3DHXA

Crystal structure of isolated c2 domain of the methionine uptake transporter
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
LDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAPLLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVLGYVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high-affinity E. coli methionine ABC transporter: structure and allosteric regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Methionine import ATP-binding protein metN
total genus 23
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09383 NIL NIL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dhxA00
1YBAA 1XTZA 1UJ4A 2QSWA 2DT9A 2LQJA 2NYIA 5IS2A 2J0XA 3OBIA 2PC6A 2CDQA 2JHEA 4NMLA 2DTJA 3DDNA 2KO1A 3W7BA 3HHEA 3UW1A 3U7JA 1LKZA 3MTJA 5T41A 3LOUA 2RE1A 4M8LA 3MAHA 1UJ5A 3CEDA 3TUJC 3DHWC 3AAWB 3MWBA 3IBWA 3OFGA 2P9GA 4GO7X 2QMWA 3ENQA 4GMKA 3ENVA 3NRBA 1UJ6A 3IXQA 2FGCA 1KS2A 3KWMA 2P9CA 3O1LA 3K5PA 4PWUA 2PA3A 2H9ZA 2J0WA 2MDAA 4X84A 5IT4A 3LUYA 5IT0A 3DC2A 1YGYA 2QRRA 3ENWA 3TUIC 3AB4B 1PSDA 1M0SA 2P9EA 2LVWA 3N0VA 5FIIA 4GO5X 2F1FA 2F8MA 1LK5A 5JJBA 2I9SA 1Y7PA 2QMXA 1O8BA 1ZPVA 2RQKA 2RQMA 3OFFA 3AB2B 3L7OA 4LUBA 1SC6A 3OFEA 3OFHA 3TUZC 1U8SA 1RWUA 2JOQA 3DHXA 3P96A 4IO1A 1LK7A 2ZHOA 3S1TA
chains in the Genus database with same CATH superfamily
2EWHA 3ZNJ1 2AWZA 2RF2A 3AT1B 3GJTB 3O5TB 4WFZA 5L8RC 4FBUA 1FX4A 3ILIA 4ZHRA 4QWDA 4IOCQ 1HD1A 4KPYA 1U1QA 4IG0B 4FF2A 1UAWA 3C15A 3CPWR 4USJC 1RHQB 4ANEA 2YTCA 2MQ8A 4FYXB 3AOAA 5HI7A 3NBPA 4OZNA 1UVNA 4B9VA 1GH8A 2DXDA 2YXLA 3H25A 2NQPA 1H2UX 2CQ4A 3VR1A 2Z30B 3CD6S 2W2PP 5IZHA 2WVCA 3R7SB 4TYBA 1U1OA 1DTTB 1TL7A 4KTQA 2J9CA 1RACB 5T41A 3MFHA 1WWHA 2KFNA 1N52B 3QLHA 5C7PA 1KNZA 1ZM4A 2AP6A 2FZKB 2DD8S 2H54B 3QZ7A 3FCWA 2NLWA 5KFDA 3HSZA 4AE5A 4CO5A 1RAEB 1T03A 2R7VA 5KFCA 1AA1B 3KJVA 1SJ3P 3POTA 4OHXA 2QYGA 1HWLA 4MKBA 2I2YA 2ZE2A 3FMBA 1FDBA 3R8YA 3ENVA 4OHWA 2QIFA 3VGTA 4DL7A 1FJEB 3HF5A 1HLWA 3BSCA 3I31A 3Q8UA 2CQCA 4JP8A 4X65J 4H4MB 4DR1F 4DQIA 3N79A 2OH2A 1SUQA 3SYZA 1D09B 4ZA1A 2KVIA 3LO3A 3W2VA 5MAOA 3KMSA 3ILJA 1N32F 1UL3A 2HFVA 4J9UE 4NLSA 3MMJA 2CQ3A 4WZQA 1DTQB 2LLZA 2W7OA 3BO2A 2G4BA 2H5IB 4RW9B 2MKHA 3CSKA 3HHKA 1U1MA 3GQCA 2E1CA 1W7WA 1NK6A 4LF5F 4OL8A 1T8EA 2HHSA 2HQ3A 3SSQA 2EW9A 4Y2IA 3PW0A 2ZZTA 4WP3A 4JV2A 3FFIA 5M2UA 4Y2MA 1U47A 3D0HE 3LPYA 1S48A 4WU3A 8RUCA 3CC2S 2JNJA 4Q5VA 2B9EA 1EARA 4V1Ak 1S0VA 1N33F 4P2FA 1N5YA 1R6YA 4Y28C 2MPUA 2LXFA 2VH7A 4U96A 3K58A 4B3SF 4JI5F 1Z2LA 5CABA 2VG7B 3W5YA 1RUSA 1WC6A 1N54B 4OLOA 4WK3A 2LXUA 5D6GA 2HBRB 1OYDA 1X4EA 2FJBB 2HS4A 3T6JA 4BCAA 1VC5A 4ZVGA 1FESA 4K50A 1JJ4A 1ZPWX 3U1NA 3DRYA 5CZVA 2WBRA 3FJ2A 1HBUB 2GA7A 3GLJA 3GB0A 5C2GA 3CCES 3THVA 2HS3A 4B9TA 4TVAB 4HKQA 4RNMA 2I9SA 3FSYA 2ABYA 3PEJA 2B4OA 5L1KA 4NI2A 2D3O1 2RQKA 1SQGA 3HZGA 1YITS 2JLEA 4NLOA 4WZMA 3NGUA 3R5BA 4B3TF 4XTTA 5A0YB 2W7PA 2FLPA 3IM8A 1NKEA 4DR4J 1PJ6A 4KKOA 1OQ3A 2XMTA 3GIKA 3A12A 4K4WA 4EI2A 3SSRA 3CWJA 8AT1B 4ED8A 3BN7A 1S6UA 3CIMA 1C0UB 1OY9A 2Z2LA 2XG8A 4USVA 2HVEA 4BWJA 3MOZA 4DV4F 2BKPA 1UTAA 2MKYA 1V3ZA 4N47A 2XZTB 1EZZB 1Q8LA 3H40A 3JYTA 3QAUA 4DFMA 2DR7A 1LQ9A 3HX9A 1KQKA 3SXLA 2KT3A 4RWXA 4RWWA 2MY8A 5HVFA 3RRKA 2HVIA 2W9BA 2RHQB 4O3RA 4NCGA 3S1TA 4LF7J 2J6TA 4DQRA 3MUMP 2HSEB 3VGSA 1GK8A 1GAOA 3A1YG 1FRXA 4OYIA 1N6QB 1SL2A 1FJGF 3CD0A 5C2CA 4FKYA 4ES1A 2IM1A 4F0MA 3L95X 5EWEA 4HEA9 5AXKA 3RBEA 5GAHU 4OI6A 1B70B 3Q8RB 2MLXA 3UN5A 4F26A 3MXHP 3RB0A 1T94A 1N4LA 2GVZA 2E1PA 2RUGA 3D67A 3NAHA 3E8OA 3BJYA 2XS2A 1AT1B 3VAFA 2A3JA 1F9EB 3GYNA 3M8RA 4LF8F 4X66F 4WE1B 2OGUA 3BR9A 2C3MA 4RW8A 4KHPJ 2O3DA 4NI2B 2ZC3A 4KFBA 3H42A 5HBMB 4DR3J 2HLTA 2C3UA 3HSDA 3CJQA 2K1RB 1Y5IB 3TZYA 3A8EA 4ZVTB 4B9LA 1JNZB 2RB7A 5J2MB 2A6MA 1UJ5A 3KHLA 3LGNA 3MPDA 2QGFB 1NNDA 3BGOP 4JI6F 1LWCB 2I8EA 3GG1A 2PFDA 4DUZJ 2G9OA 3AAWB 5J2PA 2CNLB 2GJIA 3KHHA 2P9GA 3QT6A 3HMJG 3MUTP 1Y5NB 2YNHA 1UA1A 1M5OC 2LA4A 1KP6A 3T5HA 1FK9A 2DGXA 3D28A 3RB6A 2HNDA 3DCAA 2VUGA 1CEZA 4RBVA 2QT7A 3VGUA 1RDRA 2ROGA 2PDAA 4WKYA 3KWMA 4IO9Q 2MKJA 4OI0A 3MD3A 