HPMA 4P2OC 3DURA 1MFAH 4NM8H 4U1SA 2D7PA 3DYOA 3MLSL 4NDMA 5T3XD 1P7KA 3MLTB 3CJJA 1U3HD 4G6JH 3HG1A 5IVXA 3ZL4H 1WAAA 4X7SL 1CXLA 2FEEL 2OCFD 1EO8H 1O7SA 2WUBL 5BW7A 2NX5A 2YD2A 1MCOH 5ID1B 4APQD 3RL2A 3C87A 2KKQA 2XN9D 4YFEA 3OJ2C 3FO9A 2X9YA 4CMMA 2YKLH 3MRRB 1TCRA 3TZVB 1JF5A 1WZ1L 4FQ2L 1AKJD 3X13B 3K4DA 5KG9A 1G7PB 3LPWA 1CU4H 2F58H 3RU8L 4PLOB 2OI9B 4KK5D 4RFOH 3GGWB 4KK8D 1A6AA 2F9BT 3U30C 2J88L 3MJ9L 4Q6IC 4XNZB 2DL9A 4LKXB 4LLYA 2IG2H 2AERT 5HHMD 4XMLL 2YRLA 1DBBH 1R5IA 1P5VA 4M6OH 1NLDL 1F4YH 1HNFA 3MXVL 4ZD3L 3VXSB 3VWJA 4F7MA 4V1DD 1NANH 3BWAA 1UM5L 1EUUA 1PDKA 2H32A 4X5WB 3ULUF 4X5XB 1J0KA 1LO0H 4Z5RA 1QFWI 3IDXL 4Z7VA 5HHXH 3WIIL 4KPHL 1IGMH 4NJAL 5EB9A 5L0QB 1WIUA 4BM7A 4GBXD 3QUXD 1CFSA 1OTSC 3VJ6A 1SYVA 5K9JH 1RHHA 3RVUD 4OCWL 4AM0B 1FCGA 4PGDB 3MBXL 1UM6L 2Y36H 3BKCL 4AG4L 1ORQA 1XR8A 4W6WB 3MLWH 4QHMA 3S35L 1O7VA 1YEJL 3O8XB 2B2XH 4JM2A 2NY7H 3EYQD 2J12B 2WSKA 1FVCA 4PGEA 5IJKC 3E6HB 1VHPA 5DC9B 1DZBA 1ZT1B 4H20H 4Y4HB 3GMNB 4K23L 5A3IC 4PY8I 3WNPA 3O2WH 4DN3H 1HCFX 4U1KA 5A2JH 4AIZA 2VLRB 3X17A 3QI9C 4MA1B 1MCRA 1NPUA 1EBPA 1PG7H 5FKPA 4QRTB 1LK2B 1MLCA 1RSFA 4JN2B 1A7QL 3LVEA 3ZMRA 1T3FA 3KNBA 3VXPA 5HVFB 3RWCA 4F15C 5KSBE 2R1YA 1QEWA 3MFFA 2NXYC 3VFOB 4N0FB 4LMQI 4UOJA 4HKXB 4NN7B 3HRZA 4PJ7E 4L5FL 1UC6A 1GXEA 4JFQB 1P7QD 4L3AA 4X0KB 2G9HA 3F7VB 1HSAA 4NO3A 4PJIF 4NKDB 3BN9D 1S78D 4JFHD 3CFEB 3EOAB 3UYPA 1PY9A 3DIFB 3TJEH 3MNVA 2C1PA 2YXMA 3JV4B 5ESVA 1JGDA 5D93B 4MNQD 2DD8H 4KMLB 3QDAA 4NRZB 5HHOE 3NTCL 2ENYA 4MA8L 1OAUH 4XI5D 1JPFB 2IAMC 5C07D 1YN6B 4XVJL 2FX8L 1MOEA 3DVNB 4R4BA 1XR9A 2EYSA 3MACH 3TCLB 5C2BH 4KQ4L 4PD4K 3THML 5FB8A 1MFCH 1HDMB 4QWWC 3OKNB 1JPST 4PJDF 1VACB 1CL7H 3RX5A 5I1DB 5GRJL 1RZJC 4OZIB 1U2HA 3F8UB 4P59L 4ELMF 4OUOA 2AK4B 2EC8A 5FYJL 5T1DL 5EPMB 3FN0L 4POYA 4NOFA 1UA6H 1FNSL 3BPCB 2YK1L 4OCSH 1I9IL 2FCBA 3UJTH 5MP6L 4L4VB 4OSUL 2OJZL 3WS3A 2WBKA 4R2GC 5KOVC 4BSJA 4K7FB 2OS7A 5J9PB 1KB9J 4ZDHA 1B0GB 4IIQB 5JW5B 3WNLA 3EFFA 4EDXB 2C9AA 4WIQA 3HI6L 2HH0L 2NY4C 4LVOC 3BQUB 2OL3A 4FQQA 4E42A 2FBJH 5GRUL 1NCTA 2BOCA 4KUZH 5BV7C 4LCCC 3V79C 1TENA 4KRPC 3CMGA 3V6BR 5D4QA 1IAIM 3RNKB 3SGJA 2C7UA 1LDPL 2OM5A 1YYLH 4PUBH 2DJUA 1S5HA 1I9RL 4YHPA 5LXGL 1ZANH 4DVBB 5HGAA 3TNNB 4UDUA 3GRWH 3FO1B 5IGXL 5C0DA 3VGBA 3MLXL 4XT1C 5KVFL 1OTTD 3OKLA 2YN3A 2X1PA 1YZZA 4LLAA 2EC9T 4JHWL 1JPSH 4OLXL 1CTNA 4Q9RL 1M7XA 5BJTB 3T65A 5C0BD 3KYMB 1QBLH 3C2SA 5DFVC 3RWIB 3PWPD 5CEZD 1KTLB 1F00I 3QXAA 3VXUA 1MCQA 3TN0A 5JHDD 3MRNB 1NMBH 4MZ2A 1YYMH 4R9HA 1HZHH 5T3ZD 2DMKA 4Y19B 4ISVA 4LIQL 3WHE0 3GIVB 3H9HB 2X4PB 3VXMA 1O5DT 5MEOA 4GKSB 5HDQL 2LE9A 3HS0B 2UVEA 1DCLA 4XGZA 4F3FB 4QLRA 5EU6E 1KBGH 5MERB 1KENH 4OJFL 3S36X 3HC0A 2EO9A 3QUYA 3W2DL 3U46B 3VWJC 5EZIL 1YEHH 1FHGA 4LLMA 2R0WH 2NR6C 4Y2DB 3N1QC 4JO1L 3TWCH 1BFTA 4X7EC 2AAVA 1LP9B 5GSRB 5EZOH 4ZO8A 2YUZA 5HGBB 4RGOH 1N64L 1NBZB 4Y4FB 1A22B 2CJUL 4OF3A 1DSFL 3G9AB 4E0RB 2DJ4A 5IMOB 4L4TE 3LN5A 3EDDA 3V8OA 3WLBA 1N5YH 3QIBA 2ICCA 3RDTB 3T3PF 1RIUH 4LHUG 3FHQA 4JM2C 1A6WH 2LABA 1A6TB 4PS4H 1EAPA 3IAPA 3LIZH 3U7AA 3HA0A 1KSRA 1MF2H 3KPRD 3DVGA 2GT9B 2IBZY 1DN0A 2E9BA 1MHPH 3FQWA 3GBNL 2ZP0T 2W0FA 1RZFH 1IEAA 2R2BA 1D5BB 2NY0C 1I7TB 1YDPA 2I5YH 4LL9A 3HAEB 4NUGH 4YAQB 4DCQB 3DUUB 2GSGB 5AAWA 3ETBF 4A6YA 5IK3B 1TVHB 1RZ8B 5MI0C 3RX7A 1U8IA 3AAZA 4LCWB 4X7DC 1PSKL 2RFXB 2OK0H 4JB9L 2Y07H 4OIIH 3OGCA 1KXQE 1T03L 1TVBA 2X4NB 3QNXB 2J3SA 5JZ7C 5KZCB 1A14H 3KG5A 3IKCB 2X2YA 4UIKH 1A02N 1EZVY 1KPUB 3MLYL 4BKLB 4HPOH 4Y0GA 1V7MH 1GRWA 5F7FA 5EULV 1CT8B 1YMMA 5CSZB 5EH1A 3C9NA 2XXCB 3EW3B 4WWKA 1FYTD 2VDRL 5FHBH 4MDJA 4P5MA 1T2JA 4RMUA 2EH8L 4Z7QF 3CPLA 3C08L 3IDJA 1KCLA 5DQJA 3P30H 2NY1C 4MA3A 5DLMH 4KJQC 3O6MH 1V3MA 1T0MB 2IPKA 3DNKA 1IL1B 5JOPD 1U8NA 3ULSA 4QNPE 3SQOL 5CCKL 3RBSA 4L8DA 2PO6C 3KXFA 4U31A 2P24B 3SOBH 1QYGL 4HWBL 2GUOB 5GRZA 3QCTL 1KLGA 1GGCH 4NQED 4YXLL 2OR8A 4D94A 3L7FA 2GAZB 3QUMH 2BNQE 3C2AL 5FHAH 1A4JB 1T22B 2G60H 1I8KB 2DJSA 3D0VB 4FQPA 1XF3B 1I8MA 1CF8H 4JKPH 4U1NA 1X5FA 1RULL 4YHNB 2H26A 1MH5A 4G3YL 2VAJA 3QFJD 2A73A 5DGQA 4OZHA 1LQSR 3MROB 4B0MM 2HRLA 1AIFB 2V2XB 5KJRH 2ZSWB 2PYED 5DD0L 3VDCA 5JIPA 2IH3B 2FJGB 2V2WB 2AJVH 3RX8A 2J6EL 3B3IB 5GGSB 2P42B 4GRLA 4HDIA 4PBVC 3SGJC 4KGLA 1F90H 2AEQL 4KJPD 1LD9A 1KN2L 1KN4L 3DUSA 2H2PD 3O6FC 4PJAA 4GKNA 1JHTA 2YC1B 4XVUC 4ZAKC 1JUFA 3NBNA 4JFXA 1EJOH 3NACH 1J5OH 4ZPVB 4BK4A 5ITFB 5IFAH 2YPVL 4OFDA 2JJSA 3PGDB 4WTZG 4U7KA 2EIEA 3WS6A 1Q9LA 4JG0H 4HG4K 3B9KB 3BYYA 4FN0A 1SYSB 4HLZH 2DQIL 3SCMA 3TVMA 3RVTC 4GRWH 1T1ZB 3NFSL 1MCHA 1ZGLP 3SDDB 1ZS8A 2BJML 4YHMH 4X6DA 3CVIL 1MHCA 1OGAD 2AGJL 3C6SB 4NQCA 2BP3A 2O5XL 2OJEB 3QXUA 2LQRA 