3DHXA

Crystal structure of isolated c2 domain of the methionine uptake transporter
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
LDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAPLLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVLGYVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine import ATP-binding protein metN
publication title The high-affinity E. coli methionine ABC transporter: structure and allosteric regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 23
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09383 NIL NIL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dhxA00
3AAWB 1YGYA 2LQJA 1O8BA 3DDNA 3OFEA 1LKZA 2RQMA 2RQKA 1LK5A 2P9CA 4GO7X 1SC6A 3IXQA 2QRRA 3TUIC 1Y7PA 2J0WA 3MTJA 3OFHA 2P9EA 3TUJC 3DHWC 3U7JA 2F8MA 1ZPVA 3W7BA 3K5PA 2KO1A 2ZHOA 1KS2A 2I9SA 4X84A 1M0SA 4LUBA 3OFFA 2CDQA 2F1FA 2RE1A 2J0XA 4GO5X 2PC6A 1YBAA 2QMWA 3S1TA 2JOQA 2PA3A 2P9GA 5IS2A 4NMLA 3N0VA 3DHXA 2MDAA 2NYIA 4GMKA 4M8LA 4PWUA 2H9ZA 5IT4A 3L7OA 5T41A 3O1LA 3CEDA 3OFGA 3ENVA 1UJ6A 3DC2A 5FIIA 4IO1A 3NRBA 3MWBA 1UJ4A 3UW1A 3HHEA 3P96A 3ENWA 3AB4B 5IT0A 1U8SA 2QSWA 2FGCA 3AB2B 2DT9A 3IBWA 3TUZC 3OBIA 1LK7A 3ENQA 1RWUA 2LVWA 3MAHA 1PSDA 3LOUA 3LUYA 5JJBA 2JHEA 1XTZA 3KWMA 1UJ5A 2QMXA 2DTJA
chains in the Genus database with same CATH superfamily
3W3SA 1EQMA 3K59A 1XR7A 2HVHA 4JI2F 1R27B 2GC8A 4DV4J 2MZSA 1R0BG 3HULA 5HBMA 1R3NA 4JI8F 2D7SA 3T1YJ 1S1TA 3OFHA 1D8ZA 4NYPA 2XMAA 1T05B 1NB7A 4KHPJ 1AW0A 4MIBA 2BR0A 2CPFA 5HROA 1Y3KA 2HRTA 4QR1A 3I32A 3G82B 3GU0A 2O66A 2HFVA 2KRRA 2CPHA 2B5JA 2CG8A 2DNLA 3C14B 1T8EA 3BR9A 5C24A 4B9TA 4PG7A 1P1TA 2VA3A 1WF1A 1T3OA 4ZVSB 4RW6B 1V5VA 2KKHA 3OXGA 3VAJA 3QT6A 3LALA 3IAS9 5LMNJ 3GLJA 3BBCA 3VGVA 5ETTA 3OTOF 3F0NA 3LGNA 4C6AA 1WWHA 2ZD1B 3ADAC 1DFDA 3RW7A 4CLZA 3OR1A 3PX6A 4C2MA 3QYYA 1WI6A 3ZZRA 3EYZA 3CCUS 2A6MA 2V67A 4QZVB 3QJJA 2FJDB 3Q2SC 1DLOB 1M0SA 4LUBA 3VAIA 1U2RA 4TY8B 5F8HA 3CDWA 2HK3A 1M5SA 3S8SA 3A8JA 3EXCX 1R0AA 3PDNA 2FHJA 4ZPVR 1S1UB 4ZVOB 2B9WA 2OO4A 1FJGJ 4TN2A 5D0EA 4QIFA 4LF8J 2FQQB 1FD2A 3RR7A 1FK9B 3CUNA 3HT3A 4DR3F 1JLBA 1WF2A 4AYBD 1RWUA 1FNMA 3GZ7A 3W63A 2NREA 3G2XA 3GR0A 2ZE2A 4KKOA 4IO9Q 2VUGA 1OJ4A 5KFRA 3MM6B 2Q3PA 4LRDA 1Q8BA 3DYAB 5C5JA 4JI4J 1FE0A 2W4DA 1JLQA 1FRLA 1KKHA 1IUJA 2FDNA 3IR5B 1SV5A 2OPPB 1UWAA 1T03A 2RAQA 3EVOA 4HYKA 2AWZA 3DLGB 1EP4B 1LWCA 4HHJA 1X4AA 2XNRA 4RR5A 3RJMB 2KI2A 1XJWB 4F3OA 4LBPA 4B9MA 3DMJB 2RKIA 5HMXA 1YBAA 4DPXA 3HVWA 2PA8D 2CWXA 3DHXA 1YTYA 1N88A 1X4DA 2HQIA 4X4RA 2ADBA 3O6QA 3V6KA 2Z56B 3P3DA 3VAGA 2LA4A 3CPWR 3BQ1A 3IR6B 4B3MJ 3M1VA 1VS3A 3DGPB 3ZTRA 1UVKA 1JJ4A 2XSJA 5CXTA 3KK2A 2KDOA 4C8MA 2KT3A 3TUZC 4U9RA 1XBWA 3D6HB 3NOCA 1KWMA 2JLFA 2UUAJ 1E6VA 4M94A 3SCJE 1W7WA 4DR1F 2GW8A 3Q24A 4H54A 1YHQS 3PR4A 2FTRA 1T94A 3CJKA 5GMEA 4ZPBA 3ZZYA 3KLEA 3HFKA 2KVIA 5KG7A 3E51A 4USIA 1AT1B 3SDEA 1U02A 3HFZB 3W62A 1NH7A 3QSIA 5E3PA 2GFFA 3IWLA 1Y3JA 1PJ7A 3I0SA 1X60A 1XMQF 4FF1A 3PO5A 2R8JA 2VQEJ 2Y0BB 2CQ4A 3DM2A 3R2DJ 3BO4A 1RKJA 5KFSA 3G4SS 3PG9A 2E44A 1S49A 1O6XA 3AY0A 1CS4A 1QAIA 2Y0SD 3D5MA 2DCUB 4OX7A 1ZZFA 2QA4S 3CJ3A 1LNQA 1MW7A 2I1RA 1IM6A 5LL6d 4USKA 1KVKA 2QE5A 1LW0A 4LFCJ 3CJTA 4Q0BA 3TEGA 3CF5Q 1LWEA 1MWZA 2GGPB 2GCFA 1NAQA 1OSCA 1U7LA 4Y65A 5F8IA 3PXGa 1U1PA 2IYGA 2H65B 2DR5A 4RZRA 3D6FB 2LU2A 4DR6F 4EWTA 1JLGB 1H6KX 4CQ1A 3VGUA 2Z58B 4ECXA 3KJQB 4WP9A 3KLHA 2BVZA 4CLSA 1RHQB 5HQMA 1SUQB 4RBVA 2CJYB 1REVA 2WTFA 2IA0A 3RBZA 3W66A 2RS2A 1TL5A 3POTA 3PCOB 1K47A 1HQUA 4WFYA 3C6UA 2OTLS 3K0JA 1SQFA 2K1RB 3CSKA 3JYTB 2XS5A 4Y0FA 3QIPA 5K14A 1VQPS 1RT4A 2RRBA 1FERA 4JV2A 3KK1B 1EETA 3T6JA 1N52B 2WBMA 4H4KA 2CKWA 4DX5A 1U45A 1MWQA 3R5DA 3CJ0A 3MXHP 3N28A 1H72C 3P8BB 2DGVA 2DNQA 2JSXA 3MZIA 3G71S 1G2EA 3ITHB 5U47A 2WAQD 1HNXJ 2B9YA 4UW2A 1FXDA 4C11B 2XHCA 1Q7LB 2PC6A 3TZXA 4EUVA 4IDKB 2OSQA 4I6AA 3PJXA 1WSVA 1TKZB 3R97A 3DXBA 3ZNUA 4QIEA 2NQPA 1YJVA 3ZZOA 3CDAA 4MK9A 5D4NA 4WZMA 1UZHA 2V5HG 1JXLA 4MFBA 2JX2A 1APSA 3NBPB 5HLFA 3AQOA 2E9TA 1LFWA 2QYCA 1F60B 4F4KA 1HBNA 3M9MB 3PV8A 3MURP 2UXDJ 1K0TA 2QIFA 1RTIB 1SQGA 1U0HB 2WW4A 1S6PA 2HMIA 1HPZA 2L9NA 4JV5F 5J1EB 4QYRA 2DH9A 3QRRA 1NSKL 4OZNA 3THTA 2KJVA 1VQNS 3L4BC 4HDHA 4TVAB 2YNHB 2NXNA 2DIUA 4Y6IA 1EKSA 2B3TB 1HR0F 2ZVIA 1UZDA 1N6QB 2KJWA 2QTWA 3O2IA 5CYQB 1RWVB 2CQ1A 4WXWA 3D3BJ 2NXJA 2BKOA 1IWAA 3DN9A 2M88A 4DQSA 2MZ1A 1Q95G 1C1CB 2HVZA 3MMBA 3BQ2A 4WE1A 2GHVC 1JJHA 5KFMA 4JI0F 3D4JA 4AUKA 3X3UA 4DZDA 3QRPA 1OY8A 1J27A 1QE1B 2KRBA 5C7PA 1YJTA 2HRUA 1HNZJ 3K17A 1VLOA 2KT5A 3WHIA 4NCBA 4F2RA 1TR0A 1FDNA 4IOBA 4ZVGA 4FS1A 2HHUA 4RJVA 2C3PA 1TK8A 3LP0B 4UUXA 2WCXA 4AXIA 3CD0A 4PUOB 3I56S 4JI3F 4P75A 4K4SA 2B4PA 2UVVA 5DG9A 2QFJA 1LWFB 2ASDA 1KVJA 3KXDA 3I87A 5ADZA 3TYTA 1EX8A 1S12A 2GS8A 1X7VA 2YKNA 4ATNA 2P9GA 2H5EA 3ZZTA 1KQKA 3RGIA 5HBMB 5EN1A 2VPYB 3GP9A 2E7VA 2FLOA 4EBCA 2JEFA 3M30A 2LXFA 4DG1B 1S1TB 4OQJA 4CO2A 4DL2A 5DRKA 4OYXA 1WTFA 3MWBA 5KFTA 3PEJA 3BREA 1D8YA 1X5PA 4ZP9A 4RNNA 3SMZA 1SPBP 4KPCA 5HQ8A 4FDFA 1B0VA 4UOHA 4MYUA 2HIYA 5L8RC 2J7WA 2P8IA 3RU0A 3DU5A 2W9AA 