3DHQA

Crystal structure of staphylococcal nuclease variant delta+phs a90r at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLRYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Arginine residues at internal positions in a protein are always charged.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3dhqA00
3VA5A 1SNCA 3DHQA 1TQOA 1EY7A 3PMFA 2LKVA 3QOJA 2OXPA 1JOQA 1EY9A 4J1MA 1JOOA 2F0HA 5CGKA 1ENCA 1STNA 3OMGA 4EVOA 2EY2A 5I6YA 2OF1A 4J6HA 1EY5A 4K5XA 1A3VA 2EYJA 3C1FA 3D8GA 2PZTA 4HMJA 4HMIA 2EYHA 4K6DA 4ME5A 4MIUA 5I9PA 2F0NA 5CV8A 3RUZA 5KGUA 4DU9A 1AEXA 3NHHA 2EYPA 2OEOA 1KDCA 4N9PA 5EKLA 5C3WA 3P1HA 4S3SA 3BDLA 5J39A 4EQPA 5IGEA 4DFAA 1II3A 2EYOA 4QF4A 3SK8A 4F8MA 5JAVA 2KQ3A 2EY5A 2F0FA 3QB3A 3D4WA 3TP8A 3OSOA 4DF7A 3NUCA 5KYLA 1STYA 3SK4A 2F0DA 1SNQA 3HEJA 2F3WA 3E5SA 5I9OA 4ZQ3A 4NMZA 2F0OA 5IGCA 4ODGA 5IGBA 1KDAA 4LAAA 4PMCA 4B9XA 2NUCA 2F0LA 3NK9A 4QB4A 1STGA 4WORA 5CV9A 1EYCA 3NXWA 5CV5A 1EZ6A 3MEHA 4EQOA 1SNMA 4KJOA 4F7XA 5JOBA 1A2UA 1U9RA 2F0SA 4OL7A 3EVQA 5J1ZA 1RKNA 5DAUA 4IZ8A 4ZUIA 5NUCA 2HQEA 4I65A 3V2TA 4NDXA 2RBMA 1EYDA 2PQEA 1EZ8A 2EXZA 2F0KA 3MHBA 4H7BA 4KTAA 2EYFA 4KY7A 1KDBA 1F2ZA 3TMEA 1TR5A 1IHZA 2F0EA 3R3OA 4KD4A 3MZ5A 4PMBA 1JOKA 3SXHA 3TP7A 3ITPA 2EY1A 1F2MA 4KJNA 3D4DA 5C5MA 3SK6A 1ENAA 3D6CA 1KAAA 1KABA 3BDCA 1F2YA 4G57A 5CC4A 3H6MA 2PZUA 4KV6A 5C6AA 3SK5A 5HGTA 2F0QA 4N9TA 5E1FA 5IOCA 2RKSA 2F0MA 5M9OA 1SNOA 2ENBA 5IGFA 3EJIA 1STBA 1A3UA 4K5VA 3HZXA 2O4XA 1NSNS 5ISRA 5EGTA 3LX0A 4EQNA 2PZWA 1A3TA 5KYIA 1TT2A 4E6IA 4K8JA 1SYBA 1EY4A 2PW7A 1EY8A 4YIJA 4KY5A 5F2DA 5HURA 3TP5A 4NP5A 3SR1A 3QOLA 5KRUA 5J22A 3P75A 2SNMA 5DEHA 2F0VA 1NUCA 1SNPA 2SOBA 3NP8A 4RKBA 2F0WA 5C3XA 5KEEA 1SYGA 5CV6A 2F3VA 4RKLA 4ZUJA 3U9OA 2F0GA 3TP6A 4ID6A 1EY0A 4KD3A 1SNDA 2EYLA 1A2TA 4HTHA 2RDFA 5IIFA 5C4ZA 2EYMA 1SYEA 3C1EA 4QMGA 3SHLA 2F0JA 4K5WA 3MXPA 2F0UA 4KY6A 1STHA 5EKKA 3T13A 3OWFA 5CR3A 4B9WA 1SYFA 4DGZA 3S9WA 1EY6A 4TRDA 4K14A 1EYAA 5IGGA 2F0IA 1SYDA 5C5LA 5CV7A 3MVVA 2KHSA 3NQTA 3ERQA 3EROA 4KHVA 4R8NA 2F0TA 2PYKA 4IUNA 5IODA 2SNSA 5K5PA 4K2KA 4WRDA 2EY6A 5E3FA 4K2LA 1SYCA 1JORA 3T16A 2WACA 5KIXA 2M00A 5CV4A 1STAA 4IALA 2F0PA 5C4HA 2PW5A 3DMUA 4K8IA 5I6WA 4PNYA 5IGDA 1EQVA 2QDBA 3OMCA 4NKLA
chains in the Genus database with same CATH superfamily
2RF4A 1PTOC 3Q23A 2EE1A 1E24A 4NW2A 1PZID 1TWGH 4CJ0B 5CGKA 4LNQA 3ULLA 4YHHQ 4K5XA 4MN3A 2PZTA 3CPFA 1EFWA 1GVPA 4UHVA 2R93G 1CM9A 2B2VC 3A8IE 3I4NH 2HCCA 2CVRA 4ZK9B 1VQ9A 2UXBQ 4C56C 4H13C 3QB3A 5C4JB 2WB1B 4QGUA 3RNUA 3SDZA 1N36Q 2EPBA 2KECA 3NQIA 1TS2A 2WP8J 1TWCH 3ZJYC 3I4OA 1RF2D 4C3IB 3HOVH 1PYBA 1DOMA 2HD3A 4YY3L 1A2UA 2WAQG 4A3EH 2CQAA 3R8BA 1AH9A 2CW0D 2HQEA 1SN8A 4H44C 1XPUA 4LF8L 1GO3E 4OEMB 4ZYSA 2UXDL 3U58A 1TR5A 1Y1WH 1JOKA 2IHFA 1B8AA 4LF9Q 1JMCA 3D4DA 2E2IB 3TZUA 1ZYRD 4DN4M 4GOPB 4A3DH 2F0MA 4BXXH 1YI2A 3H0GB 2UUAL 4RHSA 2VZAA 3CCJA 5EAYA 1K8AC 1A3TA 1LTTD 1GUWA 1PFBA 3K59A 3A7AB 5F2DA 1L1OB 1R9TH 3SR1A 1UE5A 5JEAH 4DV2Q 1VQLA 3BZKA 1XX8A 5D3DA 2EYLA 2OQ0A 4GOPC 4FF1A 1H9RA 4B3RQ 1BNZA 2JA8H 2NN6I 5G3LD 3Q22A 2NWGA 1SEBD 2H5XA 1SJHD 1E2VA 2RA4A 2A69C 3ERQA 1L1OC 3A74A 2KENA 2AWNA 2PYKA 3RZDH 3S1QB 4DR6Q 3IL8A 5C0XG 1NAPA 2BA0A 4IPDA 1QUQA 1UUPA 1K8MA 2E2JH 1FNWA 1Q1BA 1HFNA 4K0KL 3CRLC 1TWFH 1WFQA 3PUZA 1IBLQ 1KD1C 4PZ7A 2XIWA 2L5TA 3P1HA 4S3SA 3TN2A 1X6OA 1QCBD 1Q12A 1X3EA 1Q8IA 2I07B 1IBKL 2EY5A 4JI3Q 4A93H 5KYLA 1CI3M 2MGSA 4RA8A 3E9IA 1STYA 4X62L 3KFUA 5GAHC 1X56A 2F0OA 2A6HD 2N49A 4ODGA 4PMCA 4YWMA 1Z47A 5FOBB 2NUCA 1ASZA 2PPBC 3IAYA 1IYVA 3OWEB 1U9RA 4DPGA 3I4MG 4DR1L 2Z6KC 3HOUG 4LF4L 2ZTEA 2NZHA 1EUJA 3T56B 3A0JA 4A3MH 1N32L 4NXMQ 3R3OA 2R7ZG 1CSQA 5C44H 1KAAA 1HA5A 1B9MA 1ILQA 4AYBG 2LY7A 1AE2A 2FINB 3KUPA 3T4AC 3CCSA 1YNNC 1SNOA 2L0CA 3ERSX 4LW1A 5BN4A 4HJ8A 4IUTA 3HZXA 2NVXB 3KYHC 5EGTA 1LTID 1B2TA 2MNAA 3HOZB 3CQZH 5IYDG 5C4XB 4JI6L 2IX1A 5C3XA 2A68D 4RKBA 1VQBA 3A8JE 3AB9A 4KN7C 4DV3Q 4F87A 4H02A 1D1IA 2UU9L 4XYOA 5M9OA 3DEPA 4DK3C 3K57A 1OXTA 1FNVA 4O0AA 4A3JH 4P2CB 1I4RA 3S2HH 1GXDC 4FXDA 4J8QA 3KDFB 1CZGA 4BY1H 3C46A 2NVYH 2B63B 1B50A 3DLLA 1SMXA 1CHPD 1SE3A 4YCUA 5C3EG 4HIKA 3GTPB 1KL9A 5AFWA 2MUYA 1SFOH 2JE6I 2K32A 1DD2A 2EDGA 4BBRG 2Y0SG 2Q2IA 1Z6HA 4L5TA 1HNXL 3T1YQ 1Q3LA 4OWWB 1KDCA 1FGBD 3CXCA 5E4WC 1II3A 3SK8A 1PV4A 1SE4A 5M5WH 3MXGA 1T9HA 1O7LA 3M4OB 1VF7A 1XMOL 1N9WA 1NR4A 3NE5B 4X65Q 3SK4A 1ZKOA 3CC2A 3HKZG 3HOYH 3E5SA 3K0XA 5I9OA 1PTOH 4HCSA 5AJ3L 2AKWB 4PMWA 1HR0Q 4TKOB 2XTIA 1ML0D 2AQ1B 2PI2E 1FL0A 2B2TC 1S5BD 5EBCA 1X32A 2EJMA 3J81c 4A3BH 2EXDA 2F0KA 2AHOB 2WKCA 3NENA 3MTSA 3RLOA 1IYUA 2B2WA 3K5NA 2JK8A 1KABA 1ET9A 4DNRB 2Z4IA 2E75C 1F9SA 2X6LA 3QIAA 3GV3A 1C4QA 2NTTA 1VQFA 4UP7A 1I4QA 1A6XA 2UUBQ 1JWSD 2D5DA 1HUNA 2VUMG 3P75A 5H1SE 1XTCD 2SNMA 2GVAA 4GN4B 1SYGA 3MWYW 5C4JH 1E1OA 4HTHA 2QF7A 1PTOD 1R4QB 2K52A 2VY3A 1I50B 4G4KA 3OW7A 3RLFA 2E2HH 1H9SB 5CR3A 2GN5A 4DV1L 3AEVA 2J7ZA 4C3IH 3S1NH 4L8JA 2AQ3B 4C3HB 4RAUC 1B44D 4JYAL 5IODA 1HR0W 3I4NB 4DAVA 1AP0A 4U68A 1IL8A 1TS3A 2C5CA 2IT1A 1STAA 3DMUA 4IURA 3I90A 4UP9A 4JI2L 1PXUA 5I4DA 5IY0A 1SNCA 3HOWH 1ZYRC 2OXPA 1XPOA 1ENCA 2CCZA 2RCNA 1VMPA 3H0GH 3K80C 1EIFA 5LMNL 1U4LA 3CKIB 4GN3B 4CDCC 4IFDG 2KJXA 3TZDA 5M3MG 3WWVA 1GUNA 4N9PA 5DNFA 4GNXB 3J80c 2EYOA 4DV6L 1KLGD 3CMEA 3D4WA 4N8X1 1N36L 2LXJA 3A8KE 4FDBA 2BE5C 4JBMA 3CD6A 3JAMc 4GS3A 1WOCA 1WVLA 1MI2A 3I7FA 4ZQ3A 1RDPD 5IGBA 3DUZA 1XNQL 3U9SA 2E74C 1UAPA 4LF7Q 1EZ6A 4U673 4HIOA 1B53A 4DUYQ 1NBWA 5FJ8H 3MFYA 3TS0A 1VQKA 1A8VA 4AIMA 2OTJA 3S1QH 1CKNB 3OPOA 2PNRC 1EZ8A 1CT1D 2VQEQ 1HA6A 2PQAA 5JEAJ 4RH6A 1PH9A 2LMCB 3NBHB 1NMFA 4HEDA 3R2IA 2KEDA 4FF2A 3H09A 5C6AA 1MJCA 3FKIB 3KJPA 2DNEA 4K5VA 4BS9A 4EQNA 5GQOA 1UEAB 4BWGB 1FGUA 1SYBA 2Q8IB 1V1PA 4KY5A 3RZDB 2LS01 4N8FA 1MSGA 4LFAL 3PO3H 1DYQA 5A35A 3S15B 4ULLA 3BDOA 4OO1I 3NTIA 4C3JG 4LUOA 3NWSA 2VXWA 1STEA 3MXPA 4DGZA 2F1MA 4H0LC 4FXGC 4A3FB 5M5YB 1IKMA 1RJTA 4ME3A 4LFCL 3X3MA 3OTOL 4GN5A 4DR7Q 1GOZA 1ENFA 2A74C 4DUZQ 1O80A 2H4OA 2JXMB 1V43A 2AQ2B 2F03A 2LFNA 5M3FG 4OX9Q 4A93B 1QNUA 5IGDA 4DR2L 5K36G 2QDBA 1M4VA 2EZVA 1FNUA 5FO8B 5IP9G 2HUGA 1EY7A 2LKVA 5HY6A 1PH5A 2A73B 2G9HD 1JOOA 4JI5L 4V190 4J15A 3OMGA 4EVOA 5I6YA 5LMUQ 4GKJL 1WCMH 2HT1A 1CTMA 1SBBB 3BZCA 4A3MB 1QZGA 4F8MA 5C4XH 3AFQA 3KK7A 2D0OA 1EQQA 2KCCA 3J7A5 2AUKA 2K03A 4BA1I 5C44B 2A68C 2PMZE 3W1GA 3J7AF 1EIYB 4QUCA 3I56A 3Q0AA 2IX3A 2O2LD 3OHXC 4JI7Q 1EWCA 3STBD 2Z6BA 3KF8A 2VQFL 1SNMA 5JOBA 1HTPA 3E9HA 1Q82C 4OL7A 3PF4A 2WINB 1K0RA 3CQZB 4P71A 2X6GA 5L37A 2EXZA 3IFDA 2B63H 4TVAB 1IBML 1HPCA 1SJED 4HSPA 2MFIA 1DJRD 3GTPH 3RMHA 4MHEA 3AQQA 1LABA 3BVMA 3H6MA 5HGTA 3IKJA 5DM73 4R4IA 1G2SA 4DV5Q 1JWUD 1PH4A 1SRUA 4A3LH 4JVZA 1NCVA 2PZWA 4QQBX 1CA6A 3UE0A 3KBXA 4E6IA 4GLXA 1KNAA 2NZ1D 4CKEA 3D3RA 1X54A 3RZOH 4BY1B 1MIUA 1OXSC 3BZDB 3KLSX 1XJVA 1EOTA 1YJNA 3OIPA 1E0BA 2HQLA 4DV4L 3QO2A 1KIXA 3J7YW 2XRQD 1DZ1A 1C48A 4KKUA 3TQYA 3C1EA 1HNZL 2YV5A 4JW0A 3G6EA 4B9WA 3HP3A 2C35B 2E8GA 2JA6G 5IWAQ 1EEID 3FVQA 5KNBA 3QWNA 1HZCA 4A3CG 3KF6B 4IUNA 3TBIB 4L6TB 3QG1A 2ICIA 1L0WA 2BH8A 2JA5B 3S24A 1VF5C 1OXXK 1U4MA 4HR7B 4NKLA 1J9OA 3DHQA 4G7OC 1HQMC 3DWAA 1BQQT 2BDOA 3QOJA 4R1JA 2HIXA 2F0HA 1D5MC 2FJ2A 2DJGC 1Z9FA 4ME5A 1G6PA 2AMCB 3CW2C 2ES2A 1PH6A 1X3GA 1JCKB 1K3BC 5IP7H 5EKLA 2R92G 1F9PA 4A3BB 2FMMA 3H91A 3CCRA 4NXNQ 3VYUA 2LSSA 2RHQB 3TP8A 4JCVE 4CKBA 1S5ED 2FFKB 3JC66 2FHTA 4DAYA 1XTDA 2WFWA 3GV6A 5IYCH 1OTCA 1U4PA 1I50H 2FMCA 4M1UB 1QG7A 1STGA 2SDFA 3NXWA 5CV5A 1K73C 4DR4L 2WKDA 3HOVG 4ZAIA 3GTJH 4AQYQ 4C3HH 1H9JA 4A3EG 4DR3L 1J8IA 1SE8A 4KY7A 3TMEA 2WB1E 3OYYA 3TP7A 1YNXA 1Y1WG 3D6CA 1I6HH 3VYSA 4B3SL 3IFTA 1F2YA 1S40A 2XSCA 5FKAC 4ALPA 2E2HB 2GA4B 2ZXPA 5E1FA 1BCPF 2XVSA 1OO9B 4LF6L 4A3DG 2A5HA 5J3BA 1E1TA 4BXXG 1BVSA 1YZ6A 3S1NB 1G91A 2EJFC 1PFMA 4Y7NH 4HAEA 5KYIA 4QY7A 2PW7A 2NYZD 4A3IB 4KKSA 2ASBA 3FMCA 1LT4D 5HURA 1ESFA 4CDFC 4F88A 4C2MB 2F0VA 1O7IA 5FLXL 3A55A 3T1HL 5EBDA 2X69A 2ZM6L 3V96A 4WJ4A 2CH4A 5COYA 1FJGQ 4KD3A 2B2UA 1BF4A 1G8ZD 2RDFA 2B2YC 3HOWB 4UDUC 2EYMA 4JI1L 3VDYA 1K0SA 4K5WA 3CCMA 3T13A 2JA8G 4APVA 1A63A 1DXMA 1Y1VG 2KCNA 1D5ZC 1VMCA 4KHZA 3C3LA 3GDEA 2KA7A 4LJZC 3BVGA 4ZLTF 5DM63 2E5LQ 1BBWA 5M5XH 4P74A 3PUXA 1YHBA 1JORA 5EPLA 2BE5D 5C0XI 1XMQL 3BYTB 1IL2A 1EQVA 1L0XB 4A3KG 5ELCA 1AFPA 4GZYC 3UDXA 1EY9A 3FKIH 3PQIA 1ICFB 5BR8Q 4ABNA 4JOIC 2I0QA 3IRBA 3PIP3 3CCVA 4LMQD 3X3NA 5BN3A 5C3WA 2ZJPA 1D5XC 2K5HA 5IGEA 1F2LA 5LMNW 1FVIA 4TSSA 4KI0A 5FLMH 1K83B 3NUCA 4IOAA 