4P57A 1CGSL 1RUMH 5IROA 4FP8L 4Z6AT 5CP3H 3QUYC 3L3HB 3DUHA 1FZKA 3OZ9H 1HXMB 1NCBH 2BCKA 5EO0B 3T2OA 2E27H 2P5EA 3QG7H 2VDNL 5F6HJ 3WYRA 5CKAA 4DEPC 4M5YL 4NP4H 3C60D 3CMOL 4MDIB 5CINH 1YECH 3A6CL 3WO4B 1MI5E 4U6TA 3C5ZA 4F9LA 2XG4A 4JN1L 1DBAH 3F7PC 4HKZA 5C09A 3QYCA 4PRHE 2UWEB 4YQXH 4YFLF 2BDNL 4HUKB 3UO1H 1TCMA 3UYOD 3G6JA 3QHZL 1CD1B 1N59B 3MRQA 5IBUB 3UBXA 3EYVA 1HILA 3GB7A 3QIBC 4UDTA 4LGRB 1VFMA 2IADA 2X4OA 3GSNA 1KB5A 2W0KA 4NN6C 5B3JF 5FIEA 5KS9F 1I1CA 1CZ8H 4RNRA 5E03A 4DUWA 2HKFL 5LG1A 1J8HA 3PWNA 4F7EB 2PETA 1KG0B 3BH8A 2DQDL 5F7NC 5F3HA 5DJDA 3S88H 3T0BA 4WO4A 4QHKI 4TVPH 5MEND 4HV8A 3QDMD 4TUOB 5TQ2H 4LF3A 2YRZA 3GMQB 2AS5M 3QIUB 3V5KA 1SBSL 4F58H 1QO3A 4XPGH 4POUB 2XKUA 2DBLH 2PW2B 3CFCL 4GW1B 5F97E 4G8GA 3MJ6A 3STLA 1HHGA 2V7HB 2VZUA 1A3LL 3P11L 2VERN 3AREA 1S9WA 5LCVL 2ZOLB 3HE6D 3RNQA 1S7TA 4NO2B 1FPTL 3TIDB 1R5VA 1D9KB 5MEQA 2FD6H 4Z78A 2XWBA 4QKXB 4LSDA 4XP9H 2CUIA 4MHHG 1OTSD 4LCUA 1IM3B 3ULUL 2ARJQ 1T21A 1W72A 1WSST 3M1BA 4IOIB 5IB4A 1NEZB 3AXLB 5C6PB 1A7PL 4JY5H 3FQXA 3QRGL 1SY6A 3JWOC 3QO1A 2ATPB 2FGWH 1OSPH 3PE9A 1U95A 4MB4A 1MJUH 2EDNA 3BKJH 1T04A 2DRUA 5HVGB 4WCYH 2Y6SD 1S5IH 3MV8E 3QEGL 4P5KB 5ALCL 4ODVL 3VRIB 1U91B 3UYRH 3ULVE 2EE6A 3QI9D 4U1GC 4QRSA 5GPRA 3MUY1 4PJHF 2AEWA 2MSPA 1GHFL 4O2FB 5ACMA 3F12A 5I73B 1JPGA 1TQCC 4NQDB 3P9LB 4KC3B 5EU6B 2XY1A 1JNHB 4AEIL 4NFCA 1C08B 1H15A 4GXVH 2NXYD 1HWHB 5FYLD 1QRNE 1NGWB 4S10A 3SKOA 2I27N 4OLWL 1P7HL 2WNGA 1QSFD 3MUJA 2NY5C 1R3JA 5D1QB 3S4SA 4MJ5B 3BESR 3MOBH 5HYSG 1BFVH 3DX8A 4EDWH 4GRLC 4XPFL 3AMKA 1MIML 1JF1A 2A9MH 5GIRA 1NC4A 5FECB 4YBLB 1RK1B 2CK0L 2DL2A 2G5RA 1CN4A 5FGCE 2IAMD 4GQ9H 4F33B 5IHZB 3TLRA 2JJSC 5E94A 2E7MA 3BT2L 4WY7L 3BZEB 3QO0B 3BIKA 5IB1A 3D39D 3O6KH 4KTEL 3DHMA 3BUTA 4OBSA 4QWWD 1NQBA 4U1IB 1ZGLB 5EU7C 4JFDB 4JPWL 4P9ML 4NC1E 4PD4J 3SCMC 3MCG1 4H26A 4QT5B 5CUSH 2VDKL 3BX7C 2QSCL 4KV5F 1HKLH 3LB6C 5L88H 2OMBA 3OJMB 2H3NB 4QXTB 1FL5A 3CDGB 1ED3A 2VLJA 4F7TB 4L29A 3MLUH 1C5BH 3HNSH 4PG2A 1UWGH 5B22A 2CDFB 2WUCL 3U9UA 4A6YH 4EOWH 3A6OA 4S1DC 2GCYB 4CAGA 5IT2L 2A74A 2GJZA 4LVHC 5I1AB 1S7XA 4UUJA 2PCPB 5IROC 4YXHH 1F4XL 3VFWB 4Y4KB 5L2JA 3BZFB 1AQDA 3FT3B 3QAZB 4BZ2L 4NZRH 3O9WC 2DICA 2WIMA 1J0YA 2OZ4L 4Y1AE 4U2YA 3MRHB 4AZ8A 5TJWK 4YIQA 4ZO7A 1N3NB 4CKVX 3O3AA 3MRBA 3C5ZC 1R3KA 5F1IA 4YNYB 3V0VA 1GIGH 2VL5B 4N9GB 4LPUA 2DIJA 5D2LB 1J1PL 3RIAK 1HIML 3SQBA 2KUTA 1KIRB 3GFUA 3RY6A 4B7LA 3OL2A 3HG1D 35C8H 1HHIA 3PWLA 3BDYH 2NX5D 3O3DB 4GXUN 1P6FA 4YXKH 2I9LB 1DBMH 2X4TB 1KV3A 3LS5L 4ZS7L 5EN2B 3WJLC 1KTDB 3VFSB 3H42L 4U1LA 5DFVD 4M8QB 5DVLA 1KIPB 4NKIH 1AY1H 5I16B 2FNBA 4LU5L 3T0WA 3TPUA 3P4LA 2X40A 3Q6FB 3EYSL 3CXDH 1EFXD 1IGJB 1A7NH 3H7BB 5KVGL 1QTYT 1W2KT 5F96H 4ZFGL 4JG1L 3ULVH 1T4KA 2R69L 4M48H 4NQUA 1T2QL 43C9A 3T3MF 3SGEI 1E6JL 1BLNB 2HFEB 4GMSL 2P44B 3HC4L 3I2CL 1JMXA 5DMKA 4TSBH 5EO1B 2BSRA 2EDKA 4MCZA 2IBZX 2ZCKH 3NABL 3ZE0F 3IJYB 5D71L 3VWJD 3I02A 3MUZ1 4G6KL 2GK0B 1PZ5A 1JCKA 2IFFH 2GFBA 3AREC 3MLRL 1UJTA 1I1YB 4PG9A 5IMKB 3MGOB 4ORGA 2AABH 5GZOD 5JW4M 1GH7A 4MXVF 1B90A 3W9EA 3VD9A 4KJYB 1KJ2H 3OAYH 1I1RA 3AUVA 4JKMA 3MV7E 3LMJH 3GDBA 4N1EA 1EMTH 3ZYZA 4NRXB 2EDQA 4JO3L 3DYMA 1MJ8L 4EVNB 4P49A 5ESQB 1XFPA 2I60L 2DQJH 5TFSH 2XZAH 1DEDA 3G5ZA 4XCYA 4Z0BH 2E7BA 4JM2D 2YPKB 5HI5C 1EZVX 2I07B 3MRKA 2C3XA 4G9FA 3NZ8B 1MIEH 1MJJB 1ZKAA 4YDIL 5HGDA 1SBBA 3A6BL 1BVLB 4OGYL 1IQDB 3BYTA 4WI3A 5EBMB 1HQRA 2X09A 4MWFA 1A47A 4MXWL 1A6VH 5AZ2L 2MNUA 3QJHB 4FXGB 2AJSH 3LH2L 4C4KT 1LVEA 5BVJB 4XX1G 3FL7A 1AGBB 1MRFH 5C86A 4RX4A 5ENWA 3FRPA 2VXSH 2ADGB 3QHFH 3PHSA 3IRPX 4NNPH 4U2ZA 5D1ZB 1VA9A 3WIHH 2HTLC 4HKBA 1Q0XH 4R4FL 5D1XD 2A1WH 2F74A 1NL0H 1KELH 1FG2B 4P99A 1JJUA 4HUVB 3FFDA 2ZUWA 4ZUWB 1UKSA 1MI5B 4AJ0A 3GHEL 5JR1H 1D5ZA 4C59B 3O45A 4LOUD 1UZ8B 1N2RB 5LQBH 4BSVA 1H3UA 2J8OA 4ELKA 1U3HB 1U8MB 4X5LA 2KBGA 4HF5L 5E5UB 4APQB 3PNWA 2XN9B 1OQXA 1I7UB 6CGTA 4X99A 4P3DB 4ZOAA 1FL3A 5GZND 4LEOB 5CIPH 4WRLA 3VD4A 4DGYL 2CUHA 4JFZH 1KB5H 2V2TB 1AKJB 3C5JB 2XZQL 4FTVA 5H2BA 2ESVA 4UV4H 2Z4QB 5GRVL 4P3CH 3CFDB 4KI5F 2MCPL 2XTJE 5JDSB 3LHPH 4HMDA 1U92B 1N6QL 5CHNB 5FO7B 3IXAA 2XOTA 4JFFE 2Z93B 5LBSH 1EBAA 3VG9C 1KYOK 4JFPB 4YWGL 4AEHL 3EFDH 5JO5A 3QFJE 1KOAA 1M7DA 3MYJA 4S1QL 3IJHA 4I0PA 1MCPH 5CJOL 1P53A 3KR3H 4O51B 1JHKL 4PG2C 5DMIL 1DUZA 1EXUB 4H1LH 4LVEA 2IBBA 1F2XK 4PJEA 5DD6B 3TBVB 1AGFA 4V1DB 4TVPD 3UJIH 4IM8A 2FATL 4PRNA 1SJVA 1FLRH 1OQOA 1D6VH 5EFIA 3HI5H 4YX2L 4LGSB 5IQ9B 1DEEA 3DSFL 3R1GL 1T1WA 2OQJA 1UYWH 3NCCB 2AJZB 5CJ5A 4RMSA 5IOPB 1QLRB 4GW5A 4GBXB 5BZDB 1GVIA 3QUXB 1IEBA 3PJSB 3KPSA 2HT3C 5MEPA 4I13B 4LSPL 15C8L 2JELH 4OCYH 4R26H 3VXOA 3OAYK 5T1KD 5GGTA 2C1OA 