1AA1B 3PNIA 1L3UA 4MAKA 5DDOC 4ER8A 4FXVA 5EX0A 1V6HA 2G0CA 4ILLA 2MQ8A 4KAIA 5KFPA 1YSJA 2GV1A 2A6OA 3CMAS 4KFBB 4A8OA 3GJRB 3OUYB 1YJWS 2IVYA 2XEXA 4GVBA 2HHTA 2IDEA 1VQOS 1S10A 3I0RB 3MM9B 5DQIA 1O5JA 2LXIA 2KO1A 2J7UA 4DR7F 1JK9B 2DVIA 1RYRA 5DJBA 2ACMA 2O5DA 4BC9A 4K0KJ 3Q22A 3Q83A 4CLUA 2H4YB 2OD4A 5B0CA 2KM8C 1XC9A 2C1EB 3MMJA 3N01A 2MGZA 1VYAA 2FD2A 2CNKB 1AXQA 4NASA 4ZCMA 1VQ5S 4NXMF 4OYPA 4CT8A 2G4BA 5CAAA 4U96A 1RCXB 3PHTA 4X2BA 3W2VA 4X4OA 4DPYA 2ZH4A 5H1SV 2CNNB 3ETMA 1B64A 1QAJA 1NJZA 1SKWA 2MXYA 1DTQA 2HEKA 3CIZA 4NZ0A 2HVEA 4WU3A 1GEHA 2PE8A 4XTTA 2DHXA 5HJYA 1WKJA 4U67Q 3MAQA 4OIXA 3KJNB 4JI7F 3DLKB 2ZZMA 2I5JA 1NZ8A 3DRXA 4DDFA 1NNDA 3SQGA 3P4UB 3W8PA 4PPDA 4URQU 4G1IA 3EDQB 4K4YA 2QJ3A 2WB4A 3BZQA 2NUHA 4N56A 2J7KA 3DLEA 3OD2A 1LW2A 2ILYA 1U47A 4F0MA 5D4PA 4LF5F 3OW2R 2RDDA 1URRA 4ZCKA 3TJ8A 2OFGX 1X4BA 2QYGA 2HHVA 1V9OA 4HT5A 3NGRA 3QGHA 3RTVA 1FT8A 3B4DA 1YZ7A 3I31A 5E2QA 3LGHA 2M4MA 4O3OA 1NH8A 4E98A 1S72S 4L75A 2MKKA 4BBYA 1QUPA 1WC1A 5JVGQ 2RDJA 1HIYA 2Z8QA 4M5KA 2XSJB 5A2QY 2B0GA 1CG2A 2VQFJ 3QRQA 3KK2B 4OLOA 2ALZA 2MKIA 3R7NB 3M8PA 2G1DA 2UU9J 1PYSB 1CVJA 5AT1B 1M1KT 3CD6S 2EEYA 1VQLS 3CJ8A 1K0VA 3T5KA 4C9DA 4I1TA 4NMLA 3KLEB 4X4SA 1F2HA 3DDKA 3W60A 1VQ7S 4PZVA 2NPFA 3VQSA 4AXJA 3IRXB 3SDEB 2Q43A 4EGLA 4B08A 1FEHA 1X4GA 2CZ4A 5ETPA 2GMHA 2HVIA 1A6LA 1FRJA 2POKA 1XMBA 3WX8A 1JLAA 3I0SB 2FHOB 3CXCR 4N47A 3IG1A 4JI2J 1N5QA 1VC6A 1Y11A 3OVAA 2JHEA 3ZXWA 3UCZP 1AB8A 2P6SA 4ZPDA 3DM2B 2Z2YB 1IBCB 3NAIA 1GX6A 4NLPA 3HJFA 3ET6A 2EC0A 2L3MA 5HVFA 1IKXB 4V1Ak 4KIAA 2YWWA 1I3OB 5BYQA 1Y7PA 4I2PA 1PGZA 1VIOA 4RW8B 4B02A 1OS5A 4DV0F 1IR1A 1S76D 1J5EF 3OFFA 3IM9A 1LW0B 1N4LA 1SKRA 2HHQA 4UZCA 4LVOP 3IFEA 4USJC 1NK5A 2CQHA 1BC6A 4QPTA 3CO0P 1QVFR 2RH3A 1HD0A 2N7YA 3J7A1 2NSBA 4LBHA 3B78A 2RMLA 2WSCC 3HM9A 4B9UA 2HIQA 1B4SA 4N5SA 3MI7X 4DR5F 2GHWA 2D3O1 5G0RB 1SC3B 1Q82T 4IRKA 3CMQA 3L7PA 3RBXA 1GXUA 3POTB 3ISZA 2W4CA 2DRBA 1VBZA 4K2JA 5HSPA 1D9DA 2P9CA 5KFQA 3HSGA 4YN3B 4ILRA 4ZPAA 1ZPWX 2C42A 4ED7A 1RT4B 3GONA 4LR9A 1IBMF 2V4QA 2YY3A 1T9UA 4OZ2A 2RT3A 4GO5X 3U02A 2HFNA 2XWYA 3Q8SB 2AP6A 3TQ1A 2DNNA 2EPIA 1F9FA 1U1LA 1PBUA 4M8LA 1KQFB 5DLGA 3FMWA 4DR3J 3V81A 2CJAA 3DLBA 2GHPA 1Z1ZA 1GXTA 2P5VA 3W65A 1WDDA 3W8GA 4D3GA 1IJFB 3PIOQ 1WDTA 1QAYA 4ALZA 4OI2A 4ICLA 4ZHRA 2G9OA 3FGVA 3K5OA 1NB2A 5C42A 4O3SA 4QR2A 2RJZA 3PYEA 2F63A 4MFBB 5A6PA 3BGRB 2ZH2A 5HLFB 4Q2MA 2MKHA 2IC3A 3OJSA 2R4FA 1RWOB 5J2PA 3MMCA 1IBKJ 3E01A 3QT7A 5JXSA 2KFNA 4DXLA 3H42A 2ZBPA 3V6DB 4P7VA 1A9NB 3IWNC 4RBUA 3FBCA 3BYPA 1NJXA 1X31C 3T1HF 3QBCA 1IKVB 1S6PB 1DTTA 2B9XA 4P74A 2MZQA 3M2RB 4NEZA 1HPZB 4WJBA 2HHHJ 2ILZA 4KGKA 4USWA 3FRZA 2OLWA 2YQ1A 3MM7B 1UVMA 3B54A 2JDJA 3OL6A 3AD7C 2AYGA 1W2IA 3LQVA 1FXLA 2U2FA 3AB4B 5T14A 4NX9A 3UE2A 2BJ3A 4CLFA 3IWXA 4E2FB 2CJXB 2F7VA 2IFXA 3U1LA 2NXCA 4CO4A 3A3OB 1NDLA 4URSA 4Y2MA 3KYLA 4ZJQA 3DDNA 2P6TA 4Q8EA 2MLXA 4PAAA 2W25A 1DQ8A 2RF2B 1L5UA 5DDQC 1NSAA 3H0PA 2UVUA 1SCJB 2V8PA 2DNYA 1XMQJ 3W7BA 4B9NA 3LP2A 4C3LA 1BQXA 3NNCA 2XYPB 2KG1A 2R7WA 1SL2A 4M5DA 2AMCB 3HHLC 2H54B 1N34F 4QYZK 4ES1A 3D9BA 2ZUGA 4GMKA 2DKOB 2GIFA 1UEVA 1XWLA 2CJKA 2IMOA 3BYRA 2W8KA 1WACA 1MWYA 2H5IB 3SEOA 4Z2XA 3TI0A 1JNRB 1U8SA 3VWSA 1J2VA 4X64F 2YKNB 3FFIA 2LVWA 3H40A 1XNRF 5KFDA 2GQQA 3IC1A 4ZDNA 3AA9A 2FGOA 2VG7A 2N4DA 2GVZA 3BF4A 3HVTA 4ZN1A 1HWIA 2BANA 4LIWA 5KT6A 1FX2A 4R8UA 2CIMA 4DR6J 4Q7AA 4DSJA 2LP4A 1N5YB 1NUEA 4DV3F 2OI2A 2CJ9A 3A8EA 2AZ3A 3UR3C 2D9PA 1S0MA 1WKLA 4RL1A 3E2EA 3MR5A 5FDLB 2V63A 5K5MA 1G6BA 4KO0A 4ED8A 3MTKA 4NOHA 4OX9F 2W9CA 4GVBB 4PRFA 2MYFA 3ZC4A 1BQMA 1S9EA 4Z7YA 2RDIA 3TA0A 2HNDA 4FXWA 2PGCA 3PYGA 5BR8J 1FNOA 2CPEA 3SFUA 1WJ9A 4NL5A 5JUMA 2GIRA 2PEBA 3TJ9A 8RUCA 1KBRA 3KLVA 1R6VA 3D68A 4WK1A 4C0HA 4LF2A 2M7SA 3SBMA 2LECA 3EICA 3QLHA 1UVNA 1U48A 2CA9A 4DV4F 5HATA 2KZMA 4DHVA 3ILIA 2LU1A 3GIJA 1FDAA 3RAMA 3HSDA 4ZVFA 4NLUA 3TO8A 3UDEA 1NK8A 1Y5NB 1V5IB 4K50A 3CD7A 2XHWA 2ZZTA 3C3LA 2DGTA 2JH3A 1DTQB 5D4LA 1RHMB 4GRSA 2A2CA 3RRKA 4ZJOA 2M2BA 3TP2A 4P72A 5DQHA 4RW4B 2OPSB 2OIHA 4F4WA 4O3PA 1UVJA 2I5JB 1T95A 2WSEC 3ZZZA 5GAHU 1T02A 3C6TA 3RG6A 4OI0A 4G1QA 4UOGA 3SSRA 4IOAQ 4MIAA 1F9HA 2CQ2A 3JSMB 4DSKA 4K4ZA 3VR1A 4ANCA 1U0SA 2C2NA 5F3TA 4PQUB 1S1VA 1RI7A 5E5NA 4LR8A 3BEGB 3KHGA 5J1PA 4JV5J 5LMNF 2MQOA 5B0AA 5L1LA 3SI8A 3CE8A 2WHOA 3MECB 2W7AA 4EZ9A 5IC4B 2JEJA 1Y10A 1GK8A 2GVDB 1NCLA 3EGNA 5ETKA 1JNZB 5HL7Q 1J5OA 4H4MA 4NI2B 3UVJA 3MD1A 1E6YA 3D1HA 4F25A 2FJWA 2B51A 1ZPVA 1YK9A 3CCQS 3D2WA 3FJ2A 2WONA 2VG6A 1ZTTA 4I2QB 2PA3A 2IJRA 1Q16B 1WKKA 1ZBTA 2EFNA 3PACA 2OUGA 5JVHQ 4Y2CA 3M8PB 1WC5A 5ETQA 2C3OA 4LF8F 4EO8A 3H90A 2UUBF 4MK7A 2DCLA 2YVSA 4MTPA 2VV5A 2L08A 1GQEA 5KFZA 2WVBA 4FBUA 5J2MB 4FF4A 4Z7CA 4OJHA 5DG7A 3P5TL 2MPUA 2AJQA 4P52A 9ATCB 5AXNA 1U1NA 1S4FA 1IKWA 4OX8A 4ZLJA 4J5OA 4RW7A 1VDHA 1JXVA 2ZJRQ 1ULRA 4ZIVA 4JI3J 3BGUA 4JV0A 3W64A 1CJUA 5KT2A 1FJCA 1T0TV 3R2CJ 4Q8FA 1LV5A 4R0JA 3AD9C 2PT0A 1Y00A 4FP9A 5B0BA 5LSLA 2DY9A 5IQQA 2XMWA 2BE9B 5M2RA 2HFOA 3N9UC 1RABB 1FKOB 3TX8A 1FI4A 2BJDA 4X4UA 1JLEB 5I4MA 3A4TA 3ET6B 