2MP1A 1I5FA 2F0DA 3ULPA 2NB0A 3J7AV 3S15H 4LF7L 1GHKA 3DEOA 1XYIA 1GUOA 2I5MX 1VQ8A 1ASYA 4A3FH 5M5YH 1V9PA 2HHHQ 3SEBA 4CKCA 2PI2A 4IN3A 4POGA 1RKNA 4XQNA 4IZ8A 4ZUIA 4I65A 3GO5A 5JJIA 5ELFA 5GAGC 3CMAA 4KTAA 4FO2A 4MZ9A 3PO3B 2PCFB 5C5MA 3PO2B 1IW7C 3MXNB 4V0BA 1YNJC 5LHY1 5C44G 4JV5L 4RGNA 2ZXRA 4DNIA 3FRPB 3VR6A 4X66L 2CWPA 4B3MQ 1JWMD 1ONLA 2NVTB 1KXLA 1TS4A 1O7YA 2OTLA 1YJ9A 4K8JA 5HGQA 1XPRA 4KHPQ 3ND9A 1GUGA 2ZTCA 5C0XH 1PA6A 4IJHA 3VR5A 1SNPA 1X55A 4QIWB 3S1MH 2F0GA 4G7ZC 2YTVA 2NN6H 3HGBA 4L63B 1A2TA 2CH4W 2YU9H 1TS5A 1B9NA 2MHVA 1WD0A 3SHLA 4DV7Q 1Z7TA 2JYOA 2Z4HA 4DV0Q 1LTSD 3S2DB 2R6GA 1EY6A 4K14A 3P7JA 5GAEC 4A3JG 1NMGA 3NELA 1WCMB 3R2TA 1BOSA 3STBC 3MA2B 2QGQA 3ND8A 4YWLA 4K2KA 1HNWQ 1X65A 2KCTA 3KOJA 1EU3A 4IALA 1EOVA 1PHJA 2IHEA 2YTYA 4OHJA 2P5ZX 4HJ7A 3NPPA 1ET6A 4IUQA 3UI2A 4RMFA 1RODA 2XNAC 3M7NA 2EYJA 3HOUH 4MIUA 4A4IA 3WDNA 4DK1A 4Q5VA 3VR4A 5KGUA 2EYPA 4GNXA 2Q2HA 2DY7A 1N34Q 3HG9A 4DKAC 5KNCA 1SXTA 4R4CA 2VS1A 3W5OA 2VB2X 2EJGC 1I94Q 2UUCL 1BR9A 4JI8Q 4DNTB 1VQJA 3H15A 3GTMB 1Y69U 2KVMA 2F3WA 3L0OA 3HOXG 3A7LA 4R4QA 3HOYG 2UXCQ 1PFNA 2PO4A 3GQBA 4XQQA 1GJXA 2QCPX 3MEHA 1IXRA 4GKKQ 1FR3A 2F0SA 4LF5L 3BS1A 1BCPD 1EEFD 1AZQA 3RZOB 1HZBA 4NDXA 1N33Q 1C0AA 2ZT9C 4ZCKA 1WTXA 4R9WA 4BBSB 1GD7A 3L3OC 2JA5H 1WTWA 4DXGA 3DXJC 4L5QA 4FNFA 4UAIA 3A5UA 3UDGA 1RHPA 2B8FA 2F0QA 4N9TA 4JI4Q 1HH2P 1GHJA 1SLJA 1PH2A 5A2QL 3BYYB 5CBEE 3UE1A 3CF5A 1HJPA 2BDNA 1G291 1HFGA 3TRZA 2QKIC 1DOKA 1QUQB 3D0FA 4ID6A 2F4VL 4FF4A 1YIJA 2BA1A 2WB1G 4BBRH 1SYEA 1WTHA 4B3TL 1O7ZA 3S9WA 1KRSA 4ZRZA 1QWYA 3B6YA 4R4TA 3CCUA 4C3IG 2KHJA 1B4OA 4BY7B 4KHVA 3WOEA 3VR2A 4DR5L 4OWXB 3RN5A 3I8ZA 1E22A 2YTXA 1PH1A 1YBYA 4WFN3 3RR5A 1I4PA 3U4VA 3VA5A 1GUTA 4X64L 5LL6X 4DA2A 3HOWG 1LV9A 5I2YA 2K01A 4LFBL 1STNA 1SSOA 2JSOA 3QR8A 3U9OA 1P8LA 2MPMA 2EYHA 3H0GG 3E0EA 4L5SA 1K8GA 1LT6D 1VQDA 4IFDI 3RUZA 3GTJB 1QE6A 4A3IH 4YY3Q 3BDLA 1JC7A 4Z9CB 4EQPA 1PRTF 3AYHB 4DFAA 4C2MH 4LF9L 4A3GB 2RSOA 4DF7A 1VQPA 4LF8Q 2UXDQ 1CSPA 2NTSA 4OGQC 2ATWA 1I6HB 4YHHL 1VQIA 3SGIA 3MFGA 3FHWA 4RCNA 3F2UA 1SE2A 4LUZA 2F0LA 2JA7B 4X6AH 1ILPA 2K5WA 2JJQA 1NY4A 5D3IB 1XWEA 3CHBD 4F7XA 4CJ1B 4Y7NB 4OXPA 2UXBL 5IT9c 2UUAQ 2VUMH 2EOTA 5ELOA 4X3KA 2RBMA 3GTOH 4UPAA 3GP7A 2L55A 3JAME 5ELDA 3MZ5A 3N52A 1F2MA 1QJOA 4EGVA 4K6LA 1ICWA 1X9NA 1ENAA 2OCEA 5JPMC 4G57A 3TEHB 4FP5D 3I4LA 4KV6A 1X3PA 1S5FD 2RKSA 2K5QA 3ONAB 3WOFA 2R93B 1Y14B 1CUKA 1BBXC 1WYDA 5M5XB 3A56A 4OIJA 4XT1B 3PUWA 1NUCA 1YHAA 2F0WA 4ZUJA 2F3VA 1QB5D 2K14A 3TREA 1EY0A 1K83H 1AE3A 2L4NA 5IYBG 4CDEC 3OOCA 1VQHA 4KY6A 4HSVA 4IUPA 2GVBA 3S17B 2XWJB 2WAQB 1EYAA 2MJ8A 5M3MH 4K0KQ 3LWUA 1IKLA 1B7YB 1S5CD 4P72A 5K5PA 2N88A 4DV2L 5GADC 1HZAA 2PW5A 3E6ZX 1PH8A 4B3RL 2DUDA 1IBKQ 3BG3A 1IYJB 1H9KA 3PO2H 5FLXE 1PZJD 2SEBD 2RDGA 1EIGA 4X62Q 3LGJA 3PUYA 3PV0A 1EY5A 1A3VA 4HMIA 4IOCA 2NVTH 4K6DA 4DR6L 4ILWA 1MJEA 2OQKA 3K5MA 1CZWA 3ULJA 1D7QA 2ZJRA 2B2VA 4WJWA 1VQEA 4DR1Q 3G7LA 4LF4Q 3HOZG 1QNKA 5C4XG 1IW7D 1U4RA 3HS0C 4IUUA 1YNJD 4LUVA 1IBLL 3BVZA 3I72A 1BUVT 2HHHL 4NMZA 1JR0D 4WORA 3G4SA 1EYCA 3S2DH 2B39A 2QW7A 4KJOA 2A19A 1CQVA 2Z8LA 1UE6A 4BA2I 5DAUA 2RVLA 4JI3L 3NTHA 4IPCA 5CORA 5C0XJ 3F2CA 3F8TA 3EN2A 1D8LA 4ZKBB 4CJ2C 4PMBA 2F0EA 2B2WC 3S1MB 2KHIA 4JI6Q 2B63G 1TWAB 1W6KA 2ZXOA 2YU9B 1EQRA 2F3IA 2B8GA 1A62A 1Q7YC 2ENBA 4NB3A 3J81L 4O42A 2N8NA 2UU9Q 1LM0A 4JI0Q 3ER0A 1MGSA 3PUVA 4KN4C 4AH6A 4NXML 5J22A 2V1CC 3NP8A 2ZTDA 1BCPB 4OO1H 2Q8RE 2Z1CA 5IP9H 3H3VI 3GTMH 1M8AA 1YJWA 2A6ED 4GOPA 1F9RA 3VYRA 2F0UA 5EJWA 2R3ZA 5IGGA 3I4MB 1SYDA 3HOUB 3NEMA 3S14H 2G5DA 3G48A 2Q2TA 1HUMA 2F52A 4DK6C 1Y8OB 2O5JC 1PH3A 1L1OA 2Z0SA 2R7ZB 1HNXQ 3CU7A 1BCPC 5KIXA 4DV3L 3EFXD 2QEXA 3JAMi 1BO0A 1PH7A 2IY5B 4BBSH 4L5RC 1VCIA 5JVH3 2MO0A 3OMCA 4AYBB 5KNDA 3BJUA 3PMFA 1XMOQ 1PLFA 4GLVB 2DJFC 1A15A 1SR3A 4HMJA 1K9MC 5I9PA 3S16B 1JQYD 1OXVA 1HRJA 3I91A 2IWHA 1T5EA 5AJ3Q 1I94L 1VS0A 4JI8L 2XN9C 5IP7G 3KLSA 2KQ3A 2D0PA 2PQAB 3O13A 1MSHA 1VQ5A 1LT3D 1E7ZA 4OIKA 4XXEA 2XRSD 2PNHA 2J4XA 4YCWA 3M4QA 5IT9L 4X3TA 3AU7A 2QILA 4HJ9A 3CCLA 4GKKL 1KDAA 3D31A 4LAAA 1J5EQ 4PQXA 2IJ0A 2E2DC 3J80L 3T1YL 1SDFA 4C1NI 3KJOA 4EQOA 4JBJA 2C9OA 4BY7H 4M8AA 1V1PB 1PMRA 3JAML 2E76C 4C3HG 2Z6KA 2BH2A 4X65L 3I4NG 5C3EB 1V1OA 1IHZA 3PGZA 3K8AA 3ITPA 1Q90A 1LTRD 4CGYB 4JI4L 4YWKA 4DAPA 1QVCA 2Y0SB 4BBRB 3DM1A 4HIMA 2PZUA 3A54A 1HR0L 3I2ZA 2JA6H 3PIPA 3EJIA 3D6WA 1MHWC 3PIO3 1LTGD 3MEFA 2Q2UA 4DV1Q 1WJJA 2ID0A 1SAPA 1KC8C 1LACA 1WI5A 3LWEA 2K6AA 5GROA 3TSSA 4JYAQ 1M90C 5IE8A 4A3GH 1QVFA 1N8RC 3HKZB 2I46A 2ALYB 3W1BA 5C4ZA 1NJIC 2DY8A 1XXGA 1G51A 4JI2Q 1CQFA 1D6EC 2F0JA 1Q81C 2JN4A 3EA6A 1STHA 5EKKA 5JJZA 3L2PA 3CCQA 1JE5A 1K8OA 5T1GA 2JA7H 1BXTA 2UUBL 3M7GA 3EQLC 3NQTA 1T5XD 4X3UA 2R92H 4R8NA 5LMNQ 2TMPA 4UP8A 4Q0FA 2RHSB 4K2LA 1LTLA 3CC7A 5A2QE 1DOLA 1I3QB 1CHQD 1A0IA 4DV6Q 1I4GA 5JEAG 2IPKD 1B3AA 1U5KA 3SVMA 4XYQA 1RCVD 2KUMA 4CBVA 4HIDA 3G6JB 3DM3A 1PVOA 1XNRQ 3FKIG 1XNQQ 3KF8B 3M3YB 2R93H 1HZ9A 2F0NA 1QVGA 4XTCS 4DU9A 2VUMB 3KDFA 2OEOA 5J39A 5FO7B 3UDIA 3HFZB 4QF4A 2VB3X 3GTOB 1Q46A 3CC4A 3NBIA 3M4YA 3MAQA 2XGTA 5FLMG 1WD1A 3NSWA 1EIHA 1M1KC 4OWTB 1SMYC 4IJLA 4FF3A 1UNSA 2EIFA 3U4ZA 4YCVA 3S17H 4FVMA 1KTKA 1K28A 4A3FG 1WTVA 3I3CA 1WTPA 1E2ZA 5CYUA 1JICA 3J81j 2B2TA 4KMUC 5DLQE 3PCOB 3U50C 2OT2A 1SROA 1F2ZA 1RIPA 1VQOA 4OELB 1RL2A 1TWHH 2EQSA 3V05A 4A93G 3BDCA 2HCIA 4B08A 3RN2A 3CCEA 2HDLA 4LFAQ 1PZKD 2M9VA 1KAWA 1Y1VH 1H9MA 1STBA 4DUYL 5M3MB 4IFDJ 1NSNS 3RD4A 4EQ5A 3ZYYX 5LL6S 2VQEL 1PTOF 4LFCQ 4NP5A 3QOLA 3OTOQ 1C8CA 5DEHA 4A3MG 3I73A 4A3KH 1EYGA 3URYA 3K81C 1K3RA 2NN6G 4DR2Q 2XWBB 1KRTA 5E7NA 2BCOA 5ELBA 4JI5Q 3EROA 2FXQA 2SNSA 2K5NA 5JJLA 4GKJQ 3T16A 2OWOA 3VYTA 3FDTA 4JPBW 4QIWE 1Q1EA 2F0PA 5C4HA 1F9QA 4K8IA 4PNYA 1B70B 5IGCA 4DAYB 5JVG3 3W2DA 1TWAH 2L9HA 3VA7A 1H9SA 1JOQA 2K1BA 4DR7L 4DXFA 4J6HA 5CV9A 3C1FA 3D8GA 3OW2A 4KKTA 4RGTA 1EFID 1FD7D 5CV8A 4DUZL 4G7HC 1CFMA 3E0JA 1BDOA 2VQFQ 4OX9L 2R7FA 1PDQA 4I7AA 4BY1G 3CAMA 4C3JB 1JT8A 1IBMQ 4PV1C 1S72A 2Q8TA 5LMUL 1BBUA 3I55A 3L7ZC 3K0YA 4B9XA 1KNEA 2A6EC 1PRTB 4Y52H 3I4MH 3UDFA 1Q8KA 1JB7A 4TQUS 3GTLB 5M3FB 4JK1C 5EPKA 1G6ZA 2J0TD 2R7ZH 1I4XA 4UY8C 1JB3A 1KDBA 3GTQH 2DNCA 1J6QA 2F4IA 2JA5G 3QJYA 1S5DD 4JI7L 1VQCA 4DV4Q 5CC4A 1GKHA 5IOCA 1PRTC 4JI0L 4A75A 1HNZQ 3S14B 2N55A 1X3QA 3J7ZC 2G9DA 3S16H 1PYSB 2K75A 2B3GA 2QEJC 5IYDH 4IPHA 1CKNA 1TU2B 1GM5A 3T51B 3SE0A 2KOLA 2VL6A 4IO9A 1DCZA 1GUSA 1UWVA 4A3BG 2B2UC 3TP6A 3AMUA 3NBHA 4PZ8A 1S4ZA 4DV5L 3FP9A 4MTKA 3K7AH 3OWFA 3HRZC 1U0LA 2F0IA 2RQXA 1NR2A 2CHBD 3CRKC 2K5DA 1VQGA 2K28A 1P16A 3J81E 2CQOA 2DN8A 3E3XA 1TIID 4MTNA 4RGOS 4IPGA 3C2PA 1V8QA 2I5LX 2M00A 3F2BA 5C3EH 1B3QA 5ELNA 2VNUD 3HOXH 1Y8NB 1JJCB 1YEZA 4J1MA 5IWAL 1PFSA 2K04A 1LLRD 4NPSA 4R4OA 3S1RB 2D2CC 5E4XA 2VW9A 2QA4A 3GTGB 2L15A 4DR4Q 1AEXA 1ZEQX 4RHRA 3L9AX 2IL8A 4JC0A 4A3IG 2Z9HA 3K7UC 4DR3Q 5TSSA 3OSOA 1WTRA 2L11A 2NVQB 1J5EL 5BN5A 3HEJA 4CDDC 1TVXA 2EVBA 2TSSA 4B3SQ 2JA6B 3NK9A 1R4PB 1O78A 1S3OA 5ELEA 2QDLA 4LF6Q 3M85A 3EVQA 5NUCA 4NXNL 1VQ7A 3V2TA 3H3VC 4MNOA 4ZKCB 2R61A 1VQAA 2RCFA 1EQTA 1I3QH 3SXHA 3GTKB 1OXUA 3K6OA 3SK6A 1LO5D 3T1HQ 2JEAI 5D65A 2ZM6Q 3KLRA 1TWGB 4GLAC 3CP0A 4JI1Q 1A3UA 4AQYL 2O4XA 5IT9E 5D14A 5ISRA 1HHVA 2DGYA 2IX0A 1YITA 3M3YH 2R92B 2R7DA 2N78A 2LXKA 4YIJA 3J80E 1CKOA 4HN7A 2CW0C 3RLNA 5KRUA 5FJ8G 1JJGA 2SOBA 1UEBA 3Q8DA 5KEEA 2A1AA 4RKLA 4XQJA 2JQOA 4P75A 2E2IH 1SNDA 1B1ZA 5JJKA 5IIFA 3I70A 1XMQQ 2RSNA 1QZHA 1TWCB 2WIIB 4QMGA 3LNNA 3ICEA 3HOVB 1SYFA 5EPJA 3MVVA 4DK0A 4A3EB 2MQHA 2CKZB 1VDZA 2F0TA 3PF5A 2HDMA 1HCZA 4XT3B 4WRDA 2EY6A 1KQSA 3M4PA 1SYCA 1FJGL 4RCOA 1Y8PB 1X3FA 1Y1WB 5CV4A 2CWAA 2AWOA 5I6WA 2L1BA 3M9BA 1SMYD 3GD7A 4I7ZC 1XNRL 5T1IA 3PO3G 4DAMA 3PO2G 2B29A 4P73A 4A3DB 1W6JA 2V4DA 1BKBA 1WTQA 2A8VA 3DWQA 3K5LA 1W2BA 2WAQE 2KEEA 2JEBI 2EY2A 3FPPA 2OF1A 2KCMA 4O1NA 4IFDH 2E5LL 1QOHA 2N3SA 4GNXC 4C1NK 1NTGA 3KF6A 1R9TB 1JJ2A 2K7VA 2ICEC 3P20A 1QILA 2F0FA 4QUFA 2D9UA 1AZPA 1RD9D 1TWHB 2D62A 1C9OA 1SNQA 4RG1A 2AUJD 3PSIA 1YVCA 2JA8B 1D1KA 4HCEA 5BR8L 3Q24A 2A69D 4JV5Q 1Y1VB 3R93A 3CPWA 4QCLA 5CMDA 3AFPA 4X66Q 2HIVA 3TS2A 1NNXA 3J81i 3F1ZA 5J1ZA 4FXKC 2BOSA 1WCMG 1RTOA 3FPUB 1EWIA 5IYBH 4A3KB 4LWCA 2O5IC 4WJ3M 2E2JB 3HKSA 1N32Q 4A76A 2RDHA 1TWFB 1MKHA 3BU2A 1LT5D 5FLXc 1H95A 1L2FA 5IGFA 1TKWB 2A6HC 1NE3A 1HQRD 3KLWA 5CBAE 1I6VC 3LX0A 4R8IA 4XDXA 4PZ6A 1G2TA 3TP5A 5FO9B 1E2WA 3KBGA 2JP1A 1PYWD 4LK1C 5CV6A 4OONA 1YHQA 2NBFA 4OO1G 3A5ZB 4IQZA 1CKMA 4C3JH 2H1EA 3TDQA 4B3ML 2NZOA 2B2YA 1UE1A 1EL0A 1DM0B 1CA5A 4KHPL 2NVXH 2ZJQA 1MBYA 2KHSA 4A3LG 4EX5A 3F2DA 1L0YB 4PG3A 1LUZA 3EBEA 1UE7A 4FYDA 4XIGS 2L12A 3HOZH 1V1QA 3D4RA 1D2BA 5E3FA 4JBKA 1ZXTA 3GTLH 5M3FH 1VQ6A 2WACA 5G3LF 2CFMA 5K36H 5FK9C 1Q86C 4BBSG 4DV7L 2PMZB 3VR3A 2I5HA 1TQOA 4DV0L 1YNND 1F77A 3W3AA 2UUCQ 3PIOA 1LTAD 1HXYD 5EQ0A 2K5VA 2MO1A 4KK7A 1HNWL 1JE4A 1CK1A 4JOIA 2KBNA 3J80i 4HJ5A 3NHHA 2M2LA 4LF5Q 4CHTB 5JAVA 3GTQB 4O2DA 4RFBA 4AYBE 1AN8A 1PRTD 1EWHA 3N6RA 1VQMA 4X3SA 1E3PA 1TXYA 4A3JB 4QB4A 1C7YA 4RWSC 1N34L 3S2HB 3G71A 3K58A 4POFA 4BY7G 2NVYB 1EYDA 1RTNA 1KLUD 2PQEA 3MHBA 4H7BA 2WV6D 3MC0B 2EYFA 3NWTA 4KD4A 3M4OH 4KJNA 2EY1A 1KHIA 2K05A 4HJAA 2JA9A 2UXCL 3Q6SA 1SFOB 1AW7A 2F4VQ 3SK5A 5EKIA 3DWPA 3K7AB 5IYCG 4QJFA 3S1RH 2K4KA 4B3TQ 2K33A 1N33L 1TT2A 4KLKA 3GTGH 1EY4A 1EY8A 2IW3A 1LYLA 3MXUA 1ESRA 1W3SA 4RGMA 1MD2D 1EU4A 5M5WB 3NTKA 3H3VH 4DR5Q 1I4HA 3H94A 4JBWA 1DONA 1VQ4A 4A3GG 3FEWX 3MXNA 2NVQH 4IUVA 2Y0SE 1TY2A 3HOXB 1DGSA 3HOYB 2K50A 5JPNC 1IZ6A 1HTLD 3T53B 1WTOA 1PTOB 4X64Q 1FYCA 4TRDA 3EIVA 5C5LA 5CV7A 4JG2A 2JA7G 2YYZA 4A3CH 4LFBQ 5I2XA 4QL5A 1VQNA 3OIQA 1TY0A 3HKZE 1LTBD 3GTKH 3K5OA