2AI0L 1RIVH 3WFHB 1S3KL 2ATKA 4PRAA 4UV7L 3WO3B 1K4CA 4ZYKA 3FB6A 4MCYA 3RY6C 3C8HA 3M8OH 5C0GA 1OARL 5EU5B 2NW3B 5C0CD 3P4MB 4RGNE 3MV8B 4PJCB 3TH3T 3ES6A 4EKXA 1R5WB 3LKQB 3P0YL 3BDXA 4X6EB 4OZIF 4HG4J 3G04B 4JKLA 1RURH 2IPTL 1MCWW 5JLZA 1TMCB 2EDYA 4L8BB 3MRGA 4EI6B 5JNYA 1T89A 1CTOA 3VXUD 3TN0D 1DUYB 5SWZA 1MFNA 5C0IA 1WBZB 1JTOA 3VXMD 3ET9F 2D7QA 4MJIE 1P7QB 1EEYA 2PNDA 3I50L 4NBXB 1ACYL 3HZVA 3LRSA 2V6HA 4EQ2A 4DOHE 1HHKB 2V9RA 1JZ6A 5D8JH 4BUGA 1AD0A 4OQ1A 1P84J 4HWEL 3UTZB 5ICXB 1IGIL 2J7LA 3M17A 4WU7B 3SGKC 1IT9H 1EIBA 3ZLQC 3OJDB 4Y5XB 1ND0A 4JPKH 4GLRI 5C07B 4N5UA 3AGVA 1XCTB 5EORL 4EUPA 2AEIT 4HIHA 4JZOA 4XBPB 3IFLH 3JV0A 1I85A 3DETD 3REWA 2CK2A 4DZBB 4OLYL 4Y5YC 1A7BA 3QZWG 2Z8VC 1JE6A 2UZIL 1OHQA 1P2CA 3KVQA 1CICA 5MHSD 4RAUB 5F7KC 5EOCH 3LZFL 5IJVA 3MXWL 2X9WA 3GSRA 1NFDE 1K8DB 1QFWL 3VFPA 5INDA 4MXQC 2VLLA 2CKBL 4D3CL 4L3EA 4R0LA 5E1HB 4JRXE 3RVWC 2ORBH 2IANA 4Z7UE 4L4JA 1CDHA 3IJSA 2NLJA 1LEIA 2CRYA 5I8OL 1FIGH 4QTHA 1A6UH 3BJ91 3DI3B 3QFDA 5KVDL 4ODBD 3MA9H 5DJZB 1X4ZA 1R3HB 3IKKA 4JJ5A 1W0VA 5KN5B 1BIHA 5DSCA 5IFJB 1U58A 2EDXA 5IWLC 5I71C 2HVKA 1OB1B 2NNAA 1U42A 1HNGA 3MJ8A 4JPIA 5F71A 2FIKA 3N9GL 3S3SA 1AO7A 3DRTA 1LP9F 1T7YA 5HYQB 5ERWB 4MAYA 1YMMD 4QF1B 1G6RB 2Q20A 3MNWB 4WWKD 4GG8B 4MQTB 3MLSH 3IDYB 5CMAB 5ACLA 2DDQL 3WL9A 3O4LE 3BP6A 5EG6C 5BOPA 3CH8A 4ODXB 4X7SH 3UTTE 3T2NL 2WUBH 2YZ8A 3ALPA 5J11C 5IW3A 4NFBA 1XZ0B 1CDJA 1MFDL 4HWBA 2DQFA 5C0BB 4DWHA 1NAKL 3EDEA 4NZUL 3STZA 1YEGL 4HJGA 5HGHB 5D72L 3KXFD 5JHDB 4FQ2H 2JK5A 3FONA 3IU3B 3OSKA 1TLKA 4RMTA 3RU8H 4JZNB 3PGFL 3FQRB 4AENB 5DK2A 4D0BA 1K2DB 4QYOB 3WXVL 4M62L 1T0NB 5GS1A 3MJ9H 4PGBA 4LPCA 4WEUD 4I0PC 5CGMA 3I6GB 2ZUSA 3EJJX 1LDSA 5ADPL 3MUGB 5A40E 1NCCH 3MXVH 5FYLE 1U3ZA 4ZD3H 1VEMA 2Z31C 4U1JB 1ZT4A 2C4FU 1UM5H 3TA3A 1ZLSL 4ODUB 3WHXA 6FABL 4HHAA 3CFBB 3HPLA 2AV7A 3D25B 2J1KA 1FNHA 3PABA 5DDHA 4GS7B 3IDXH 2HJKA 1CE1H 5FA4B 3WIIH 5DHYB 5IW6A 3RWDA 1YUHB 4IMLA 2YD7A 4PJ9B 4X7FC 2NXZD 2EYRA 5C0AE 3G6DL 4NZJA 5GS0L 5ANME 3W9DA 2XACC 3CXHK 4RGMB 2AV1A 1ERNA 2ID5A 2X10A 4OCWH 4OFVA 1L6ZA 3HE7B 3MBXH 4LBEB 1UM6H 2DLEA 3BKCH 3MV7B 1SMAA 4AG4H 4ZUTA 3S35H 5GISL 1YEJH 2V7NB 5B38B 1MAML 1KUMA 2ZCLL 1CDUA 3AROA 2A6JB 3KPRB 3PWUB 4LIQE 4LPTA 4WTXA 4K23H 3QIWA 2ZKHH 4NHCH 4PP1C 4HIXH 4H8WC 1P69B 3GHBL 1BBDH 4D9RE 4YPJA 3SJVE 3TVMD 3RVVD 5D7IE 3LB6D 3ARFD 1A7QH 1T89C 3QEUB 4HWUA 2ICWB 3CDYA 2Z0BA 3GSVA 3H3KA 1FNEA 5HPOA 2WBJA 1XIWB 4ZFZB 2VUOA 2IC2A 4XAKD 1NH6A 5EBLA 4NQCD 2XA3A 4S1DD 2CSPA 4L5FH 4CN4A 1EEQA 3LKSB 1NFKA 2Y1VA 4PJFE 3QBTB 3TIEB 5DMGC 1FYTB 1AXTH 4OCXL 1KLUB 3X12A 5IBTH 2P5ED 3BH9A 1HI6B 2P47B 3V6FA 3BIBX 3SDYL 1RQ5A 3NTCH 4KUCD 3HUJB 4MA8H 2NTFA 1X5LA 5C09D 4OZFA 4HLZG 1VCAA 2WWKO 4G6AD 4LLUB 4HK0B 2D03L 2OR9L 5ITBL 2EIZB 1V7NL 1G7HB 1I85C 4I2XB 4KQ4H 1LGVA 4HBCH 4LEXL 3THMH 1HSBA 4Q0XL 4NQEB 1B4JL 4NHUA 4ONFL 1CICC 4I8DA 2Z9TA 1E4XL 1G6VK 1TJIL 3JTSB 2DMCA 1J05A 5GRJH 4NCDA 4P59H 5KTEL 2JIXA 5J0BA 5FCSH 1FC2D 2XTJB 1A6PA 3U4BL 3O6LL 5F7EL 3GKWL 3FN0H 2JJWA 4ZUSA 4FNLL 5FUZL 4NZTL 1FNSH 4JFFB 4JO4L 4N0CD 2YK1H 4U1MB 4ZNCD 2ADIA 1I9IH 1WBYB 4JDVB 4R0LC 3QFJB 1FVDA 3O41A 2GK2A 4HUUB 1BPVA 2JB6A 3LSOB 4OSUH 2OJZH 2H2SC 3EO0B 3FB7A 3FAWA 4HIIA 2OI9C 5ISZE 3ARBA 4EZMA 1M1SA 3ILQC 3RA7L 5HI4D 5EUKA 4UOW1 3ARGA 4WO4D 2P8MA 4GKOA 4XNZC 1OM3L 4I4WB 3FB8B 2BVPB 2J4WH 2HH0H 2QADD 3KYOA 3VGGA 5HYEA 5C92A 4DZ8B 4YR6B 4Q9QL 2DLFL 5IVZA 5IMMA 4RRPG 4X6FA 3TO4B 4MD0A 3EOBA 3VH8G 1A1MA 5CEYB 3U7YL 4G8GD 1LDPH 2J5LB 3BW9B 1I9RH 4GAGL 3ARED 5LXGH 4L8CB 1KT2B 5K9OA 4EBQL 4MAYC 2UWEF 3W11C 1JWSB 1WCBA 3VDAA 1RUAH 1Z5LB 3SDXA 4CU6A 2V9TA 1RZ7L 3LN9A 4JHWH 1LEKA 4RFEA 4OLXH 1Z6JT 4Q9RH 2ZJSL 3O8XC 3DV6A 3MPCA 2Q6WA 4CGTA 4HUNB 4P9HC 5HI5D 5TPWL 4KXZI 4Y4HC 3IF1A 4KI5C 4RDQF 3D5OF 3WFBH 3HR5B 3GBML 1IAIL 4LIQH 2KPNA 1OGAB 1EGJL 5A2IH 1X5JA 5L7XL 1D5IH 4JDTL 1H3VA 4KVNL 4MA1C 5HDQH 5GS1C 1Q8MA 4OI8A 1NMAL 2FO4B 4MJIB 3GMMA 3W0WA 4D8PB 3EYFA 4M5ZH 4OJFH 4WFHD 5DJ8B 4U7MA 3W2DH 1J1OL 3MRMB 2HLFC 4C54A 5C0FB 3LV3B 5IM7B 3OX8B 3TA3C 4TOYL 3C60B 3U0PA 1WFTA 4JO1H 1IBGL 5J1AB 5DURD 2AXJA 4ZUVA 3IGAA 1N64H 4NKMB 2FSEA 2CJUH 3EJYC 4WFED 1JZ8A 1DSFH 4WW1B 4LK4A 4H0HB 1CK0L 3UC0L 5A2LH 2MWCA 1TJHL 5IQ7L 2R56L 1FN4A 8FABB 4OD1L 1YN7A 3T4AA 5JPMB 3T0EE 1NC4D 4C56D 1BQHG 3SE9L 2BNRD 1VEOA 3DLQR 4LASL 1CD9B 2HJLB 5HYJA 2C3VB 1HH9B 5GJTL 4J2XA 2YSSA 3LPGA 1YY9C 4YZFF 1VDGA 3B9EA 5J06A 3GBNH 3QIWC 1W8NA 2O61A 3DWTA 4FABH 3CZFA 3IU4L 3DX6A 1T5WA 4XVTL 4XP5L 3UDWA 4HFUL 3DX9A 1XGUB 4JRXB 4PRPA 5F6HI 5HHNA 4Z7UB 5MENB 3U30B 2LU7A 4Q6IB 1MCLA 5E08H 5JXEA 5H35B 1KYOJ 3E3QC 1SJHA 4G80B 2N7BA 4XNMB 1ORSA 2EDRA 4NBYB 