3UQSA 5I3UB 1NK4A 1KD1T 3M2UB 2EKNA 4PWUA 1X9WA 4B3MF 5IV3A 4I2PB 1VK8A 4CLKA 1EHWA 1T9WA 1MROA 2EXUA 1HI0P 4OLPA 3OXFA 2D3UA 1PYTA 4F04B 2AEJA 2CFXA 4LSZB 2IVFB 2DHSA 2FB0A 2UUAF 1REGX 2F4VJ 4HACA 3WC2A 2PMHA 3TARA 3CMES 2UVWA 3KMQA 2N82B 4J9SA 3HK2A 2L41A 1TVRA 4J9PA 1CBKA 3NGUA 2QA4G 1G7CB 4DCPB 2WVFA 5A2QU 4I67A 1VR6A 3I5AA 1HYSA 4RLEA 2HQGA 3K8WA 4QBUA 2GJIA 4L72B 1FWKA 1TL1A 4CM2A 3GQCA 2D69A 2WSFC 2ZHOA 4M1KA 4ZPWR 4KGZB 2DEJA 3QNWB 4OV6A 4NXMJ 2K7JA 2WW8A 5A76A 4O3NA 3D0HE 4PYDA 4DR4F 3D0GE 4AQYF 1S97A 1UJ6A 5EGYA 3UR0A 1RT1B 1N54B 3Q0AA 2AYMA 1S48A 4DLEA 1ZM9A 1KN6A 1FJEB 1EIYB 3UCUP 5HP1A 3J7ZT 3BH6B 4CLLA 2MTLA 4NLDA 5AXMA 4O0NA 4NXNF 2YKMA 2JC1A 1JLCB 3M2VA 3V81B 2PMZD 3MEDB 5IM0A 2PMWA 4WP3A 1S6OA 4LQ9A 1D0EA 1OO0B 2H5JB 5KT7A 4I7FA 3DHWC 4J7CA 2HGNA 3HVRA 1RWWB 2GQ2A 1QM9A 4RBTA 1VRUB 4DSEA 1U49A 4LF5J 3BSAA 2RE1A 3LAKA 3QO9B 4F7VA 2MZJA 4MMOA 2XMTA 2AW0A 5J2PB 2CQ0A 2B43A 4OYMA 3E01B 1UCNA 2WZ1A 1YITS 4EK2A 3NRBA 1JLFB 1WG1A 9RUBA 2AX0A 2XMVA 1SJQA 3DI6A 3GYNA 4F8RA 3NCPA 3MD3A 3C46A 3TVKA 3VGTA 5K8PA 3MAAA 2L48A 5HVGA 3DOMA 1S1XB 1R8BA 1GMWA 3PX4A 2IJNA 5LMUF 4H4OB 3OL9A 1OQ3A 4MKVA 3F44A 2EK6A 1F2GA 4CLWA 2XB2D 4GO7X 3O5TB 5LXRA 1ZA2B 1U4BA 5I3PA 3R1LA 4USTA 3K58A 2E7WA 5MAOA 5IOLA 2OKQA 2DXEA 3KFWX 4A8KA 1MSWD 2AEMA 3GMGA 4LF7F 2NUUG 3KLFB 1GMUA 2KHCA 3RB3A 2ABYA 2VD3A 1SJ4P 4ELUA 2RU9A 1XNQJ 2RQ4A 4ZVQB 1NBEB 1D1UA 3MUTP 2J76E 4ID8A 2BABA 4NYOA 3FBFA 2J9DA 2QSWA 5IZHA 2FGCA 1XIQA 2UXDF 3OL8A 3T6BA 4ZP6A 1QSSA 5KG3A 2VOPA 1CPZA 3CD5A 2IBKA 2BXJA 2NYHA 2LFVA 1N56A 4I6YA 2CVEA 5DLFA 1N48A 5C2CA 2M8HA 1Q81T 1RWKB 4ZIWA 1VISA 2W8LA 3KLIA 3PO4A 1RJJA 2HNZA 2ALYB 4P7TA 4IRCA 1J5EJ 3FFIB 3A3NB 1H0HB 4O3RA 1RCOB 1ZM2A 2UUTA 4ENOA 3QSYB 3DU6A 3MM5B 2IPOB 1OMSA 4C3MA 4J9QA 2EI5A 3HVTB 1Q78A 2BEFA 3UDVA 3R3TA 4RKUC 2A3JA 3M8RA 3NCQA 1AYEA 2HZVA 4UOFA 2XO6A 4QU7A 1R6YA 1Q1KA 3MEGB 2ZEJA 1SJFA 4DV2J 1Q8LA 5A8RA 3J81j 4DR2F 4J9UE 4RW9A 1VIXA 1ZM3A 2CQ3A 4DS4A 1FA0A 4ZCLA 3GJSB 2OMLA 3T19A 3GE9A 2DHAA 1ZAVA 3MPUB 1UKUA 1NSQA 2Y1RI 2QFIA 2VBZA 4PG5A 2DTJA 1S9EB 1M5HA 3FK4A 4J91A 1C1BB 2HNDB 4LVNP 4B3RJ 3HHLB 1RWMB 3M4XA 1DAXA 4QIWD 1SVDA 2RQKA 3PX0A 4CO0A 3MTJA 2UZAA 3QLHB 1R89A 1EARA 2I9SA 1NEEA 2YPZA 4P6QA 3H98A 5I3QA 1B7YB 4IG3A 1QLNA 1JJCB 3DOLA 1IVZA 3O1LA 3IN5A 2YNGA 1CJKB 3SIPB 3UNGC 1VBKA 3US5A 5KG4A 1FWPA 1NXIA 3CCLS 3G96A 2E9RX 2J6TA 3ISND 6AT1B 2HBYB 3NLCA 5F3ZA 5L1KA 1VMBA 1Y9OA 3W1YC 1KFSA 2XZDB 2CPJA 1T9YA 1RA7A 1HBMA 2VICA 1XTZA 2ASLA 1DHMA 3PIPQ 3BSNA 3HT0A 4PKDB 1QSYA 1XR5A 4J9VA 1HARA 1TU0B 1S9GB 2QLXA 2XY5A 4TQSA 2MLZA 2EBGA 1M5VC 5KFWA 4F2SA 1WG5A 5F8GA 1VQSA 2M70A 3N4WA 4ETXA 1HFEL 3W9HA 2R8IA 2DRDA 2QX0A 1RHUB 1HA1A 3A12A 1B7FA 2QA2A 2R7SA 1VC5A 1ZS6A 4U7CA 2XZWA 5SZTA 2YNIA 1GMWD 4OYAA 2JFDA 5LJ5Y 2J8SA 2WOMB 1AROP 4B3SJ 3UVJB 5HN0A 1AZSB 3ZTQA 1CJTB 2O3DA 3DC2A 2KXNB 4RU9A 2VKZG 4O23A 4BCAA 2KHDA 3CJ4A 5J2QA 4F0KA 1PC4A 5ITHA 2W2NP 1TMMA 3T9ZA 3RBDA 3I4HX 4FKXA 4U7UK 1VFJA 3PW0A 1PJ6A 4R5PA 5H9EJ 3H4BA 4P2XA 4EEYA 2AV5A 2B4UA 3PHEA 4P2FA 5GADI 3ZTSA 1IN0A 2FLPA 3BGLA 4TU9A 5F8LA 4MT1A 1SQEA 3LH2S 2IM1A 1MG7A 4DBQA 4X65J 3I4PA 2FVQA 3FZBA 4WP8A 2E29A 3MEEA 3AOCA 2BE2A 3TOQA 2F4FA 2HLUA 4L6V3 2R7OA 4NZ6A 1N34J 1IKWB 4YFUA 4DUZJ 4LF1A 4RW7B 2ZBQA 1JKHA 2BYCA 2DGUA 2QMWA 1IKYA 5KG6A 1DZ5A 1Q5YA 4UQTA 5IS2A 1U1OA 1CJUB 3L9ZA 3CC4S 3MR6A 3AH6A 2HNYA 2HBZB 1BXNA 4CT9A 4NLTA 4M5HA 3RB0A 4IO1A 4ZP7A 3GG0A 5M2PA 2DK2A 2LQ8A 5GMKa 4U8YA 2L9DA 4BDPA 4Y28C 4CH1A 5HO4A 5IT0A 1FRXA 4EO6A 5K20B 3EE3A 1C0TA 3K5LA 1EB0A 2KL8A 3LUYA 2HZCA 1UFWA 5KFLA 2OPQA 1KLMA 1QUVA 3HLUA 2I8EA 2HAFA 4ED4A 2QZ8A 4X66J 2CPDA 1N0UA 3W2WB 4NLQA 4PWDB 3DRSB 4QU6A 3BPSP 1UETA 4ANEA 4ILMA 5L9XA 4HACB 4J9LA 5KT3A 2KG0A 3BQ0A 2VJUA 4JUZA 4NLYA 2F8MA 3T41A 4DCJB 2KYXA 2I2YA 4M5GA 5A0YB 3T5JA 5CYJA 1WC3A 3E3XA 1H38A 4NRTA 3N5FA 4FYDA 3KJFB 1TK0A 1IR2A 1RTDB 4K59A 4DV1F 3B4MA 3B8HA 4ZS6A 5D15A 1RT3B 3KJVB 3ENVA 2GX8A 2XLJA 4W90B 4LSNB 2J5AA 1TMJA 4A8XA 3A8IA 2OGUA 3MPYA 4LF6F 3V4IA 2QLWA 3R5GA 1RZMA 3Q86A 3MM8A 3N6LA 2CQCA 5ETRA 3MOZA 3KMSA 1RQ0A 1QD1A 4G6VB 2HQDA 3CCWA 1SIWB 3TAMA 4JI5F 5CHCB 1PAUB 2IYIA 4TKTA 2PD1A 2QLBB 2OPRA 1EKRA 2RS8A 5SUHA 3CCTA 5DO2A 2EC2A 1TP7A 5L9NA 2CNOB 5IM0B 2OH2A 4Q5VA 1RT5B 2NYIA 3UFCX 2BW2A 3A13A 3HX9A 4HEA9 4KQZA 4I7FB 1FO1A 1TUVA 2UUCJ 4OZ3A 4ZLLA 2ZZNA 4ZA1A 1DQ9A 3UD3P 1N5TA 1VI7A 3TANA 5KFAA 3RUBL 2DT9A 4G65A 2MKSA 2GA7A 3QFWA 3RR8A 3CO9A 3MCMA 5E7OB 3CW2C 4CYUA 3RW6A 5H9FK 4RUHA 2ZUAA 2LQBA 1OSDA 1LXJA 3DI6B 1ELOA 2V50A 1RT2B 5A8KA 2RQMA 4PWWA 3CJ2A 3J81Y 3RYLA 3MAAB 5E3QA 1FRIA 3P6YC 5KFXA 2CZ9A 1RTJB 4QR0A 2IAJB 2AYEA 3QJLA 3KLGA 1WHYA 2UUBJ 1RAGB 3Q8PB 1BHNA 2MDAA 2QN6B 5DG8A 1S1WA 2J0QD 3PYDA 3MPDA 3I6PA 3GCWP 1PO6A 4NRUA 4G1PA 4DFPA 3UCGA 2AT1B 1X0PA 4FVCA 4WIIA 2COLA 3SSSA 1SIZA 3N6NA 3D6MB 4ECZA 1PKUA 1RTHB 3LA0A 3OTBA 4LF9F 1QDUB 4AFFA 3FEZA 1GX5A 3MMAA 3IGNA 4LRBA 3E8OA 4O4RA 3QT5A 2VODA 4PR6A 1GT8A 3SCLE 1DY3A 4DEZA 1IR0A 2NZCA 3R5BA 4KV8B 3R1HA 1HI1A 4ED5A 3FBBA 1CQMA 3NGDA 1IBKF 3IS9A 3SFGA 5DGAA 3IXQA 4K8RA 1SJ1A 