chains in the Genus database with same CATH topology
1PTOC 3Q23A 2EE1A 4NW2A 1PZID 4CJ0B 5CGKA 4K5XA 4MN3A 2PZTA 1CM9A 2B2VC 3A8IE 2HCCA 2CVRA 4ZK9B 4C56C 4H13C 3QB3A 5C4JB 2WB1B 3SDZA 2EPBA 2KECA 3NQIA 1TS2A 2WP8J 1RF2D 4C3IB 1DOMA 1A2UA 2CQAA 3R8BA 2CW0D 2HQEA 4H44C 4ZYSA 1TR5A 1JOKA 3D4DA 2E2IB 3TZUA 1ZYRD 4DN4M 2F0MA 3H0GB 4RHSA 1A3TA 1LTTD 1GUWA 1PFBA 3K59A 3A7AB 5F2DA 3SR1A 5JEAH 1XX8A 5D3DA 2EYLA 4FF1A 1H9RA 1BNZA 2NN6I 5G3LD 3Q22A 2NWGA 1SEBD 1SJHD 1E2VA 2RA4A 2A69C 3ERQA 2AWNA 2PYKA 3S1QB 3IL8A 5C0XG 1NAPA 2BA0A 1UUPA 1K8MA 1FNWA 1Q1BA 1HFNA 3CRLC 3PUZA 2XIWA 2L5TA 3P1HA 4S3SA 3TN2A 1QCBD 1Q12A 1Q8IA 2I07B 2EY5A 5KYLA 1CI3M 2MGSA 4RA8A 1STYA 2F0OA 2A6HD 4ODGA 3IAYA 4PMCA 1Z47A 5FOBB 2NUCA 2PPBC 1IYVA 3OWEB 1U9RA 3T56B 3R3OA 1KAAA 1HA5A 1B9MA 1ILQA 2LY7A 2FINB 3KUPA 3T4AC 1YNNC 1SNOA 2L0CA 5BN4A 4IUTA 3HZXA 2NVXB 5EGTA 1LTID 1B2TA 3HOZB 5C4XB 2IX1A 5C3XA 2A68D 4RKBA 3A8JE 3AB9A 4KN7C 4F87A 1D1IA 4XYOA 5M9OA 3DEPA 3K57A 1OXTA 1FNVA 4P2CB 1I4RA 1GXDC 4FXDA 4J8QA 1CZGA 3C46A 2B63B 1B50A 1CHPD 1SE3A 3GTPB 5AFWA 2MUYA 2JE6I 2K32A 1DD2A 2EDGA 1Z6HA 1Q3LA 1KDCA 1FGBD 5E4WC 1II3A 3SK8A 1SE4A 3MXGA 1O7LA 3M4OB 1VF7A 1NR4A 3NE5B 3SK4A 1ZKOA 3E5SA 5I9OA 1PTOH 4HCSA 4PMWA 4TKOB 1ML0D 2AQ1B 2B2TC 1S5BD 5EBCA 1X32A 2EJMA 2F0KA 2WKCA 3MTSA 1IYUA 2B2WA 3K5NA 1KABA 1ET9A 4DNRB 2Z4IA 2E75C 1F9SA 2X6LA 3QIAA 3GV3A 1C4QA 2NTTA 1I4QA 1A6XA 1JWSD 2D5DA 1HUNA 3P75A 1XTCD 2SNMA 1SYGA 3MWYW 4HTHA 2QF7A 1PTOD 1R4QB 1I50B 4G4KA 3OW7A 3RLFA 1H9SB 5CR3A 2J7ZA 4L8JA 2AQ3B 4C3HB 4RAUC 1B44D 5IODA 3I4NB 4DAVA 1AP0A 4U68A 1IL8A 1TS3A 2C5CA 2IT1A 1STAA 3DMUA 4IURA 3I90A 1PXUA 5I4DA 1SNCA 1ZYRC 2OXPA 1ENCA 1VMPA 1U4LA 3CKIB 4IFDG 2KJXA 3TZDA 1GUNA 4N9PA 5DNFA 2EYOA 1KLGD 3D4WA 3A8KE 2BE5C 1WVLA 1MI2A 4ZQ3A 1RDPD 5IGBA 3DUZA 3U9SA 2E74C 1UAPA 1EZ6A 4U673 1B53A 3MFYA 3OPOA 2PNRC 1EZ8A 1CT1D 1HA6A 5JEAJ 4RH6A 2LMCB 4HEDA 3R2IA 2KEDA 4FF2A 3H09A 5C6AA 3FKIB 2DNEA 4K5VA 4BS9A 4EQNA 1UEAB 4BWGB 1SYBA 2Q8IB 1V1PA 4KY5A 3RZDB 2LS01 1MSGA 1DYQA 5A35A 3S15B 4ULLA 3BDOA 4OO1I 3NTIA 4C3JG 3NWSA 2VXWA 1STEA 3MXPA 4DGZA 2F1MA 4H0LC 4FXGC 4A3FB 5M5YB 1IKMA 1RJTA 3X3MA 1GOZA 1ENFA 2A74C 1O80A 2H4OA 2JXMB 1V43A 2AQ2B 2F03A 2LFNA 4A93B 1QNUA 5IGDA 5K36G 2QDBA 1M4VA 2EZVA 1FNUA 5FO8B 2HUGA 1EY7A 2LKVA 2A73B 2G9HD 1JOOA 4V190 3OMGA 4EVOA 5I6YA 1CTMA 1SBBB 4A3MB 4F8MA 3KK7A 2KCCA 2AUKA 2K03A 4BA1I 5C44B 2A68C 3J7AF 4QUCA 3Q0AA 2IX3A 2O2LD 3OHXC 1EWCA 3KF8A 1SNMA 5JOBA 1HTPA 4OL7A 2WINB 3CQZB 2X6GA 2EXZA 3IFDA 1HPCA 1SJED 4HSPA 1DJRD 3RMHA 4MHEA 1LABA 3BVMA 3H6MA 5HGTA 3IKJA 5DM73 1G2SA 1JWUD 1NCVA 2PZWA 1CA6A 3KBXA 4E6IA 1KNAA 2NZ1D 4CKEA 3D3RA 4BY1B 3BZDB 1OXSC 3KLSX 1EOTA 3OIPA 1E0BA 3QO2A 3J7YW 2XRQD 1DZ1A 1C48A 4KKUA 3C1EA 4B9WA 3HP3A 1EEID 3FVQA 5KNBA 3QWNA 4IUNA 3TBIB 4L6TB 3QG1A 2ICIA 2JA5B 1VF5C 1OXXK 1U4MA 4HR7B 4NKLA 1J9OA 3DHQA 4G7OC 1HQMC 3DWAA 1BQQT 2BDOA 3QOJA 2F0HA 1D5MC 2FJ2A 4ME5A 1JCKB 5EKLA 1F9PA 4A3BB 2FMMA 3H91A 3VYUA 3TP8A 4CKBA 1S5ED 2FFKB 4DAYA 2FHTA 3GV6A 1U4PA 2FMCA 4M1UB 1QG7A 1STGA 2SDFA 3NXWA 5CV5A 2WKDA 4ZAIA 1H9JA 1J8IA 4KY7A 3TMEA 3TP7A 3D6CA 3VYSA 3IFTA 1F2YA 2XSCA 5FKAC 2E2HB 2GA4B 2ZXPA 5E1FA 1BCPF 2XVSA 1OO9B 2A5HA 3S1NB 1G91A 2EJFC 1PFMA 4HAEA 5KYIA 2PW7A 2NYZD 4A3IB 4KKSA 3FMCA 1LT4D 5HURA 1ESFA 4F88A 4C2MB 2F0VA 5FLXL 3A55A 5EBDA 2X69A 3V96A 5COYA 4KD3A 2B2UA 1BF4A 1G8ZD 2RDFA 2B2YC 3HOWB 4UDUC 2EYMA 4K5WA 3T13A 1DXMA 4KHZA 2KCNA 1D5ZC 1VMCA 3C3LA 2KA7A 4LJZC 3BVGA 4ZLTF 5DM63 3PUXA 1JORA 5EPLA 2BE5D 5C0XI 3BYTB 1EQVA 1L0XB 5ELCA 1AFPA 4GZYC 1EY9A 4ABNA 3PIP3 4LMQD 3X3NA 5BN3A 5C3WA 1D5XC 5IGEA 1F2LA 4TSSA 4KI0A 1K83B 3NUCA 2MP1A 2F0DA 2NB0A 3J7AV 1GHKA 3DEOA 1XYIA 1GUOA 3SEBA 4CKCA 4IN3A 1RKNA 4XQNA 4IZ8A 4ZUIA 4I65A 3GO5A 5ELFA 4KTAA 4FO2A 3PO3B 2PCFB 5C5MA 3PO2B 1IW7C 4V0BA 1YNJC 5LHY1 4RGNA 2ZXRA 3FRPB 3VR6A 1JWMD 1ONLA 2NVTB 1TS4A 1O7YA 4K8JA 3ND9A 1GUGA 5C0XH 3VR5A 1SNPA 4QIWB 2F0GA 4G7ZC 2NN6H 3HGBA 4L63B 1A2TA 1TS5A 1B9NA 2MHVA 1WD0A 3SHLA 1Z7TA 2JYOA 2Z4HA 1LTSD 3S2DB 2R6GA 1EY6A 4K14A 3P7JA 1WCMB 3R2TA 1BOSA 3MA2B 3ND8A 4K2KA 1EU3A 4IALA 4OHJA 3NPPA 1ET6A 4IUQA 3UI2A 1RODA 2XNAC 3M7NA 2EYJA 4MIUA 3WDNA 4DK1A 4Q5VA 3VR4A 5KGUA 2EYPA 2DY7A 3HG9A 5KNCA 1SXTA 2VB2X 2EJGC 1BR9A 4DNTB 3GTMB 1Y69U 2KVMA 2F3WA 3A7LA 1PFNA 2PO4A 3GQBA 4XQQA 1GJXA 2QCPX 3MEHA 1FR3A 2F0SA 3BS1A 1BCPD 1EEFD 1AZQA 3RZOB 4NDXA 2ZT9C 1WTXA 4R9WA 4BBSB 3L3OC 1WTWA 4DXGA 3DXJC 4FNFA 4UAIA 1RHPA 2B8FA 2F0QA 4N9TA 1GHJA 5A2QL 3BYYB 5CBEE 2BDNA 1G291 1HFGA 2QKIC 1DOKA 4ID6A 4FF4A 2BA1A 1SYEA 1O7ZA 3S9WA 4ZRZA 1QWYA 4C3IG 1B4OA 4BY7B 4KHVA 3WOEA 3VR2A 3I8ZA 4WFN3 1I4PA 3VA5A 1GUTA 5LL6X 4DA2A 1LV9A 5I2YA 2K01A 1STNA 1SSOA 2JSOA 3U9OA 2MPMA 2EYHA 1LT6D 4IFDI 3RUZA 3GTJB 1QE6A 3BDLA 1JC7A 4Z9CB 4EQPA 1PRTF 4DFAA 4A3GB 2RSOA 4DF7A 2NTSA 4OGQC 1I6HB 3MFGA 4RCNA 3F2UA 1SE2A 2F0LA 2JA7B 1ILPA 2K5WA 5D3IB 1XWEA 3CHBD 4F7XA 4CJ1B 4Y7NB 2EOTA 4X3KA 2RBMA 3GP7A 2L55A 3JAME 5ELDA 3MZ5A 3N52A 1F2MA 1QJOA 4EGVA 4K6LA 1ICWA 1ENAA 5JPMC 4G57A 4FP5D 3I4LA 4KV6A 1X3PA 1S5FD 2RKSA 2K5QA 3ONAB 3WOFA 2R93B 1BBXC 5M5XB 3A56A 4OIJA 4XT1B 3PUWA 1NUCA 2F0WA 4ZUJA 2F3VA 1QB5D 1EY0A 2L4NA 3OOCA 4KY6A 4HSVA 4IUPA 3S17B 2XWJB 2WAQB 1EYAA 2MJ8A 3LWUA 1IKLA 1S5CD 5K5PA 2N88A 2PW5A 3E6ZX 3BG3A 1H9KA 5FLXE 1PZJD 2SEBD 2RDGA 1EIGA 3PUYA 3PV0A 1EY5A 1A3VA 4HMIA 4K6DA 4ILWA 3K5MA 1CZWA 2B2VA 4WJWA 3G7LA 1QNKA 1IW7D 1U4RA 3HS0C 4IUUA 1YNJD 3BVZA 3I72A 1BUVT 4NMZA 1JR0D 4WORA 1EYCA 2B39A 4KJOA 1CQVA 2Z8LA 4BA2I 5DAUA 2RVLA 3NTHA 5CORA 5C0XJ 4ZKBB 4CJ2C 4PMBA 2F0EA 2B2WC 3S1MB 1TWAB 1W6KA 2ZXOA 2YU9B 2B8GA 2ENBA 3J81L 4O42A 1MGSA 3PUVA 4KN4C 5J22A 3NP8A 1BCPB 4OO1H 2Q8RE 2Z1CA 1M8AA 2A6ED 1F9RA 3VYRA 2F0UA 5EJWA 2R3ZA 5IGGA 3I4MB 1SYDA 3HOUB 1HUMA 1Y8OB 2O5JC 2R7ZB 3CU7A 1BCPC 5KIXA 3EFXD 1BO0A 1VCIA 5JVH3 3OMCA 4AYBB 5KNDA 3PMFA 1PLFA 1A15A 4HMJA 5I9PA 3S16B 1JQYD 1OXVA 1HRJA 3I91A 2IWHA 1T5EA 2XN9C 3KLSA 2KQ3A 3O13A 1MSHA 1LT3D 4OIKA 4XXEA 2XRSD 2J4XA 5IT9L 4X3TA 3AU7A 2QILA 1KDAA 3D31A 4LAAA 4PQXA 2IJ0A 2E2DC 3J80L 1SDFA 4C1NI 4EQOA 2C9OA 4M8AA 1V1PB 1PMRA 3JAML 2E76C 4C3HG 5C3EB 1V1OA 1IHZA 3ITPA 1Q90A 1LTRD 4CGYB 4DAPA 4BBRB 2Y0SB 3DM1A 2PZUA 3A54A 3EJIA 3D6WA 3PIO3 1LTGD 2ID0A 1SAPA 1LACA 3LWEA 2K6AA 3TSSA 3HKZB 2I46A 5C4ZA 2DY8A 1XXGA 1CQFA 1D6EC 2F0JA 3EA6A 1STHA 5EKKA 5JJZA 1K8OA 5T1GA 1BXTA 3M7GA 3EQLC 3NQTA 1T5XD 4X3UA 4R8NA 2TMPA 4Q0FA 4K2LA 5A2QE 1DOLA 1I3QB 1CHQD 1I4GA 5JEAG 2IPKD 1B3AA 3SVMA 4XYQA 1RCVD 2KUMA 4CBVA 3G6JB 3M3YB 2F0NA 4XTCS 4DU9A 2VUMB 2OEOA 5J39A 5FO7B 4QF4A 2VB3X 3GTOB 3NBIA 3M4YA 3MAQA 1WD1A 3NSWA 1EIHA 1SMYC 4FF3A 1UNSA 4FVMA 1KTKA 1WTVA 3I3CA 1WTPA 1E2ZA 5CYUA 1JICA 2B2TA 4KMUC 2OT2A 1F2ZA 3V05A 3BDCA 2HCIA 4B08A 2HDLA 1PZKD 2M9VA 1H9MA 1STBA 5M3MB 4IFDJ 1NSNS 3RD4A 3ZYYX 5LL6S 1PTOF 4NP5A 3QOLA 1C8CA 5DEHA 3I73A 3URYA 2NN6G 2XWBB 2BCOA 5ELBA 3EROA 2SNSA 3T16A 3VYTA 3FDTA 1Q1EA 2F0PA 5C4HA 1F9QA 4K8IA 4PNYA 5IGCA 5JVG3 3W2DA 2L9HA 3VA7A 1H9SA 1JOQA 2K1BA 4DXFA 4J6HA 5CV9A 3C1FA 3D8GA 4KKTA 4RGTA 1EFID 1FD7D 5CV8A 4G7HC 1CFMA 3E0JA 1BDOA 1PDQA 4C3JB 4PV1C 2Q8TA 3L7ZC 3K0YA 4B9XA 1KNEA 2A6EC 1PRTB 4TQUS 3GTLB 5M3FB 4JK1C 5EPKA 1G6ZA 2J0TD 1I4XA 1JB3A 1KDBA 2DNCA 2F4IA 3QJYA 1S5DD 5CC4A 5IOCA 1PRTC 3S14B 2N55A 1X3QA 2G9DA 2QEJC 1TU2B 3T51B 3SE0A 2KOLA 1DCZA 