1X0PA 1TR0A 2JH3A 3BREA 4OZ1A 3W64A 2MQQA 1PAUB 2MGZB 1Q86T 5KFHA 3MCNA 4C98A 3R9LA 1U0HA 3MF5A 3OR1A 1PCAA 4OQJA 2BKNA 2GHWA 5L38A 2JVOA 1KONA 5M2PA 1TUWA 1HBMA 1VOMA 3TJAA 2Y0SD 4W98A 2XYHB 5F8GA 1S6OA 2EI5A 2W9CB 3RRHA 4HR2A 5JMNA 3PZPA 3BM7A 2B3TB 1T7PA 2W9AA 4TNOA 1BD6A 2W2NP 2HHHF 1FFGB 1PAEX 1SC4B 1BWVA 4PKDB 4CLYA 4ECXA 3FK4A 3D9BA 4P72A 5E0OA 3ZZZA 2CQ0A 3CGIA 4LF7F 1T9XA 2N3OA 2CJKA 1HHQA 2YBVA 4OYAA 5DDPC 1V6HA 2KJWA 2VFUA 2YWGA 1ZM9A 3TAQA 2HHQA 3KXDA 4KH1B 2QL5B 3FUYA 3L7UA 3W61A 2VDIA 3BZQA 3CT9A 5DDOC 4F4WA 3UCGA 2WSEC 2ZH2A 3HHLD 1NK7A 4DCOB 3DNCA 3H59A 1EP4A 4FVMA 2M9KA 2UUAF 3HT0A 3KJQB 1L3UA 1VRUA 2ASYA 3THTA 3RBDA 4QZVB 1TKTA 3S8SA 4ELUA 2VJUA 1HARA 2KZMA 4AFFA 2U2FA 3TZXA 2MHNA 2AJ4A 3W9JA 2MLYA 2HHVA 1T05B 2EG2A 3CJRA 5B0FA 2DR9A 3CC7S 1X4GA 2XC9A 1OYEA 1FFSB 1XNQF 1NKCA 2NSBA 2HNZA 2WB1D 2XMJA 2RQMA 5JVGQ 3RTVA 2XMVA 3PJ9A 3LALA 2KB2A 2UVWA 1S6PB 4NXNJ 3R2CJ 3NBPB 4EEYA 3H5UA 2QO3A 4QWBA 2BE7D 3UFCX 1EJ7L 3J80U 1RHUB 5KFPA 5J2NB 2UUAJ 4CLWA 2IJNA 2GAGC 1IBMJ 1KTQA 3UD5A 2V34A 2GMLA 5KFGA 4CO1A 3IRWP 1HIYA 1KHWA 4CIOA 2OP5A 4LBIA 1RWUA 4O3PA 7AT1B 3MM5A 1FTCA 2A2DA 3BGFA 3PX4A 2UU9F 4B3SJ 4UY8T 3LP2A 3IG1A 3SDEB 3MEEA 2IVMA 4FYYB 2I5JA 2IRXA 1T3NA 4QIFA 2CJ9A 1F60B 1BHNA 2DRBA 4P10A 4KJIA 1Q7YT 3ET6B 2MZTA 3RZAA 5BYQA 2NXUA 1NDKA 4KYZA 3OHBA 1YRUA 2DT9A 5ETKA 1IBMF 1TVRB 1HQUA 1VJQA 1RCOB 3GCWP 1WTFA 5CCMA 2VA2A 3D5MA 2J7KA 1W25A 1H0HB 2D9PA 4KC5A 1JLCA 3UVJB 1FT8A 2R42A 5BYSA 2RDJA 4J9MA 3C14A 4ECUA 2RQ4A 3PTWA 1FDDA 5GAGU 1ITPA 1DY3A 4UOGA 3KG1A 5E3PA 3VZIA 1N6QA 1U25A 3SFUA 4B3TJ 3AA8A 3KHRA 2BYCA 3U7JA 4NCGB 2VC0A 4PG5A 2V4JB 2DH9A 5G0RB 2R2TA 5L1JA 1VI7A 4I4BA 3GILA 1F9HA 3CEDA 3LF0A 4JB8B 4RW8B 4U7UK 3W2VB 1KLMB 5A8KA 2E9ZA 1NH7A 2JC0A 4RNNA 4WE1A 4H4MA 1VBYA 1DQ8A 2RHSB 2RKIB 1WEYA 1WG5A 4P6QA 4ZLJA 9RUBA 4FF1A 3G86A 2VQFF 5KFAA 3W3SA 3DRRB 4LF6J 1UVLA 2IJRA 2D3ZA 4GVBB 3AOCA 5IQQA 4DBQA 1RB0A 3DLHA 2QSFA 1UJ6A 1FXLA 2DVIA 1TL1A 3KJVB 2DHSA 2VZ9A 1U24A 3D68A 2HNYB 5B0GA 3DLLQ 1RTHB 3NNHA 3JQJA 3OPKA 4DV4J 3MMAB 4OI4A 2AX0A 2L9NA 3D1OA 2X1AA 1B64A 1NSQA 2DNOA 3OSNA 2ALZA 3R1HA 4CH7A 1B0PA 1U8WA 3AHPA 2QLWA 1FRJA 3GJSB 4ETXA 1WJ9A 2W2QP 2J9EA 5KG2A 5IT0A 3H2LA 5B0EA 3DC2A 5KT5A 3AFGA 1YGYA 3DU5A 1MWYA 2GGPB 2VASA 1FKOB 1JMTA 4MYTA 4ZPCA 1N32J 2YNIA 2FJWA 1CJKB 4Y6IA 1MN9A 1FJGJ 1P1LA 1PJ5A 2HQGA 1WUUA 2EBEA 2JJ4D 4LIRA 2JLGA 4GRSA 3TUIC 3ZTQA 1R43A 3M9MB 3QGPA 3KNAA 2OEKA 5KAKA 1PSDA 2HMIB 1X5TA 2AEFA 1X5SA 1RTJB 2B4PA 5EGYA 1RISA 2JX2A 1HYSB 5GMEA 5LJ3Y 3OXLA 4DSEA 4NXMF 2WVDA 3I0RB 2OFHX 3DOMA 2WTFA 2V9WA 2VFSA 1YJWS 3CJTA 4F50A 3EXYA 1VQOS 5KFFA 1BQMB 4GVBA 3IC1A 4I56A 2AYGA 3TI0A 4GO5X 3BF4A 2XI3A 3UDCA 3J81j 3MFIA 5IOLA 1HNIA 4FPIA 2XY5A 2ZVIA 1DLOB 1JLGA 1TUVA 1V3SA 1VR6A 3CW2C 4MK9A 3TQ1A 2NR0A 4ZP7A 1UMJA 1SJFA 2ZH1A 5KFOA 1X9SA 1RAFB 3DKDA 2DO4A 5L1IA 3OFFA 5ETPA 1U6FA 3T1YF 3UR0A 3R6GB 1X8DA 3RAQA 3CXCR 2LQ5A 3GFYA 2FJVA 2QLJB 5LOQA 1RT6B 1S9EB 3HJVA 3UNGC 3KK3B 3NNAA 2FC8A 2D3UA 2ROEA 4XPCA 4RW6A 4R5PA 2IPOB 2YKNB 1WOPA 3OFHA 3UN3A 3WIUA 2XZDB 2AF6A 1U8SA 2UXCJ 1XR5A 2XSJB 1UVIA 3M05A 3QLHB 2AIRB 1C4CA 3G82B 2U1AA 3M1VA 5D3GB 1FF2A 3VAHA 1N36F 1K9MT 3Q83A 3F0NA 3J7AN 2OJ3A 2AYBA 4XIUA 4B3RJ 2GHPA 2YWHA 1IBKF 2Y0BB 1RKIA 1VC6A 3C6TB 1QE1A 4CYUA 3N28A 2K7JA 4Z37A 4TU9A 3BS9A 5B0BA 1UVKA 1BQMA 2HFSA 2UXBJ 4LF2A 1NK0A 4QW8A 3B4MA 4ZN3A 3FKBA 3EGZA 1Z1ZA 2LA6A 2ZOGA 1WKKA 3O2IA 4ZLNA 4WCEQ 1MMLA 2CYYA 3PV8A 4U8VA 4HHHA 4UQGA 4M5DA 2DGOA 2IRYA 4HH0A 3N5FA 3TQEA 4LBHA 4CLZA 1NHUA 3V6KA 2BVZA 2HFOA 1SKUB 1TTHB 1FWKA 1RTJA 2XMWA 4JOUA 2XGQA 5JUMA 2Z0GA 3UDEA 2BACA 3CDAA 5F41A 4HT7A 4ECRA 2HGNA 2X1GA 4DL2A 2MLZA 1RZMA 1DAXA 2YQ0A 4CO3A 4ES3A 3K7RA 3M8SA 3C6TA 3W2WA 3N6NA 1X31C 3QT8A 2PIIA 2FD2A 2OPPA 3DLJA 4DV1F 3NWGA 1XNRJ 4GMKA 3EUNA 2WSFC 1VRUB 3I82A 3NS6A 2BEFA 4IG0A 1R7IA 2FGCA 2J8AA 3WDOA 2GO8A 5E2QA 3K5PA 4K2JA 4LIWA 3GP9A 4MMOA 4JI1J 5EWGA 1HHSA 3ZZOA 1X0FA 2OIHA 3GFZA 2HVHA 2KM8C 4JBCA 5CYQA 1U1RA 2OSRA 1TL1B 4K7QA 1FA0A 1PC4A 2WVBA 2UV8A 4R5PB 5F8NA 3G8TA 2UU9J 1S7IA 3G71S 5DZ7A 