4PQAA 3IP0A 2R7RA 1NDCA 1GXLA 1R43A 3AQPA 3CCMS 4IH5A 1NPPA 4J9NA 1GFWB 4DOZA 4WBFA 1HNVB 3KLIB 4OJGA 2HHHF 2C2ZB 4OYIA 1K73T 4ZVPB 5BYSA 1RLDA 1VK3A 2PEHA 2HK2A 2R8GA 1NJYA 3PR5B 2CXEA 2E66A 1NM2A 1GNKA 1RA6A 3TAQA 3K89A 3CCRS 2Y8WA 5KFYA 4DF4A 3V2UC 4DX7A 4B3TF 5F8NA 1YDLA 3HP6A 5J2NB 2V4JA 2V6AA 3H20A 1CJVB 1S77D 3BKFA 2RU3A 4FPIA 4PXCA 3HF5A 4HVZA 1FNXH 1NHVA 2ZC3A 2WB1D 2DYAA 3JTPA 4N77A 1OYDA 1RHJB 3PY8A 4IQXA 5F0WA 2EFQA 1FCAA 3ELHA 3HHDA 2MQQA 1N8RT 2HURA 4HHUA 1W26A 1S7IA 4K7QA 5A6WA 4I68A 4DR4J 2DHHA 4AQYJ 4MKBA 6FD1A 2WBRA 4W4MA 4OYZA 1UTAA 3OSPA 1NK9A 2J6UA 1KRPA 1MNEA 1PBAA 4CI0B 5ETSA 4X4TA 2O01C 2YH1A 2A2DA 1YRUA 3G82A 4NA1A 5IT4A 1ZA1B 5I42B 4XO0A 2D3OR 4MKYA 5F41A 4Y34A 3MR7A 2HHXA 3BGFA 3L3CA 2B4OA 7FD1A 1Z4UA 2F8EX 4HTIA 1YIJS 4NXNJ 2RQCA 4B3OA 5D0GA 1HBOB 2M5YA 5G4DA 3NS6A 3HZGA 4DX6A 2YBVA 4KBIA 2ZD1A 3M6VA 1S6QA 2XMMA 1OWXA 3R6GB 1L3TA 2A18A 3UNYA 3KK3A 3JXOA 1V3RA 3EPIA 4DSFA 1HQEA 2BE7D 1WC4A 3MR2A 1ZYQA 1P27B 3D1QA 4CIOA 3UI3A 4J37A 2CRLA 3MCOA 2ERRA 1DLOA 3I82A 1G1XA 1N32J 4ZVRB 2XGPA 3GR1A 4NLVA 3FCHA 4OZ1A 1H73A 2NXEA 5KFKA 3G6ES 3KNAA 4B9LA 2W1BA 2ASJA 3FSXA 4IFVA 2KFYA 3D28A 4ID5B 5FIIA 3J80Y 2HHPA 3GSDA 1TKXA 5BR8F 4B9SA 2MZRA 4F4AA 4UZBA 3H5UA 2F3JA 4LSLB 4USHA 2VPWB 2RVJA 3QQCD 3I9ZA 2V4RA 4KC5A 1KDNA 4IG0B 3J7AN 3MM6A 2OTJS 2ZBRA 2F9JA 5LMUJ 3GFZA 3MAHA 3PVXA 1VRQC 5K8NA 4AL5A 2V68A 2VBWA 2R7VA 2B6AA 2EW9A 2QMXA 3A8KA 2IMWP 4QOTA 1RADB 5IFMA 3H5SA 4LF7J 4K4UA 3DLGA 1EP4A 2VASA 4I69A 3TUPA 1YJUA 4M5NA 4EYHB 1F5CA 1RT7A 3VQTA 2F40A 5B0GA 2B8PA 2RILA 1RDRA 1B0TA 2D9OA 4PXDA 2FJBB 3C16A 4ZP8A 3TZWA 2ZJPQ 1SH3A 2E5HA 3CC7S 4V19X 3CT9A 5GVQA 1KLNA 2BE2B 2W9BB 4FYWB 3PRDA 2OMOA 4ANDA 3DGPA 3KHLA 1N5VA 2BJ8A 2YX1A 1JKHB 4DUYJ 2Q1LA 3SZ2A 1KC8T 3ZZUA 5A8WB 2N4CA 3R5CA 3AT1B 3G8QA 3L09A 2AGOA 2VFSA 3QIDA 3BS9A 3LAMA 2RIJA 2DH7A 4KT0C 3GIKA 4I64A 2JLEA 1HI8A 5D0HA 1TV6A 2B7CB 4I56A 1PG5B 3U1MA 3M9OB 3AHPA 4U6PA 2V2QA 4YR2A 4OL8A 4CO5A 3ILLA 2PFDA 2E1CA 3JTNA 2YWHA 5B0DA 2VF3A 1KLMB 2KN4A 3UO0A 4OHXA 3H7HB 4QIVA 2CJQA 4WFXA 4DR2J 2K06A 1NSPA 2DRAA 4OI1A 5B0EA 5DM7Q 3D0IE 2F8HA 2FLLA 2KU7A 5T7LA 1N36J 4O4GB 1D9AA 3DFEA 1SKUB 3TJAA 4EI2A 2B8QA 1VQYA 1TQLA 4DN0A 3J7Z5 2DITA 3DLLQ 1RAHB 2DXFA 1RK8A 2VU5A 3Q8UA 3ILOA 1NHUA 4QWCA 1I1GA 3JAMU 3QT8A 4ES3A 2BJ7A 3BO3A 4G3IA 5IQ6A 4QIGA 1Q86T 2LQJA 1B70B 1PAEX 2GGPA 3LPEA 4KHRA 3D3CJ 5FD1A 2XBPA 2ZWOA 1PC5A 2G13A 4P10A 2V8VA 1Z2LA 1RSCA 1UAWA 1P9YA 4ZCIA 3DLJA 2AX1A 1JLGA 3R7BB 2JC0A 3MEKA 2ZH3A 2QA1A 4GC7A 1TL3A 3KUGA 4TY9A 1IQZA 4K5SA 3G87A 1SUQA 4K4WA 1NU4A 3TAMB 5CCMA 4LFAF 3LGMA 2BJEA 5IV4A 2R9LA 4F0HA 3EZOA 5HROB 2LEPA 2PI4A 2BX6A 2IBOA 1KQSR 2XTJP 4KTQA 3HXMA 2EG1A 2K1RA 1ZETA 2VC1A 4JV1A 4NMXA 5D3GA 2F4VF 4EYIB 3OTEA 2B5JB 3FSIA 5IWAF 3KK1A 3FSYA 4OHYA 5C24B 1Y4ZB 4WKRA 1BE4A 4DU8A 1BY9A 2ZOFA 4OYWA 1V3SA 4C7QA 3VCDA 4ECYA 2M3DA 1FRHA 3OT9A 4NWBA 3OL7A 1JX4A 1XQIA 4JI1J 1O8BA 5KAKA 2DGSA 2HQFA 1QAXA 1M5PC 4LRCA 1UMJA 2CWKA 3ITHA 4YY3F 3H2UB 1FKAF 2F65A 2BUNA 2QL5B 3BKUA 2FC9A 3OR1B 1UFLA 5AE3A 3GSIA 4CYUB 4C11A 1Q7YT 3PEHA 3GYGA 2FPHX 1DRZA 5B0FA 2V0NA 3TEHB 1ZAWA 1X8DA 1NO8A 2DR8A 1SBRA 2I38A 2OAUA 2G2ZA 1R0AB 5CQGA 1WEYA 3NBPA 5HVHA 3M8SA 4Q45A 3FUYA 2AHOB 2V34A 4CH7A 1NDPA 3W9JA 2GMLA 3NGTA 2XZTB 2CQDA 3AB2B 2DR6A 2VA2A 1T9VA 3ENQA 4QWDA 1RTIA 1JLBB 1U0HA 4DWIA 2ZE2B 4KKOB 1HW9A 4KB7A 2Y9HA 1SL0A 1U2FA 2DNMA 4U95A 2BOPA 1JLQB 1X5OA 4N8NA 3B6BA 1SV5B 3KG0A 1VOMA 1NRKA 1MN9A 2YNHA 1T03B 2FVCA 4YB7A 1LWCB 3VVUA 5KFHA 1D3WA 2AF6A 5CYQA 4HHHA 1K1SA 4YP3A 2XO7A 4F3MA 4M5LA 3VGSA 2VBYA 2H3EB 2XS2A 2DNKA 4ZVHA 2RKIB 2XI2A 1SJRA 4WCEQ 1C1CA 4YEAA 3KHRA 4RUBA 4Q2LA 3AOAA 5GAGU 1LXNA 4RWXA 4TLQA 4X4NA 1HHTP 2YQ3A 3M1VB 2DD8S 4J9KA 2BMBA 2ZH6A 2GMJA 1FTCA 2FJXA 3MFHA 1KFDA 1E6VB 1FXRA 2BRLA 3W5YA 3V6JA 1BGXT 2V9WA 2ZNYA 2FZGB 3LP0A 2J9EA 2DNZA 2BQRA 2J8AA 3CJKB 3J81U 3CJSA 4NPOA 1SC6A 1LWFA 3V5RA 2RHSB 4DFMA 3TX0A 3THPA 1DURA 1RGVA 4YQWA 4YOEA 2AGPA 4DQRA 1Q8IA 1BUXA 1DJ0A 1SKSA 5C25A 4DV1J 1LFPA 4LQ3A 2HSEB 1JB0C 4JP8A 1XNQF 3HO1A 2QLJB 3Q8VA 1OY6A 4FN5A 3G6VA 4UY8T 3N0VA 2ZKUA 4GKJF 3D7SB 4DG1A 2E5LJ 3P49B 2X7IA 4I6WA 3CIMA 4CLTA 3IM8A 3K2YA 4LF6J 2C3YA 4KSEB 1S4EA 4DLGA 2RUGA 1GTHA 1KEKA 3R7SB 2G0JA 4CNYA 3FCVA 2CVIA 2DGWA 1T7PA 2R3VA 1HLWA 4DQIA 3PTWA 2OELA 1RAJA 1ZTWA 3CCVS 4E8UA 4DV5J 1CS4B 2X1FA 4A8QA 2R42A 4JI5J 7FDRA 5DS7A 2GZOA 4WFBQ 1OIAA 1VQMS 4DU7A 2BOAA 4KFBA 2HRYA 3OUYA 1U1KA 1LK5A 4Q0BB 4DL5A 3PW2A 1EJ7L 4B3OB 1LWEB 3I0RA 1UEUA 3MM9A 2J9DE 4LR7A 2YX7A 2YXLA 1HWJA 1RP5A 1FTRA 4NLOA 5E3AA 4QW8A 4CO1A 1S6QB 2ZJQQ 3GG1A 1RU2A 5D6GA 3KK3B 3J7YU 1T3NA 1HQEB 1MLAA 3EGZA 1SXLA 4JYAJ 3JSBA 3ZFVA 7AT1B 4DV2F 4WPAA 5AE2A 3HFVA 3KLHB 2FZCB 5HAOA 1REVB 1KP6A 2JWNA 4LRAA 4JOUA 3MUVP 3SCKE 3T5HA 1HQUB 1W25A 3C6UB 2BKNA 2BBEA 4ECQA 4IFVB 3H4DA 1PCAA 3QIPB 5K14B 2MJUA 4B3RF 2QSFA 2NS1B 1TKXB 4A8SA 2I0XA 3VTIA 1NK6A 3HSJA 2YWFA 6FDRA 2WVDA 1EETB 2LDYA 3DLKA 2MZTA 4RU2A 1NPRA 4Y3CA 1Y0HA 2XGQA 3BDEA 2V8DA 4XPEA 2JEIA 2Q6CA 2M52A 3UPFA 1TTHB 4KPYA 2FYXA 2B6AB 5KOWA 4JI6F 3ULHA 3ZNJ1 