1GUSA 2B2UC 3TP6A 3AMUA 3NBHA 1S4ZA 3OWFA 3HRZC 2F0IA 2RQXA 1NR2A 2CHBD 3CRKC 2K5DA 2K28A 3J81E 2DN8A 1TIID 4RGOS 3C2PA 1V8QA 2M00A 2VNUD 1Y8NB 4J1MA 2K04A 1LLRD 3S1RB 2D2CC 5E4XA 3GTGB 1AEXA 1ZEQX 4RHRA 3L9AX 2IL8A 5TSSA 3OSOA 1WTRA 2L11A 2NVQB 5BN5A 3HEJA 1TVXA 2EVBA 2TSSA 2JA6B 3NK9A 1R4PB 1O78A 5ELEA 3M85A 3EVQA 5NUCA 3V2TA 3H3VC 4ZKCB 2R61A 1EQTA 3SXHA 3GTKB 1OXUA 3K6OA 3SK6A 1LO5D 2JEAI 5D65A 3KLRA 1TWGB 1A3UA 2O4XA 5IT9E 5D14A 5ISRA 1HHVA 2IX0A 2R92B 4YIJA 3J80E 4HN7A 2CW0C 5KRUA 2SOBA 5KEEA 4RKLA 4XQJA 1SNDA 1B1ZA 5IIFA 3I70A 2RSNA 1TWCB 2WIIB 4QMGA 3LNNA 3HOVB 1SYFA 5EPJA 3MVVA 4DK0A 4A3EB 1VDZA 2F0TA 2HDMA 1HCZA 4XT3B 4WRDA 2EY6A 1SYCA 4RCOA 1Y8PB 1Y1WB 5CV4A 2AWOA 5I6WA 2L1BA 1SMYD 3GD7A 4I7ZC 5T1IA 4A3DB 1W6JA 2V4DA 1WTQA 3DWQA 3K5LA 2KEEA 2JEBI 2EY2A 3FPPA 2OF1A 4O1NA 4IFDH 1QOHA 4C1NK 1R9TB 2K7VA 2ICEC 3P20A 1QILA 2F0FA 4QUFA 2D9UA 1AZPA 1RD9D 1TWHB 2D62A 1SNQA 2AUJD 2JA8B 1D1KA 4HCEA 3Q24A 2A69D 1Y1VB 3R93A 4QCLA 5CMDA 5J1ZA 4FXKC 2BOSA 1RTOA 3FPUB 4A3KB 2O5IC 2E2JB 2RDHA 1TWFB 1LT5D 5IGFA 1TKWB 2A6HC 1HQRD 5CBAE 1I6VC 3LX0A 4R8IA 4XDXA 1G2TA 3TP5A 5FO9B 1E2WA 3KBGA 2JP1A 1PYWD 4LK1C 5CV6A 2NBFA 4OO1G 4IQZA 2H1EA 3TDQA 2B2YA 1EL0A 1DM0B 1CA5A 1MBYA 2KHSA 1L0YB 4FYDA 4XIGS 2L12A 3D4RA 1D2BA 5E3FA 1ZXTA 2WACA 5G3LF 5K36H 5FK9C 2PMZB 3VR3A 1TQOA 1YNND 1F77A 3W3AA 1LTAD 1HXYD 5EQ0A 4KK7A 1JE4A 1CK1A 3NHHA 2M2LA 4CHTB 5JAVA 3GTQB 4RFBA 1AN8A 1PRTD 1EWHA 3N6RA 4X3SA 4A3JB 4QB4A 4RWSC 3S2HB 3K58A 2NVYB 1EYDA 1RTNA 1KLUD 2PQEA 3MHBA 4H7BA 2WV6D 3MC0B 2EYFA 3NWTA 4KD4A 4KJNA 2EY1A 2K05A 3Q6SA 1SFOB 1AW7A 3SK5A 5EKIA 3DWPA 3K7AB 2K33A 1TT2A 1EY4A 1EY8A 2IW3A 3MXUA 1ESRA 4RGMA 1MD2D 1EU4A 5M5WB 3NTKA 1I4HA 3H94A 4JBWA 1DONA 3FEWX 3MXNA 4IUVA 1TY2A 3HOXB 3HOYB 5JPNC 1HTLD 3T53B 1WTOA 1PTOB 1FYCA 4TRDA 5C5LA 5CV7A 2YYZA 5I2XA 3OIQA 1TY0A 1LTBD 3K5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VA5 A;  1SNC A;  3DHQ A;  1TQO A;  1EY7 A;  3PMF A;  2LKV A;  3QOJ A;  2OXP A;  1JOQ A;  1EY9 A;  4J1M A;  1JOO A;  2F0H A;  5CGK A;  1ENC A;  1STN A;  3OMG A;  4EVO A;  2EY2 A;  5I6Y A;  2OF1 A;  4J6H A;  1EY5 A;  4K5X A;  1A3V A;  2EYJ A;  3C1F A;  3D8G A;  2PZT A;  4HMJ A;  4HMI A;  2EYH A;  4K6D A;  4ME5 A;  4MIU A;  5I9P A;  2F0N A;  5CV8 A;  3RUZ A;  5KGU A;  4DU9 A;  1AEX A;  3NHH A;  2EYP A;  2OEO A;  1KDC A;  4N9P A;  5EKL A;  5C3W A;  3P1H A;  4S3S A;  3BDL A;  5J39 A;  4EQP A;  5IGE A;  4DFA A;  1II3 A;  2EYO A;  4QF4 A;  3SK8 A;  4F8M A;  5JAV A;  2KQ3 A;  2EY5 A;  2F0F A;  3QB3 A;  3D4W A;  3TP8 A;  3OSO A;  4DF7 A;  3NUC A;  5KYL A;  1STY A;  3SK4 A;  2F0D A;  1SNQ A;  3HEJ A;  2F3W A;  3E5S A;  5I9O A;  4ZQ3 A;  4NMZ A;  2F0O A;  5IGC A;  4ODG A;  5IGB A;  1KDA A;  4LAA A;  4PMC A;  4B9X A;  2NUC A;  2F0L A;  3NK9 A;  4QB4 A;  1STG A;  4WOR A;  5CV9 A;  1EYC A;  3NXW A;  5CV5 A;  1EZ6 A;  3MEH A;  4EQO A;  1SNM A;  4KJO A;  4F7X A;  5JOB A;  1A2U A;  1U9R A;  2F0S A;  4OL7 A;  3EVQ A;  5J1Z A;  1RKN A;  5DAU A;  4IZ8 A;  4ZUI A;  5NUC A;  2HQE A;  4I65 A;  3V2T A;  4NDX A;  2RBM A;  1EYD A;  2PQE A;  1EZ8 A;  2EXZ A;  2F0K A;  3MHB A;  4H7B A;  4KTA A;  2EYF A;  4KY7 A;  1KDB A;  1F2Z A;  3TME A;  1TR5 A;  1IHZ A;  2F0E A;  3R3O A;  4KD4 A;  3MZ5 A;  4PMB A;  1JOK A;  3SXH A;  3TP7 A;  3ITP A;  2EY1 A;  1F2M A;  4KJN A;  3D4D A;  5C5M A;  3SK6 A;  1ENA A;  3D6C A;  1KAA A;  1KAB A;  3BDC A;  1F2Y A;  4G57 A;  5CC4 A;  3H6M A;  2PZU A;  4KV6 A;  5C6A A;  3SK5 A;  5HGT A;  2F0Q A;  4N9T A;  5E1F A;  5IOC A;  2RKS A;  2F0M A;  5M9O A;  1SNO A;  2ENB A;  5IGF A;  3EJI A;  1STB A;  1A3U A;  4K5V A;  3HZX A;  2O4X A;  1NSN S;  5ISR A;  5EGT A;  3LX0 A;  4EQN A;  2PZW A;  1A3T A;  5KYI A;  1TT2 A;  4E6I A;  4K8J A;  1SYB A;  1EY4 A;  2PW7 A;  1EY8 A;  4YIJ A;  4KY5 A;  5F2D A;  5HUR A;  3TP5 A;  4NP5 A;  3SR1 A;  3QOL A;  5KRU A;  5J22 A;  3P75 A;  2SNM A;  5DEH A;  2F0V A;  1NUC A;  1SNP A;  2SOB A;  3NP8 A;  4RKB A;  2F0W A;  5C3X A;  5KEE A;  1SYG A;  5CV6 A;  2F3V A;  4RKL A;  4ZUJ A;  3U9O A;  2F0G A;  3TP6 A;  4ID6 A;  1EY0 A;  4KD3 A;  1SND A;  2EYL A;  1A2T A;  4HTH A;  2RDF A;  5IIF A;  5C4Z A;  2EYM A;  1SYE A;  3C1E A;  4QMG A;  3SHL A;  2F0J A;  4K5W A;  3MXP A;  2F0U A;  4KY6 A;  1STH A;  5EKK A;  3T13 A;  3OWF A;  5CR3 A;  4B9W A;  1SYF A;  4DGZ A;  3S9W A;  1EY6 A;  4TRD A;  4K14 A;  1EYA A;  5IGG A;  2F0I A;  1SYD A;  5C5L A;  5CV7 A;  3MVV A;  2KHS A;  3NQT A;  3ERQ A;  3ERO A;  4KHV A;  4R8N A;  2F0T A;  2PYK A;  4IUN A;  5IOD A;  2SNS A;  5K5P A;  4K2K A;  4WRD A;  2EY6 A;  5E3F A;  4K2L A;  1SYC A;  1JOR A;  3T16 A;  2WAC A;  5KIX A;  2M00 A;  5CV4 A;  1STA A;  4IAL A;  2F0P A;  5C4H A;  2PW5 A;  3DMU A;  4K8I A;  5I6W A;  4PNY A;  5IGD A;  1EQV A;  2QDB A;  3OMC A;  4NKL A; 
#chains in the Genus database with same CATH topology
 2RF4 A;  1PTO C;  3Q23 A;  2EE1 A;  1E24 A;  4NW2 A;  1PZI D;  1TWG H;  4CJ0 B;  5CGK A;  4LNQ A;  3ULL A;  4YHH Q;  4K5X A;  4MN3 A;  2PZT A;  3CPF A;  1EFW A;  1GVP A;  4UHV A;  2R93 G;  1CM9 A;  2B2V C;  3A8I E;  3I4N H;  2HCC A;  2CVR A;  4ZK9 B;  1VQ9 A;  2UXB Q;  4C56 C;  4H13 C;  3QB3 A;  5C4J B;  2WB1 B;  4QGU A;  3RNU A;  3SDZ A;  1N36 Q;  2EPB A;  2KEC A;  3NQI A;  1TS2 A;  2WP8 J;  1TWC H;  3ZJY C;  3I4O A;  1RF2 D;  4C3I B;  3HOV H;  1PYB A;  1DOM A;  2HD3 A;  4YY3 L;  1A2U A;  2WAQ G;  4A3E H;  2CQA A;  3R8B A;  1AH9 A;  2CW0 D;  2HQE A;  1SN8 A;  4H44 C;  1XPU A;  4LF8 L;  1GO3 E;  4OEM B;  4ZYS A;  2UXD L;  3U58 A;  1TR5 A;  1Y1W H;  1JOK A;  2IHF A;  1B8A A;  4LF9 Q;  1JMC A;  3D4D A;  2E2I B;  3TZU A;  1ZYR D;  4DN4 M;  4GOP B;  4A3D H;  2F0M A;  4BXX H;  1YI2 A;  3H0G B;  2UUA L;  4RHS A;  2VZA A;  3CCJ A;  5EAY A;  1K8A C;  1A3T A;  1LTT D;  1GUW A;  1PFB A;  3K59 A;  3A7A B;  5F2D A;  1L1O B;  1R9T H;  3SR1 A;  1UE5 A;  5JEA H;  4DV2 Q;  1VQL A;  3BZK A;  1XX8 A;  5D3D A;  2EYL A;  2OQ0 A;  4GOP C;  4FF1 A;  1H9R A;  4B3R Q;  1BNZ A;  2JA8 H;  2NN6 I;  5G3L D;  3Q22 A;  2NWG A;  1SEB D;  2H5X A;  1SJH D;  1E2V A;  2RA4 A;  2A69 C;  3ERQ A;  1L1O C;  3A74 A;  2KEN A;  2AWN A;  2PYK A;  3RZD H;  3S1Q B;  4DR6 Q;  3IL8 A;  5C0X G;  1NAP A;  2BA0 A;  4IPD A;  1QUQ A;  1UUP A;  1K8M A;  2E2J H;  1FNW A;  1Q1B A;  1HFN A;  4K0K L;  3CRL C;  1TWF H;  1WFQ A;  3PUZ A;  1IBL Q;  1KD1 C;  4PZ7 A;  2XIW A;  2L5T A;  3P1H A;  4S3S A;  3TN2 A;  1X6O A;  1QCB D;  1Q12 A;  1X3E A;  1Q8I A;  2I07 B;  1IBK L;  2EY5 A;  4JI3 Q;  4A93 H;  5KYL A;  1CI3 M;  2MGS A;  4RA8 A;  3E9I A;  1STY A;  4X62 L;  3KFU A;  5GAH C;  1X56 A;  2F0O A;  2A6H D;  2N49 A;  4ODG A;  4PMC A;  4YWM A;  1Z47 A;  5FOB B;  2NUC A;  1ASZ A;  2PPB C;  3IAY A;  1IYV A;  3OWE B;  1U9R A;  4DPG A;  3I4M G;  4DR1 L;  2Z6K C;  3HOU G;  4LF4 L;  2ZTE A;  2NZH A;  1EUJ A;  3T56 B;  3A0J A;  4A3M H;  1N32 L;  4NXM Q;  3R3O A;  2R7Z G;  1CSQ A;  5C44 H;  1KAA A;  1HA5 A;  1B9M A;  1ILQ A;  4AYB G;  2LY7 A;  1AE2 A;  2FIN B;  3KUP A;  3T4A C;  3CCS A;  1YNN C;  1SNO A;  2L0C A;  3ERS X;  4LW1 A;  5BN4 A;  4HJ8 A;  4IUT A;  3HZX A;  2NVX B;  3KYH C;  5EGT A;  1LTI D;  1B2T A;  2MNA A;  3HOZ B;  3CQZ H;  5IYD G;  5C4X B;  4JI6 L;  2IX1 A;  5C3X A;  2A68 D;  4RKB A;  1VQB A;  3A8J E;  3AB9 A;  4KN7 C;  4DV3 Q;  4F87 A;  4H02 A;  1D1I A;  2UU9 L;  4XYO A;  5M9O A;  3DEP A;  4DK3 C;  3K57 A;  1OXT A;  1FNV A;  4O0A A;  4A3J H;  4P2C B;  1I4R A;  3S2H H;  1GXD C;  4FXD A;  4J8Q A;  3KDF B;  1CZG A;  4BY1 H;  3C46 A;  2NVY H;  2B63 B;  1B50 A;  3DLL A;  1SMX A;  1CHP D;  1SE3 A;  4YCU A;  5C3E G;  4HIK A;  3GTP B;  1KL9 A;  5AFW A;  2MUY A;  1SFO H;  2JE6 I;  2K32 A;  1DD2 A;  2EDG A;  4BBR G;  2Y0S G;  2Q2I A;  1Z6H A;  4L5T A;  1HNX L;  3T1Y Q;  1Q3L A;  4OWW B;  1KDC A;  1FGB D;  3CXC A;  5E4W C;  1II3 A;  3SK8 A;  1PV4 A;  1SE4 A;  5M5W H;  3MXG A;  1T9H A;  1O7L A;  3M4O B;  1VF7 A;  1XMO L;  1N9W A;  1NR4 A;  3NE5 B;  4X65 Q;  3SK4 A;  1ZKO A;  3CC2 A;  3HKZ G;  3HOY H;  3E5S A;  3K0X A;  5I9O A;  1PTO H;  4HCS A;  5AJ3 L;  2AKW B;  4PMW A;  1HR0 Q;  4TKO B;  2XTI A;  1ML0 D;  2AQ1 B;  2PI2 E;  1FL0 A;  2B2T C;  1S5B D;  5EBC A;  1X32 A;  2EJM A;  3J81 c;  4A3B H;  2EXD A;  2F0K A;  2AHO B;  2WKC A;  3NEN A;  3MTS A;  3RLO A;  1IYU A;  2B2W A;  3K5N A;  2JK8 A;  1KAB A;  1ET9 A;  4DNR B;  2Z4I A;  2E75 C;  1F9S A;  2X6L A;  3QIA A;  3GV3 A;  1C4Q A;  2NTT A;  1VQF A;  4UP7 A;  1I4Q A;  