2KDOA 4C8LA 2ZVSA 1V3RA 3OTEA 3OD2A 4D3HA 4X4PA 1WHVA 3UDLA 1K73T 2J0SD 2B51A 4X62J 2VPWB 2C2NA 2MZQA 1U7LA 4WP8A 1NZ8A 2KH9A 3KK1B 1KFDA 3KLHA 1CC8A 5I3PA 4EK2A 5CYMA 5ETOA 4F3OA 2DGSA 2ZBPA 5KG0A 3FCHA 3HVTA 4QOTA 2QV6A 4QJVA 2FVSA 3RR8A 4RUAA 4D3GA 4TN2A 3LA0A 1U45A 2V2QA 4JI4F 2GW8A 1SJQA 2WOMB 4RNFA 3AJ1A 3IS9B 3J81Y 4L72B 3H4BA 2Z57B 1VJWA 4RBTA 1H2TZ 4JI2J 2CXEA 2AZ3A 3S6EA 2QMUB 2F9DA 4LFBF 2HZCA 3PKYA 4J5OA 4CM2A 4CH1A 3Q8QB 4LQ3A 2OD6A 3J7A1 3PW5A 1JIHA 2JLFA 1P1TA 2FHJA 2MQNA 2OPQA 4NWBA 4OX9F 3RU0A 2HMIA 1M5PC 2AD9A 3IN5A 1O0PA 3NGDA 1SI9A 3PIPQ 3ET6A 2KL8A 3I87A 3LW5C 4G1IA 4IOBA 4USTA 1HBOB 2Y3YA 1SCJB 1ZPVA 4L73A 4F7VA 4ECTA 2P8IA 5IWAF 4MJKA 3SZ2A 1C0TA 3MR5A 1G7CB 4FS2A 1VIOA 4HTIA 2O1PA 3DOKB 1ZA2B 3OHAA 1P9YA 2BUNA 4USWA 2QLBB 1R0AA 1WACA 2BABA 3HSGA 3I4PA 1RWXB 5J1EB 5HANA 1VQ8S 5FJ4A 3CDBA 3GIRA 5IXUA 3SCKE 1JQGA 1HKAA 4QIGA 4HACA 1JLQB 1AZSA 2DGVA 3WC0A 4ZLPA 2QX0A 5KFRA 4U67Q 2DNMA 2OD4A 1GXLA 1Q53A 1JLEB 2J8SA 2XZWA 4I2PA 4B02A 2G1HA 4AXIA 4J9KA 1RWMB 1RT1A 4TXSA 3CO0P 4XDDA 4P7TA 4FXVA 5J2QB 5C42A 4FP9A 2OMOA 1NHVA 4MK8A 3V5RA 4DL3A 4DR5F 2MSTA 1RTDB 4EGLA 3QATA 3RRGA 2AYMA 4FZVA 4Q2MA 1F3FA 4USMA 5CAAA 3F73A 1X4DA 4AUKA 1Q4RA 3H2UB 4NLVA 3G87A 3QO9A 3MOJB 3EGWB 2HHTA 3F56A 2XSJA 2DEJA 4P73A 1S76D 1C0UA 3ETOA 1NSPA 4ER8A 1TU0B 1TZ0A 1PBAA 1RK8A 2HWHA 3MEGB 3ZNUA 4DX7A 4LRCA 4C2MA 4F2RA 3VAJA 4J9QA 5AE2A 3MPYA 2HQDA 3SCJE 3RAXA 3BQ0A 1BC6A 1NK8A 1WEXA 4A8KA 1SH0A 4MKVA 1R31A 2DNRA 3IBWA 4ED0A 3MR6A 1E6YA 3M30B 2HZAA 1VDHA 3C6UB 3HCXA 2W24A 2ROPA 3MM6A 3PNIA 4NLQA 4Q7AA 2DPIA 4H54A 4ITSA 3LP1A 1S72S 1UPMB 1TV6A 1KVIA 3D6HB 5I3QA 4PQUB 1YDLA 2ZKTA 3IXQA 1HNWJ 5HJYA 3MEKA 1M1GA 1C1BB 2IM3A 2N3LA 2NSCA 5IM0B 2N7CA 1YJNS 1Y4ZB 1S0NA 2HIYA 4M5DB 3UPFA 3PY8A 1HI1A 2H9ZA 3R7NB 4ED4A 1KOOA 2FUG9 1SPBP 2C3PA 2HQIA 5K8MA 3PW4A 2KYZA 2V2VA 4C9DA 4KQZA 3DRPA 1SB6A 4ZVFA 5D0HA 1WC1A 1YSJA 2FHJD 1RBOB 4USIA 2HFNA 1REVB 1UWBA 3B78A 3T1YJ 1NDPA 1WD6A 1JLBA 3PRBA 3G96A 1T05A 3MM9B 4J9LA 3LP0A 3W1YC 3V4IB 1PC5A 4HI2A 3VHQA 2ZOMA 1IXKA 1O51A 4DXLA 2IFXA 3R5JB 4ALZA 2ZZNA 2XHCA 4DSIA 3G82A 3W66A 1BLUA 2WSCC 4WXOA 2R8JA 2BW2A 2GQCA 4P2SA 1IKXA 1VQYA 3OSPA 1S1TB 1CULB 4USUA 2W4PA 4DCJB 4C6AA 4ED1A 1XC9A 1F0XA 2BE9B 5CZXA 1J27A 2X3GA 2QLXA 5HP1A 4YR2A 3VALA 3IR6B 3BO3A 2VF3A 2XLKA 1FDAA 1HBNA 4OJGA 4NASA 1Y00A 3FRYA 2WVEA 3QBCA 5B0DA 2DBBA 2NXNA 3M4XA 4ECSA 1L3SA 1Q1KA 1K1SA 2CNNB 3CIZA 4DCPB 4PRFA 1S99A 4KGZB 2B9XA 5A6WA 4HHJA 1CJUA 2MZJA 4NA1A 5HMZA 2ZJQQ 1VMBA 3IO1A 1U6BA 3J80Y 4YEAA 1Q78A 5HROB 2E5GA 2B56A 4CLLA 2VIHA 2V4JA 3AB2B 2BXJA 5G0RA 2OPSA 1OPIA 2ZOFA 3AY0A 3M6UA 5BYRA 4QW9A 3T5JA 1X4CA 2UUCF 1PG5B 1Q95G 3OUYA 1KVKA 2R2SA 5H1SV 1SC6A 1YWXA 1F2HA 4A46A 3HI9A 4DSLA 2Y9HA 2CQPA 3B8HA 4QIEA 1QY7A 4UQTA 3M2VA 1OS5A 3OTDA 5E3CA 2CPFA 1PYOB 3HKZD 3NCPA 1RAIB 2IVFB 2YQ1A 3SI8A 1REVA 2C22A 1QAYA 1N34J 4C8MA 1MROB 2VJVA 4K8RA 5FD1A 2JOQA 4CO2A 2D1CA 4G1PA 1VQ9S 4RU9A 1MSWD 2W01A 3IRXA 4LR8A 1W2IA 3HHLA 4WYLA 3VTIA 2ZUAA 3NCQA 4CO4A 2Y1JA 5KT2A 2F4VF 4CTAA 1HQEA 4DUTA 4A8FA 1FKAF 5ETRA 1HWJA 3W2WB 3THPA 4UZCA 3T1HF 3P5BP 4KR0B 3ZC4A 5AE1A 1RT4A 4P75A 5K8OA 3W5ZA 1M90T 2CQHA 2LP4A 4LR9A 3QIDA 4Y3CA 2NXEA 2VBZA 2WHOA 3FRZA 1NJYA 3OUYB 2R8KA 4W90B 2PC6A 2DCLA 5GAHI 1U26A 4NMLA 2DTJA 1JXVA 2XNQA 4RPFA 5E7OB 4JI5J 1WC3A 4NLWA 1UVMA 4LSNB 3KLEA 2QTWA 2F4VJ 3CDWA 3OXGA 3IAS9 2ZH8A 2VOPA 4HT5A 2V50A 2AYEA 1NPPA 4Q45A 5B7WA 2E9TA 1GMWD 3BN4A 4OZ5A 1HR0J 1K0TA 2ATLA 2DHXA 4LSLA 4DV5F 3MEGA 4AL6A 4J9PA 4C0HA 3MWBA 3KLGB 4WIIA 1S1UB 2W9BB 1B99A 1QDUB 3NCRA 1Q8KA 1T9YA 2DGUA 4GO7X 4BBYA 4A8XA 2V5HG 1WF0A 4DPYA 1U1LA 1XQIA 3S7RA 5I3UA 2DNYA 3TZZA 4JYAF 1NXIA 1YZ7A 2RILA 1MWZA 3HXMA 2HVZA 3MMBB 1TFWA 4DN9A 2ZFHA 4C8OA 4UTGA 1M1HA 1RI7A 1R0CB 1RE1B 3E51A 1GMVA 2C2EA 4O3SA 2DNLA 2RIJA 4LF8J 2B0GA 4IR1A 1IJEB 2CPYA 4Y00A 2J7WA 3CVKA 4UZBA 5B09A 2COLA 4WPAA 4PR6A 4RW4B 5DM7Q 4DZDA 3I9ZA 2LYVA 5D15A 4DX6A 4ED6A 4QU6A 1SVDA 5J1EA 3EVOA 3QRQA 3Q22A 4WK1A 1HBMB 3BBBA 3D0GE 2Q6CA 3KMQA 2BANA 2QC3A 1FRKA 3CD7A 3RW7A 1KD1T 5IM0A 5KG5A 