4M95A 4WWSA 3UN3A 4ZLNA 3OR2A 5LSRA 1UEKA 2QL9B 4HKQA 1RT7B 4QWEA 4DL7A 2DXDA 4LF9J 2IM2A 4CM0A 5LT5A 2AKWB 2QGFB 2ZWPA 1P9QC 2X3DA 3Q2TC 2BRKA 2VONA 5CD4H 2Z30B 2C3UA 3C16B 4P71A 3CGIA 2XLIA 3UD4P 1L3KA 3NAHA 1R31A 1RAAB 1R8AA 5KTQA 5CABA 1HBNB 2DJWA 2WRMA 4QCLA 1UPPA 3HHKA 3G8SA 3BKTA 1NMEB 2HMIB 1VHIA 1WEZA 1K9MT 3T5LA 2LYVA 2VPXB 2XMUA 2CQIA 2YKOA 2HKEA 1KNZA 2W2OP 3MOJB 3RRGA 1TV6B 2EBEA 3UWTA 2CDQA 2OD6A 3CCJS 3N5BA 4PPZA 3LW5C 4P9SA 2MJNA 2IM0A 3FRYA 2QC3A 3GFHA 3I5CA 4B3SF 2R2TA 1FFSB 3IRXA 3FBEA 4B3TJ 4NLRA 4X62F 2KB2A 3P5BP 1RAIB 3J80U 3AODA 1U25A 2ZDPA 3WX4A 4OZJA 3X1LB 4R0EA 2N7CA 3EGWB 3MMBB 2KYZA 1TZ0A 4WE1B 2Z4PA 3PM9A 4RUAA 4WIQA 2ADCA 3PW7A 5F8MA 5T7LB 2Z57B 5E3RA 1C4CA 2DNPA 4X65F 2FUG9 1YGYA 4ECWA 2HFUA 4C3KA 1IKXA 1Y5LB 2Y8YA 4C4WA 4RW8A 5HI7A 5JMNA 1N33J 5KFFA 1N5SA 4IOCQ 2D41A 2C22A 4DUZF 4ECUA 1F3FA 4IYQA 2IRUA 1KS2A 2YQ0A 1QTMA 4PABA 1ICEB 2LEBA 2R8KA 2FHMA 1WOOA 2XSFA 4FPRA 4HH0A 2AYBA 4K4VA 3WIVA 4Z37A 2H1YA 3DOKA 3DRPA 1M90T 3HHEA 1TUGB 3M30B 4NLGA 4WK3A 3PJWA 2XG8A 1TL3B 1CSJA 1UVIA 2BM0A 4DL6A 3GWCA 3IMQJ 3JS9A 4J9OA 5EWEA 5CA5A 3IBWA 3HHNB 5G0RA 4EZ6A 2ZM6J 4F50A 2FJAB 3M32A 4X66F 1RKIA 4X4VA 2DO4A 1YJ7A 2HVDA 4XK8C 3NGKA 1SH2A 3H25A 5C2GA 3BO2A 3C2PA 5DM6Q 4Y00A 5D3GB 4URGA 5KFEA 4TYBA 5AJ3F 4NE9C 4ED2A 5DDPC 2EG2A 2AQ4A 4DX8H 4UOCA 5L1JA 4OJ3A 1WNEA 2FHJD 4CTAA 3OHBA 2MLYA 4C97A 1VBXA 3WQPA 5GAGI 3VVTA 5CYMA 4OHZA 2APOA 2L9WA 3BB5A 3MDFA 1WHXA 3HSZA 2GJ2A 3LF0A 1FDBA 3PJ9A 4NEYA 1UJ4A 2C2OB 3GIIA 2MGZB 3TR5A 2ZITA 4YR0A 4E0DA 1QTNB 1F9EB 3W2VB 2XYHB 3H8YA 4PXEA 2VB6A 2HLTA 1NJIT 2FVSA 2JNJA 3BGRA 3RAXA 1U6FA 2ZBCA 1XERA 4DZ6A 1QSLA 2VH7A 3K5NA 3GFXA 5D77A 5IC6B 1H7XA 4OYBA 1S7HA 2DNRA 3V6DA 4U8VA 3AJ2A 2R2RA 2OFHX 2NCKL 2XMJA 2P9EA 2NR0A 3TNVA 1IKVA 2MHEA 3KUHA 3M2RA 1WOSA 1D09B 3BR8A 4FF3A 3SQGB 1IQTA 1TFYA 2VFRA 1XMOJ 1U2CA 3C66A 3ZO7A 1U26A 5KFUA 3MM7A 3KUEA 3M7VA 3MCNA 5EWFA 3AA8A 1F5BA 2GQCA 3DLEB 1LW2B 3QPIA 2ROGA 2XM3A 5CZXA 2UUCF 2DIVA 3FMBA 3IRWP 4L3KA 2RB7A 2B7BB 4HI2A 3S01A 5L46A 1P8GA 5AXKA 4J90A 2XC9A 5F9LA 2HHSA 1OYEA 1FFGB 3FDSA 2UXBJ 4EBEA 1IBLF 1MN7A 1VBYA 3C8YA 1VGYA 2ZH7A 1RB0A 2CQPA 3WBZA 2YPYA 2MY8A 5KFNA 3MUMP 3UDCA 2AU0A 4RO0A 3M6XA 5KFCA 2W01A 2MKYA 2RF2A 2JFKA 2G1HA 2VFVA 3IGVA 8ATCB 2YWGA 3PFEA 1DARA 4DL4A 4DS5A 2HZAA 3IBCB 5DZ6A 3J7YI 1SI9A 4F26A 1MU2A 1URNA 3BBFA 2FC8A 4NA3A 4PEOA 4K2XA 1S9FA 2B9EA 1X0FA 2W2MP 3N79A 4HLBA 4O3QA 2JLGA 1KVIA 2LQ5A 1B0PA 1VHFA 3VV2B 2EFPA 1UW4A 4KRWA 4P2MA 5H9EK 3BN4A 3A1YG 3CJ5A 3VHQA 2CPIA 4PCQA 3P96A 5C25B 2AEFA 4IFYA 4XDCA 3GB0A 3LPYA 1NJWA 1EAYC 1JXEA 3NS5A 4J9RA 3N6MA 4BS2A 4DSLA 1JLAB 4HT7A 4DSIA 1TL7A 3BJYA 5HMWA 2W7OA 1ROFA 3IG1B 5D0RA 5ETVA 1RYSA 4P2SA 2N3OA 4LFBF 2BM1A 2V8GA 3ZTOA 4USVA 1NKBA 4D3HA 2X3GA 1KTQA 1FD8A 2HWTA 4WFAQ 2CQGA 2KFZA 4YUDA 4DN9A 2DB1A 1N5YA 3S7RA 4NA2A 1YBUA 2CADA 3LWMA 1NK7A 1PJ5A 1GH8A 3Q89A 5ETMA 1JMTA 2ACYA 2CYYA 4LFAJ 4A8FA 1M1GA 4ZPTR 5FDLA 4AD6A 2EWHA 4NCAA 5H9FJ 2MHNA 1NKCA 2GAGC 4HL9A 3QMQA 4ZJLA 2HBQB 4DUTA 1LWXA 4UTGA 3VALA 2CPXA 1GMVA 4PG8A 2OEKA 3ZZ0A 2M9KA 5D78A 5CCLA 4A47A 3JQMA 2AZ1A 4ZVTB 1UPMB 3BBBA 2IM3A 1FE4A 2XYGB 5IWAJ 3VAFA 2VDIA 1DBDA 4C0OC 1CC7A 2V2ZA 1RAOA 4RUCA 3ISNC 4TLRA 4CLYA 5GADU 4DV6F 5KFVA 2QEXS 2QG9B 3LOUA 2LLZA 3F56A 3JTOA 3CB4A 4YY3J 1H2TZ 2U1AA 1F1BB 1HBUA 1K44A 3GJQB 1P6TA 2IHR1 4YB1P 3H2LA 2XWXA 1YRXA 4YB6A 2DNHA 4L76A 4I4BA 4EFAC 3TW0A 5FJ4A 3A3PB 3K5PA 2KH9A 1Q53A 3QWPA 4RW4A 4FBTA 2OPSA 3S1TA 5ETNA 2ZBIA 4ELTA 2VHGA 4MKAA 4RNMA 3QGIA 1BD6A 4UT4A 5KFGA 4TNOA 1I6JA 3AOBA 2ATLA 2LCWA 3NNHA 3G86A 3JSMA 2BACA 1AUSL 3UW1A 4YB5A 2DH8A 5EDWA 2R8HA 2DPIA 4PQUA 3L7UA 2ZNZA 4NCGA 4NZ7A 1EQ0A 1WEXA 1CC8A 3MFIA 1S0NA 3OR2B 1ZAXA 2RUSA 5HQLA 4HR2A 3MECA 1UA1A 3EGVA 4DF8A 1UJ5A 4ICLB 4ZHRB 2KVQE 1SH0A 2GVDA 5HANA 1H7WA 5C42B 2NPIA 4F36A 1C0UA 4NI2A 2QMUB 3TVZA 2UUWA 2Y1IA 1QVGR 2A10A 2JL9A 3LWLA 4IUFA 4DFJA 1FJ7A 1N32F 2HFZA 3D54A 2IC3B 2CPZA 3MMCB 1WUUA 2V9KA 4USUA 4OV1A 2ZC4A 1YLXA 4I2QA 5KG5A 2KT2A 4DI6A 1K1QA 1Q8KA 4TU8A 3QATA 1U6ZA 1Q5VA 4YS2A 4KE5A 1DTTB 3D67A 5L38A 1RISA 3V6HA 2VZ9A 2UV8A 3R27A 3D1OA 2E7XA 4DV7J 5J2MA 4F4XA 1KQGB 3M6UA 4NLWA 3H5YA 2XY7A 2CJBA 2PSZA 3K7RA 2IIHA 5K8OA 3GV8B 3KNGA 3FCWA 3OVBA 2HWHA 1VQ8S 1IM4A 1NHKL 2FJVA 2NXUA 3FKBA 1I51B 2JJ4D 2DISA 2CAJA 2M0GB 4OHVA 4NYZA 1DQAA 4DPUA 4JI8J 1FKOA 2WK4A 3TUJC 2YNFA 4GKJJ 1UWBA 3SCIE 2HQCA 1JLEA 3DGVA 3S6EA 3CVKA 3DXSX 5I3UA 3ZZPA 3LP2B 3TA1A 3M2UA 3NWGA 2OEMA 2CG4A 2G0IA 1TKDA 4YHHF 2Y1LB 3UD5A 2AIRB 4M5DB 1VQ9S 2E5JA 3GIMA 1TAUA 1WORA 5GMDA 3T1AA 4KR0B 2JVRA 4DPOA 2YX4A 2PIIA 2V2VA 2VFTA 3BGOP 4GKKF 2GNKA 4DUYF 4AL7A 4TQRA 4IKAA 1ZM4A 2AD9A 1K8AT 3HVAA 3M8WA 2LDIA 3EM1A 5F0UA 4LBIA 1LK7A 3G6XA 1XN9A 1I94F 1HW8A 1HHSA 3EUNA 1NKEA 1PSDA 1IWGA 5EX3A 5JJBA 4LREA 3DOKB 3DRPB 3AJDA 1LEOA 2N3LA 1HD1A 3OFEA 4C48A 2ZKTA 3NG8A 2VG7B 3OTOJ 1LQ9A 2GVZB 2BANB 2MSTA 4R8UB 3HMJG 4FYYB 2Y3YA 3AJ1A 3M32B 1T9TA 4MK8A 4A46A 2C2RA 2ZH8A 2MB0B 1HNIA 1X4HA 4O0IA 1VLYA 1WOPA 1HHQA 1FRMA 1N36F 2VG5A 5DQGA 1U09A 1RT1A 1Z2ZA 1M5OC 1BWVA 3OQ2A 4OX6A 