1A6X A;  2UUB Q;  1JWS D;  2D5D A;  1HUN A;  2VUM G;  3P75 A;  5H1S E;  1XTC D;  2SNM A;  2GVA A;  4GN4 B;  1SYG A;  3MWY W;  5C4J H;  1E1O A;  4HTH A;  2QF7 A;  1PTO D;  1R4Q B;  2K52 A;  2VY3 A;  1I50 B;  4G4K A;  3OW7 A;  3RLF A;  2E2H H;  1H9S B;  5CR3 A;  2GN5 A;  4DV1 L;  3AEV A;  2J7Z A;  4C3I H;  3S1N H;  4L8J A;  2AQ3 B;  4C3H B;  4RAU C;  1B44 D;  4JYA L;  5IOD A;  1HR0 W;  3I4N B;  4DAV A;  1AP0 A;  4U68 A;  1IL8 A;  1TS3 A;  2C5C A;  2IT1 A;  1STA A;  3DMU A;  4IUR A;  3I90 A;  4UP9 A;  4JI2 L;  1PXU A;  5I4D A;  5IY0 A;  1SNC A;  3HOW H;  1ZYR C;  2OXP A;  1XPO A;  1ENC A;  2CCZ A;  2RCN A;  1VMP A;  3H0G H;  3K80 C;  1EIF A;  5LMN L;  1U4L A;  3CKI B;  4GN3 B;  4CDC C;  4IFD G;  2KJX A;  3TZD A;  5M3M G;  3WWV A;  1GUN A;  4N9P A;  5DNF A;  4GNX B;  3J80 c;  2EYO A;  4DV6 L;  1KLG D;  3CME A;  3D4W A;  4N8X 1;  1N36 L;  2LXJ A;  3A8K E;  4FDB A;  2BE5 C;  4JBM A;  3CD6 A;  3JAM c;  4GS3 A;  1WOC A;  1WVL A;  1MI2 A;  3I7F A;  4ZQ3 A;  1RDP D;  5IGB A;  3DUZ A;  1XNQ L;  3U9S A;  2E74 C;  1UAP A;  4LF7 Q;  1EZ6 A;  4U67 3;  4HIO A;  1B53 A;  4DUY Q;  1NBW A;  5FJ8 H;  3MFY A;  3TS0 A;  1VQK A;  1A8V A;  4AIM A;  2OTJ A;  3S1Q H;  1CKN B;  3OPO A;  2PNR C;  1EZ8 A;  1CT1 D;  2VQE Q;  1HA6 A;  2PQA A;  5JEA J;  4RH6 A;  1PH9 A;  2LMC B;  3NBH B;  1NMF A;  4HED A;  3R2I A;  2KED A;  4FF2 A;  3H09 A;  5C6A A;  1MJC A;  3FKI B;  3KJP A;  2DNE A;  4K5V A;  4BS9 A;  4EQN A;  5GQO A;  1UEA B;  4BWG B;  1FGU A;  1SYB A;  2Q8I B;  1V1P A;  4KY5 A;  3RZD B;  2LS0 1;  4N8F A;  1MSG A;  4LFA L;  3PO3 H;  1DYQ A;  5A35 A;  3S15 B;  4ULL A;  3BDO A;  4OO1 I;  3NTI A;  4C3J G;  4LUO A;  3NWS A;  2VXW A;  1STE A;  3MXP A;  4DGZ A;  2F1M A;  4H0L C;  4FXG C;  4A3F B;  5M5Y B;  1IKM A;  1RJT A;  4ME3 A;  4LFC L;  3X3M A;  3OTO L;  4GN5 A;  4DR7 Q;  1GOZ A;  1ENF A;  2A74 C;  4DUZ Q;  1O80 A;  2H4O A;  2JXM B;  1V43 A;  2AQ2 B;  2F03 A;  2LFN A;  5M3F G;  4OX9 Q;  4A93 B;  1QNU A;  5IGD A;  4DR2 L;  5K36 G;  2QDB A;  1M4V A;  2EZV A;  1FNU A;  5FO8 B;  5IP9 G;  2HUG A;  1EY7 A;  2LKV A;  5HY6 A;  1PH5 A;  2A73 B;  2G9H D;  1JOO A;  4JI5 L;  4V19 0;  4J15 A;  3OMG A;  4EVO A;  5I6Y A;  5LMU Q;  4GKJ L;  1WCM H;  2HT1 A;  1CTM A;  1SBB B;  3BZC A;  4A3M B;  1QZG A;  4F8M A;  5C4X H;  3AFQ A;  3KK7 A;  2D0O A;  1EQQ A;  2KCC A;  3J7A 5;  2AUK A;  2K03 A;  4BA1 I;  5C44 B;  2A68 C;  2PMZ E;  3W1G A;  3J7A F;  1EIY B;  4QUC A;  3I56 A;  3Q0A A;  2IX3 A;  2O2L D;  3OHX C;  4JI7 Q;  1EWC A;  3STB D;  2Z6B A;  3KF8 A;  2VQF L;  1SNM A;  5JOB A;  1HTP A;  3E9H A;  1Q82 C;  4OL7 A;  3PF4 A;  2WIN B;  1K0R A;  3CQZ B;  4P71 A;  2X6G A;  5L37 A;  2EXZ A;  3IFD A;  2B63 H;  4TVA B;  1IBM L;  1HPC A;  1SJE D;  4HSP A;  2MFI A;  1DJR D;  3GTP H;  3RMH A;  4MHE A;  3AQQ A;  1LAB A;  3BVM A;  3H6M A;  5HGT A;  3IKJ A;  5DM7 3;  4R4I A;  1G2S A;  4DV5 Q;  1JWU D;  1PH4 A;  1SRU A;  4A3L H;  4JVZ A;  1NCV A;  2PZW A;  4QQB X;  1CA6 A;  3UE0 A;  3KBX A;  4E6I A;  4GLX A;  1KNA A;  2NZ1 D;  4CKE A;  3D3R A;  1X54 A;  3RZO H;  4BY1 B;  1MIU A;  1OXS C;  3BZD B;  3KLS X;  1XJV A;  1EOT A;  1YJN A;  3OIP A;  1E0B A;  2HQL A;  4DV4 L;  3QO2 A;  1KIX A;  3J7Y W;  2XRQ D;  1DZ1 A;  1C48 A;  4KKU A;  3TQY A;  3C1E A;  1HNZ L;  2YV5 A;  4JW0 A;  3G6E A;  4B9W A;  3HP3 A;  2C35 B;  2E8G A;  2JA6 G;  5IWA Q;  1EEI D;  3FVQ A;  5KNB A;  3QWN A;  1HZC A;  4A3C G;  3KF6 B;  4IUN A;  3TBI B;  4L6T B;  3QG1 A;  2ICI A;  1L0W A;  2BH8 A;  2JA5 B;  3S24 A;  1VF5 C;  1OXX K;  1U4M A;  4HR7 B;  4NKL A;  1J9O A;  3DHQ A;  4G7O C;  1HQM C;  3DWA A;  1BQQ T;  2BDO A;  3QOJ A;  4R1J A;  2HIX A;  2F0H A;  1D5M C;  2FJ2 A;  2DJG C;  1Z9F A;  4ME5 A;  1G6P A;  2AMC B;  3CW2 C;  2ES2 A;  1PH6 A;  1X3G A;  1JCK B;  1K3B C;  5IP7 H;  5EKL A;  2R92 G;  1F9P A;  4A3B B;  2FMM A;  3H91 A;  3CCR A;  4NXN Q;  3VYU A;  2LSS A;  2RHQ B;  3TP8 A;  4JCV E;  4CKB A;  1S5E D;  2FFK B;  3JC6 6;  2FHT A;  4DAY A;  1XTD A;  2WFW A;  3GV6 A;  5IYC H;  1OTC A;  1U4P A;  1I50 H;  2FMC A;  4M1U B;  1QG7 A;  1STG A;  2SDF A;  3NXW A;  5CV5 A;  1K73 C;  4DR4 L;  2WKD A;  3HOV G;  4ZAI A;  3GTJ H;  4AQY Q;  4C3H H;  1H9J A;  4A3E G;  4DR3 L;  1J8I A;  1SE8 A;  4KY7 A;  3TME A;  2WB1 E;  3OYY A;  3TP7 A;  1YNX A;  1Y1W G;  3D6C A;  1I6H H;  3VYS A;  4B3S L;  3IFT A;  1F2Y A;  1S40 A;  2XSC A;  5FKA C;  4ALP A;  2E2H B;  2GA4 B;  2ZXP A;  5E1F A;  1BCP F;  2XVS A;  1OO9 B;  4LF6 L;  4A3D G;  2A5H A;  5J3B A;  1E1T A;  4BXX G;  1BVS A;  1YZ6 A;  3S1N B;  1G91 A;  2EJF C;  1PFM A;  4Y7N H;  4HAE A;  5KYI A;  4QY7 A;  2PW7 A;  2NYZ D;  4A3I B;  4KKS A;  2ASB A;  3FMC A;  1LT4 D;  5HUR A;  1ESF A;  4CDF C;  4F88 A;  4C2M B;  2F0V A;  1O7I A;  5FLX L;  3A55 A;  3T1H L;  5EBD A;  2X69 A;  2ZM6 L;  3V96 A;  4WJ4 A;  2CH4 A;  5COY A;  1FJG Q;  4KD3 A;  2B2U A;  1BF4 A;  1G8Z D;  2RDF A;  2B2Y C;  3HOW B;  4UDU C;  2EYM A;  4JI1 L;  3VDY A;  1K0S A;  4K5W A;  3CCM A;  3T13 A;  2JA8 G;  4APV A;  1A63 A;  1DXM A;  1Y1V G;  2KCN A;  1D5Z C;  1VMC A;  4KHZ A;  3C3L A;  3GDE A;  2KA7 A;  4LJZ C;  3BVG A;  4ZLT F;  5DM6 3;  2E5L Q;  1BBW A;  5M5X H;  4P74 A;  3PUX A;  1YHB A;  1JOR A;  5EPL A;  2BE5 D;  5C0X I;  1XMQ L;  3BYT B;  1IL2 A;  1EQV A;  1L0X B;  4A3K G;  5ELC A;  1AFP A;  4GZY C;  3UDX A;  1EY9 A;  3FKI H;  3PQI A;  1ICF B;  5BR8 Q;  4ABN A;  4JOI C;  2I0Q A;  3IRB A;  3PIP 3;  3CCV A;  4LMQ D;  3X3N A;  5BN3 A;  5C3W A;  2ZJP A;  1D5X C;  2K5H A;  5IGE A;  1F2L A;  5LMN W;  1FVI A;  4TSS A;  4KI0 A;  5FLM H;  1K83 B;  3NUC A;  4IOA A;  2MP1 A;  1I5F A;  2F0D A;  3ULP A;  2NB0 A;  3J7A V;  3S15 H;  4LF7 L;  1GHK A;  3DEO A;  1XYI A;  1GUO A;  2I5M X;  1VQ8 A;  1ASY A;  4A3F H;  5M5Y H;  1V9P A;  2HHH Q;  3SEB A;  4CKC A;  2PI2 A;  4IN3 A;  4POG A;  1RKN A;  4XQN A;  4IZ8 A;  4ZUI A;  4I65 A;  3GO5 A;  5JJI A;  5ELF A;  5GAG C;  3CMA A;  4KTA A;  4FO2 A;  4MZ9 A;  3PO3 B;  2PCF B;  5C5M A;  3PO2 B;  1IW7 C;  3MXN B;  4V0B A;  1YNJ C;  5LHY 1;  5C44 G;  4JV5 L;  4RGN A;  2ZXR A;  4DNI A;  3FRP B;  3VR6 A;  4X66 L;  2CWP A;  4B3M Q;  1JWM D;  1ONL A;  2NVT B;  1KXL A;  1TS4 A;  1O7Y A;  2OTL A;  1YJ9 A;  4K8J A;  5HGQ A;  1XPR A;  4KHP Q;  3ND9 A;  1GUG A;  2ZTC A;  5C0X H;  1PA6 A;  4IJH A;  3VR5 A;  1SNP A;  1X55 A;  4QIW B;  3S1M H;  2F0G A;  4G7Z C;  2YTV A;  2NN6 H;  3HGB A;  4L63 B;  1A2T A;  2CH4 W;  2YU9 H;  1TS5 A;  1B9N A;  2MHV A;  1WD0 A;  3SHL A;  4DV7 Q;  1Z7T A;  2JYO A;  2Z4H A;  4DV0 Q;  1LTS D;  3S2D B;  2R6G A;  1EY6 A;  4K14 A;  3P7J A;  5GAE C;  4A3J G;  1NMG A;  3NEL A;  1WCM B;  3R2T A;  1BOS A;  3STB C;  3MA2 B;  2QGQ A;  3ND8 A;  4YWL A;  4K2K A;  1HNW Q;  1X65 A;  2KCT A;  3KOJ A;  1EU3 A;  4IAL A;  1EOV A;  1PHJ A;  2IHE A;  2YTY A;  4OHJ A;  2P5Z X;  4HJ7 A;  3NPP A;  1ET6 A;  4IUQ A;  3UI2 A;  4RMF A;  1ROD A;  2XNA C;  3M7N A;  2EYJ A;  3HOU H;  4MIU A;  4A4I A;  3WDN A;  4DK1 A;  4Q5V A;  3VR4 A;  5KGU A;  2EYP A;  4GNX A;  2Q2H A;  2DY7 A;  1N34 Q;  3HG9 A;  4DKA C;  5KNC A;  1SXT A;  4R4C A;  2VS1 A;  3W5O A;  2VB2 X;  2EJG C;  1I94 Q;  2UUC L;  1BR9 A;  4JI8 Q;  4DNT B;  1VQJ A;  3H15 A;  3GTM B;  1Y69 U;  2KVM A;  2F3W A;  3L0O A;  3HOX G;  3A7L A;  4R4Q A;  3HOY G;  2UXC Q;  1PFN A;  2PO4 A;  3GQB A;  4XQQ A;  1GJX A;  2QCP X;  3MEH A;  1IXR A;  4GKK Q;  1FR3 A;  2F0S A;  4LF5 L;  3BS1 A;  1BCP D;  1EEF D;  1AZQ A;  3RZO B;  1HZB A;  4NDX A;  1N33 Q;  1C0A A;  2ZT9 C;  4ZCK A;  1WTX A;  4R9W A;  4BBS B;  1GD7 A;  3L3O C;  2JA5 H;  1WTW A;  4DXG A;  3DXJ C;  4L5Q A;  4FNF A;  4UAI A;  3A5U A;  3UDG A;  1RHP A;  2B8F A;  2F0Q A;  4N9T A;  4JI4 Q;  1HH2 P;  1GHJ A;  1SLJ A;  1PH2 A;  5A2Q L;  3BYY B;  5CBE E;  3UE1 A;  3CF5 A;  1HJP A;  2BDN A;  1G29 1;  1HFG A;  3TRZ A;  2QKI C;  1DOK A;  1QUQ B;  3D0F A;  4ID6 A;  2F4V L;  4FF4 A;  1YIJ A;  2BA1 A;  2WB1 G;  4BBR H;  1SYE A;  1WTH A;  4B3T L;  1O7Z A;  3S9W A;  1KRS A;  4ZRZ A;  1QWY A;  3B6Y A;  4R4T A;  3CCU A;  4C3I G;  2KHJ A;  1B4O A;  4BY7 B;  4KHV A;  3WOE A;  3VR2 A;  4DR5 L;  4OWX B;  3RN5 A;  3I8Z A;  1E22 A;  2YTX A;  1PH1 A;  1YBY A;  4WFN 3;  3RR5 A;  1I4P A;  3U4V A;  3VA5 A;  1GUT A;  4X64 L;  5LL6 X;  4DA2 A;  3HOW G;  1LV9 A;  5I2Y A;  2K01 A;  4LFB L;  1STN A;  1SSO A;  2JSO A;  3QR8 A;  3U9O A;  1P8L A;  2MPM A;  2EYH A;  3H0G G;  3E0E A;  4L5S A;  1K8G A;  1LT6 D;  1VQD A;  4IFD I;  