1F3DJ 2Q7YA 1BZQK 4JB9H 3K2UL 1T03H 3GMRA 4NO5B 3Q3GA 2WANA 3DRQB 4HD9A 5FUCE 1QLFA 3ZDYE 5E8OA 4IIQC 1PEZA 2WINA 3MLYH 1MCSA 2OZ4A 1KPRA 4X98B 2H6PA 4POZC 4HWZA 3BQUC 5BQ7A 1UJ3A 2L0DA 1HHHB 5E8NA 3B2VH 4S2SA 2EECA 3HZKA 4O2CB 1XF4A 2BNUA 2EH8H 3MUHL 1GJIA 3C08H 4LAQL 4YHLL 2Z92B 3MRFB 4XC1L 2Y7QA 1OD9A 3GM0A 4LCIL 1GCFA 3ECBB 5BS0A 2Y5TA 1XCQA 5K59F 2NW2B 3SQOH 5CCKH 3MBED 1QFPA 4HULB 2QQLL 1GAFL 2VUYA 4M6NL 4PFEA 1FFPB 4Z9KB 4E5XA 4J3OC 4CVZA 1QYGH 3ZT7A 1UQSB 3QCTH 3VFNB 4AY0A 3B5HA 3O11A 5D7LA 4JCMA 4YXLH 4X7TB 2UZXB 4JGMA 1D7FA 4YHKL 3C2AH 1OF2B 3DECA 1PY4A 1BD2A 3LKOB 4K2UL 1AD9B 3QI9B 5E0QA 4M7JL 5FO8B 1RULH 4WFFE 4PV9B 4G3YH 2FH6A 1CIUA 1E4WL 3HRPA 3L7EA 2OTUA 4GKZB 4L9LB 3VXME 3K1DA 5JTWA 2D9QB 4YGAB 3VRLF 3D3VE 3P9MB 2DWEA 2NXYB 2Q8BL 4QRPE 2ZNWA 3ARDA 1XGTA 5DD0H 2VAAA 3IVKA 1UADC 2X4SB 4D0DB 5HHVH 1QFOA 3FN9A 3FHAA 2X70A 3KPOA 3GIZL 4XWGL 3ULUE 5D6DA 4I48A 5ABDE 3BPOB 2J6EH 5I76B 1FZMA 4Z7WA 2CUMA 2PXYA 3O2DA 3FO2B 1YNLL 3O3EB 4PB9L 2LU3A 2AEQH 2XZCL 3QQNA 5ANMB 1FFNB 1KN4H 1KN2H 4M00A 5CGYD 3L3DB 1FP5A 4WENB 4F9PC 1TZIB 3TJHC 1EDQA 5IESH 2VOTA 2IAMB 1ZSDB 3IDNA 5IVNA 1UB5A 2P8PA 4RWYL 1VGKA 2XKNA 5D2LF 4YDVB 1RUPL 3E1F1 4U6YA 1MCOL 2IQAB 2DAVA 3AU1B 5D7KD 2Z35B 4G9FD 2AJ3B 1FJ1B 1UB6B 2J8UA 4XP6L 4MXQD 4M7ZC 4BFIA 2A6IB 3CVIH 4QOKE 1WC7B 3RVWD 2O5XH 3CDCA 3RY4A 4ZSOE 4R2GB 3TBTA 5ICYA 1CGSH 4RX4D 4LFHD 3RL1B 3BHBA 4FP8H 3T4YB 2H9GA 4K9EC 1GC1L 3CD4A 5E00B 5T1LD 3HMWL 5TF1H 5HHQB 4X9HA 2VDNH 4KKBD 3TBYB 1VFOA 3BE1H 4M5YH 4YDJB 3CMOH 3P4NB 5EOQH 5BV7B 4KRPB 2MKWA 3A6CH 4R96B 5I17B 1VB9A 4XCEB 4ZFFA 5C70A 1KIUA 4WFGD 3HLAA 3RJQB 4JN1H 1ZWIB 3FOMA 4FXKA 4P2CG 3EIFA 1KCRL 3LKRA 4K3JL 2BDNH 2R8SL 1HXYA 4K3DL 1IGML 1KF9B 3ZDZF 5EZJB 4OD3L 5HPMB 3DURB 1OY3B 4U1SB 4NDMB 4CRPA 2VQUA 1P7KB 4HBQA 3HG1B 3QQ9C 5IVXB 4NNXA 3RL2B 2Y36L 4PJ5E 3FO9B 1A8JH 1DFBL 5DO2D 4CMMB 2B2XL 5IFHL 2VDPL 1N8ZA 1TCRB 4PJDE 3MJ7A 2HKFH 4H20L 2BXZA 5KG9B 2BX5A 5FYJD 4FTVD 2ESVD 3GSXA 3UDWC 2GIYA 3PUCA 2DQDH 3O2WL 1NANI 4D9QE 3ZE1F 1A6AB 5HY9A 2DN7A 5JUEL 5F88A 2DB8A 4L8SA 4Z0XA 4NIKB 4LLYB 4I0PD 1SBSH 2M1KA 3BGFB 5AEAA 1M4KA 5IV2A 1R5IB 4YO0A 5F3BA 2YZ1A 5DZOA 3VWJB 1IE5A 1WITA 4F7MB 3CFCH 2BHUA 1X5HA 3WUZA 3BWAB 4EIZC 4YE4L 1JRHL 2H32B 3RHWF 5DMJB 1A3LH 2D2OA 3P11H 1ONQA 3Q2CA 3NH7H 5LCVH 3AB0C 1HKFA 4Z5RB 1UM4H 1MWAA 1FPTH 3LQAL 4Z7VB 3EJZD 1JV5A 3JWDL 1U8HA 1CFSB 3VJ6B 3ULUH 1UACL 1SYVB 3KPSD 5TF0A 4OZGA 5E7BA 4HJ0D 1RHHB 1A7PH 3CXHJ 3NN8A 1ORQB 1XR8B 3BPNC 4QHMB 4NN5B 5DXWA 4P2QE 5DEZA 1JWMA 4JM2B 1PLGH 1FVCB 4PGEB 1RV6X 5K9QG 3QEGH 4KTYA 5ALCH 4ODVH 1EHXA 2DLIA 1JPTL 5EU7E 4H1LG 4LSSH 1MFCL 4N8VG 5GSVA 3SBWA 3B9KC 4PP1D 4NKOA 4R7DA 4U1KB 5EOCJ 1M05A 4AIZB 1INDL 2F54E 5FKPB 1NCNA 4XRCA 3U0TA 1MVUA 1GHFH 1MLCB 4ZPTA 1Q9OA 3PL6A 4XAKE 3SDDC 5IB3A 5HJ3A 4HCRA 5D6CA 1T3FB 2DQUL 3KNBB 2Y4SA 5ECJE 5MI0B 5DRWA 3VXPB 2X05A 3BN3B 3RWCB 4AEIH 5SWZD 2R1YB 4LSQL 1H8NA 1QEWB 3MFFB 3S9DB 2EDJA 4GO6B 3HRZB 4OLWH 3WHE1 4B41A 2CH8A 1QG3A 4H0IA 2G9HB 1HSAB 4NO3B 43CAA 3TM6A 2M8XA 5D6DC 5DMGD 1IQWL 2IH1A 4JVUA 4XPFH 1QD0A 2MHAA 4FFZL 3MNVB 2C1PB 1MIMH 1C7SA 5C09E 2AXHA 5ESVB 4G8FA 1JGDB 3WO4C 4HH8A 5D96C 3RZCD 2CDEA 2NY1B 2CK0H 1CL7I 4G42A 1A1OA 5JW3L 1BVKA 4M3JA 1T0PB 4U7SA 4R4BB 1XR9B 2EYSB 3RUGA 3BT2H 4WY7H 3T3PE 4KTEH 5FB8B 1CXFA 2LTQC 4BQ6A 1TZHA 4NM4H 4JPWH 2EDHA 4P9MH 2P45B 2QSCH 1MUJA 1NUFA 4OGZA 4PJCF 5E6IA 5I2IA 3GSQB 2R0KL 1J8HE 1IRAY 1OLZA 3UPCA 4GOSA 4LHUA 2WUCH 3WS3B 3FFCA 5D7JA 3H8NA 5I30L 5IT2H 2IMMA 1I8IA 5EC1A 1K8IA 3DXAD 3KPLA 1NGXA 4ZDHB 5CSGA 1F4XH 1KCUL 1Q9WA 4BYHA 4CMHC 5E8PA 3EFFB 2LV4A 3QIUC 3BD5A 1X5GA 2YUWA 1KENL 2OL3B 4FQQB 4ZO9A 1J0HA 2GY7B 3VGHA 4E42B 1EO5A 1U8OA 4JLRA 2BOCB 4QXUL 1I1AA 3BO8A 1QVOA 3PHQA 4X4YA 1FRGL 2C7UB 4GQPH 5FKAA 3Q0HA 3AS2A 1S5HB 4YHPB 1PBYA 5DJ6A 1AO7D 4ZAKB 5HGAB 2NY5H 4Z7QE 4UDUB 1FSKC 1J1PH 3VCLA 1HIMH 5C0DB 1VKXA 1YMHA 3W11D 5L2KE 4HUWA 3OKLB 3VA6A 2NY3D 2HAZA 4OFIA 3RI5F 3DX7A 5CFHA 3UZQA 3T65B 3LS5H 3QISA 4ZS7H 4KK9D 3H42H 5FFLA 3TC9A 4LLDA 1FQ9C 4CVWA 3QXAB 4Q2ZA 1L7TL 3F7RA 4Z95L 4LU5H 3TN0B 3UTSD 3VXUB 2VZVA 2UZYB 2XT1B 3MCLL 4LRIC 3MMEA 5KAQF 4JDZA 4ISVB 5DHVH 4ZFGH 3VXMB 4JG1H 5MEOB 4H0GA 1F6FB 1T2QH 2GJ6A 1E6JH 3D3VB 4L8SC 4GMSH 3HC4H 3I2CH 4XGZB 3E2HC 1HHJA 1I3UA 3KHOA 3H0TB 4F7CA 3F5WA 2YEZA 3HC0B 1TPXC 4J12A 3QUYB 3NABH 5INCA 2CKNA 5D71H 4LLMB 1U93A 4G6KH 1MCWM 2N1KA 4DEPB 5CJBA 4KU1A 5I1IL 2K9UA 5IBLC 4QGYA 3MLRH 3RKDC 1U36A 2WW8A 1CDGA 1QR4A 3EJYD 2ED8A 1NDMA 2VRAA 4R6UA 3Q5YA 5DR5H 3JVGA 3LN5B 3WLBB 4JO3H 1MJ8H 2B20A 1EA9C 3QIBB 4WHTA 5GS2H 2I60H 1CFQA 4XHJC 4ETYA 1U3YA 1QFUL 1RPQA 5DD1L 5HYIA 1J1XH 1EAPB 2AP2A 2YD9A 