2DO0A 1YJRA 3B82A 4ZKAA 4KO0B 1FX4A 3U1NA 4ZVEA 1GTEA 4Y2AA 2W9CB 4A8YA 3JSYA 3ENWA 2K8GA 1BQMB 1RAFB 4PYAA 4CTAB 1ITPA 3SQOP 3VAHA 2A1BA 4LF4F 5CYMB 2MKJA 4KH1B 4PG6A 2PN6A 1JLCA 4ZMMA 5E3CA 1MMDA 3MEDA 4M5JA 2HS4A 4Q43A 2PDAA 5BXIA 3DCAA 2FLNA 4YMEA 2ZHAA 4JI6J 4OZ0A 4ZOSA 1VC0A 4WYLA 4DPWA 3FQLA 2EK1A 4EMDA 5KFIA 3TUIC 4J9MA 4FYXB 5L39A 2D74B 1G4CA 1VRUA 3GILA 3UDLA 4WU2A 2BV3A 3G9CA 2BDPA 4RWWA 4DL0C 3QO9A 4KGVB 2ROEA 3KDNA 4X84A 4CRJA 3M6WA 1T11A 3RRHA 1RBLA 2JVOA 3I5BA 3P45B 3NL0A 1H2VZ 1JLFA 3W9IA 4HI1A 5KG1A 3MPVA 1CLFA 4DL3A 3HD1A 1PILA 1HNWF 1WELA 3C6TB 2AJ2A 1UA0A 1FDDA 5DETA 4G1QB 5J1NA 3ZTPA 4OMFG 1S1XA 3VZIA 3EWGA 4FS2A 4NLSA 4ZPCA 1S1VB 2ZFHA 2XQCA 2G2OA 1HL6A 2PI5A 2HPUA 4H4OA 4IH7A 4JI1F 3VAMA 4DR1J 1R0CB 3W5XA 2KXHA 2ATCB 3GIRA 4FNIA 5KG2A 3O8WA 2HGLA 1J5OB 2FY1A 1VRTA 3U7JA 4H4MB 3KLFA 3GJTB 2R2SA 1E6YB 2R7XA 4FNHA 4LT6A 4X62J 1U1RA 1JQGA 2HFSA 2W4PA 3G6YA 4UY85 2IA6A 2WONB 2DGQA 3QZ7A 2VG6B 5BYRA 3M8QA 3QAEA 4JB8B 3BN7A 3WC0A 2UXCF 4HH1A 1BMQB 5K9FA 5B08A 4ZK7M 5F9NA 5KG0A 4C8YA 5IT9Y 2CPYA 1MU2B 1WD6A 5MLCV 2F9DA 1YX2A 2F5GA 3OTDA 3JAMY 4WKYA 5GAEU 1XEZA 2HBRB 3D6TB 3H2VE 4XDDA 4XAKA 4OYOA 4AT1B 2DR7A 2O67A 3OBIA 4O44A 1TKTA 3DRRA 2YKQA 3EPGA 3NY0A 5EUHA 1LOUA 5KT5A 3CDBA 1CQNA 2KZZA 1X9SA 3HI9A 1EZZB 5HMZA 1AUDA 1X5TA 3LP1A 3BDPA 1P1LA 4IFYB 1BQNA 3NEKA 4QWAA 5E41A 4WTOB 3BV8A 3MM5A 2WVCA 1TL7B 3MF5A 1R8CA 1F6TA 5HK4A 1NDKA 1F3VA 2W7PA 1NPKA 1TAQA 3WIUA 3RZAA 3PRBA 3RBEA 4N76A 4K5RA 2JOQA 2DGXA 2EVZA 4YDXA 2HHWA 3MEGA 3IAM9 4A4JA 4DPTA 5T41A 4M5MA 2QV6A 2XI3A 4XPCA 3OFGA 3OVSA 3TZZA 1XK8A 2RRAA 1FVQA 2QT7A 1MROB 2Z2MA 3D66A 3MPWA 2HWIA 4ERDA 1B3TA 3C15A 5FLXY 4BHQA 3TVYA 4C0BA 3NMRA 3GV7B 2OJ3A 3QAUA 2E1AA 1WI8A 2LMIA 1C1BA 3HHLA 5AJ3J 2AJ0A 1RT6A 4FVMA 3W61A 1RLCL 1VCTA 4KH0B 2R7TA 2JZ5A 2C3MA 3H5XA 1NLKL 1TVRB 1XR6A 2PO4A 3TQEA 3VZHA 4N41A 1ZH5A 3CJQA 3IO1A 1HYSB 2CDRB 3WZ0A 3RAQA 2E9ZA 1FFWB 2KTQA 1TL1B 3W5ZA 2ROPA 1HBUB 1CULA 3V4MA 5E33A 3PZPA 5M2UA 4CZCA 2BJ1A 4QJVA 3GTYX 3T1YF 2E5LF 1FRKA 3KOAA 3BPDA 1CJKA 4OI3A 3SYZA 2BA9A 2ZOGA 2H9ZA 3AXKA 4IQMA 1YJNS 3IA0A 2X1BA 3NOGA 4TYAA 4KHPF 2SXLA 4FKYA 2IRYA 2DNOA 2DEIA 2P2CB 3Q8YA 3ILJA 2IRXA 1PYOB 1FKPA 2H4WB 4DV5F 4BWJA 4KGXB 5HP1B 5IXUA 4OI6A 1S9GA 4ZITA 1TL4A 3ETOA 4ECTA 5LXYA 3AAWB 1YVFA 4EBDA 4RNOA 2YKMB 4Y2KA 3M2VB 2O1PA 4X4QA 4NCGB 4XIUA 4IH6A 4JBCA 2DY1A 3SXLA 2Y1JA 2C2DA 4UUWA 2A0FB 4WF9Q 3RB4A 2NZ4A 1O0PA 3QJPA 1F0XA 2R7UA 2KM8B 3KTQA 4GC6A 4JYAF 1HMVA 2WOMA 1C0UB 5L1IA 3JB9k 4ED1A 1HR0J 1AZSA 1CJTA 3T3FA 2M8DB 5DDRC 5K8MA 3M8ZA 2H48B 2ZDOA 2XY6A 1IBLJ 2WVEA 3QGPA 3EVWA 3HCXA 4DJBA 4ITSA 2MEWA 4NLXA 4RPFA 2CNLB 2PFFB 1U6BA 3THVA 1FJGF 1UVLA 2E1RA 4JI0J 4OJ1A 3RB6A 3KWMA 2FIUA 3IR7B 1RUSA 2HG4A 3DOMB 3OLAA 1S79A 1QJHA 1TFWA 1U1QA 3OV7A 4QW9A 1S0VA 4ELVA 2EFGA 1TK5A 2Q6BA 2FY8A 1KOOA 4JI4F 3DKDA 4IR9A 4KGMA 3CCSS 1GAOA 3KDOA 3C19A 2W2QP 4AE5A 1AFJA 3FNNA 5ETLA 3PW5A 3OJUA 3PFOA 3CWJA 2H51B 2MMYA 4LIRA 3NMAA 2LXUA 2FVPA 4BC7A 2X51A 5DGBA 5F8JA 3EJMA 1ACMB 2QL7B 3M8YA 3EZ5A 2R2UA 1FHTA 2YNFB 1UWBB 4USMA 2KXFA 2YWEA 3MCSA 4TXSA 1YRTA 1C2PA 3HDSA 2UP1A 1L3VA 4LFBJ 1X4FA 1H3DA 1RWPB 4KJIA 3R8YA 5B7WA 2CQBA 2MKCA 3NGSA 1YG0A 1RAEB 1U1MA 1FEEA 2BZ2A 1RBAA 3ICLA 3UN2A 8AT1B 1H74A 2VJVA 4M5IA 3FEXB 1WG4A 5KOXA 1VJQA 1UFKA 2HGMA 3W2WA 2ZVSA 2XNQA 2Z0GA 4PWDA 3DRSA 4WZQA 4MH8A 1SL1A 5D4OA 3VF0B 1T9XA 3T9NA 4A48A 2EFOA 4CCHA 2HNZB 5ETOA 5EHHA 4C8NA 1TUWA 4YR3A 4Y2IA 1RACB 5A0YA 4OZLA 3Q8RB 3NNAA 2RSQA 3WDOA 1UW9A 2D3ZA 4DR7J 1RTDA 5CH7B 2MQNA 3HHLD 4MYTA 2G2YA 1V3ZA 1FVSA 1RT3A 1VQ4S 3KJVA 2MQPA 4LSNA 1WSRA 1IXKA 1HWKA 3PYFA 3HJVA 1X4CA 4DV6J 3I96A 2Z2ZA 1G3OA 2OHDA 1FF2A 2K3KA 5LJ3Y 4C8OA 4C8ZA 4MJKA 5A8RB 3H59A 1S6UA 2VQEF 1HNIB 3MHYA 3I55S 4RW9B 2C2MB 3CTRA 1M5KC 1KOHA 1RU1A 3F41A 4I0WA 4B9VA 4DQQA 4CNZA 1SB6A 4KHMA 2VG5B 4QQBA 3F73A 3EZUA 4BLGA 1JJ2R 5DZ7A 2BKPA 2FHKA 2MY7A 1O51A 1T05A 2VIHA 4C98A 3CC2S 5HMYA 2YWKA 1LKZA 5EWGA 4TU7A 1N33F 3K57A 1NZAA 4LFCF 4JI7J 3R5JB 5KFJA 4H4KC 3NWRA 2V69A 5CZVA 3TA2A 1RT5A 1C4AA 3C14A 1RBOB 4S0MA 5GAEI 1YBTA 2VL1A 2XULA 4F3QA 4RW6A 4IG3B 2AJFE 2Q66A 3DOLB 3QGGA 2HS0A 2YNGB 1ZOTA 2JEGA 4LMZA 1RE1B 3BSCA 3AFGA 1MMNA 2ZM6F 2BJ9A 1Q79A 3NCRA 2VKRA 4F67A 1Q0NA 2C28A 2RRNA 2ZHBA 1RT2A 1HBMB 1FWLA 1PIEA 4TY8A 4UQGA 4WTYA 2Q79A 4BWMA 3QWUA 3QFHA 1I5OB 2AGQA 1D9FA 3GV5B 1RTJA 4ECSA 2LKZA 2HAIA 2QO3A 1S1UA 1UP1A 1MMLA 2BW7A 1Y5IB 2IAJA 3R6LB 2YKPA 3EVMA 2DBBA 1FK9A 4ES2A 3CULA 2K7KA 4L73A 1JIHA 3MGJA 2X1GA 2GO8A 3CDUA 2Z2LA 1HNXF 3KHHA 2YNIB 2R7QA 1Q4RA 3ENAA 3DYAA 4CDIA 2QLFB 2AJ1A 3FZ2A 1VRTB 1S59A 1RTHA 1HWLA 4QYZJ 4FF2A 2IDLA 2XCAA 3OPKA 5J2QB 4A8WA 2OPPA 1HQ2A 2VC0A 3FQKA 3M8QB 1H2UX 2XMKA 3EDRB 3TRGA 4YDDB 3M05A 4X4PA 3PRVA 2DPJA 4R5PB 4ED6A 4IRDA 3DMJA 4KV8A 4L74A 4F02A 4CWBA 2ZH5A 3K5MA 3LTOA 3CJRA 3VAKA 3LO3A 4O44B 1TKTB 3DRRB 1W2BR 3ONQA 3MEEB 2VFUA 1N0VC 4YHHJ 1XMOF 1HNVA 4Q44A 2ASYA 4MIWA 2LQ9A 1KTVA 2IJFA 4DV0J 2ZH9A 2E5IA 5THWA 2VOOA 3LP1B 1HWUA 4RX6A 2E1MC 4WXOA 1BQNB 2GAHC 4GKKJ 4C8LA 3JQJA 1VQKS 1IKYB 2RNEA 3L7OA 1S57A 2OP5A 3IBFB 