3RUZ A;  3GTJ B;  1QE6 A;  4A3I H;  4YY3 Q;  3BDL A;  1JC7 A;  4Z9C B;  4EQP A;  1PRT F;  3AYH B;  4DFA A;  4C2M H;  4LF9 L;  4A3G B;  2RSO A;  4DF7 A;  1VQP A;  4LF8 Q;  2UXD Q;  1CSP A;  2NTS A;  4OGQ C;  2ATW A;  1I6H B;  4YHH L;  1VQI A;  3SGI A;  3MFG A;  3FHW A;  4RCN A;  3F2U A;  1SE2 A;  4LUZ A;  2F0L A;  2JA7 B;  4X6A H;  1ILP A;  2K5W A;  2JJQ A;  1NY4 A;  5D3I B;  1XWE A;  3CHB D;  4F7X A;  4CJ1 B;  4Y7N B;  4OXP A;  2UXB L;  5IT9 c;  2UUA Q;  2VUM H;  2EOT A;  5ELO A;  4X3K A;  2RBM A;  3GTO H;  4UPA A;  3GP7 A;  2L55 A;  3JAM E;  5ELD A;  3MZ5 A;  3N52 A;  1F2M A;  1QJO A;  4EGV A;  4K6L A;  1ICW A;  1X9N A;  1ENA A;  2OCE A;  5JPM C;  4G57 A;  3TEH B;  4FP5 D;  3I4L A;  4KV6 A;  1X3P A;  1S5F D;  2RKS A;  2K5Q A;  3ONA B;  3WOF A;  2R93 B;  1Y14 B;  1CUK A;  1BBX C;  1WYD A;  5M5X B;  3A56 A;  4OIJ A;  4XT1 B;  3PUW A;  1NUC A;  1YHA A;  2F0W A;  4ZUJ A;  2F3V A;  1QB5 D;  2K14 A;  3TRE A;  1EY0 A;  1K83 H;  1AE3 A;  2L4N A;  5IYB G;  4CDE C;  3OOC A;  1VQH A;  4KY6 A;  4HSV A;  4IUP A;  2GVB A;  3S17 B;  2XWJ B;  2WAQ B;  1EYA A;  2MJ8 A;  5M3M H;  4K0K Q;  3LWU A;  1IKL A;  1B7Y B;  1S5C D;  4P72 A;  5K5P A;  2N88 A;  4DV2 L;  5GAD C;  1HZA A;  2PW5 A;  3E6Z X;  1PH8 A;  4B3R L;  2DUD A;  1IBK Q;  3BG3 A;  1IYJ B;  1H9K A;  3PO2 H;  5FLX E;  1PZJ D;  2SEB D;  2RDG A;  1EIG A;  4X62 Q;  3LGJ A;  3PUY A;  3PV0 A;  1EY5 A;  1A3V A;  4HMI A;  4IOC A;  2NVT H;  4K6D A;  4DR6 L;  4ILW A;  1MJE A;  2OQK A;  3K5M A;  1CZW A;  3ULJ A;  1D7Q A;  2ZJR A;  2B2V A;  4WJW A;  1VQE A;  4DR1 Q;  3G7L A;  4LF4 Q;  3HOZ G;  1QNK A;  5C4X G;  1IW7 D;  1U4R A;  3HS0 C;  4IUU A;  1YNJ D;  4LUV A;  1IBL L;  3BVZ A;  3I72 A;  1BUV T;  2HHH L;  4NMZ A;  1JR0 D;  4WOR A;  3G4S A;  1EYC A;  3S2D H;  2B39 A;  2QW7 A;  4KJO A;  2A19 A;  1CQV A;  2Z8L A;  1UE6 A;  4BA2 I;  5DAU A;  2RVL A;  4JI3 L;  3NTH A;  4IPC A;  5COR A;  5C0X J;  3F2C A;  3F8T A;  3EN2 A;  1D8L A;  4ZKB B;  4CJ2 C;  4PMB A;  2F0E A;  2B2W C;  3S1M B;  2KHI A;  4JI6 Q;  2B63 G;  1TWA B;  1W6K A;  2ZXO A;  2YU9 B;  1EQR A;  2F3I A;  2B8G A;  1A62 A;  1Q7Y C;  2ENB A;  4NB3 A;  3J81 L;  4O42 A;  2N8N A;  2UU9 Q;  1LM0 A;  4JI0 Q;  3ER0 A;  1MGS A;  3PUV A;  4KN4 C;  4AH6 A;  4NXM L;  5J22 A;  2V1C C;  3NP8 A;  2ZTD A;  1BCP B;  4OO1 H;  2Q8R E;  2Z1C A;  5IP9 H;  3H3V I;  3GTM H;  1M8A A;  1YJW A;  2A6E D;  4GOP A;  1F9R A;  3VYR A;  2F0U A;  5EJW A;  2R3Z A;  5IGG A;  3I4M B;  1SYD A;  3HOU B;  3NEM A;  3S14 H;  2G5D A;  3G48 A;  2Q2T A;  1HUM A;  2F52 A;  4DK6 C;  1Y8O B;  2O5J C;  1PH3 A;  1L1O A;  2Z0S A;  2R7Z B;  1HNX Q;  3CU7 A;  1BCP C;  5KIX A;  4DV3 L;  3EFX D;  2QEX A;  3JAM i;  1BO0 A;  1PH7 A;  2IY5 B;  4BBS H;  4L5R C;  1VCI A;  5JVH 3;  2MO0 A;  3OMC A;  4AYB B;  5KND A;  3BJU A;  3PMF A;  1XMO Q;  1PLF A;  4GLV B;  2DJF C;  1A15 A;  1SR3 A;  4HMJ A;  1K9M C;  5I9P A;  3S16 B;  1JQY D;  1OXV A;  1HRJ A;  3I91 A;  2IWH A;  1T5E A;  5AJ3 Q;  1I94 L;  1VS0 A;  4JI8 L;  2XN9 C;  5IP7 G;  3KLS A;  2KQ3 A;  2D0P A;  2PQA B;  3O13 A;  1MSH A;  1VQ5 A;  1LT3 D;  1E7Z A;  4OIK A;  4XXE A;  2XRS D;  2PNH A;  2J4X A;  4YCW A;  3M4Q A;  5IT9 L;  4X3T A;  3AU7 A;  2QIL A;  4HJ9 A;  3CCL A;  4GKK L;  1KDA A;  3D31 A;  4LAA A;  1J5E Q;  4PQX A;  2IJ0 A;  2E2D C;  3J80 L;  3T1Y L;  1SDF A;  4C1N I;  3KJO A;  4EQO A;  4JBJ A;  2C9O A;  4BY7 H;  4M8A A;  1V1P B;  1PMR A;  3JAM L;  2E76 C;  4C3H G;  2Z6K A;  2BH2 A;  4X65 L;  3I4N G;  5C3E B;  1V1O A;  1IHZ A;  3PGZ A;  3K8A A;  3ITP A;  1Q90 A;  1LTR D;  4CGY B;  4JI4 L;  4YWK A;  4DAP A;  1QVC A;  2Y0S B;  4BBR B;  3DM1 A;  4HIM A;  2PZU A;  3A54 A;  1HR0 L;  3I2Z A;  2JA6 H;  3PIP A;  3EJI A;  3D6W A;  1MHW C;  3PIO 3;  1LTG D;  3MEF A;  2Q2U A;  4DV1 Q;  1WJJ A;  2ID0 A;  1SAP A;  1KC8 C;  1LAC A;  1WI5 A;  3LWE A;  2K6A A;  5GRO A;  3TSS A;  4JYA Q;  1M90 C;  5IE8 A;  4A3G H;  1QVF A;  1N8R C;  3HKZ B;  2I46 A;  2ALY B;  3W1B A;  5C4Z A;  1NJI C;  2DY8 A;  1XXG A;  1G51 A;  4JI2 Q;  1CQF A;  1D6E C;  2F0J A;  1Q81 C;  2JN4 A;  3EA6 A;  1STH A;  5EKK A;  5JJZ A;  3L2P A;  3CCQ A;  1JE5 A;  1K8O A;  5T1G A;  2JA7 H;  1BXT A;  2UUB L;  3M7G A;  3EQL C;  3NQT A;  1T5X D;  4X3U A;  2R92 H;  4R8N A;  5LMN Q;  2TMP A;  4UP8 A;  4Q0F A;  2RHS B;  4K2L A;  1LTL A;  3CC7 A;  5A2Q E;  1DOL A;  1I3Q B;  1CHQ D;  1A0I A;  4DV6 Q;  1I4G A;  5JEA G;  2IPK D;  1B3A A;  1U5K A;  3SVM A;  4XYQ A;  1RCV D;  2KUM A;  4CBV A;  4HID A;  3G6J B;  3DM3 A;  1PVO A;  1XNR Q;  3FKI G;  1XNQ Q;  3KF8 B;  3M3Y B;  2R93 H;  1HZ9 A;  2F0N A;  1QVG A;  4XTC S;  4DU9 A;  2VUM B;  3KDF A;  2OEO A;  5J39 A;  5FO7 B;  3UDI A;  3HFZ B;  4QF4 A;  2VB3 X;  3GTO B;  1Q46 A;  3CC4 A;  3NBI A;  3M4Y A;  3MAQ A;  2XGT A;  5FLM G;  1WD1 A;  3NSW A;  1EIH A;  1M1K C;  4OWT B;  1SMY C;  4IJL A;  4FF3 A;  1UNS A;  2EIF A;  3U4Z A;  4YCV A;  3S17 H;  4FVM A;  1KTK A;  1K28 A;  4A3F G;  1WTV A;  3I3C A;  1WTP A;  1E2Z A;  5CYU A;  1JIC A;  3J81 j;  2B2T A;  4KMU C;  5DLQ E;  3PCO B;  3U50 C;  2OT2 A;  1SRO A;  1F2Z A;  1RIP A;  1VQO A;  4OEL B;  1RL2 A;  1TWH H;  2EQS A;  3V05 A;  4A93 G;  3BDC A;  2HCI A;  4B08 A;  3RN2 A;  3CCE A;  2HDL A;  4LFA Q;  1PZK D;  2M9V A;  1KAW A;  1Y1V H;  1H9M A;  1STB A;  4DUY L;  5M3M B;  4IFD J;  1NSN S;  3RD4 A;  4EQ5 A;  3ZYY X;  5LL6 S;  2VQE L;  1PTO F;  4LFC Q;  4NP5 A;  3QOL A;  3OTO Q;  1C8C A;  5DEH A;  4A3M G;  3I73 A;  4A3K H;  1EYG A;  3URY A;  3K81 C;  1K3R A;  2NN6 G;  4DR2 Q;  2XWB B;  1KRT A;  5E7N A;  2BCO A;  5ELB A;  4JI5 Q;  3ERO A;  2FXQ A;  2SNS A;  2K5N A;  5JJL A;  4GKJ Q;  3T16 A;  2OWO A;  3VYT A;  3FDT A;  4JPB W;  4QIW E;  1Q1E A;  2F0P A;  5C4H A;  1F9Q A;  4K8I A;  4PNY A;  1B70 B;  5IGC A;  4DAY B;  5JVG 3;  3W2D A;  1TWA H;  2L9H A;  3VA7 A;  1H9S A;  1JOQ A;  2K1B A;  4DR7 L;  4DXF A;  4J6H A;  5CV9 A;  3C1F A;  3D8G A;  3OW2 A;  4KKT A;  4RGT A;  1EFI D;  1FD7 D;  5CV8 A;  4DUZ L;  4G7H C;  1CFM A;  3E0J A;  1BDO A;  2VQF Q;  4OX9 L;  2R7F A;  1PDQ A;  4I7A A;  4BY1 G;  3CAM A;  4C3J B;  1JT8 A;  1IBM Q;  4PV1 C;  1S72 A;  2Q8T A;  5LMU L;  1BBU A;  3I55 A;  3L7Z C;  3K0Y A;  4B9X A;  1KNE A;  2A6E C;  1PRT B;  4Y52 H;  3I4M H;  3UDF A;  1Q8K A;  1JB7 A;  4TQU S;  3GTL B;  5M3F B;  4JK1 C;  5EPK A;  1G6Z A;  2J0T D;  2R7Z H;  1I4X A;  4UY8 C;  1JB3 A;  1KDB A;  3GTQ H;  2DNC A;  1J6Q A;  2F4I A;  2JA5 G;  3QJY A;  1S5D D;  4JI7 L;  1VQC A;  4DV4 Q;  5CC4 A;  1GKH A;  5IOC A;  1PRT C;  4JI0 L;  4A75 A;  1HNZ Q;  3S14 B;  2N55 A;  1X3Q A;  3J7Z C;  2G9D A;  3S16 H;  1PYS B;  2K75 A;  2B3G A;  2QEJ C;  5IYD H;  4IPH A;  1CKN A;  1TU2 B;  1GM5 A;  3T51 B;  3SE0 A;  2KOL A;  2VL6 A;  4IO9 A;  1DCZ A;  1GUS A;  1UWV A;  4A3B G;  2B2U C;  3TP6 A;  3AMU A;  3NBH A;  4PZ8 A;  1S4Z A;  4DV5 L;  3FP9 A;  4MTK A;  3K7A H;  3OWF A;  3HRZ C;  1U0L A;  2F0I A;  2RQX A;  1NR2 A;  2CHB D;  3CRK C;  2K5D A;  1VQG A;  2K28 A;  1P16 A;  3J81 E;  2CQO A;  2DN8 A;  3E3X A;  1TII D;  4MTN A;  4RGO S;  4IPG A;  3C2P A;  1V8Q A;  2I5L X;  2M00 A;  3F2B A;  5C3E H;  1B3Q A;  5ELN A;  2VNU D;  3HOX H;  1Y8N B;  1JJC B;  1YEZ A;  4J1M A;  5IWA L;  1PFS A;  2K04 A;  1LLR D;  4NPS A;  4R4O A;  3S1R B;  2D2C C;  5E4X A;  2VW9 A;  2QA4 A;  3GTG B;  2L15 A;  4DR4 Q;  1AEX A;  1ZEQ X;  4RHR A;  3L9A X;  2IL8 A;  4JC0 A;  4A3I G;  2Z9H A;  3K7U C;  4DR3 Q;  5TSS A;  3OSO A;  1WTR A;  2L11 A;  2NVQ B;  1J5E L;  5BN5 A;  3HEJ A;  4CDD C;  1TVX A;  2EVB A;  2TSS A;  4B3S Q;  2JA6 B;  3NK9 A;  1R4P B;  1O78 A;  1S3O A;  5ELE A;  2QDL A;  4LF6 Q;  3M85 A;  3EVQ A;  5NUC A;  4NXN L;  1VQ7 A;  3V2T A;  3H3V C;  4MNO A;  4ZKC B;  2R61 A;  1VQA A;  2RCF A;  1EQT A;  1I3Q H;  3SXH A;  3GTK B;  1OXU A;  3K6O A;  3SK6 A;  1LO5 D;  3T1H Q;  2JEA I;  5D65 A;  2ZM6 Q;  3KLR A;  1TWG B;  4GLA C;  3CP0 A;  4JI1 Q;  1A3U A;  4AQY L;  2O4X A;  5IT9 E;  5D14 A;  5ISR A;  1HHV A;  2DGY A;  2IX0 A;  1YIT A;  3M3Y H;  2R92 B;  2R7D A;  2N78 A;  2LXK A;  4YIJ A;  3J80 E;  1CKO A;  4HN7 A;  2CW0 C;  3RLN A;  5KRU A;  5FJ8 G;  1JJG A;  2SOB A;  1UEB A;  3Q8D A;  5KEE A;  2A1A A;  4RKL A;  4XQJ A;  2JQO A;  4P75 A;  2E2I H;  1SND A;  1B1Z A;  5JJK A;  5IIF A;  3I70 A;  1XMQ Q;  2RSN A;  1QZH A;  1TWC B;  2WII B;  4QMG A;  3LNN A;  3ICE A;  3HOV B;  1SYF A;  5EPJ A;  3MVV A;  4DK0 A;  4A3E B;  2MQH A;  2CKZ B;  1VDZ A;  2F0T A;  3PF5 A;  