4MVBD 4NN6B 3EGSA 2QQKL 4YDIH 1AXIB 3A6BH 4FQXA 1RHFA 1F4WL 3DVGB 1DN0B 4TTDD 4B50A 3FQWB 5I1JL 2W0FB 4MXWH 5AZ2H 3SBWC 1IEAB 2R2BB 5C0NC 4KJWC 3LH2H 3U6RA 4JRWA 1YDPB 1EHAA 2VLJE 1CLOL 4WTZA 4X8XA 3PL6C 4A6YB 2VABA 3K4ZA 4K3GA 5EBGA 1IAOA 1X3DA 4UT7H 2WBJD 2IFGA 4JFEE 1U8IB 3AAZB 3QDJA 5T33L 2COQA 3MLVL 4R4FH 2OSLA 3OGCB 4DJMA 1TVBB 4R4NC 3D87B 2ITCA 4KDWA 4K8RC 4P2RE 1N4XL 4XTRD 4NCC1 5FGBA 2Q1EA 2AQ2A 3WN5A 3RAJL 3OG6B 3CDFA 3GHEH 4FOMA 1YMMB 4HJJH 3C9NB 1NKRA 4POZD 1W0WA 4WWKB 4JE4B 4J3VA 4LVNB 4LSRL 4P5MB 1SJEA 4IBLT 1JTPA 4HF5H 3CPLB 3IDJB 4U1HA 5DQJB 4MA3B 2XZZA 3FCTA 4G6ML 3QDHA 1GGUA 2IPKB 1AJ7L 2VSDA 1U8NB 3ULSB 5TDPA 3TT1L 2D4FA 3U83A 4L8DB 2JTDA 3KXFB 5FYKE 1ZXQA 4UTAL 1NAMA 4BQ8A 2XZQH 2WBWB 1KLGB 3CGTA 4WI5A 2MCPH 2YPLE 3QA3A 5B3JE 1QP1A 3L7FB 4QY8A 1N6QH 2O26U 4YWGH 2FECI 4AEHH 5E6IC 3EZ8A 3BUYA 1CDCA 4U1GB 4S1QH 1I8MB 4U1NB 5EU3B 5CJOH 2H26B 4F57L 1JHKH 1MH5B 4YHML 4QHNA 1EVUA 5DYOA 2A73B 2F15A 4OZHB 1NFIA 5SWSE 5D7JC 1KJMB 3LCYA 1OPGH 2FATH 3BEWA 3ARBD 1OP3H 1G7QA 4YX2H 1AR2A 1RZKC 3DSFH 4PRBA 3ARGD 5ETUA 5E2WL 2EZ0C 3GI8L 1FAKT 3WMSA 3MJGX 3D0LA 4XXCA 3CSPA 3EO1A 5C08A 5L6YH 2YR3A 1T7VA 4K3HA 1I1AC 1NCBL 4GRLB 3VXNA 3K0WA 5GGVH 4LSPH 15C8H 4MNQA 5CINL 4LMQE 1LD9B 3DUSB 1KCKA 4PJAB 4GKNB 1JHTB 3O81A 3DYPA 1JUFB 3HUJF 3MV9A 2AI0H 4JFXB 5DS8A 1S3KH 4UV7H 4WDIA 5BRZE 1CLCA 2D4DA 1BJ8A 1FVEA 3LS4L 3CVHA 3GSUA 4MD4A 4EEEA 5J1TC 2HTKC 1A2YA 1Q9LB 2QL1A 4OAWA 2HMIC 1L6XA 3QCVL 3P0YH 2BOBB 2ZUXA 3SCMB 3UTQA 4KHXL 3TVMB 2ZSVA 4PRIE 2IPTH 1T7XA 3L6FA 1OVZA 3UZVB 2VR4A 1A6ZB 1CZ8L 5ID1A 1ZS8B 2CLRA 1Z0NA 4X6DB 4WEBL 3VMOA 3ZTNL 3JXAA 4NRYA 1MHCB 2XICA 4PJHE 4NQCB 1YJDC 1A64A 5KBNC 4LVHB 3I50H 3ARPA 4NPYA 4P57B 1N0XH 1IC4L 3KS0H 1REIA 1AR1C 4C83A 1Y6MR 1LNUA 5BZWA 5L8KB 2GKIA 2RAMA 1FZKB 2BCKB 4M4RA 2P5EB 3SDCA 1HYSC 2IMNA 1P4LA 4HWEH 2YA1A 1IGIH 2ILLA 4LKCA 3QPQD 1OP5H 5T1MA 3C5ZB 3BAEH 5JHLL 5F21B 4HKZB 5C09B 5AWNL 1F02I 5EORH 4JRYA 3VXRA 2JE8A 1X5YA 1QSEA 4LQFH 1GL4B 1FL6A 4N0UA 1U3HC 2YBRA 1FNLA 2UZIH 1PKOA 1YPZA 3UBXB 3EYVB 1HILB 3GB7B 4X7CC 4UDTB 2VLKE 4APQC 5GQBA 2IADB 2X4OB 3GSNB 3SY0A 5HYSA 4JM4L 3LZFH 1KB5B 5HYJD 5F7UA 1OSPL 4PRDA 2HJFA 1DQQA 5C0EB 2E3VA 3PWPA 1QFWH 4RNRB 5D5MA 2CKBH 4D3CH 2YD8A 5FYKH 2EKJA 2X7LA 4KV5E 1J8HB 3PWNB 2KH2B 3FT2A 5I8KL 1CQKA 4KK5C 3BH8B 5F3HB 5I8OH 4PRPD 5DJDB 2GHWB 4WO4B 1XF2A 1OT1A 4HV8B 1T7WA 1PYWA 2B4CC 4X8JA 5DWUL 4LF3B 5JXED 3SN6N 1OP3K 1KGCE 2X5PA 4WGWB 2DM7A 3L9RA 4QRTA 3S96A 4G8GB 1S7RA 4GXVL 3STLB 1HHGB 4JFYA 1UXSA 3LEXA 4WJ5A 1VGEH 3N9GH 4YDLC 3AREB 1S9WB 3WN5C 4AT6A 3RNQB 1S7TB 1MREL 3HI1A 1R5VB 4LHJB 5MEQB 2BC4A 3QQ4A 4Z78B 3QUXC 2XWBB 5JMOC 4OD2A 4LCUB 4YBQD 1MRCL 3AS1A 4XHQA 1T21B 2JCCA 1CD8A 3RVUC 3T2NH 1W72B 2UYLA 2VDQL 1ZLUH 3M1BB 3D9AL 3S37X 5IB4B 1I3RA 3FQXB 4NQVA 3GUTA 1MFDH 2GEEA 3QO1B 2RCSL 1NEUA 3EYQC 4NZUH 4XXDA 1YEGH 1U95B 4HAFA 4XNUL 5D72H 3Q5OA 5F9JA 1DE4A 1KIQA 4YC2C 4GQ9L 3H9SE 4M1DH 1RVFL 2YA2A 5D7LD 1OAXL 4HPYH 3VD3A 3O6KL 3PDDA 1NBQA 1V3JA 1BJ1H 4X4MA 1OAQL 1BD2D 3WXVH 4M62H 5CUSL 1WISA 1FNFA 1RZIA 1FFRA 4QRSB 4PJ8D 2DQHL 2Q8AH 4Z7UF 5DRXA 5I1DA 3CLEL 1UH3A 3NCMA 3F12B 1JPGB 4QHLA 5FCUL 3LN4A 1C5BL 5DFTA 1FO0A 3LOWA 1F11A 1ZLSH 1H15B 4XP4L 3SO3B 3ARDD 4F8QA 2ZOKA 2IEPA 5DURB 3SKOB 4OQTA 3ZE0E 4KWUA 1LILA 1H3TA 4DK3A 3HMXL 3W82A 4OCMC 4UIMB 1R3JB 3I6KA 1OP5K 3G6DH 3S4SB 1UXWA 5GS0H 3DX8B 2PXYD 1ZVSA 1DL7L 1JF1B 4MXVE 4MQ7A 4P46A 5GIRB 1NC4B 4J7RA 4JHAH 5GISH 2RQ8A 4Y5XC 1P1ZA 4O02L 3G08A 1K4DA 4M4PA 4N1CA 1WFUA 1GIGL 3L1OL 2ZCLH 4P4KD 1AC0A 5JXAH 1AI1L 3NFNA 5E94B 5GS2D 3BIKB 5IB1B 5GGRY 3B83A 3QXDA 1EV2E 3ZDXE 4M6AA 3GHBH 4H26B 3BDYL 3B5GA 5ILTL 1RAMA 3VFVA 1K5NA 4RFNC 4L3EE 5DEGA 1FL5B 1CDBA 1ED3B 1G7LA 1WBXA 5F6IC 2VLJB 4L29B 4NKIL 3JWNC 4Q9BA 2IANE 4PBXA 1MY7A 2XQBL 5TDOA 2BVYA 3CXDL 1MFBL 1A7NL 2GJJA 3U9UB 3T1FA 4N90E 5ID0B 5F96L 5LVEA 2XQYG 2KZ1B 2YHGA 4LNRA 2A74B 2GJZB 3ULVL 3IAGC 1S7XB 1BWWA 4LP5A 4M48L 4UUJB 3PDOA 5EIVA 3H9HA 2Q86B 3VXSE 5L2JB 1AQDB 2RHEA 1S9XA 2BHZA 4UT9L 4U05A 2E9WA 2HT2C 3GMPA 3H9ZA 4OTXH 3FQNA 4YIQB 3SDYH 5KW9L 2LAGB 2VZ1A 4NNYA 1AO7E 3MRBB 4JHZA 4LNVA 4X6CA 4E41A 1R3KB 1WIPA 5F1IB 3MRPA 4HSQA 3V0VB 2D9CA 3HZYA 3H3BC 2D03H 2OR9H 3MZGB 5ITBH 2DIAA 4GAYA 4J6RL 1ZLUK 4UNUA 3VMPA 1OTTC 4LEXH 3RBGA 1KJ2L 2DYPA 4Q0XH 1B4JH 5GGRA 1NBZA 4LP4A 1UWEL 4ONFH 4Y4FA 4UZGA 1E4XH 5KTEH 4IMKA 1F2QA 1RUKH 3LD8C 1HHIB 3PWLB 3U4BH 3O6LH 5F7EH 4FNLH 1MEXL 2XKSA 3NCYS 4KI5E 4NZTH 4JO4H 4U1LB 3KPPA 3OPZL 1CGTA 3TPUB 5H37G 3WUWG 2NY2D 1IC5L 3D69A 1IAKA 1NUDA 4HS8L 4QO1A 5FM5O 1QA9A 3D6GA 5DTFA 1ZA3A 3RA7H 1T4KB 3BSZL 43C9B 5JPNA 5SX5H 3U79A 3K80A 1VFBA 5DMKB 4KVCL 2BSRB 1I7TA 