2HNYB 1I94J 4DCOB 3BM7A 2YKAA 4LRFA 4ED3A 5GAHI 1NK0A 5J2NA 2DR9A 3OLBA 5LSOA 1A0OB 4K4TA 4K4XA 2UXBF 3O3LA 1R8PA 1KONA 1CJVA 2VPZB 4HDGA 3DDIA 4KY3A 1X9MA 3QZ8A 2HS3A 4A8MP 1C0TB 2W24A 4DQPA 4DR5J 4PG4A 3EMTA 3O44A 2OPQB 3R9LA 4V19J 5KFOA 3I9V9 3CDEA 3OSNA 1YQHA 3NXZA 4CP5A 5LM7E 1YZ6A 1B99A 3C15B 2MQLA 1BWEA 2QRRA 1YJ9S 4W98A 2V94A 1HNZF 1SC4B 1F5AA 1L3SA 1UL3A 3HKZD 2C2KB 1HKAA 3PKMA 4ZN3A 2K3IA 1IBMJ 2UV8G 1RT6B 5CD4A 1KSPA 3Q8QB 2OSRA 5I42A 2HYIB 2LA6A 2GJFA 4F4YA 2DNGA 5IT9U 2J6SA 1M1HA 4LF4J 1RTZA 1FESA 4WFZA 3SV3A 1CULB 1A7GE 3KG4A 4F4ZA 2YH0A 4RNHA 2LEAA 1HBOA 1JWWA 1KR4A 4OFZA 1YWXA 1RXOB 3L95X 4CLPA 2BQ3A 2E5GA 2CZVC 3U27A 2C2EA 2HQ3A 3HZEA 3V4IB 1R8HA 3M9NB 4WFNQ 3MM8B 1SJ3P 2XS7A 1RWNB 3KG1A 4OHWA 1SC1B 3PW4A 1BLUA 1FKPB 2MQMA 1X5SA 3MR3A 1IJEB 4U7UD 2NLWA 2OPRB 3GCXP 2E1PA 2HW3A 3T1HJ 3BH7B 4UF4A 2MSSA 3R5AA 3JYTA 4ID5A 2UVRA 1HNWJ 1U24A 4N7TA 3KKFA 4LSLA 3GPAA 4K0KF 5D8HB 1X4EA 5BJRA 2I6WA 4CH0S 4P73A 4IG0A 1KHWA 4KYZA 3OHAA 4B17A 4PXBA 5LOQA 1HMVB 2XCPA 3BSOA 1WHWA 2XLKA 5FLXU 2J9CA 3AD8C 1OQ6A 4FXDA 2FZKB 2CUYA 1RWXB 2FJEB 3K8VA 4OI4A 4WYWA 3EXYA 1OPZA 3FEYB 4IDKA 4W92B 1WHVA 4DFKA 3HKWA 4HTJA 1H98A 3G8TA 3LANA 5A8KB 1TKZA 2FVRA 2J0WA 5AE1A 1WF0A 3OTCA 4ZVUB 4GVLA 4M63A 1S99A 2UXCJ 2B4VA 3CCZA 4CO3A 2EFVA 2X1AA 3CNQP 1RHKB 1S5ZA 2W9BA 3KLGB 2YTCA 1S1WB 3JQKA 3HPOA 1U8WA 2DHGA 2W2PP 3FC9A 5A8WA 2V8HA 4DMZA 2VBXA 1YI2S 4FZVA 3Q23A 3OXLA 3NS7B 1VJWA 2OEJA 1VQ6S 5J1EA 1QY7A 3TZYA 3TAPA 3NKYA 1ZZNA 2AJ4A 4X64J 4QWBA 2K2PA 1RHRB 3PKYA 1AFIA 4OZ5A 5HJXA 1XNRJ 3DLHA 1CEZA 3DNCA 3MMAB 1TELA 4EU0A 2IVMA 4QPXA 3CCES 1N6QA 4N8OA 4IR1A 1WC6A 1S0OA 1KHVA 2J0SD 2GIQA 3AXMA 3IS9B 4RNFA 3SV4A 3FVYA 4ECVA 3UN5A 2VQFF 2IY5B 1OPIA 5B09A 2F1FA 1OY9A 4DV3J 2J0XA 4AL6A 3HD2A 3NP5A 2V2KA 2UU9F 2EKYA 2NSCA 5KFBA 5E0OA 4ETZA 5AXLA 4O4GA 4ECRA 2JRSA 4ZLPA 4R25A 5RUBA 3EX7B 3CEDA 4L3NA 3SSQA 1QE1A 2D1CA 2ZH1A 3TWZA 5KT4A 4DV7F 4OX9J 2GO9A 2B56A 4LJMA 3DRYA 4ED0A 2VDHA 2BQUA 2ZOMA 3JSRA 4FYVB 3GYXB 1WC0A 4C8KA 1WTBA 3GFYA 1YKWA 4PUOA 2V4JB 1R7IA 2RHQB 2RD5C 2DGOA
chains in the Genus database with same CATH topology
3W3SA 4DV4F 3K59A 1XR7A 2HVHA 2KZMA 4QOTA 4JI2F 1R27B 2GC8A 2FJVA 2NXUA 5IFMA 2JJ4D 2DISA 3H5SA 2MZSA 4DHVA 2M0GB 4K4UA 3DLGA 1EP4A 2VASA 2LU1A 3GIJA 5HBMA 1R3NA 4I69A 1YJUA 4JI8F 1FDAA 2D7SA 4EYHB 3RAMA 1F5CA 4OHVA 4NLUA 1RT7A 4NYZA 4ZVFA 3TO8A 3VQTA 1NK8A 1DQAA 2F40A 1Y5NB 5B0GA 1S1TA 3OFHA 1FKOA 4K50A 2WK4A 3CD7A 1D8ZA 2RILA 1RDRA 3TUJC 2YNFA 2XHWA 1UWBA 4NYPA 3SCIE 3C3LA 1B0TA 1JLEA 2DGTA 2JH3A 2D9OA 3CVKA 3S6EA 1DTQB 5D4LA 1T05B 3DXSX 5I3UA 4PXDA 2A2CA 3RRKA 3ZZPA 3LP2B 2M2BA 3TP2A 3TA1A 3M2UA 1NB7A 3NWGA 1AW0A 2FJBB 4MIBA 2CG4A 5DQHA 4RW4B 2OPSB 2OIHA 4ZP8A 4F4WA 2ZJPQ 1TKDA 1SH3A 4O3PA 1UVJA 2BR0A 4YHHF 2CPFA 2E5HA 4M5DB 5HROA 2E5JA 1VQ9S 3GIMA 3CC7S 4V19X 1TAUA 1Y3KA 3CT9A 5GVQA 1KLNA 2I5JB 2BE2B 2W9BB 1T95A 2WSEC 3ZZZA 3PRDA 3T1AA 2OMOA 4QR1A 4KR0B 2JVRA 3DGPA 4DPOA 3I32A 5GAHU 2YX4A 2PIIA 3KHLA 2VFTA 1T02A 1N5VA 3C6TA 4GKKF 2GNKA 4DUYF 4AL7A 4TQRA 4IKAA 4OI0A 2O66A 4G1QA 1ZM4A 3SSRA 2YX1A 1JKHB 4IOAQ 4MIAA 2AD9A 2CQ2A 1K8AT 2KRRA 2CPHA 2B5JA 2Q1LA 3JSMB 3HVAA 3SZ2A 1KC8T 3ZZUA 4DSKA 4K4ZA 5A8WB 2DNLA 2N4CA 2LDIA 3VR1A 5F0UA 1T8EA 3BR9A 3R5CA 1LK7A 3G8QA 5C24A 4B9TA 4PG7A 5F3TA 3L09A 3G6XA 1XN9A 2AGOA 4PQUB 1P1TA 1S1VA 1HW8A 2VFSA 1HHSA 1I94F 2VA3A 3EUNA 1RI7A 1WF1A 1NKEA 3QIDA 5E5NA 1PSDA 1T3OA 3BS9A 5EX3A 3BEGB 3LAMA 5JJBA 2RIJA 3KHGA 2DH7A 4KT0C 5J1PA 4I64A 3GIKA 5LMNF 2JLEA 4RW6B 2MQOA 2KKHA 3OXGA 1HI8A 5B0AA 5L1LA 3VAJA 3SI8A 1TV6A 3LALA 3CE8A 2WHOA 3IAS9 3DOKB 3MECB 2B7CB 3DRPB 4I56A 2W7AA 2N3LA 4EZ9A 3U1MA 3M9OB 3AHPA 2JEJA 3OTOF 1HD1A 3LGNA 3OFEA 2ZKTA 1WWHA 3NG8A 4U6PA 2ZD1B 2VG7B 4YR2A 1DFDA 3RW7A 3EGNA 4OL8A 1LQ9A 4CO5A 3OR1A 3PX6A 4C2MA 1JNZB 5HL7Q 2BANB 3QYYA 1WI6A 1J5OA 4H4MA 2MSTA 3MD1A 4R8UB 2E1CA 3ZZRA 3HMJG 3JTNA 3EYZA 3CCUS 1E6YA 3D1HA 2YWHA 5B0DA 4F25A 2FJWA 2B51A 1ZPVA 4QZVB 3QJJA 1KLMB 2KN4A 3CCQS 3D2WA 3AJ1A 3FJ2A 2FJDB 3Q2SC 1DLOB 3M32B 2WONA 1M0SA 2VG6A 4LUBA 4OHXA 3VAIA 4MK8A 4A46A 1U2RA 2C2RA 2ZH8A 4QIVA 2MB0B 1HNIA 2CJQA 1X4HA 4TY8B 5F8HA 4O0IA 1VLYA 3CDWA 1ZTTA 4I2QB 4WFXA 2PA3A 1M5SA 3S8SA 1Q16B 1ZBTA 3EXCX 2EFNA 3PACA 1R0AA 2DRAA 1FRMA 4OI1A 5B0EA 1N36F 5JVHQ 4Y2CA 5DM7Q 2VG5A 3D0IE 2F8HA 1U09A 3M8PB 2FHJA 3PDNA 1RT1A 1Z2ZA 5DQGA 1M5OC 2FLLA 2KU7A 3OQ2A 5T7LA 4OX6A 4ZPVR 1S1UB 2C3OA 2DO0A 1YJRA 3B82A 2B9WA 4O4GB 4KO0B 4EO8A 4ZKAA 2UUBF 4LF8F 1D9AA 3DFEA 3U1NA 2OO4A 4MK7A 4ZVEA 4TN2A 1GTEA 2DCLA 4Y2AA 4QIFA 2YVSA 4MTPA 2W9CB 4A8YA 3JSYA 3ENWA 1FD2A 2VV5A 2K8GA 2L08A 3RR7A 1FK9B 3CUNA 3HT3A 1BQMB 1VQYA 4DR3F 1TQLA 4DN0A 4CTAB 3J7Z5 1GQEA 5KFZA 2DITA 1JLBA 5J2MB 4FBUA 4FF4A 1WF2A 4OJHA 4AYBD 3VAHA 3P5TL 5DG7A 3DLLQ 1RWUA 2MPUA 1FNMA 3GZ7A 2AJQA 2NREA 1RK8A 2A1BA 4LF4F 3GR0A 5CYMB 5AXNA 2MKJA 2ZE2A 4KKOA 1U1NA 4PG6A 4IO9Q 2VUGA 5KFRA 2PN6A 1JLCA 1NHUA 3MM6B 2Q3PA 1S4FA 4ZMMA 4QWCA 5E3CA 1IKWA 1MMDA 1I1GA 1Q8BA 3DYAB 4J5OA 4OX8A 5C5JA 4RW7A 3MEDA 4ES3A 2W4DA 1FE0A 1JLQA 2HS4A 2ZJRQ 3BO3A 4G3IA 4Q43A 1FRLA 