2HDM A;  1HCZ A;  4XT3 B;  4WRD A;  2EY6 A;  1KQS A;  3M4P A;  1SYC A;  1FJG L;  4RCO A;  1Y8P B;  1X3F A;  1Y1W B;  5CV4 A;  2CWA A;  2AWO A;  5I6W A;  2L1B A;  3M9B A;  1SMY D;  3GD7 A;  4I7Z C;  1XNR L;  5T1I A;  3PO3 G;  4DAM A;  3PO2 G;  2B29 A;  4P73 A;  4A3D B;  1W6J A;  2V4D A;  1BKB A;  1WTQ A;  2A8V A;  3DWQ A;  3K5L A;  1W2B A;  2WAQ E;  2KEE A;  2JEB I;  2EY2 A;  3FPP A;  2OF1 A;  2KCM A;  4O1N A;  4IFD H;  2E5L L;  1QOH A;  2N3S A;  4GNX C;  4C1N K;  1NTG A;  3KF6 A;  1R9T B;  1JJ2 A;  2K7V A;  2ICE C;  3P20 A;  1QIL A;  2F0F A;  4QUF A;  2D9U A;  1AZP A;  1RD9 D;  1TWH B;  2D62 A;  1C9O A;  1SNQ A;  4RG1 A;  2AUJ D;  3PSI A;  1YVC A;  2JA8 B;  1D1K A;  4HCE A;  5BR8 L;  3Q24 A;  2A69 D;  4JV5 Q;  1Y1V B;  3R93 A;  3CPW A;  4QCL A;  5CMD A;  3AFP A;  4X66 Q;  2HIV A;  3TS2 A;  1NNX A;  3J81 i;  3F1Z A;  5J1Z A;  4FXK C;  2BOS A;  1WCM G;  1RTO A;  3FPU B;  1EWI A;  5IYB H;  4A3K B;  4LWC A;  2O5I C;  4WJ3 M;  2E2J B;  3HKS A;  1N32 Q;  4A76 A;  2RDH A;  1TWF B;  1MKH A;  3BU2 A;  1LT5 D;  5FLX c;  1H95 A;  1L2F A;  5IGF A;  1TKW B;  2A6H C;  1NE3 A;  1HQR D;  3KLW A;  5CBA E;  1I6V C;  3LX0 A;  4R8I A;  4XDX A;  4PZ6 A;  1G2T A;  3TP5 A;  5FO9 B;  1E2W A;  3KBG A;  2JP1 A;  1PYW D;  4LK1 C;  5CV6 A;  4OON A;  1YHQ A;  2NBF A;  4OO1 G;  3A5Z B;  4IQZ A;  1CKM A;  4C3J H;  2H1E A;  3TDQ A;  4B3M L;  2NZO A;  2B2Y A;  1UE1 A;  1EL0 A;  1DM0 B;  1CA5 A;  4KHP L;  2NVX H;  2ZJQ A;  1MBY A;  2KHS A;  4A3L G;  4EX5 A;  3F2D A;  1L0Y B;  4PG3 A;  1LUZ A;  3EBE A;  1UE7 A;  4FYD A;  4XIG S;  2L12 A;  3HOZ H;  1V1Q A;  3D4R A;  1D2B A;  5E3F A;  4JBK A;  1ZXT A;  3GTL H;  5M3F H;  1VQ6 A;  2WAC A;  5G3L F;  2CFM A;  5K36 H;  5FK9 C;  1Q86 C;  4BBS G;  4DV7 L;  2PMZ B;  3VR3 A;  2I5H A;  1TQO A;  4DV0 L;  1YNN D;  1F77 A;  3W3A A;  2UUC Q;  3PIO A;  1LTA D;  1HXY D;  5EQ0 A;  2K5V A;  2MO1 A;  4KK7 A;  1HNW L;  1JE4 A;  1CK1 A;  4JOI A;  2KBN A;  3J80 i;  4HJ5 A;  3NHH A;  2M2L A;  4LF5 Q;  4CHT B;  5JAV A;  3GTQ B;  4O2D A;  4RFB A;  4AYB E;  1AN8 A;  1PRT D;  1EWH A;  3N6R A;  1VQM A;  4X3S A;  1E3P A;  1TXY A;  4A3J B;  4QB4 A;  1C7Y A;  4RWS C;  1N34 L;  3S2H B;  3G71 A;  3K58 A;  4POF A;  4BY7 G;  2NVY B;  1EYD A;  1RTN A;  1KLU D;  2PQE A;  3MHB A;  4H7B A;  2WV6 D;  3MC0 B;  2EYF A;  3NWT A;  4KD4 A;  3M4O H;  4KJN A;  2EY1 A;  1KHI A;  2K05 A;  4HJA A;  2JA9 A;  2UXC L;  3Q6S A;  1SFO B;  1AW7 A;  2F4V Q;  3SK5 A;  5EKI A;  3DWP A;  3K7A B;  5IYC G;  4QJF A;  3S1R H;  2K4K A;  4B3T Q;  2K33 A;  1N33 L;  1TT2 A;  4KLK A;  3GTG H;  1EY4 A;  1EY8 A;  2IW3 A;  1LYL A;  3MXU A;  1ESR A;  1W3S A;  4RGM A;  1MD2 D;  1EU4 A;  5M5W B;  3NTK A;  3H3V H;  4DR5 Q;  1I4H A;  3H94 A;  4JBW A;  1DON A;  1VQ4 A;  4A3G G;  3FEW X;  3MXN A;  2NVQ H;  4IUV A;  2Y0S E;  1TY2 A;  3HOX B;  1DGS A;  3HOY B;  2K50 A;  5JPN C;  1IZ6 A;  1HTL D;  3T53 B;  1WTO A;  1PTO B;  4X64 Q;  1FYC A;  4TRD A;  3EIV A;  5C5L A;  5CV7 A;  4JG2 A;  2JA7 G;  2YYZ A;  4A3C H;  4LFB Q;  5I2X A;  4QL5 A;  1VQN A;  3OIQ A;  1TY0 A;  3HKZ E;  1LTB D;  3GTK H;  3K5O A; 
#chains in the Genus database with same CATH homology
 1PTO C;  3Q23 A;  2EE1 A;  4NW2 A;  1PZI D;  4CJ0 B;  5CGK A;  4K5X A;  4MN3 A;  2PZT A;  1CM9 A;  2B2V C;  3A8I E;  2HCC A;  2CVR A;  4ZK9 B;  4C56 C;  4H13 C;  3QB3 A;  5C4J B;  2WB1 B;  3SDZ A;  2EPB A;  2KEC A;  3NQI A;  1TS2 A;  2WP8 J;  1RF2 D;  4C3I B;  1DOM A;  1A2U A;  2CQA A;  3R8B A;  2CW0 D;  2HQE A;  4H44 C;  4ZYS A;  1TR5 A;  1JOK A;  3D4D A;  2E2I B;  3TZU A;  1ZYR D;  4DN4 M;  2F0M A;  3H0G B;  4RHS A;  1A3T A;  1LTT D;  1GUW A;  1PFB A;  3K59 A;  3A7A B;  5F2D A;  3SR1 A;  5JEA H;  1XX8 A;  5D3D A;  2EYL A;  4FF1 A;  1H9R A;  1BNZ A;  2NN6 I;  5G3L D;  3Q22 A;  2NWG A;  1SEB D;  1SJH D;  1E2V A;  2RA4 A;  2A69 C;  3ERQ A;  2AWN A;  2PYK A;  3S1Q B;  3IL8 A;  5C0X G;  1NAP A;  2BA0 A;  1UUP A;  1K8M A;  1FNW A;  1Q1B A;  1HFN A;  3CRL C;  3PUZ A;  2XIW A;  2L5T A;  3P1H A;  4S3S A;  3TN2 A;  1QCB D;  1Q12 A;  1Q8I A;  2I07 B;  2EY5 A;  5KYL A;  1CI3 M;  2MGS A;  4RA8 A;  1STY A;  2F0O A;  2A6H D;  4ODG A;  3IAY A;  4PMC A;  1Z47 A;  5FOB B;  2NUC A;  2PPB C;  1IYV A;  3OWE B;  1U9R A;  3T56 B;  3R3O A;  1KAA A;  1HA5 A;  1B9M A;  1ILQ A;  2LY7 A;  2FIN B;  3KUP A;  3T4A C;  1YNN C;  1SNO A;  2L0C A;  5BN4 A;  4IUT A;  3HZX A;  2NVX B;  5EGT A;  1LTI D;  1B2T A;  3HOZ B;  5C4X B;  2IX1 A;  5C3X A;  2A68 D;  4RKB A;  3A8J E;  3AB9 A;  4KN7 C;  4F87 A;  1D1I A;  4XYO A;  5M9O A;  3DEP A;  3K57 A;  1OXT A;  1FNV A;  4P2C B;  1I4R A;  1GXD C;  4FXD A;  4J8Q A;  1CZG A;  3C46 A;  2B63 B;  1B50 A;  1CHP D;  1SE3 A;  3GTP B;  5AFW A;  2MUY A;  2JE6 I;  2K32 A;  1DD2 A;  2EDG A;  1Z6H A;  1Q3L A;  1KDC A;  1FGB D;  5E4W C;  1II3 A;  3SK8 A;  1SE4 A;  3MXG A;  1O7L A;  3M4O B;  1VF7 A;  1NR4 A;  3NE5 B;  3SK4 A;  1ZKO A;  3E5S A;  5I9O A;  1PTO H;  4HCS A;  4PMW A;  4TKO B;  1ML0 D;  2AQ1 B;  2B2T C;  1S5B D;  5EBC A;  1X32 A;  2EJM A;  2F0K A;  2WKC A;  3MTS A;  1IYU A;  2B2W A;  3K5N A;  1KAB A;  1ET9 A;  4DNR B;  2Z4I A;  2E75 C;  1F9S A;  2X6L A;  3QIA A;  3GV3 A;  1C4Q A;  2NTT A;  1I4Q A;  1A6X A;  1JWS D;  2D5D A;  1HUN A;  3P75 A;  1XTC D;  2SNM A;  1SYG A;  3MWY W;  4HTH A;  2QF7 A;  1PTO D;  1R4Q B;  1I50 B;  4G4K A;  3OW7 A;  3RLF A;  1H9S B;  5CR3 A;  2J7Z A;  4L8J A;  2AQ3 B;  4C3H B;  4RAU C;  1B44 D;  5IOD A;  3I4N B;  4DAV A;  1AP0 A;  4U68 A;  1IL8 A;  1TS3 A;  2C5C A;  2IT1 A;  1STA A;  3DMU A;  4IUR A;  3I90 A;  1PXU A;  5I4D A;  1SNC A;  1ZYR C;  2OXP A;  1ENC A;  1VMP A;  1U4L A;  3CKI B;  4IFD G;  2KJX A;  3TZD A;  1GUN A;  4N9P A;  5DNF A;  2EYO A;  1KLG D;  3D4W A;  3A8K E;  2BE5 C;  1WVL A;  1MI2 A;  4ZQ3 A;  1RDP D;  5IGB A;  3DUZ A;  3U9S A;  2E74 C;  1UAP A;  1EZ6 A;  4U67 3;  1B53 A;  3MFY A;  3OPO A;  2PNR C;  1EZ8 A;  1CT1 D;  1HA6 A;  5JEA J;  4RH6 A;  2LMC B;  4HED A;  3R2I A;  2KED A;  4FF2 A;  3H09 A;  5C6A A;  3FKI B;  2DNE A;  4K5V A;  4BS9 A;  4EQN A;  1UEA B;  4BWG B;  1SYB A;  2Q8I B;  1V1P A;  4KY5 A;  3RZD B;  2LS0 1;  1MSG A;  1DYQ A;  5A35 A;  3S15 B;  4ULL A;  3BDO A;  4OO1 I;  3NTI A;  4C3J G;  3NWS A;  2VXW A;  1STE A;  3MXP A;  4DGZ A;  2F1M A;  4H0L C;  4FXG C;  4A3F B;  5M5Y B;  1IKM A;  1RJT A;  3X3M A;  1GOZ A;  1ENF A;  2A74 C;  1O80 A;  2H4O A;  2JXM B;  1V43 A;  2AQ2 B;  2F03 A;  2LFN A;  4A93 B;  1QNU A;  5IGD A;  5K36 G;  2QDB A;  1M4V A;  2EZV A;  1FNU A;  5FO8 B;  2HUG A;  1EY7 A;  2LKV A;  2A73 B;  2G9H D;  1JOO A;  4V19 0;  3OMG A;  4EVO A;  5I6Y A;  1CTM A;  1SBB B;  4A3M B;  4F8M A;  3KK7 A;  2KCC A;  2AUK A;  2K03 A;  4BA1 I;  5C44 B;  2A68 C;  3J7A F;  4QUC A;  3Q0A A;  2IX3 A;  2O2L D;  3OHX C;  1EWC A;  3KF8 A;  1SNM A;  5JOB A;  1HTP A;  4OL7 A;  2WIN B;  3CQZ B;  2X6G A;  2EXZ A;  3IFD A;  1HPC A;  1SJE D;  4HSP A;  1DJR D;  3RMH A;  4MHE A;  1LAB A;  3BVM A;  3H6M A;  5HGT A;  3IKJ A;  5DM7 3;  1G2S A;  1JWU D;  1NCV A;  2PZW A;  1CA6 A;  3KBX A;  4E6I A;  1KNA A;  2NZ1 D;  4CKE A;  3D3R A;  4BY1 B;  3BZD B;  1OXS C;  3KLS X;  1EOT A;  3OIP A;  1E0B A;  3QO2 A;  3J7Y W;  2XRQ D;  1DZ1 A;  1C48 A;  4KKU A;  3C1E A;  4B9W A;  3HP3 A;  1EEI D;  3FVQ A;  5KNB A;  3QWN A;  4IUN A;  3TBI B;  4L6T B;  3QG1 A;  2ICI A;  2JA5 B;  1VF5 C;  1OXX K;  1U4M A;  4HR7 B;  4NKL A;  1J9O A;  3DHQ A;  4G7O C;  1HQM C;  3DWA A;  1BQQ T;  2BDO A;  3QOJ A;  2F0H A;  1D5M C;  2FJ2 A;  4ME5 A;  1JCK B;  5EKL A;  1F9P A;  4A3B B;  2FMM A;  3H91 A;  3VYU A;  3TP8 A;  4CKB A;  1S5E D;  2FFK B;  4DAY A;  2FHT A;  3GV6 A;  1U4P A;  2FMC A;  4M1U B;  1QG7 A;  1STG A;  2SDF A;  3NXW A;  5CV5 A;  2WKD A;  4ZAI A;  1H9J A;  1J8I A;  4KY7 A;  3TME A;  3TP7 A;  3D6C A;  3VYS A;  3IFT A;  1F2Y A;  2XSC A;  5FKA C;  2E2H B;  2GA4 B;  2ZXP A;  5E1F A;  1BCP F;  2XVS A;  1OO9 B;  2A5H A;  3S1N B;  1G91 A;  2EJF C;  1PFM A;  4HAE A;  5KYI A;  2PW7 A;  2NYZ D;  4A3I B;  4KKS A;  3FMC A;  1LT4 D;  5HUR A;  1ESF A;  4F88 A;  4C2M B;  2F0V A;  5FLX L;  3A55 A;  5EBD A;  2X69 A;  3V96 A;  5COY A;  4KD3 A;  2B2U A;  1BF4 A;  1G8Z D;  2RDF A;  2B2Y C;  3HOW B;  4UDU C;  2EYM A;  4K5W A;  3T13 A;  1DXM A;  4KHZ A;  2KCN A;  1D5Z C;  1VMC A;  3C3L A;  2KA7 A;  4LJZ C;  3BVG A;  4ZLT F;  5DM6 3;  3PUX A;  1JOR A;  5EPL A;  2BE5 D;  5C0X I;  3BYT B;  1EQV A;  1L0X B;  5ELC A;  1AFP A;  4GZY