2FZGB 1IBCB 2LU2A 4UT4A 1G1XA 2LXIA 1SC3B 3C46A 2ZHBA 1HA1A 4DLGA 3M2UA 3MDFA 3Q8VA 2Z8QA 2ZHAA 1UEVA 1C1CA 4ZPTR 4DZ6A 3CULA 3MM9A 4PUOB 4PABA 4NXMJ 4NLRA 1E6YB 1PYSB 2H65B 2C3YA 3M30A 4A47A 3IAM9 4RNHA 4DU7A 4IDKA 2EPIA 2XS5A 1OQ6A 1F5AA 4OZ3A 1JLAB 1VQPS 1HFEL 3DRPB 4HVZA 3S01A 3PRVA 1LEOA 3Q8PB 4DR5J 4X4QA 2R7WA 5DQHA 4JI2F 3TUPA 2MQOA 3CCMS 1C1CB 3M8ZA 2HGLA 1SBRA 4P52A 5LJ5Y 4KH0B 4EBEA 1PJ7A 1TKXB 1URNA 4F3QA 3D4JA 2B43A 4X66J 2WAQD 4HI1A 2M3DA 4ELVA 5KFUA 1V9OA 4J90A 2XNRA 4WFYA 2GIFA 2JVRA 5KFBA 4O44A 3PJXA 4YHHF 2RAQA 3IFEA 1ZYQA 1FTRA 2YX7A 1VQKS 3ZZRA 3UD3P 3QT7A 1JKHB 5CYJA 5J2QA 1BXNA 4TY8A 3EDRB 4YDXA 4RO0A 4ZPWR 4Q8FA 4JYAJ 3QQCD 2FLLA 2CWXA 2MZSA 5E33A 4DWIA 5CA5A 3VQTA 1T03B 4KGKA 2RJZA 2KKHA 3SFGA 1U09A 2O5DA 3DLEB 4QR1A 4NYOA 1NHKL 2K2PA 4ZLLA 4WFAQ 4Q2LA 3MD1A 1JJCB 4DX5A 3MR7A 1SIZA 2DEIA 2EEYA 2OLWA 1OSDA 4ZPDA 3CCQS 1YI2S 1VQLS 2VONA 2FJDB 2RDDA 2BRLA 5I4MA 2NXCA 1YQHA 4CLSA 3VVUA 1S59A 1RT7B 3QGHA 4DI6A 4V19J 1YRXA 3VQSA 1CJTA 3DOLA 1X9MA 2PN6A 2FLOA 2GQQA 4NLDA 3UW1A 3HLUA 4CM0A 3PW2A 1MU2A 2N4DA 2ZWOA 3R5CA 3TEHB 3BGRB 4OIXA 3G6YA 4LSNA 3KLEB 4DF8A 1T3OA 3TUJC 1C2PA 4OYWA 3TARA 3DHWC 1WG1A 1OMSA 2HBZB 3SQGA 4DV6J 1AUDA 3ZFVA 4K4YA 2K8GA 3BV8A 2VBWA 4FVCA 3RB3A 2CPXA 2WBMA 3W5XA 3OFGA 3BSOA 2C2DA 1J5OA 4QYZJ 5J1PA 5DLGA 2MQPA 3Q8YA 4LFBJ 3A3OB 3KKFA 1VHFA 1SH2A 2RF2B 3DI6B 1OPZA 4LRBA 4TLQA 1S0OA 2D69A 2DRAA 3RBZA 1HBUA 2Q79A 4K59A 2DGWA 5EWFA 2BJEA 4QU7A 3GR0A 5LXRA 3O1LA 4IG3B 1J5EJ 1GXUA 2BDPA 2L08A 3OL7A 4FF3A 3US5A 4DQQA 5KFVA 1GNKA 1UZDA 1Q8BA 4EYIB 3MI7X 1QVGR 1FJ7A 1FVSA 3MEDB 2GO9A 2DIVA 4OX7A 4C8KA 2KM8B 4KB7A 2HRTA 3T9ZA 1X60A 2MZ1A 1D1UA 1FEEA 2DNPA 1A6LA 1HNVB 1Y3JA 2WONB 4KT0C 2XMMA 4C8YA 2NYHA 2W4CA 3DLKA 2MEWA 2YKPA 4H4OB 4X62F 1CLFA 1TQLA 4LT6A 2RH3A 1CULA 4UOFA 2AV5A 4QR0A 4C0OC 4F3MA 3K57A 5KOWA 6FDRA 3CUNA 4IQXA 1AFIA 3ETMA 4OLPA 2DPJA 3FVYA 2OPSB 4DR1J 4K0KF 2XWXA 5LSOA 1RU1A 2APOA 2IIHA 4A8YA 3K5MA 1N33J 1MW7A 3VWSA 3QZ8A 4LF9F 3V6HA 3SV4A 2B7BB 2IAJB 4B9NA 3CJ4A 2J9DA 2ZH6A 4AQYF 4R0EA 4PXCA 2YKMB 4A4JA 2BBEA 3N0VA 5LSLA 3KLGA 1HWUA 3VZHA 1AZSB 4KV8A 2LU1A 4Y65A 5D77A 4I2PB 1XERA 4YY3F 2W1BA 1BUXA 1Q0NA 3KJFB 4ID5B 4USKA 5HVGA 2AEJA 1G2EA 5LMUJ 2B4VA 2DIUA 3D6FB 2OO4A 4LF4F 5A8RA 3QIPB 3MM8A 3O3LA 1DURA 4RL1A 1T0TV 2AJFE 4LF9J 2DK2A 2V68A 2H4YB 4DMZA 5DGAA 2LQ9A 2E44A 3P6YC 2BQ3A 1RYRA 1EETA 1L5UA 3KTQA 5KFTA 2DR8A 4JV5J 5EN1A 1TK0A 5A2QU 1O5JA 1TUGB 1XR7A 1RAHB 2PEBA 1OWXA 4NL5A 2KG0A 2M8DB 2NREA 2ZC4A 4RR5A 4YUDA 1X5OA 1IKVB 1H7XA 3N9UC 4P74A 1NJIT 1AFJA 2B6AB 3KUHA 4RX6A 3IM9A 3KFWX 2G0JA 3TJ8A 1S1WA 1VISA 3HHDA 2BJDA 4CTAB 4DV7F 2HIQA 3TZWA 2YVSA 4QWEA 3MMCA 1XIQA 2POKA 5M2RA 2HNDB 4IFVA 3QNWB 4DFPA 2IDEA 2YNHB 1X4HA 4C7QA 4BC7A 2NPIA 3KOAA 5A8RB 1RTHA 4S0MA 4F04B 5F3ZA 4NLPA 2EKYA 2CZ9A 1SV5A 4F25A 5GAGI 4NLUA 3W65A 3CCTA 4MT1A 1FKPA 4DR4F 1B0VA 1JXLA 1MN7A 4IYQA 3DU6A 5K9FA 3HULA 2A0FB 3LWMA 1NDLA 2E5JA 1U02A 1QE1B 4IRCA 4N41A 3QJLA 5IV4A 2GHVC 1XJWB 1Q5YA 2EKNA 1HI8A 5D0GA 5GAEU 1FNXH 3HVWA 4WTOB 4ZCIA 1NAQA 1SUQB 3ZZUA 5D4LA 4RW7B 3GFHA 3QSIA 5IFMA 2YWEA 1TL3A 4BC9A 2BJ9A 1S7HA 2ZBQA 2VICA 1WSVA 4LQ9A 1VBXA 5DZ6A 3M1VB 5D3GA 2F5GA 2Q6BA 3DFEA 2FYXA 3EGVA 1YJRA 2RT3A 2YH0A 3LOUA 1WHXA 3G2XA 2Z2YB 4I6YA 4ZVOB 2VC1A 5IC6B 2C2RA 2HZVA 1HL6A 1LWFB 1RWPB 5HP1B 4RLEA 4N8NA 1VK8A 5KFZA 4LVNP 1WF1A 5J1NA 2E1AA 2YWKA 3IWLA 4DHVA 3R27A 3G6XA 3FNNA 3H4DA 1UW9A 2DY1A 3C14B 3VAIA 3E3XA 4LFCJ 1S79A 2NPFA 2PGCA 1ZAVA 4M5HA 4OX6A 3OJSA 3I0SB 4MYUA 1JLAA 5KFMA 1MMDA 5LMNJ 1NMEB 2LQBA 2EVZA 2L41A 4DQSA 1HYSA 2J0QD 1PILA 1QTNB 1JK9B 3JYTB 1KS2A 3ZTSA 4K4ZA 2KN4A 1ZAWA 2OPPB 3X3UA 5C25A 5IWAJ 5KTQA 3Q0AA 4EZ6A 3MR3A 1AW0A 3FBEA 2PA3A 3GU0A 1M5VC 1Y9OA 4I7FA 2VG5A 3AODA 2Y8WA 1APSA 1FKOA 4KKOB 2BQRA 4DR7F 2J0WA 3FBCA 4NLYA 4DN0A 1XN9A 5IT4A 1GT8A 3WIVA 1L3TA 2HRUA 4DV0J 3Q2TC 4OV6A 4GKKF 2HGMA 2I0XA 4Q0BA 5LM7E 4PG8A 2VPXB 2QRRA 5LL6d 1U6ZA 4YMEA 2V4RA 1CS4A 5IC4B 4CNYA 1GX6A 2XM3A 4ZDNA 1HNWF 1S6PA 3PVXA 1FRIA 3D6MB 3KLFB 1LFPA 2RRNA 3NGKA 1BWEA 4B08A 4IUFA 3QYYA 4C3KA 1FNOA 2N7YA 