4MCZB 2X6MA 5FOBA 4Q9QH 2DLFH 4NNPL 3BOVA 3SEPA 1ZT7A 4DCQA 3I02B 3U7YH 4Q97A 1KJVA 4BA8A 3PV6A 1PZ5B 1KELL 2GFBB 3ME0A 2VXTL 2E7HA 4EBQH 4Z77A 1RK0A 3W9EB 1CXKA 3ZSTA 1FFOA 3B6SA 3BRGC 1JTTA 4TUJA 1RZ7H 4DGIH 5IVXF 1WAAF 2HLAA 3KJ4C 2ZJSH 1TVDA 2HA1A 3G5ZB 4XCYB 1LO3L 3MRKB 4OT1L 4G9FB 3DSNA 5TPWH 1G6RL 5HGDB 1X5ZA 3SDAD 3GBMH 4LGPB 4OZIE 3OKKA 1HQRB 4MWFB 1EGJH 1GZQA 5L7XH 4JDTH 5C0ND 3LQMA 4KVNH 3RQ3A 1LEGA 4KDVA 4DW2L 3QEQD 1CXIA 1NMAH 3EHBD 3QDMA 3PQYE 4L4VE 5ACZA 1MCPL 2OR7A 1QR1A 2C4FT 3IDGA 1KEGL 4ENEC 1KNOA 1NMCC 4G9DA 4TOYH 3P4OA 4HKBB 4P4RA 1G9NC 4M7LL 2F74B 3GJFB 1IBGH 4M9OA 3ROOA 4KHTL 4R4ND 1KPVA 3FFDB 1D6VL 2DKSA 4K8RD 3HE6A 2BZDA 1MQKL 3DROA 1UYWL 2ZNXA 1H3GA 4DVRL 1CK0H 3HHRB 4Z7VF 1D5ZB 3UC0H 5B8CA 3KAAA 3V5HA 4BSVB 4ELKB 4TPRL 5IQ7H 2R56H 5GRXG 5DJXA 4I3RH 2VXQL 1T80A 4AIXA 3SE9H 3GRWA 2JELL 4IJ3C 5A16A 3PNWB 4LASH 5J11B 3GMLA 5GJTH 3GZKA 4X99B 1FL3B 1UCBH 2NPLX 4JM2F 1NC2A 1RIVL 1DBKL 1MCDA 1P9MC 3A0OA 5K9QI 4FTVB 5H2BB 3BP7B 2HWZL 4XP5H 4K94L 4HFUH 5E95B 3IXAB 3O3BA 4JKKA 3I6LE 4CVXA 5JO5B 5DC0A 2OMNA 3DVFA 3QZWA 4PLJC 3K2MC 1M7DB 3MYJB 1X5XA 5LAXA 3IJHB 4I0PB 3RZWA 1R0AL 2EDLA 1ZA6A 2CDGA 1DUZB 4LHUD 4PJEB 1AGFB 2APWA 5SX5K 3UEZA 3FFCD 3TT3H 1CGYA 3EOTL 4PRNB 3V7AG 5EFIB 5HSFA 2Q3ZA 3NPZB 1DEEB 3OTTA 1QSFA 1T1WB 2OQJB 3MO1A 3MGTA 4FXLA 5JW4Q 3HTLX 3V6ZA 4GW5B 4MJ6A 5KSBA 4WW2A 1QFWM 1UGNA 1JK8A 1IEBB 1I1AD 3KPSB 1LP9E 4LAQH 4PJ7A 4L3CA 4YHLH 5MEPB 5TH2A 1ODAA 4KJPC 4LCIH 1FZJA 2H2PC 3MOAL 3VXOB 3L3GA 4QRRD 5F7YC 2C1OB 5I66A 3OV6A 2QQLH 1S7WA 1GAFH 4M6NH 2ATKB 4M8VA 4PRAB 3SDXE 1K4CB 5C6WH 4ZYKB 3X14A 2PR4L 3FB6B 4MCYB 3IFLL 3RWEA 5CEXA 3AY4A 3L5WA 4S1SL 3FT4A 4YHKH 5HHOA 4IMKC 5C6TL 4K2UH 3QUZA 3ES6B 1DQTA 1BGXL 2E7LA 2YMXH 3WKNA 4EN3D 5EOCL 1A9EA 4M7JH 3QWQB 5JLZB 5JNYB 3MRGB 4D0CA 1A7RH 3X3GL 1E4WH 4DUXA 2EKSA 5SWZB 3EYOA 5C0IB 4GUPA 2Q8BH 3OR6A 3E0GA 3W0WE 4HK3N 1EEYB 4F80A 1FG9C 12E8L 4KH2A 5DUMH 4I9WD 3GIZH 4JPVL 4LCWE 4XWGH 3INUH 3HZVB 3LRSB 2QV2A 3W81A 3MA9L 3L3KA 4BQCA 2FEDD 1OOAA 1YNLH 1G7MA 4K55A 3C60C 3NCYP 1AD0B 4PB9H 1HYSD 2XZCH 2HYMA 4GT7A 3M17B 4NO0A 5GS0D 5AZEL 5CBEA 1ND0B 3L5XL 4HQQL 4LLWA 2Y5EA 4RWYH 4W70A 5CWSA 4HT1L 4EUPB 1I7RA 4HIHB 4JZOB 3NIDE 3ARYA 3REWB 3PDGA 1DDHA 3NIFF 5FV2A 3VA2C 2WMPA 3DGGA 1RUPH 2MQ3A 1P2CB 1CICB 1Q72L 4V2BA 1GGYA 5IJVB 5I6XC 3GSRB 3QUMA 4QHUA 4FQXD 3VFPB 1BBJA 4XP6H 2VLLB 5INDB 4L3EB 4R0LB 1EFXA 3PGCA 2IANB 3ISWA 3O2VL 3IJSB 2P5WD 3MNZA 2NLJB 4GG6A 1LEIB 1XT5A 3CK0L 4XB8A 9CGTA 4MNHA 4S1RL 3CC5A 1FZOA 1GC1H 1UWXH 3QFDB 1NGZA 2R29L 3HMWH 1JWUA 4JJ5B 1W0VB 5KANG 1J0IA 1NCCL 3QDJD 3R8QA 5F1SA 2Y9RT 5DSCB 1U58B 1V3KA 3HNVL 3MRDA 1AXSA 2HVKB 2NNAB 1BMGA 2CMRL 1PKQA 4HH9A 2DWDA 2FEEI 3ZHLA 3MJ8B 4JPIB 1KCRH 3VW3L 2FIKB 3HE6C 4K3JH 4PV8A 1AO7B 3DRTB 2R8SH 1CE1L 2Q76A 4K3DH 1F6AA 4MAYB 4OD3H 1GGIL 1L9NA 4O5LL 3WL9B 3BP6B 2NY3B 4J3UA 5BS0E 1IILE 3UBXG 4W6XB 1H5BA 2VR5A 2EO1A 4RA3A 2DQFB 1DFBH 1B4RA 1JGUL 5IFHH 3B43A 2PW1A 2VDPH 3STZB 4HJGB 4NC2B 5JA8B 4IHOA 1E28A 2EXWD 2JK5B 2Y6SC 3FONB 4L4TA 1J10A 1ZV5A 2W65A 5E9DD 1BD2E 1XF5A 4NSKA 4BELD 4KY1H 2ZKHL 4NHCL 3RTQA 5DK2B 4D0BB 4M6ML 4FFYH 4HIXL 1RUQL 2BY2A 2NY6C 1U8PA 3VWKA 1KEML 1BBDL 3NZHL 5JUEH 5GS1B 3MREA 4PGBB 4WV1A 3DJ9A 3ZKMD 4QT5A 4L9LC 4HEME 1VFUA 1ZT4B 4R90L 3TA3B 4NKQB 1FGVL 4YE4H 2F53E 5D1XA 1FYHB 1JRHH 3WHXB 3D1MC 4HHAB 4N8CL 2DLTA 2P1YA 1AQKL 4CN6A 3HPLB 5DRNA 3HAEH 2AV7B 5CP3A 2VLME 1Z2KA 2D0FA 3PABB 3MR9A 4TNWF 5DDHB 1MELA 3OB8A 2HJKB 3LQAH 4W4OA 4XWOD 2E5EA 4FFVD 5IW6B 3RWDB 4IMLB 1N5AA 4HFWB 3BPOC 5C08D 2DQGL 3NCFB 3JWDH 2EYRB 1AXTL 2W38A 3W9DB 2HT4D 3WLWD 1UACH 4NT6A 1MNUL 2AV1B 5IBTL 1PG7X 3UAJC 2Y23A 2UWEE 3GBLA 4HC1L 4ZUTB 4OCLC 1GPOL 1A7OH 4RRPA 3MV9D 3VH8A 3WNNA 1XGQA 1JPTH 3AY4C 4P5TA 1JMZA 2AK1L 3ARRA 4HBCL 1ZEAH 3QIWB 5JOFA 4HUXA 1I8LA 2QKIA 1INDH 1XGYL 4QTIH 4OLZL 1DQDH 2J8UE 4ONOA 1WICA 2WP3T 2VDMH 1QLEH 3S36L 1AC6A 3GSVB 5BVPL 2DQUH 4ODWB 5IHUH 1FNEB 1OW0A 1SJXA 3PQYB 2BNQA 4LSQH 5DMYA 5EBLB 4YHZL 4OZHF 3TZVD 1UWXK 3BZ4A 2A38A 1W8OA 1YY8A 2D31A 2EIDA 2VE6A 2AVGA 2J4WL 4WHCA 1IQWH 2BRRL 3S4SG 1QPXA 1WEJL 4FFZH 5ICZA 3X12B 3SDCD 2HT2D 3BH9B 1Q9KA 2KQMA 3N0PB 3V6FB 3BD4A 5FYLL 1S7SA 5D7SL 5T1KA 2NTFB 4OZFB 3IJYA 3ZKND 4PJAF 5JW3H 3CNKA 4JRYD 4UBDC 3VXRD 3PP3H 3S34L 1QSED 1CQYA 2PTTA 5DHXB 1RUAL 1HSBB 3BFOA 4W6YB 4MMZC 4NHUB 5C0CA 5BW7C 1A4KA 4YZFE 1J05B 3T04D 3DTXA 4JQXA 2JIXB 2ZCHL 4BSWA 4FZ8L 1G7IA 1FGNL 2R0KH 1CFTA 2ADIB 1BQHA 4Y5VA 1FVDB 3O41B 4CUCA 4ODHL 2GSIA 3WFBL 2JB6B 3FB7B 5I30H 4PGZA 3U2SA 3NZ8A 1BJ1J 4HIIB 4LARL 4X6DF 3ARBB 1RZJL 1D5IL 5ESAA 2IQ9H 5EUKB 1ZTXH 1KCUH 3CH1A 4Z7NF 2P8MB 4NQDE 1XEDA 5CZXD 1OTUD 