2PDAA 1ULRA 1IUJA 3DCAA 5IQ6A 4QIGA 1Q86T 2FDNA 2LQJA 4KHRA 2GGPA 3IR5B 4YMEA 2FLNA 2ZHAA 1SV5A 5FD1A 3BGUA 4JV0A 4OZ0A 4ZOSA 2XBPA 1VC0A 2OPPB 5KT2A 1PC5A 4WYLA 1FJCA 2G13A 3FQLA 4Q8FA 2V8VA 1T03A 2EK1A 1Z2LA 1LV5A 5KFIA 4R0JA 3TUIC 4J9MA 5L39A 4HYKA 2AWZA 3DLGB 2PT0A 1EP4B 1LWCA 2D74B 4HHJA 1UAWA 1VRUA 1X4AA 1Y00A 2XNRA 4ZCIA 3GILA 4FP9A 5B0BA 5LSLA 3DLJA 2AX1A 3UDLA 1JLGA 2KI2A 5IQQA 2XMWA 4WU2A 2BV3A 4F3OA 3G9CA 2JC0A 5M2RA 4RWWA 2BDPA 4DL0C 3QO9A 3MEKA 2ZH3A 2HFOA 2ROEA 3N9UC 4X84A 3TX8A 1FKOB 2QA1A 3DMJB 4B9MA 4GC7A 1TL3A 2BJDA 2RKIA 3M6WA 4X4UA 5HMXA 1YBAA 4TY9A 1IQZA 1JLEB 3HVWA 4K5SA 5I4MA 2PA8D 3RRHA 3UQSA 5I3UB 1NK4A 1SUQA 4K4WA 3DHXA 1NU4A 1KD1T 2JVOA 3I5BA 3TAMB 1YTYA 5CCMA 3M2UB 1N88A 1X4DA 2HQIA 3NL0A 1H2VZ 4X4RA 1JLFA 4PWUA 1X9WA 4LFAF 3LGMA 4HI1A 2BJEA 2R9LA 2ADBA 5KG1A 4B3MF 4I2PB 3O6QA 3V6KA 1VK8A 3MPVA 3P3DA 5HROB 2LEPA 1CLFA 3VAGA 2LA4A 3CPWR 2PI4A 2IBOA 3BQ1A 3IR6B 1MROA 1KQSR 3M1VA 1VS3A 4DL3A 1HI0P 1PILA 4OLPA 1WELA 3OXFA 1HNWF 2D3UA 4KTQA 1UVKA 3HXMA 2EG1A 2K1RA 2CFXA 1JJ4A 3C6TB 2XSJA 1UA0A 1FDDA 5DETA 5CXTA 2IVFB 4G1QB 1ZETA 2DHSA 2VC1A 2KDOA 4C8MA 3KK2A 2FB0A 4JV1A 5D3GA 5J1NA 2F4VF 2KT3A 2UUAF 4EYIB 3TUZC 4OMFG 4U9RA 1XBWA 1S1XA 3VZIA 3OTEA 2B5JB 3FSIA 4FS2A 2JLFA 5IWAF 1E6VA 3FSYA 3KK1A 4OHYA 3WC2A 4M94A 3SCJE 5C24B 1Y4ZB 4WKRA 4NLSA 2PMHA 4ZPCA 3TARA 3CMES 1BY9A 1S1VB 4DR1F 2ZFHA 2GW8A 2UVWA 2ZOFA 3KMQA 1V3SA 1HL6A 3Q24A 2PI5A 4H54A 4C7QA 2N82B 4J9SA 1YHQS 2HPUA 4H4OA 4IH7A 3VCDA 2L41A 4JI1F 3HK2A 3PR4A 3VAMA 4ECYA 1TVRA 4J9PA 2FTRA 1T94A 2M3DA 1FRHA 4NWBA 3OL7A 1JX4A 3CJKA 1O8BA 5KAKA 2QA4G 1G7CB 2DGSA 1QAXA 1M5PC 2KXHA 4I67A 1UMJA 3I5AA 4ZPBA 3ZZYA 3KLEA 3ITHA 4YY3F 3HFKA 3H2UB 1HYSA 1FKAF 4FNIA 2KVIA 4RLEA 5KG2A 5KG7A 2BUNA 3O8WA 3K8WA 3E51A 2FC9A 4QBUA 4USIA 2GJIA 3OR1B 4L72B 2HGLA 1UFLA 1TL1A 3SDEA 5AE3A 1J5OB 3GQCA 2FY1A 1VRTA 3U7JA 4H4MB 3KLFA 4C11A 1Q7YT 2WSFC 2R2SA 2ZHOA 1NH7A 4M1KA 4ZPWR 5E3PA 1E6YB 3PEHA 2R7XA 2GFFA 4FNHA 2FPHX 4LT6A 3IWLA 1U1RA 1DRZA 2W4PA 3G6YA 1Y3JA 5B0FA 4UY85 2V0NA 2IA6A 2K7JA 2WONB 2DGQA 3I0SA 3QZ7A 1ZAWA 2VG6B 2WW8A 5BYRA 3M8QA 1X8DA 1NO8A 3QAEA 2DR8A 1SBRA 1XMQF 3BN7A 3WC0A 2I38A 2OAUA 4O3NA 3D0HE 4FF1A 3PO5A 2UXCF 4HH1A 4DR4F 3D0GE 2R8JA 5K9FA 5B08A 4ZK7M 4AQYF 5F9NA 5KG0A 4C8YA 5IT9Y 2CPYA 1R0AB 5CQGA 1S97A 1MU2B 1UJ6A 1WD6A 1WEYA 2CQ4A 5MLCV 5EGYA 2F9DA 3DM2A 3UR0A 3NBPA 1RT1B 3M8SA 4Q45A 1N54B 3OTDA 3Q0AA 3JAMY 2AYMA 1S48A 4WKYA 5GAEU 3BO4A 4CH7A 1XEZA 4DLEA 1RKJA 1ZM9A 1KN6A 3H2VE 4XDDA 4XAKA 1FJEB 2GMLA 5KFSA 3G4SS 3UCUP 2CQDA 2E44A 3AB2B 2DR7A 2O67A 5HP1A 2VA2A 1S49A 3OBIA 4O44A 1TKTA 3AY0A 2YKQA 3DRRA 3ENQA 3EPGA 3J7ZT 1QAIA 4NLDA 2Y0SD 3D5MA 1RTIA 4QWDA 5AXMA 2DCUB 4OX7A 5EUHA 1ZZFA 1JLBB 2QA4S 1LOUA 3CJ3A 5KT5A 4DWIA 1MW7A 2I1RA 4NXNF 2YKMA 3CDBA 2ZE2B 4KKOB 1CQNA 2KZZA 2JC1A 5LL6d 1X9SA 3HI9A 5HMZA 1HW9A 1JLCB 3M2VA 4KB7A 3V81B 2QE5A 1LW0A 1AUDA 1X5TA 2PMZD 1SL0A 4Q0BA 3LP1A 3CF5Q 3MEDB 1U2FA 3BDPA 5IM0A 1P1LA 2DNMA 4IFYB 1BQNA 2BOPA 1JLQB 1LWEA 1X5OA 4N8NA 4QWAA 1MWZA 2GGPB 1SV5B 2GCFA 5E41A 3KG0A 1NAQA 1OSCA 1S6OA 1U7LA 1VOMA 1NRKA 3MM5A 4Y65A 4LQ9A 3MF5A 1R8CA 1D0EA 5F8IA 1OO0B 5KT7A 2YNHA 3PXGa 1U1PA 2IYGA 1T03B 4I7FA 3DHWC 2FVCA 2HGNA 2DR5A 4YB7A 3HVRA 4RZRA 1LWCB 5KFHA 4RBTA 2GQ2A 1QM9A 2LU2A 1D3WA 1VRUB 4DSEA 1U49A 2AF6A 2W7PA 3BSAA 4DR6F 2RE1A 4EWTA 1TAQA 1JLGB 1H6KX 5CYQA 3RZAA 3PRBA 3RBEA 3LAKA 3QO9B 4N76A 1K1SA 4YP3A 2XO7A 2MZJA 4F3MA 4CQ1A 4K5RA 2VBYA 2JOQA 2DGXA 2EVZA 2XS2A 2DNKA 4YDXA 4ECXA 4ZVHA 2RKIB 2XI2A 2HHWA 3MEGA 1SJRA 4MMOA 4WCEQ 3IAM9 3KLHA 2XMTA 2BVZA 4A4JA 2AW0A 5T41A 2CQ0A 5J2PB 2B43A 1SUQB 2QV6A 3E01B 2XI3A 4XPCA 4RBVA 1C1CA 3OFGA 4YEAA 3OVSA 1REVA 3KHRA 2WTFA 1YITS 3NRBA 2IA0A 4Q2LA 1JLFB 1XK8A 1WG1A 2AX0A 2RS2A 5GAGU 1LXNA 1TL5A 3POTA 4RWXA 2XMVA 1SJQA 4TLQA 3DI6A 2RRAA 4X4NA 1HHTP 2YQ3A 1FVQA 2QT7A 1MROB 1HQUA 3GYNA 4WFYA 4F8RA 3M1VB 3NCPA 3MD3A 2Z2MA 3MPWA 3C6UA 2OTLS 2HWIA 3C46A 3TVKA 4ERDA 5K8PA 3K0JA 2DD8S 2K1RB 4J9KA 2L48A 3CSKA 5FLXY 4BHQA 3JYTB 3TVYA 2ZH6A 4C0BA 2XS5A 4Y0FA 3NMRA 3QIPA 3GV7B 5K14A 1VQPS 2OJ3A 3QAUA 1RT4A 2GMJA 2RRBA 1FTCA 2E1AA 3DOMA 1WI8A 1S1XB 2LMIA 1FERA 2FJXA 3MFHA 4JV2A 1KFDA 1C1BA 1R8BA 3KK1B 1E6VB 1FXRA 1EETA 3HHLA 2BRLA 2AJ0A 1RT6A 4FVMA 3T6JA 1N52B 3PX4A 2WBMA 2IJNA 3V6JA 4H4KA 2CKWA 1BGXT 2R7TA 2JZ5A 2V9WA 2C3MA 1U45A 2ZNYA 5LMUF 3H5XA 4H4OB 3OL9A 3R5DA 1OQ3A 1TVRB 3CJ0A 3LP0A 3MXHP 1XR6A 2PO4A 2J9EA 3F44A 2DNZA 3N28A 2EK6A 2BQRA 2DGVA 1F2GA 2J8AA 3CJKB 2XB2D 4GO7X 3O5TB 2DNQA 4NPOA 1SC6A 1LWFA 2JSXA 3V5RA 3VZHA 5LXRA 1U4BA 5I3PA 3MZIA 4DFMA 3G71S 3R1LA 3THPA 1DURA 1RGVA 4YQWA 4N41A 1ZH5A 1G2EA 4YOEA 3K58A 2E7WA 2AGPA 3ITHB 3IO1A 5MAOA 2OKQA 1HYSB 4DQRA 1Q8IA 3KFWX 4A8KA 5U47A 1MSWD 2WAQD 3WZ0A 3GMGA 1DJ0A 4LF7F 2B9YA 3RAQA 4UW2A 2E9ZA 2KTQA 1SKSA 1TL1B 2ROPA 5C25A 1HBUB 3V4MA 1FXDA 1LFPA 2NUUG 5E33A 4LQ3A 3KLFB 4C11B 3PZPA 1Q7LB 5M2UA 2PC6A 4CZCA 1JB0C 4EUVA 1XNQF 3HO1A 2KHCA 3RB3A 2ABYA 2VD3A 4IDKB 4QJVA 2OSQA 1SJ4P 3T1YF 2E5LF 4FN5A 4I6AA 1FRKA 3PJXA 3G6VA 4ELUA 4UY8T 2RU9A 3N0VA 3KOAA 2ZKUA 4GKJF 2RQ4A