4I1TA 5C25B 2VOOA 1IJFB 4FN5A 1Q79A 1WC0A 2VG5B 1Y10A 3TVYA 3FEXB 3M6WA 1U1KA 2H1YA 3AQPA 1A9NB 1XMBA 4XDCA 5D4NA 2JEIA 1XMOJ 5FIIA 4YS2A 4LJMA 2VL1A 2H4WB 2RDIA 1LK5A 3FFIB 4B3RF 5JJBA 4DV6F 3OT9A 2VPZB 5KT7A 2MY7A 3PYFA 4WWSA 4LRFA 4IH7A 4UUWA 5EHHA 5KFNA 3UR3C 2XY6A 4CT8A 4UOCA 1NK9A 4GC6A 3UCZP 2B9WA 2IA0A 2OAUA 1LWFA 2XEXA 3WX4A 4DFKA 2UXCF 3R5DA 4I64A 4LUBA 3CD5A 1SKRA 2FIUA 1ZTTA 3GV5B 3KG0A 5ETVA 2R2RA 4O0IA 1DQ9A 1HQUB 4MAKA 1QSYA 3DM2B 2MYFA 1IKYB 2RKIA 4G1QB 5BXIA 3CDEA 2LQ8A 2V8VA 3OXFA 5KFSA 1T9WA 4WFNQ 2DRDA 3QT5A 1G3OA 1GFWB 3CJ3A 3DHXA 3P96A 3NS5A 4DL5A 4TQRA 1R8CA 1IR2A 3MECA 3B4DA 1WKLA 3BSAA 3D66A 1S10A 2MKKA 2R7QA 2OPRB 4ZITA 1NBEB 4P7VA 5FLXY 2BX6A 3JAMU 2KRBA 4B3MJ 3CC4S 3TAMB 1Q16B 2AZ1A 3LH2S 4NLXA 1IN0A 3ZZPA 3OR2A 3G6ES 3A3PB 4PXBA 2QFJA 4M5GA 3ZTRA 1RA6A 3ZTOA 2GQ2A 5F8LA 1HMVB 3H2VE 3RYLA 3SQGB 3JSMA 3V81B 1MU2B 3K5OA 4DV0F 1UZHA 4P9SA 4ZVRB 4ZCKA 4DL6A 1HNXJ 5DM6Q 2FY1A 3LTOA 4OYBA 3ISNC 2Y1RI 3PYDA 4ZVHA 1CJKA 1N34F 1EX8A 1ZS6A 1C0TB 2E9RX 1S1VB 3MMCB 1KQGB 1ZBTA 2KO1A 5C24B 1CJVB 4HLBA 1H74A 1SQFA 1RGVA 4KGMA 5HL7Q 4YB7A 4ETZA 3WHIA 1GXTA 5DG7A 3EPIA 2OI2A 1RT7A 2VD3A 1UEKA 1FD2A 2CPHA 2WW4A 2FVCA 2PMZD 3D3CJ 4DJBA 2DO0A 2FJEB 2IMOA 5KFKA 3JB9k 4KFBB 4RKUC 1KWMA 1HHTP 3EZOA 1EP4B 2A2CA 3PFEA 1A0OB 3KK2A 1ZTWA 4NRUA 2Z2ZA 4AT1B 2LKZA 4B17A 1U2RA 2XWYA 2F4FA 4AQYJ 4K2XA 3DMJB 3D1HA 2H5EA 4ZPBA 4BHQA 3E2EA 2R7XA 4RUHA 2HHPA 3JSBA 1LWEA 2VPYB 3UE2A 3OL8A 4DL4A 1UA0A 2CPEA 1XNQJ 4HL9A 5F9LA 1RT3A 3MPVA 5CH7B 4ZJQA 3GJRB 2ERRA 1ACMB 3GCXP 4U9RA 1B3TA 4EO8A 1FJCA 1S57A 2MJNA 1CQNA 3D6TB 2Y1IA 4ILLA 2ADCA 4F4YA 5HLFB 2OHDA 4MIAA 1RAJA 4OYXA 2V63A 3C19A 5A8KB 2XTJP 3PDNA 3W8GA 4E2FB 4DPOA 1MNEA 5CYQB 2DY9A 2KT2A 2P5VA 2VB6A 3SMZA 2W8KA 2IDLA 3OL9A 4EUVA 3D0IE 2LCWA 3KG4A 4ICLB 3GZ7A 1IBKJ 3GYXB 1ZAXA 5DQGA 2ZM6J 3I5AA 1TAQA 2CAJA 3HT3A 5H9FJ 2AJ1A 3AB4B 5AT1B 3I6PA 2C2KB 4IFVB 4ZP6A 1PKUA 2MHEA 1B7YB 1VLOA 3CB4A 2L48A 3M2RB 4PEOA 4LFAF 3D1QA 1DBDA 4CLPA 4U6PA 3TRGA 2Z2MA 2B6AA 2IBOA 1NCLA 2XMKA 3MAAA 4E98A 5AE3A 3T1AA 4DV3F 4DR6J 2NUHA 2W9CA 3BGUA 3I56S 4HH1A 1RU2A 2LEAA 2LFVA 3BYPA 2JL9A 3MM5B 4O0NA 3QRRA 1RP5A 2V0NA 2QL9B 5A2QY 2KJVA 3LP2B 4FBTA 2F8MA 3GWCA 2DH8A 1YZ6A 1WI8A 2FLNA 3I55S 5DO2A 1OIAA 1RT5A 5DJBA 1QAXA 1K0VA 2FJAB 2KI2A 2LEPA 4YP3A 5IT9U 1NPRA 2W4DA 2YX1A 4PXDA 4ZKAA 1D8YA 3NS7B 2G1DA 2G2YA 2XO7A 3OTOF 1UFKA 3J7YU 2ILYA 3M7VA 3T41A 3DDIA 5K14A 1RHMB 1XR6A 4R25A 1QTMA 4YHHJ 2C28A 1IKWA 4KO0B 1UW4A 2MJUA 3CJ5A 4OMFG 5AXMA 4Q8EA 1BE4A 1S49A 2XULA 1JLFB 2UXDF 1YJ7A 3MCSA 3EYZA 2M7SA 2DR5A 2V94A 4N56A 3JTNA 3TANA 2C42A 1N5SA 3OL6A 3FCVA 2QG9B 3DN9A 4OZJA 4C11A 5HBMA 1CSJA 1NEEA 2ZDOA 3E01A 3R6LB 4X4OA 4MKAA 1KBRA 5JXSA 3M9NB 2KXFA 3Q24A 2Q66A 2E5IA 4QPTA 2KXHA 4DPTA 2DHGA 1LW0A 3VAKA 4TY8B 1NK5A 3FDSA 5IS2A 5ETQA 3BH6B 2BZ2A 2GVDA 4L3KA 2CDQA 1U0SA 2MMYA 2QL7B 3AXMA 3MEDA 3V4MA 2OEJA 3EE3A 1YRTA 2A18A 4ZPVR 2ASDA 1S97A 1RT5B 2UUCJ 4PYAA 1NK4A 2DXFA 2BA9A 3BKTA 3ICLA 4IFYA 1KHVA 3NLCA 3OVSA 2XO6A 1H6KX 2GMHA 3IG1B 5D78A 3SDEA 1ROFA 2MZRA 1RAOA 4ZP9A 1S1XA 2F9JA 4CRJA 4OV1A 4H4KA 3HPOA 4EBCA 2CVEA 3JTOA 5F8IA 2HQCA 2CG4A 1CJVA 1OY8A 4KO0A 3K0JA 1NJZA 1HW9A 1Z4UA 2MQLA 3DXSX 3NGSA 3OJUA 2VHGA 3BDEA 3BBFA 6AT1B 3BBCA 2YKAA 2VU5A 3BPDA 5T7LB 5CCLA 3NRBA 2UXBF 3K5NA 2CFXA 3TX0A 2J9DE 3JSRA 1U48A 2DISA 4ECVA 2FY8A 2LDYA 3TAMA 1X9WA 3PEHA 1ZM2A 2H5JB 2M4MA 1NJWA 3A13A 4KY3A 4X4UA 2B4UA 1KOHA 4NMXA 1LWCA 2PSZA 5J2PB 1TKTB 3M8PB 2B8PA 1I1GA 4M5MA 2HEKA 3F44A 5KFYA 1VC0A 4A8MP 3H5YA 5HMXA 2B5JB 4USHA 3HK2A 4OI1A 4F4AA 1HNZJ 3MMAA 4NE9C 5GADI 4LF5J 2ZH9A 4ECWA 3MM8B 1IKYA 3BKFA 2BQUA 3PR4A 4NLGA 3N5BA 4KGXB 2CADA 3DRSA 4NA2A 3TA0A 2F40A 4ZCMA 3QGIA 3CTRA 5GMKa 2YPYA 2B7CB 4AYBD 4NCBA 2EFVA 1FO1A 4N77A 1LOUA 1UKUA 1GTHA 2HNZB 3GIJA 1WOOA 2LDIA 3BEGB 4WF9Q 1LW0B 4WU2A 4DSJA 1HI0P 4PXEA 1T9UA 5HQMA 4ED7A 2WK4A 4YFUA 4HHUA 3UWTA 3TAPA 2XYPB 4CZCA 2LEBA 1YLXA 3CJKB 2Z58B 3AD9C 3I4HX 3C3LA 1R8HA 4G65A 3ELHA 3QJPA 4Q44A 5K5MA 4DPWA 2QEXS 1VRQC 1FFWB 2BM0A 3H7HB 1I6JA 4L75A 4JI8J 1R8BA 3MHYA 2CPJA 