2VWEE 3R8BB 4HXAL 2NQCA 3KYOB 1I75A 3BGFC 5J1SC 5I75B 1Z9LA 4AYFA 4M5ZL 3L5HA 2VLRD 2MJWA 3TFKD 4QXUH 3QXTA 5IVZB 5IMMB 4HIJA 4X6FB 3D2UA 4MD0B 5F7DA 5IR1A 1A1MB 1FRGH 3OAZH 2CRZA 1J12A 5J6GA 5GZOC 3OKDA 2D0GA 5FM8A 4KUCF 5K9OB 3V0WH 2Z8SA 1DVFA 3AS3A 1JZ3A 5FDWA 3CSGA 5EZLA 3RGVA 1WCBB 3I75A 3KYKL 5K59E 3S7GA 3KYAA 4ZUWA 4JFOA 3SKNA 2OP4L 3E6FA 3G6JF 3SDXB 5BV7L 2VIRA 1TJGL 1H5BC 2XYCA 1LEKB 4RFEB 4G7YL 4PRHA 5F1KC 4NN5C 3KWWA 4M61A 3OKMB 5CZVL 3DV6B 1MAKA 2Q6WB 1SEBA 1L7TH 4Z95H 3C8KA 5JOEA 3IF1B 1Z0MA 3HZMA 3MCLH 1CXHA 2CLVA 2P8LA 4JFDE 4O2EA 4P3DA 4M7ZB 1UZ6F 4LEOA 4DN4L 5HTSA 4NYLA 4FABL 3Q1SL 5JIIA 3VWKC 4U6HA 1JGLH 1HH6A 1XAUA 4N8PA 4WV1C 2DLGA 3VRLE 1OAYL 3GMMB 3W0WB 2EEBA 4NWTL 3BXNA 3EYFB 3IFOA 5E08L 2AK4D 5EIIA 4LAJH 3EDKA 4ENED 4GMTL 1CXEA 4O4YL 5D1XC 3U0PB 4JGJA 4YHIA 5I1IH 1Y18A 1BIIA 3LAFA 2Y25A 5DC4B 1QNZL 5J13C 4W4OC 4ZUVB 3IGAB 4RWHA 3BKYL 5HD8C 2FSEB 3X3FL 5D9SA 4CDHA 1WF5A 4LOUC 3B2VL 1TITA 4KRNA 4RMQA 1YN7B 2X4QA 3T4AB 4P46D 3PP3K 3IDMA 4IOSD 1QFUH 5D2LE 1VSCA 4WI2A 5DD1H 5GZNC 5HYJB 4UILH 2A83A 2YSSB 4F37F 1WZLA 2QQKH 4KROD 5SV3A 1F4WH 4PR5A 5I1JH 3MX0A 3UPAA 1A21A 3NMEA 5BXFA 3F62A 2O61B 1WZKA 4O9HL 3CZFB 3DX6B 1I8LC 1T5WB 1R3LA 5F89A 3DX9B 1WZMA 4PRPB 1CLOH 1C8PA 5TE6L 2OTPA 5HHNB 3LY6A 2NW3A 3VG0L 3LRHA 4PLJD 3WV0A 4RIRA 5GJSL 1SJHB 1OW0C 2IALA 5T33H 1ORSB 4ONGH 5FV1L 2QQNL 2Q7YB 3UJJL 2RIKA 3MLVH 4J23A 1S8DA 5J7CC 3GMRB 3Q3GB 2FDBP 3GK8L 1GOGA 3IS0X 1N4XH 3V0AC 2K3TA 4NQTA 1QLFB 5E4IA 5E8OB 4Y19D 3AB0B 3RAJH 4XPHH 5HHVL 2WINB 4CADA 1KPRB 2H6PB 3FB5A 2APFA 4HWZB 2DLHA 2K7QA 5BQ7B 1UJ3B 4PJGA 3OAZK 5E8NB 4LSRH 4S2SB 3HZKB 1MPAL 1XF4B 2BNUB 3GSWA 1QRNA 2Y7QB 3ZDZE 2NZ9C 4E41D 1BWMA 3C5SA 3ARQA 4G6MH 3ZKXC 5BS0B 5I8CA 2Y5TB 1XCQB 4X4XA 1KJ2A 1AJ7H 3BPNB 5GS3A 3TT1H 1NLBL 5EU4A 5IESL 2UV3A 3MRCB 4Y2DD 4UTAH 1CLZL 4CVZB 1SQ2N 3D85A 1NCDL 2DYPD 3O11B 5D7LB 2EICA 4G8IA 1B0WA 4Y4FD 1ZVYA 1T1YA 3LPFA 2Z8RA 3VI3F 3WSQH 1BD2B 1WJ3A 1AFVL 4LLQA 1T20A 4K07A 1PJ9A 4HLJA 3ARFA 4S11A 3TN0C 4F57H 4JQIL 4Y5VC 4ODSH 1BQLL 1JBJA 3B2UD 3L7EB 2OTUB 4KTDL 3ZE1E 1L7IL 4KKLC 2GJ6E 4HZLB 4UQ3A 2DWEB 5FGSA 4CL7A 3ARDB 1XGTB 2VAAB 2WAHA 1EERB 1JN6A 2F53B 5E2WH 3GI8H 3SGDI 3WIHA 2X70B 4IDJL 3KPOB 2WK2A 3NCBB 3P0VL 3V8CA 4I48B 4XVSL 4J3XA 4OM1H 1FZMB 5TF1L 4Z7WB 3IDUA 5J56B 3MODH 2PXYB 1WIOA 4RMVA 3BE1L 5EOQL 4TULL 5D96B 1F3JA 3NIGF 1MHHA 1VEPA 4WWID 2FZ3A 1IARB 1Z9SA 3ELAT 4CNIA 3MLZL 5GHWH 3CSYA 1DVFC 1QPPA 4EQ3A 2APXA 5T3XE 4CU8A 3G9VA 3IDNB 1UB5B 2P8PB 3Q48A 2OL3L 1VGKB 3DETC 3LS4H 2XKNB 4Y1AA 4D2NA 2JB5L 4XPTH 3V6OE 5J89A 1A9BA 4PLNC 2VZOA 2XN9E 4TQEL 2LTQB 1U0QA 4MS8C 3QCVH 5CIPA 4U6YB 4YPGA 5FF6A 5I1GL 5T5FH 4KHXH 3MV11 4C58B 3VGAC 3RY5A 1Y6NR 2HFTA 2G5BA 2XIDA 3EO9L 4DQOL 4U0RC 3CLFH 1PGRB 4FRWA 2J8UB 4WEBH 3ZTNH 4BFIB 5F9OL 1ULVA 3IDIA 3CFKB 3TBTB 1X7QA 5ICYB 5HHME 4ALAH 4H1LA 1IC4H 5JQ6L 1R3IL 3BHBB 3QDJE 2H9GB 4N8VA 4CMHB 2VQ1A 2W9DL 3SE8L 5K9KA 4V1DE 4KI1A 4JZJA 1JYWA 1LE9A 3JUYA 3M45A 1L9MA 4ERSL 4ZFFB 5M7QA 5E2UL 5JHLH 3FOMB 4FXKB 5AWNH 3NH7L 4I0KA 2EH7L 4FQIL 3LKRB 1UM4L 5CAYB 2CLZA 3CZJA 3ZT6A 4WWKC 1FSKB 1HXYB 3D25A 4WU5A 4LVNC 2MQCA 3DBXA 3BWUC 1QSZA 1WLHA 2R4RL 2R2HA 5DHYA 3BVNA 1BAFL 2AKRA 5DJYA 4NNXB 1G0XA 4JM4H 4MGXA 1BECA 1ZK9A 1JZ4A 2H8PA 3PF2A 1N8ZB 1Z3GL 1PLGL 3MJ7B 1K9TA 2FHFA 1NC2D 5T5NF 1TTUA 5D2NA 4PJCE 2NY2B 3WE6A 2LU4A 4LCYA 5I8KH 3GSXB 4LSSL 3OJVC 5AYUH 2NY6D 3FKUS 5DEFA 5HY9B 1WWWX 5F88B 4L8SB 4Z0XB 5HHPA 1QFHA 5DWUH 3E2HB 3T0AA 3TGXA 4TYUA 1QBML 1CGVA 4D9LL 5IV2B 4YO0B 5F3BB 5HGGS 1TPXB 5F44A 4BJLA 1F13A 3N85H 1Y0LA 1A3QA 3F7YA 2FH8A 1ONQB 4GXUM 4JFHE 4ZFOA 1MREH 1MWAB 3D48R 1VFAA 3FAXA 2NXZC 4I1NB 1PG7W 1JV5B 4MNQE 1U8HB 2EE3A 1MRCH 3ZYJA 1LO4L 4B5EA 5SWQA 2VDQH 1G1CA 2W60A 3QWOA 4OZGB 3D9AH 1SVCP 2VITA 3UAJD 5C07E 3RFZC 4C56A 2BNRA 3NN8B 2RCSH 3B4NA 3PP4L 1B0RA 1JWMB 3S5LA 3AC0A 4XNUH 1W0YT 4TSAL 1G9MC 1ZHLA 2VMFA 3MA7A 5H94A 1RVFH 4Z8FL 4PYGA 1A1NA 4MLIA 1OAXH 2A77L 1KLFA 3WS6C 4PJBA 3MTRA 5GSVB 1CFVL 3KHQA 5HHOD 4NM4L 2R1XA 4NKOB 1OAQH 4YGVA 1A3RL 1OAZH 3QUZD 1M05B 3JWOL 3TVMC 3RVVC 1TFHA 2DQHH 1TQBC 3ARFC 4XRCB 3ARZA 1JYXA 3U0TB 1MVUB 4ZPTB 1Q9OB 3CLEH 3PL6B 5LGJA 5IB3B 5L8LB 5HJ3B 4XP1L 5FCUH 1IKNA 5D6CB 1TZGL 5DRWB 3UZEA 5HBBA 4Z76A 2RGSA 3BPLC 4XP4H 2XWJA 4PJEF 3PV7A 2D7MA 4FQHA 2DQCL 4I3GA 1K3ZA 2ADJA 5FM5M 3JUZA 1R6VA 3EYUL 3HMXH 2VDLH 5DJ2A 43CAB 1I4FA 4PY7A 2EXYC 4EXKA 2IH1B 4HKJA 2HFGL 4FHBD 2VDOL 2MHAB 1DL7H 1FV1A 4G8FB 1GYAA 1PVHA 2BY1A 4XNQA 4J4PA 4F9LC 3FQTA 1DP0A 4NO0D 2CDEB 3BP4A 1GGTA 1F45A 4O02H 4G6AC 4G42B 1A1OB 3L1OH 2X1OA 3MBEA 2NY5L 1BVKB 1AI1H 5C9KA 4TNVF 1YPZE 4UBDD 5FK9A 3RUGB 3TCXA 1NGQH 5C0BE 