C;  1EY9 A;  4ABN A;  3PIP 3;  4LMQ D;  3X3N A;  5BN3 A;  5C3W A;  1D5X C;  5IGE A;  1F2L A;  4TSS A;  4KI0 A;  1K83 B;  3NUC A;  2MP1 A;  2F0D A;  2NB0 A;  3J7A V;  1GHK A;  3DEO A;  1XYI A;  1GUO A;  3SEB A;  4CKC A;  4IN3 A;  1RKN A;  4XQN A;  4IZ8 A;  4ZUI A;  4I65 A;  3GO5 A;  5ELF A;  4KTA A;  4FO2 A;  3PO3 B;  2PCF B;  5C5M A;  3PO2 B;  1IW7 C;  4V0B A;  1YNJ C;  5LHY 1;  4RGN A;  2ZXR A;  3FRP B;  3VR6 A;  1JWM D;  1ONL A;  2NVT B;  1TS4 A;  1O7Y A;  4K8J A;  3ND9 A;  1GUG A;  5C0X H;  3VR5 A;  1SNP A;  4QIW B;  2F0G A;  4G7Z C;  2NN6 H;  3HGB A;  4L63 B;  1A2T A;  1TS5 A;  1B9N A;  2MHV A;  1WD0 A;  3SHL A;  1Z7T A;  2JYO A;  2Z4H A;  1LTS D;  3S2D B;  2R6G A;  1EY6 A;  4K14 A;  3P7J A;  1WCM B;  3R2T A;  1BOS A;  3MA2 B;  3ND8 A;  4K2K A;  1EU3 A;  4IAL A;  4OHJ A;  3NPP A;  1ET6 A;  4IUQ A;  3UI2 A;  1ROD A;  2XNA C;  3M7N A;  2EYJ A;  4MIU A;  3WDN A;  4DK1 A;  4Q5V A;  3VR4 A;  5KGU A;  2EYP A;  2DY7 A;  3HG9 A;  5KNC A;  1SXT A;  2VB2 X;  2EJG C;  1BR9 A;  4DNT B;  3GTM B;  1Y69 U;  2KVM A;  2F3W A;  3A7L A;  1PFN A;  2PO4 A;  3GQB A;  4XQQ A;  1GJX A;  2QCP X;  3MEH A;  1FR3 A;  2F0S A;  3BS1 A;  1BCP D;  1EEF D;  1AZQ A;  3RZO B;  4NDX A;  2ZT9 C;  1WTX A;  4R9W A;  4BBS B;  3L3O C;  1WTW A;  4DXG A;  3DXJ C;  4FNF A;  4UAI A;  1RHP A;  2B8F A;  2F0Q A;  4N9T A;  1GHJ A;  5A2Q L;  3BYY B;  5CBE E;  2BDN A;  1G29 1;  1HFG A;  2QKI C;  1DOK A;  4ID6 A;  4FF4 A;  2BA1 A;  1SYE A;  1O7Z A;  3S9W A;  4ZRZ A;  1QWY A;  4C3I G;  1B4O A;  4BY7 B;  4KHV A;  3WOE A;  3VR2 A;  3I8Z A;  4WFN 3;  1I4P A;  3VA5 A;  1GUT A;  5LL6 X;  4DA2 A;  1LV9 A;  5I2Y A;  2K01 A;  1STN A;  1SSO A;  2JSO A;  3U9O A;  2MPM A;  2EYH A;  1LT6 D;  4IFD I;  3RUZ A;  3GTJ B;  1QE6 A;  3BDL A;  1JC7 A;  4Z9C B;  4EQP A;  1PRT F;  4DFA A;  4A3G B;  2RSO A;  4DF7 A;  2NTS A;  4OGQ C;  1I6H B;  3MFG A;  4RCN A;  3F2U A;  1SE2 A;  2F0L A;  2JA7 B;  1ILP A;  2K5W A;  5D3I B;  1XWE A;  3CHB D;  4F7X A;  4CJ1 B;  4Y7N B;  2EOT A;  4X3K A;  2RBM A;  3GP7 A;  2L55 A;  3JAM E;  5ELD A;  3MZ5 A;  3N52 A;  1F2M A;  1QJO A;  4EGV A;  4K6L A;  1ICW A;  1ENA A;  5JPM C;  4G57 A;  4FP5 D;  3I4L A;  4KV6 A;  1X3P A;  1S5F D;  2RKS A;  2K5Q A;  3ONA B;  3WOF A;  2R93 B;  1BBX C;  5M5X B;  3A56 A;  4OIJ A;  4XT1 B;  3PUW A;  1NUC A;  2F0W A;  4ZUJ A;  2F3V A;  1QB5 D;  1EY0 A;  2L4N A;  3OOC A;  4KY6 A;  4HSV A;  4IUP A;  3S17 B;  2XWJ B;  2WAQ B;  1EYA A;  2MJ8 A;  3LWU A;  1IKL A;  1S5C D;  5K5P A;  2N88 A;  2PW5 A;  3E6Z X;  3BG3 A;  1H9K A;  5FLX E;  1PZJ D;  2SEB D;  2RDG A;  1EIG A;  3PUY A;  3PV0 A;  1EY5 A;  1A3V A;  4HMI A;  4K6D A;  4ILW A;  3K5M A;  1CZW A;  2B2V A;  4WJW A;  3G7L A;  1QNK A;  1IW7 D;  1U4R A;  3HS0 C;  4IUU A;  1YNJ D;  3BVZ A;  3I72 A;  1BUV T;  4NMZ A;  1JR0 D;  4WOR A;  1EYC A;  2B39 A;  4KJO A;  1CQV A;  2Z8L A;  4BA2 I;  5DAU A;  2RVL A;  3NTH A;  5COR A;  5C0X J;  4ZKB B;  4CJ2 C;  4PMB A;  2F0E A;  2B2W C;  3S1M B;  1TWA B;  1W6K A;  2ZXO A;  2YU9 B;  2B8G A;  2ENB A;  3J81 L;  4O42 A;  1MGS A;  3PUV A;  4KN4 C;  5J22 A;  3NP8 A;  1BCP B;  4OO1 H;  2Q8R E;  2Z1C A;  1M8A A;  2A6E D;  1F9R A;  3VYR A;  2F0U A;  5EJW A;  2R3Z A;  5IGG A;  3I4M B;  1SYD A;  3HOU B;  1HUM A;  1Y8O B;  2O5J C;  2R7Z B;  3CU7 A;  1BCP C;  5KIX A;  3EFX D;  1BO0 A;  1VCI A;  5JVH 3;  3OMC A;  4AYB B;  5KND A;  3PMF A;  1PLF A;  1A15 A;  4HMJ A;  5I9P A;  3S16 B;  1JQY D;  1OXV A;  1HRJ A;  3I91 A;  2IWH A;  1T5E A;  2XN9 C;  3KLS A;  2KQ3 A;  3O13 A;  1MSH A;  1LT3 D;  4OIK A;  4XXE A;  2XRS D;  2J4X A;  5IT9 L;  4X3T A;  3AU7 A;  2QIL A;  1KDA A;  3D31 A;  4LAA A;  4PQX A;  2IJ0 A;  2E2D C;  3J80 L;  1SDF A;  4C1N I;  4EQO A;  2C9O A;  4M8A A;  1V1P B;  1PMR A;  3JAM L;  2E76 C;  4C3H G;  5C3E B;  1V1O A;  1IHZ A;  3ITP A;  1Q90 A;  1LTR D;  4CGY B;  4DAP A;  4BBR B;  2Y0S B;  3DM1 A;  2PZU A;  3A54 A;  3EJI A;  3D6W A;  3PIO 3;  1LTG D;  2ID0 A;  1SAP A;  1LAC A;  3LWE A;  2K6A A;  3TSS A;  3HKZ B;  2I46 A;  5C4Z A;  2DY8 A;  1XXG A;  1CQF A;  1D6E C;  2F0J A;  3EA6 A;  1STH A;  5EKK A;  5JJZ A;  1K8O A;  5T1G A;  1BXT A;  3M7G A;  3EQL C;  3NQT A;  1T5X D;  4X3U A;  4R8N A;  2TMP A;  4Q0F A;  4K2L A;  5A2Q E;  1DOL A;  1I3Q B;  1CHQ D;  1I4G A;  5JEA G;  2IPK D;  1B3A A;  3SVM A;  4XYQ A;  1RCV D;  2KUM A;  4CBV A;  3G6J B;  3M3Y B;  2F0N A;  4XTC S;  4DU9 A;  2VUM B;  2OEO A;  5J39 A;  5FO7 B;  4QF4 A;  2VB3 X;  3GTO B;  3NBI A;  3M4Y A;  3MAQ A;  1WD1 A;  3NSW A;  1EIH A;  1SMY C;  4FF3 A;  1UNS A;  4FVM A;  1KTK A;  1WTV A;  3I3C A;  1WTP A;  1E2Z A;  5CYU A;  1JIC A;  2B2T A;  4KMU C;  2OT2 A;  1F2Z A;  3V05 A;  3BDC A;  2HCI A;  4B08 A;  2HDL A;  1PZK D;  2M9V A;  1H9M A;  1STB A;  5M3M B;  4IFD J;  1NSN S;  3RD4 A;  3ZYY X;  5LL6 S;  1PTO F;  4NP5 A;  3QOL A;  1C8C A;  5DEH A;  3I73 A;  3URY A;  2NN6 G;  2XWB B;  2BCO A;  5ELB A;  3ERO A;  2SNS A;  3T16 A;  3VYT A;  3FDT A;  1Q1E A;  2F0P A;  5C4H A;  1F9Q A;  4K8I A;  4PNY A;  5IGC A;  5JVG 3;  3W2D A;  2L9H A;  3VA7 A;  1H9S A;  1JOQ A;  2K1B A;  4DXF A;  4J6H A;  5CV9 A;  3C1F A;  3D8G A;  4KKT A;  4RGT A;  1EFI D;  1FD7 D;  5CV8 A;  4G7H C;  1CFM A;  3E0J A;  1BDO A;  1PDQ A;  4C3J B;  4PV1 C;  2Q8T A;  3L7Z C;  3K0Y A;  4B9X A;  1KNE A;  2A6E C;  1PRT B;  4TQU S;  3GTL B;  5M3F B;  4JK1 C;  5EPK A;  1G6Z A;  2J0T D;  1I4X A;  1JB3 A;  1KDB A;  2DNC A;  2F4I A;  3QJY A;  1S5D D;  5CC4 A;  5IOC A;  1PRT C;  3S14 B;  2N55 A;  1X3Q A;  2G9D A;  2QEJ C;  1TU2 B;  3T51 B;  3SE0 A;  2KOL A;  1DCZ A;  1GUS A;  2B2U C;  3TP6 A;  3AMU A;  3NBH A;  1S4Z A;  3OWF A;  3HRZ C;  2F0I A;  2RQX A;  1NR2 A;  2CHB D;  3CRK C;  2K5D A;  2K28 A;  3J81 E;  2DN8 A;  1TII D;  4RGO S;  3C2P A;  1V8Q A;  2M00 A;  2VNU D;  1Y8N B;  4J1M A;  2K04 A;  1LLR D;  3S1R B;  2D2C C;  5E4X A;  3GTG B;  1AEX A;  1ZEQ X;  4RHR A;  3L9A X;  2IL8 A;  5TSS A;  3OSO A;  1WTR A;  2L11 A;  2NVQ B;  5BN5 A;  3HEJ A;  1TVX A;  2EVB A;  2TSS A;  2JA6 B;  3NK9 A;  1R4P B;  1O78 A;  5ELE A;  3M85 A;  3EVQ A;  5NUC A;  3V2T A;  3H3V C;  4ZKC B;  2R61 A;  1EQT A;  3SXH A;  3GTK B;  1OXU A;  3K6O A;  3SK6 A;  1LO5 D;  2JEA I;  5D65 A;  3KLR A;  1TWG B;  1A3U A;  2O4X A;  5IT9 E;  5D14 A;  5ISR A;  1HHV A;  2IX0 A;  2R92 B;  4YIJ A;  3J80 E;  4HN7 A;  2CW0 C;  5KRU A;  2SOB A;  5KEE A;  4RKL A;  4XQJ A;  1SND A;  1B1Z A;  5IIF A;  3I70 A;  2RSN A;  1TWC B;  2WII B;  4QMG A;  3LNN A;  3HOV B;  1SYF A;  5EPJ A;  3MVV A;  4DK0 A;  4A3E B;  1VDZ A;  2F0T A;  2HDM A;  1HCZ A;  4XT3 B;  4WRD A;  2EY6 A;  1SYC A;  4RCO A;  1Y8P B;  1Y1W B;  5CV4 A;  2AWO A;  5I6W A;  2L1B A;  1SMY D;  3GD7 A;  4I7Z C;  5T1I A;  4A3D B;  1W6J A;  2V4D A;  1WTQ A;  3DWQ A;  3K5L A;  2KEE A;  2JEB I;  2EY2 A;  3FPP A;  2OF1 A;  4O1N A;  4IFD H;  1QOH A;  4C1N K;  1R9T B;  2K7V A;  2ICE C;  3P20 A;  1QIL A;  2F0F A;  4QUF A;  2D9U A;  1AZP A;  1RD9 D;  1TWH B;  2D62 A;  1SNQ A;  2AUJ D;  2JA8 B;  1D1K A;  4HCE A;  3Q24 A;  2A69 D;  1Y1V B;  3R93 A;  4QCL A;  5CMD A;  5J1Z A;  4FXK C;  2BOS A;  1RTO A;  3FPU B;  4A3K B;  2O5I C;  2E2J B;  2RDH A;  1TWF B;  1LT5 D;  5IGF A;  1TKW B;  2A6H C;  1HQR D;  5CBA E;  1I6V C;  3LX0 A;  4R8I A;  4XDX A;  1G2T A;  3TP5 A;  5FO9 B;  1E2W A;  3KBG A;  2JP1 A;  1PYW D;  4LK1 C;  5CV6 A;  2NBF A;  4OO1 G;  4IQZ A;  2H1E A;  3TDQ A;  2B2Y A;  1EL0 A;  1DM0 B;  1CA5 A;  1MBY A;  2KHS A;  1L0Y B;  4FYD A;  4XIG S;  2L12 A;  3D4R A;  1D2B A;  5E3F A;  1ZXT A;  2WAC A;  5G3L F;  5K36 H;  5FK9 C;  2PMZ B;  3VR3 A;  1TQO A;  1YNN D;  1F77 A;  3W3A A;  1LTA D;  1HXY D;  5EQ0 A;  4KK7 A;  1JE4 A;  1CK1 A;  3NHH A;  2M2L A;  4CHT B;  5JAV A;  3GTQ B;  4RFB A;  1AN8 A;  1PRT D;  1EWH A;  3N6R A;  4X3S A;  4A3J B;  4QB4 A;  4RWS C;  3S2H B;  3K58 A;  2NVY B;  1EYD A;  1RTN A;  1KLU D;  2PQE A;  3MHB A;  4H7B A;  2WV6 D;  3MC0 B;  2EYF A;  3NWT A;  4KD4 A;  4KJN A;  2EY1 A;  2K05 A;  3Q6S A;  1SFO B;  1AW7 A;  3SK5 A;  5EKI A;  3DWP A;  3K7A B;  2K33 A;  1TT2 A;  1EY4 A;  1EY8 A;  2IW3 A;  3MXU A;  1ESR A;  4RGM A;  1MD2 D;  1EU4 A;  5M5W B;  3NTK A;  1I4H A;  3H94 A;  4JBW A;  1DON A;  3FEW X;  3MXN A;  4IUV A;  1TY2 A;  3HOX B;  3HOY B;  5JPN C;  1HTL D;  3T53 B;  1WTO A;  1PTO B;  1FYC A;  4TRD A;  5C5L A;  5CV7 A;  2YYZ A;  5I2X A;  3OIQ A;  1TY0 A;  1LTB D;  3K5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...