3A8IA 1FE4A 2L9WA 4M63A 8ATCB 5A6PA 4U7UD 2FZCB 3GFXA 4DFJA 1O8BA 5U47A 4PAAA 3PRDA 4KE5A 5C42B 3CCLS 4LREA 4UF4A 5KFEA 4X4TA 2CIMA 2GAHC 3H98A 3UNYA 2HHHJ 2JEJA 4CI0B 2ZH5A 2JRSA 2ZWPA 1H2VZ 3A4TA 3L7OA 3R5AA 1N8RT 2AMCB 3DRSB 4XK8C 2L3MA 4NZ7A 2E5LF 4ZVUB 1SKSA 1JXEA 3MZIA 3V81A 2ZJPQ 4YDDB 2C2ZB 3KK2B 4FS1A 3OR2B 5DG9A 2IYIA 4DR6F 2V9KA 3P49B 2QN6B 2QA2A 3LP1B 5MLCV 1DRZA 1TP7A 4AL5A 3QRPA 2HLUA 4JI8F 3OTCA 3B82A 1ELOA 1Z2ZA 4F36A 4K4UA 5HMWA 4YB1P 2YWWA 5ETSA 1YJUA 2E1MC 3ILOA 1VS3A 4C0BA 1BMQB 1HBOA 2JWNA 3BKUA 3NXZA 4EFAC 1S0MA 2QE5A 4M95A 3C6UA 3DRXA 3MM6B 1NSKL 1XBWA 2V69A 3JAMY 2ASLA 4F67A 2FPHX 2LQJA 2OFGX 5DGBA 1QSLA 4ZJLA 2ACMA 3WQPA 2XCAA 1M5SA 2CQDA 2RU9A 4OYZA 1TELA 5LSRA 4J9RA 4DV1J 1XNRF 2KHDA 2XHWA 1W2BR 3EDQB 2ALYB 3U27A 4ECQA 4Y2KA 5FLXU 2PT0A 4CLTA 2MTLA 4ZHRB 1G4CA 3NMAA 2JSXA 1FERA 3MPUB 2PO4A 2OSQA 2CJXB 1P9QC 1HQ2A 2HFUA 2WVFA 2UUWA 3KK3A 3PYEA 5DLFA 4GKJF 4Q43A 3RAMA 3VV2B 4X65F 2IC3A 3L9ZA 3M8QB 4DL0C 1HWKA 2PMWA 3EWGA 3RUBL 1DZ5A 3QGGA 4L76A 2M8HA 5HLFA 3KYLA 1ICEB 2ZH7A 1Y0HA 2JC1A 2ZZMA 2UVRA 1RTDA 3DLEA 1LWEB 4CWBA 3TA2A 2GIQA 2KT5A 2NCKL 1RABB 3UQSA 3WBZA 3K17A 1RT3B 3QJJA 1HBNB 4LBPA 1XMQF 1X4BA 5L9XA 1F1BB 4ILMA 2ZH4A 2RQCA 2PI4A 3D2WA 5CHCB 3AXKA 3NOCA 2HYIB 4ED5A 4HACB 3DGVA 4R0JA 4O3QA 4PWUA 4JI1F 4DS4A 2DNHA 1TK8A 2ZKUA 1IWAA 1X4FA 4URGA 3HM9A 5FDLB 3G4SS 1MLAA 1K47A 2XI2A 4ZVQB 3U1MA 5EUHA 3HDSA 5L46A 5F0WA 5JVHQ 1UEUA 2FQQB 2CQ1A 1VQ6S 2DITA 5D0EA 1N5VA 2ASJA 1IM6A 2Q1LA 2XSFA 1S1WB 1WORA 4DU8A 1QUVA 1DTTA 1TL7B 3R5GA 1KLNA 1NB7A 3NGRA 3MAAB 4ZVSB 1ZZNA 2QLFB 3FSXA 1NUEA 2VKRA 3AJDA 3DLGB 1FEHA 2K7KA 4L3NA 5EX3A 2K3KA 1KQFB 3HO1A 1T9VA 2EG1A 4I2QA 3CDUA 2CVIA 4C97A 1SL0A 3IGNA 2GFFA 1EQ0A 3AOBA 2HKEA 3D7SB 4DEZA 5KOXA 2LVWA 1HMVA 3FC9A 3JSMB 3GSIA 3M2VB 1RA7A 3NMRA 2GS8A 1JJHA 3WZ0A 2M88A 2HG4A 2Z4PA 4OI2A 1C1BA 2EFGA 3IA0A 3O6QA 3HVAA 1KRPA 3D3BJ 3ZTPA 4LFAJ 1KEKA 3G9CA 2DCUB 4PWDB 4DG1A 2HHWA 5F3TA 4QCLA 1JWWA 3RBXA 3HVTB 1WG4A 4C3MA 2Z56B 3PR5B 2YKMA 2GJFA 2NXJA 3PM9A 4WFXA 3TOQA 3KK1A 1L3KA 5CQGA 2MQMA 5KT4A 1KC8T 2YPZA 2V4QA 4MTPA 5D4PA 2EFOA 2CQ2A 4URQU 2GZOA 2HHXA 5BJRA 1RHJB 3FGVA 1LXJA 4TU8A 1OY6A 2GCFA 3T5KA 5DS7A 3RB4A 3HFZB 4OFZA 1D3WA 2AT1B 3EVMA 4JI3J 2PD1A 1T11A 4WTYA 3BQ2A 3V6DA 3L7PA 2VG6B 2DXEA 2KTQA 3I9V9 4IO1A 5KFLA 2C2MB 2AQ4A 1K8AT 2OTJS 1SIWB 3GSDA 3ISZA 2ZHOA 4QBUA 1ULRA 3NAIA 3BSNA 1IBLF 1YBTA 3LGHA 3NOGA 1JX4A 5DETA 5ITHA 1JLGB 3MCMA 4JI7F 1YBAA 3PACA 2W7AA 3BH7B 1RKJA 2AEMA 1N36J 3NWRA 2PA8D 4JI6J 5B0CA 2NYIA 4NA3A 4ZIWA 5H9FK 5F8HA 1Q8IA 2J0XA 1JLEA 3H8YA 3POTB 2R2UA 1NH8A 1B4SA 5LT5A 4PG6A 1QM9A 1S4EA 3C15B 3FBBA 2ZBIA 4LRDA 5ETNA 5HJXA 2R7UA 2AU0A 1NSAA 3BQ1A 4FNIA 3H5SA 1IVZA 1OSCA 2J76E 3IGVA 5HK4A 3K8WA 4DS5A 3OTBA 1KSPA 1ZH5A 2XS7A 1K44A 1FRLA 1Q5VA 3O8WA 3PIOQ 1X7VA 2RE1A 3HSJA 3MAHA 2ZD1B 3QPIA 4R8UB 2BJ7A 4OX9J 5RUBA 3WC2A 3U02A 4F02A 4C48A 3LAKA 2YNIB 1SQEA 1G6BA 1IKVA 2V2ZA 1WSRA 3RR7A 4QIVA 2YNGA 4MK7A 1KN6A 3W63A 3M2RA 3AD8C 1U2FA 3NY0A 4DOZA 3CMAS 3K8VA 4HDHA 1U49A 3G8QA 4CLFA 5KFXA 1RLCL 3MURP 2CA9A 3CE8A 3QMQA 2O67A 3IS9A 4J7CA 1RXOB 1M1KT 2KU7A 1KFSA 4ICLA 1VK3A 1YVFA 3OLAA 1LXNA 2GX8A 2VA3A 3BDPA 3G8SA 1IQTA 1LNQA 2DNKA 1IQZA 1WELA 3GTYX 5D0RA 4H4OA 4YY3J 2WOMA 4MFBB 1F3VA 2MDAA 2QZ8A 1IR1A 5HSPA 4OX8A 3TEGA 5CD4H 3GIMA 2UUBF 2WZ1A 1Y11A 2EC2A 4PWWA 4UY85 1HNIB 4Y2AA 3P8BB 4G3IA 4J9NA 1S4FA 3VCDA 4KHRA 4NLTA 4EU0A 1EKRA 1KLMA 4KGVB 4KPCA 2XCPA 1K1QA 4IG3A 4MFBA 2BV3A 4JV0A 1UETA 3DOMB 4OJ3A 1M0SA 2MKSA 3HD1A 4Z7CA 2LECA 4BDPA 3OQ2A 3EZ5A 2F8EX 1RBLA 1ZETA 3M8YA 4QR2A 4ZP8A 2MGZA 1FHTA 4TYAA 3R2DJ 4WKRA 1GTEA 2O01C 2O66A 3DDKA 3KDOA 2N4CA 2DH7A 3PYGA 4HYKA 3AQOA 1R0AB 3DGPB 2NZCA 3M6VA 1FX2A 4OHYA 1MWQA 1VCTA 4B9UA 2UUBJ 5HVHA 1RWOB 1FI4A 3IR7B 3DLGA 3DYAA 2F1FA 2WRMA 3AD7C 7FDRA 1LW2B 5KFWA 1IR0A 4I2QB 2D41A 5E41A 4I69A 4DUZF 2C1EB 3LP0B 4CDIA 3V4IA 1ZOTA 5AXLA 2C2OB 4C3LA 2KG1A 3TX8A 1YHQS 1KTVA 4TY9A 2BOPA 1HR0F 1H73A 1R27B 3HFKA 2GGPA 2VV5A 4ZIVA 5AXNA 1XMQJ 4NRTA 2HWIA 4A8SA 2PI5A 4GKJJ 3R97A 4IH6A 1O6XA 3C8YA 3B6BA 5E3AA 