1TZHB 4MA7H 3RP1A 2WWMC 3PWPE 5CEZE 2EYTA 5DUBA 5JHDE 5ILTH 1MUJB 3F6IA 5E6IB 5I2IB 3GKZA 4N0CC 5T3ZE 3KLHD 3QPXH 1IGTA 4OM0L 2XQBH 4XCNA 4LHUB 4U3HA 1MFBH 3B9AA 3MJ9A 4AL8L 5FYKU 3FFCB 5D7JB 1YEDA 3GSOA 2BVTA 4XH2A 4N1HB 2LFGA 3KPMA 5HI4C 1I8IB 3BGMA 5EC1B 5AUMA 1K8IB 3KPLB 4MNGA 1NGXB 4K71C 4WO4C 5AD0A 3KPNA 1CR9H 1Q9WB 2QADC 5E8PB 3FN3A 2QLVB 4N68A 4UT9H 3VFUA 2VISA 1U8OB 4KXZH 4JLRB 1I1AB 3BO8B 1QVOB 3PHQB 4X4YB 3L95A 5KW9H 4X9GA 3T2PA 1WK0A 4JY6B 1HWGB 5FKAB 4EI5A 1F8TL 1S7UA 5EU6D 3RHWK 3U48A 5LGKA 5DJ6B 3QXVA 4XCFL 1MY5A 3CCHA 4J6RH 3MFGB 3VCLB 3IAQA 4KKAD 1YMHB 2JCCE 4XBGA 1OP9A 4HUWB 3QXWA 5DR5L 1UWEH 3DX7B 2DI9A 5EBWA 2WM0A 4P2OA 4FS0A 3QULA 1MEXH 3KPRE 3Q5TA 2M2DA 4N9OB 1J1XL 1PAMA 4LLDB 3T8XA 3ZDXF 3OPZH 1X4YA 1RJYA 4XCCH 4L4TD 5D2NC 1JF6A 4B7IA 5HI3C 4U0QB 1IC5H 3V4PL 1AGDA 2X42A 3MMEB 4HS8H 4JDZB 5DVOA 3RTQD 2DF3A 3EZJB 3A67L 1HEZA 3NA9H 3BSZH 2XI9A 3VWKD 1BP3B 2GJ6B 1NFDA 5CBAA 4OF5A 2JJTA 2V5MA 1HHJB 4KVCH 2G2RA 3KPQA 4F7CB 5T1LA 3F5WB 3OR7A 2YEZB 4UT7L 5IB2A 5INCB 2OLDA 5KANI 3SO5A 1HQ4A 1QQDA 5F1NA 1U93B 2MMXA 3JTTA 3SO3C 4BZYA 4WI6A 1UG9A 2QR0A 5FO9A 2K7PA 2VXTH 1U8LA 1MAJA 1FYTE 1DQMH 3DMMA 4JCLA 1IFHL 5HD8D 3DRQA 4HJJL 1NDMB 2CR3A 3HUJE 5J12C 4X98A 3V4UH 2FGZA 5JOPE 1BEYL 1ZGLM 3OGOE 4WHTB 1JGEA 1CFQB 4ZS6D 1ACZA 1LO3H 4OT1H 4I2XE 4NJ9H 1G6RH 1KXTB 4NQEE 3EGSB 1CGXA 3O4LA 4FQXB 4ZTOL 5A1AA 5IB5A 1TNNA 4P5TD 3UTTA 4G8EA 1W72L 3MGAA 5A2KH 5IEHA 5IJKA 5B39B 3U6RB 1OLLA 1SY6L 3WXWL 4OLUL 1UQSA 2P49B 4LPYA 4DW2H 1J0ZA 1FBIL 3IYLW 3HAEG 4JQVA 1H9VA 1P4BL 1XGRA 3RWFA 3MZTA 1BOGA 4F7PA 1PQZA 3V95A 4KRLB 2VABB 5CS7A 5HVHB 1IKNC 5T3ZH 2O5ZH 1IAOB 1OCWH 4HMCA 5E8EA 5HHMB 4J8RA 5SX4H 1KEGH 5I8EA 3QDJB 4PGCA 2PYEE 4ZOEA 1X5IA 2BNQD 5I1HL 5J3HD 2OSLB 1M6OB 2DI8A 4M7LH 1OPGL 3DI2B 4KHTH 5EUOA 2EE9A 3ZSSA 2ITCB 4W81A 3ARXA 4YDLB 3WN5B 1DJSA 4XX1E 1MQKH 4DVRH 1PX4A 1W0WB 5L6YL 1NJ9A 4X6CE 4WI8A 2W0LA 4TPRH 1IZKA 4U4BA 2G75A 4OKVA 5GGVL 2VXQH 1A5FH 4PREA 4J4PC 4U1HB 4XBEL 5I15L 1CFNB 4LRNL 2NZ9D 3FCTB 3H3PL 3FMGL 2BRQA 3MBEC 2I24N 1MVFA 5TDPB 5C0AA 3RPIA 4YDKL 1DBKH 5DQDL 4YC2B 4R3SA 1NAMB 1TZIA 3LQZA 3QJFA 2HWZH 2ZUTA 3VFGL 3QA3B 1H0DB 4J3TA 1NUGA 1UEMA 4K94H 4RZCA 1Q1JL 4I5BA 4OCRH 3BUYB 5C3TA 1JIBA 1ZOXA 4FQCH 1DANU 4IRJA 3I9GL 1R0AH 3PHOA 1JZ7A 3FQUA 3VFRA 1OGAE 5SV4A 3VGEA 5DYOB 4RGNC 1WWCA 2C3WA 1AGCB 1NFIB 2F8VA 4KKLD 3CU1A 3EOTH 3BEWB 3WIFA 5LWYH 1F58L 3SJVA 5D7IA 4N0YL 1WGOA 1G7QB 2WQRA 4PRBB 5ETUB 1UH2A 1N0XL 4IOFD 4I77L 3QG6A 3D0LB 4LSVH 1QUNA 5C08B 3EO1B 1C5CL 3R4DA 1T5XA 1LO5A 3RL1A 2NMSA 3D2UD 3VXNB 32C2B 1HE7A 5CGYC 1UEYA 4MNQB 3WBDA 3MOAH 3DOSA 4EI5C 3RZCA 4PJFA 3U36A 3TO2A 3BAEL 3NGBB 3RKPA 4L1DA 3MV9B 4WUKL 4LCCA 5DS8B 2YUVA 1DVFD 1JNLH 4WDIB 2PR4H 2IPUK 3RGVD 1FVEB 1UKQA 1EVTC 1DLFL 1ETZA 3P3YA 4LQFL 3CVHB 3ALWA 3GSUB 4MD4B 3PWVA 3MRLA 4S1SH 3SHSA 5KVEL 4IS6A 3RWGA 1A2YB 5C6TH 2QQQA 4MQSB 1NSNL 2X44D 4OAWB 4PLKD 3RWHA 4RCAA 1BGXH 4MS8D 4PRHD 3ZKQD 3UTQB 4M7KL 1B6UA 2ZSVB 3L6FB 4JY4A 3ZYOA 3CFJA 4RFNB 1I3VA 1RMFL 3LRGA 3X3GH 5F6IB 2D7NA 4AMKL 4QXGH 3T1WA 2V5SA 3V4VL 1SM3L 2CLRB 3N1PC 3NFPA 5FYKL 2XA8L 4NRYB 4HGWA 1MLBB 5MENE 3ILPA 5HDBE 2CD0A 3QDME 3DXAA 2R23A 4YEEA 1A0QL 2JJTC 3VDBA 12E8H 1EPFA 4NPYB 4JPVH 3V2AR 1R24A 2K1MA 4C83B 1LNUB 5BZWB 1HOCA 3QUKA 4KKBC 1IM9A 4K7PL 5ISZA 3SDCB 1DQJA 4Y8DC 1P4LB 2FR4A 2R1WA 4LKCB 5F7WC 1IKFL 1F5WA 5T1MB 2VNCA 5AZEH 2BSTA 3TBSA 1NCAL 1VGEL 2DKUA 2F5AL 3L5XH 3DMMC 4HQQH 4YFLI 3VU2A 4HT1H 1YC7A 5GGQH 4JRYB 3VXRB 1QSEB 2DTML 1FL6B 4N0UB 2YBRB 5IBUG 1YPZB 3J8F7 5D70L 4MX7A 5HDOA 3SDXF 3SE4A 4P48A 4JVPA 1Q72H 3LD8B 1VADA 3SY0B 5HYSB 5I18L 5DO2C 1HN1A 4PRDB 2HJFB 4RDQG 1DQQB 3WFZA 5H8DA 3PWPB 4IRSA 1ZLWH 5D5MB 2GTZA 3UTSA 4M1DL 2RB8A 4U3CA 1KC5L 2X7LB 3B9VA 5DT1L 4ONHB 1XMWA 4HPYL 3U4EA 3FT2B 4ZO6A 3AMLA 3O2VH 5FEBA 4JQVC 4GAJL 3CK0H 1XF2B 4PJXA 4S1RH 4FMKA 1PYWB 4X8JB 2BVOA 3FZUC 2R29H 2Q8AL 5KSVA 3MV8D 1EH9A 3ULVD 2B0SH 3RRQA 3HNVH 2ZG1A 5I74B 3L9RB 3LKNA 3S96B 3RIFK 2CMRH 1BJMA 3K74B 5BMFL 3DVIA 1FNGA 1S7RB 1QSFE 4XPBL 4JFYB 1UXSB 3VW3H 3LEXB 4WJ5B 4U33A 2J6EA 4AT6B 2C3HA 4BH7A 5CP7A 3EJZC 3HI1B 1GGIH 2BC4B 2YD1A 3QQ4B 4FQLH 4O5LH 2BHYA 5CLWA 4PIRF 4OD2B 4RAVB 3HN3A 2YD4A 4CW1A 1S7QA 5AG9A 4HJ0C 1QRND 5DD5L 2JCCB 3DGCR 2UYLB 1NEZG 4OUUA 1I3RB 3NIDF 4NQVB 4JHAL 3GUTB 3IETA 3P0GB 3KJ4B 3GMOA 2FBOJ 3ZHKA 4NBZB 1JGUH 8CGTA 2WQ8A 4XXDB 3LEVL 4P23A 1RIHL 3D39E 5F9JB 1DE4B 2XFXA 1KIQB 1TETL 3UPRA 5JXAL 4AIOA 2EDDA 3D85D 3U7WL 1WT5A 3LKPA 3T0EA 4M6MH 3MSPA 5LJYH 1RUQH 2PO6A 1U8JA 3WD5L 4XC3L 1KEMH 3NZHH 1RZIB 5E5MA 3VFMA 2FB4H 2VH5L 4IRJC 4Y89A 3VXQB 2QHLA 5DRXB 1U9KA 3V9FA 3QNYA 2AXGA 4MQXD 4I18A 3UROR