1LWXA 3PCOB 3CO9A 2HHUA 2V8DA 3BYRA 2BR0A 3BB5A 4ID5A 2PFFB 2GMJA 4EWTA 2CPIA 4M1KA 4CH0S 3CCSS 3BGRA 4Y0FA 4G6VB 2XBPA 5C5JA 1SJ4P 4FPRA 4X2BA 1SJRA 2KXNB 2FHKA 5LMNF 5KT6A 1S6QA 4NCAA 4DV7J 2HFZA 2M0GB 3FEZA 4G1QA 5GAEI 4CCHA 4MIBA 3U1LA 4CO0A 3KLIA 3T19A 4BWMA 4YB6A 1TK5A 5EDWA 4N7TA 3I0SA 2E7XA 4MIWA 2VG6A 5KG4A 3CF5Q 2V2KA 4IRDA 4K4TA 4B3OA 1NB2A 2CJAA 1RYSA 1MMNA 1WDTA 1GX5A 4V19X 3T6BA 4J9OA 1FE0A 1X5PA 3MM7B 1M5HA 4DPUA 3PKMA 1WI6A 1SV5B 1TL4A 2DYAA 2IC3B 2YKNA 2MKCA 2HVDA 1QJHA 4XPEA 3EX7B 4YR3A 2C3OA 2HAFA 4ZK7M 3CCRS 1QAIA 1NZAA 1CQMA 1RT6A 3JTPA 4U7CA 3H5XA 4L74A 1LKZA 4TQSA 2V8GA 4EBDA 4RW6B 2JFDA 3DLKB 2UUTA 4DX8H 4ECZA 5B08A 3TW0A 3P4UB 2FC9A 4DUYF 5KFQA 1JLCB 3UVJA 1I51B 3ZZ0A 4X4RA 1VQ7S 5LXYA 4ERDA 3AA9A 1TVRA 2EFPA 6FD1A 1DJ0A 4M5IA 2OUGA 3OLBA 3L3CA 2OMLA 2XMUA 1D9AA 2JDJA 1E6VA 5A8WA 2I5JB 4FXWA 4QQBA 4O44B 2KHCA 4QYZK 4O4GB 4B3MF 1F5CA 1IBLJ 4PWDA 1TL5A 4NXNF 3M8PA 4U95A 1YJTA 3NKYA 2ZBRA 1BQNA 1IUJA 1EB0A 2IHR1 3I0RA 3MEEB 5EX0A 3FSIA 2CPDA 1H3DA 3PO5A 2A1BA 3A3NB 2HPUA 3G6VA 1J5EF 4KIAA 4DV2F 3OVBA 3UCUP 1JB0C 4KAIA 3ENAA 2LMIA 3SQOP 1D9FA 5T7LA 1FVQA 2DNZA 1R8PA 2K06A 4KV8B 4N76A 4RNOA 2DR6A 2ZUGA 1NKBA 4I67A 2CJQA 2JEGA 3MGJA 3SSSA 3UO0A 4OJ1A 1R3NA 1VHIA 4C4WA 4DR2F 4OZ0A 1S9FA 2RRAA 4OZ2A 3K5LA 4JI7J 4RJVA 3UI3A 2VBYA 4JI0F 3ENWA 1KVJA 4P71A 4BLGA 1DHMA 2FVRA 3MMBA 2I38A 3GONA 4YQWA 1I3OB 2IYGA 1W26A 4TU7A 1T95A 3KLVA 4IFYB 3QAEA 1NDCA 1QD1A 1KR4A 2HNYA 4F0KA 4FF4A 5ETMA 2PMHA 1YKWA 3J7Z5 4EYHB 3CNQP 2VFRA 2QJ3A 1N48A 2OTLS 2BE2A 2QA1A 2ATCB 2CZVC 4L6V3 4M5JA 4N8OA 3PJWA 4O4RA 2G0IA 3K59A 5D8HB 3Q89A 4E8UA 1UWAA 1BQXA 4EMDA 3GIIA 4K0KJ 2KRRA 3RG6A 1RHRB 2P6TA 1OO0B 1WC4A 5HATA 2B5JA 3M8QA 3M6XA 3KUGA 1IKXB 2IM0A 2MSSA 1XK8A 4X64F 3MAQA 3B54A 4PQAA 4DUYJ 5E3RA 1X4AA 5HMYA 4LSZB 2XYGB 2D3OR 1FKPB 3PFOA 1RCXB 4OJHA 2E7VA 3MUVP 2DB1A 2RUSA 1I94J 3JQKA 4ANCA 4LR7A 5DDRC 3C16A 5KG6A 4Z7YA 5SZTA 1VBKA 2WONA 1AXQA 4P2MA 1J2VA 4ZCLA 5K8NA 5T14A 2W2MP 5E3QA 3TWZA 2HURA 2ZEJA 2B8QA 1FK9B 1RQ0A 3NGTA 3MCOA 4IDKB 3RGIA 3TA1A 4XO0A 2MB0B 4F8RA 1FDNA 2W8LA 2XY7A 4DR2J 1VBZA 2BM1A 2G13A 4UW2A 4O3OA 5KFJA 4DV2J 5CXTA 3J81U 1MROA 1D0EA 2CKWA 5GMDA 3I5BA 2R8HA 1UJ4A 2QSWA 4FKXA 4NEYA 4K4XA 2FJXA 2AJQA 2F7VA 2DNNA 5KG3A 3D54A 1QUPA 3DI6A 4CP5A 4MKYA 4PQUA 4OI3A 4W4MA 2F8HA 5J2MA 1YTYA 2G0CA 1QLNA 5FDLA 1RT4B 2FGOA 2K1RA 4J37A 5DG8A 3DDNA 4ILRA 3JS9A 3T1HJ 2GV1A 3KHGA 4KHPF 3NP5A 2AJ2A 4RBUA 4I68A 3T5LA 4B9MA 4ECYA 1FRMA 1N56A 3TR5A 4JV1A 1SJ1A 2OELA 1N5YB 3BO4A 1NRKA 2ZITA 1TKDA 4ZN1A 2JFKA 4WFBQ 4FYDA 4RW4A 5BR8F 1H7WA 4A8OA 4F0HA 4LF6F 1NU4A 2X7IA 2XMAA 2FHOB 5HQLA 5I42B 2BE2B 1H38A 3E01B 1N0VC 5CD4A 1N88A 2GC8A 5I3UB 1S77D 4C11B 4KRWA 2JZ5A 4FXDA 3EVWA 3MM7A 1LFWA 2IAJA 4FDFA 4QWCA 2VQEJ 5IQ6A 1REGX 4B3OB 2BKOA 4TLRA 1SH3A 2M2BA 1S1UA 2W2OP 4XAKA 3CJSA 2VFTA 4WBFA 2YNFA 2CDRB 5I42A 1FXDA 2H51B 3GYGA 4I6WA 3IMQJ 3KDNA 4PCQA 2CJBA 3HJFA 4J9SA 2B9YA 1NM2A 3ONQA 1GMWA 1JLBB 1PIEA 3CCJS 4FNHA 3FEYB 1SL1A 4WP9A 4M5NA 2E5LJ 3EZUA 4X84A 4PG4A 2I1RA 2ZM6F 3VAGA 3T9NA 1VQ5S 4LRAA 1VIXA 4ZMMA 2CWKA 3PXGa 2HRYA 4DV5J 1VQNS 5THWA 4LF1A 2M70A 3ILLA 3Q86A 1TMMA 3VVTA 3TYTA 3JSYA 1P8GA 3O44A 1CBKA 5HAOA 2X3DA 4TKTA 2CQIA 2IRUA 4DR3F 3LPEA 1TKXA 4DPXA 4CT9A 3SBMA 4PUOA 1U4BA 2VQFJ 4A48A 1M5KC 4PPDA 4U8YA 2AGPA 1U1PA 2R8GA 1N0UA 2F3JA 1F2GA 3LWLA 1E6VB 5A8WB 3IRXB 1LW2A 2EBGA 4OHZA 5J2NA 2E7WA 3H0PA 3PW7A 1HQEB 4HDGA 2IBKA 2NZ4A 2F63A 3I96A 3BPSP 1UP1A 2FTRA 3HHLB 3ZO7A 5K20B 4LFCF 1B7FA 2QFIA 3BR8A 1CC7A 3CJ8A 1Q81T 4DQPA 4C8ZA 2DHHA 4ZOSA 1Y7PA 2RSQA 3KUEA 3QWPA 4LMZA 3GPAA 2YNFB 2KZZA 5F8JA 4DLEA 1RBAA 2WW8A 4DF4A 3V6JA 2HK2A 4CLKA 1RAAB 3M32A 1T02A 2HWTA 3L4BC 3J7ZT 1S1XB 1EAYC 2L9DA 3H20A 4RW9A 3IWNC 1TL3B 1D9DA 3CJKA 3C2PA 1DTQA 1DFDA 1VQSA 3LQVA 2AJ0A 1CG2A 4W92B 2BJ3A 4GKKJ 2GVDB 4NOHA 3PX0A 2HK3A 3TUZC 4LSLB 3ITHA 1S6QB 2BJ1A 3LAMA 1XMOF 5KG1A 1WHWA 3QWUA 5IV3A 4QWAA 2GVZB 4A8QA 3T3FA 3LANA 4F2SA 4NYPA 3PX6A 1RAGB 3FZ2A 1JKHA 2P6SA 5GVQA 4NZ6A 1FWPA 2R7RA 2HQFA 2VBXA 3W9HA 2UXDJ 1TKZB 1XTZA 1VFJA 2DKOB 1YG0A 1Y5LB 2RS8A 3ZXWA 1UVJA 1AYEA 3TP2A 4AL7A 3J7YI 3K89A 2M52A 3A8JA 2AX1A 4Z2XA 2MKIA 3R7BB 3EXCX 2DNQA 4X4NA 4IOAQ 3KLIB 2JEFA 2VODA 2QA4S 2F65A 1EQMA 1Y3KA 4URSA 2HAIA 1Q7LB 4CNZA 4CLUA 1SKWA 3SIPB 1NJXA 1IM4A 3MTJA 2BOAA 3EM1A 4AD6A 1EETB 4ZS6A 3EICA 1JLQA 3M8WA 4IQMA 4M8LA 3AH6A 3OV7A 1V5VA 2CG8A 1CS4B 1EKSA 3I32A 4P2XA 4WYWA 4IH5A 1R89A 2AGQA 2UVUA 1QAJA 1T9TA 2ACYA 3DGPA 1DARA 1H98A 2WB4A 4K5RA 3Q8SB 4UUXA 3M9OB 4Q0BB 4KHMA 3MECB 3NL0A 3H90A 3M2UB 3UDVA 4M94A 4WXWA 1I94F 3ENQA 1L3VA 1FCAA 2OKQA 1RJJA 2YWFA 3UD4P 1CPZA 1VQMS 4F4ZA 2KFZA 3GMGA 4A8WA 4NYZA 2EK6A 5H9EK 1PGZA 3CCWA 1TFYA 2BANB 3HKWA 2P9CA 5HROA 2J6SA 4ZVPB 5HQ8A 4O4GA 1CVJA 1P6TA 3ZZYA 5K8PA 2J5AA 2AW0A 2PE8A 5KFIA 4AXJA 1D8ZA 2CZ4A 4Y2CA 1YK9A 4ZVEA 3CMES 4X4VA 1EHWA 3BGLA 1FRHA 1TAUA 2XB2D 2X51A 4NEZA 2EK1A 3ZZTA 1U1NA 4YB5A 3C16B 5ETLA 3EPGA 1RT2B 1VRTA 3N01A 3QO9B 3P45B 4C8NA 2ZH3A 4K4SA 4H4KC 3V2UC 1S9EA 2YKOA 1V5IB 2E29A 1BGXT 4ES2A 2BJ8A 1WTBA 2W25A 1QSSA 2Q3PA 2HBQB 2IY5B 1VLYA 4NX9A 3UN2A 2ZDPA 2UVVA 1F5BA 1AB8A 3Q2SC 4ZPAA 1Q82T 2R7TA 1JLFA 2NUUG 1SXLA 2FB0A 5CYMB 1F9FA 2P2CB 4EO6A 3X1LB 1AUSL 4OZLA 4JI0J 1AROP 4OYPA 1IKWB 2NS1B 2KFYA 2R8IA 3ADAC 3KLFA 2H3EB 2CNKB 5K14B 1HNXF 2UP1A 3P3DA 4Y34A 2R9LA 2ZE2B 2BMBA 2RD5C 4RZRA 1WOSA 2ZNYA 3GR1A 5BR8J 3IBFB 1PO6A 4N5SA 1P27B 1HPZB 4PYDA 5F8MA 1PBUA 3DMJA 2CQBA 2FVPA 2A6OA 4ED3A 1S1TA 3HHLC 2V6AA 2QYCA 1WKJA 3MPWA 3CCVS 3KJNB 2QMXA 3N4WA 4EZ9A 1RWKB 2XLJA 2RRBA 3EJMA 3SCIE 2J7UA 2RNEA 4B9SA 3W9IA 4K5SA 2Q43A 4FYVB 2DNGA 2H48B 2ZNZA 4J9VA 3CCUS 3CCZA 3QFHA 4ED2A 3GJQB 3CJ2A 2D74B 3OTOJ 1R6VA 1U0HB 2D7SA 2EFNA 3HZEA 3OR1B 3W60A 2RU3A 2Y8YA 3PO4A 4GVLA 1CJTB 1S1VA 3DOLB 3FZBA 4QIWD 4X64J 3SV3A 4ELTA 2VG7A 3HD2A 5F9NA 2DGQA 4M5LA 4OYOA 3MR2A 3HHNB 2AKWB 3VAMA 4K4VA 4JV5F 2E66A 2GIRA 4JI4J 4DR7J 5DDQC 4F4XA 2YX4A 1DQAA 5D4OA 2IMWP 3DYAB 2R7SA 1RTIB 2I6WA 1GEHA 2VQEF 4GC7A 1RADB 4M5KA 3ISND 5IT9Y 2M5YA 2R3VA 2PEHA 1RWNB 3W8PA 1BQNB 1HPZA 4J91A 4DV3J 2KVQE 2V8PA 5KG7A 5L39A 3P5TL 2OPRA 3PHEA 4DSKA 3TJ9A 3ULHA 3TO8A 2YQ3A 2VKZG 3FQLA 4KBIA 3HP6A 2FDNA 3OBIA 1WHYA 2X1FA 1VYAA 1XWLA 2JHEA 2VDHA 3DM2A 1S5ZA 3IP0A 2UZAA 5L9NA 2QA4G 2V67A 1CJUB 1FNMA 1FWLA 1GQEA 1N5TA 4MH8A 3W7BA 3HHEA 4YR0A 3KLHB 3K2YA 2HS0A 5AJ3F 5E5NA 2CUYA 1KDNA 2CQGA 1DLOA 1NO8A 1RT1B 1HW8A 1RTZA 2GJ2A 3IR5B 3R1LA 2EC0A 3M32B 2MXYA 3NG8A 4ID8A 2CRLA 1NLKL 3EMTA 2CJYB 1UFWA 2G2ZA 4UOHA 4RU2A 3Q23A 1UCNA 2FVQA 2WCXA 5HN0A 4JI3F 1S9GA 3OVAA 1PYTA 4NZ0A 3MTKA 1VQ4S 4PPZA 3VF0B 2YY3A 5F0UA 3QFWA 1IWGA 4LVOP 3TVZA 9ATCB 1QVFR 1YBUA 1N5QA 5A76A 1KQSR 1ZZFA 2QMWA 1UFLA 7FD1A 3RW6A 5DQIA 5H9EJ 1HWIA 2HBYB 1NPKA 1RTIA 2CPZA 3CJ0A 4I6AA 5ADZA 3LGMA 4DSFA 2YKQA 4O23A 5ETTA 5AJ3J 5C24A 2YNGB 1BY9A 1UPPA 2ZD1A 4R8UA 3SCLE 1UWBB 3TNVA 4ENOA 3QSYB 1VGYA 5SUHA 4YOEA 2OPQB 2XGPA 4IRKA 3PG9A 5A0YA 1FXRA 1RHKB 3W62A 3NEKA 4NPOA 1JJ2R 2SXLA 1YJ9S 1B0TA 3I5CA 3LUYA 2E1RA 3C66A 3FBFA 2BW7A 4PG7A 1GMUA 4RUBA 1URRA 4CQ1A 4X4SA 2ADBA 3IBCB 3PHTA 5G4DA 4RUCA 1J5OB 1S12A 3N6MA 2Y1LB 3OW2R 2XQCA 3QIPA 3TVKA 2ZBCA 2HW3A 2DHAA 2BRKA 2YH1A 3DOKA 1F6TA 1WNEA 3DLBA 1LV5A 2KYXA 1TV6B 4YN3B 3DXBA 4I7FB 3GV7B 2E5HA 2X1BA 1WF2A 3A8KA 5L1LA 2P9EA 3R3TA 5LMUF 1RWVB 3DRRA 2RMLA 4HTJA 4CYUB 1XEZA 4F4KA 1RWWB 1WC5A 3AJ2A 2EXUA 1EIYB 3JXOA 5GADU 2DGTA 1FD8A 1I5OB 5B0AA 4KSEB 2A10A 3N6LA 2IA6A 2CNOB 2IJFA 4OYMA 4BS2A 2IVYA 2G2OA 2AHOB 1R0BG 3JQMA 4WIQA 3SEOA 4JUZA 1A7GE 4FYWB 4WJBA 2VFVA 4ANDA 2J6UA 3V6DB 1TKZA 5HO4A 4E0DA 4O3NA 1MG7A 3FMWA 3IWXA 2FHMA 4QPXA 5KT3A 1HNVA 1H72C 1RT2A 1SC1B 1VRTB 2AGOA 3GV8B 2IM2A 1KKHA 2D9OA 3L09A 3WX8A 4ATNA 2XLIA 1S9GB 2K3IA 4I0WA 2OEMA 4DDFA 4IR9A 5DRKA 3FQKA 3HVRA 3EGNA 1WDDA 4IKAA 4RW7A 3HFVA 3ITHB 4QYRA 3OFEA 2RVJA 3VGVA 2ZJRQ 2EFQA 4PZVA 4OHVA 2DJWA 1HNZF 4DG1B 3RJMB 2GNKA 1YX2A 2R7OA 2V8HA 4ZJOA 2N82B 1ZM3A 1R8AA 1TMJA 1WEZA 2R4FA 1HD0A 2RS2A 3F41A 1RLDA 1U2CA 1ZA1B 2ILZA 1JNRB 1OJ4A 3CMQA 3GE9A 3KNGA 1YIJS 1LK7A 1C4AA 3GG0A 3NNCA 1RSCA 2UV8G 4LF4J 1YJVA
chains in the Genus database with same CATH topology
2EWHA 2AWZA 2RF2A 3O5TB 4WFZA 5L8RC 4FBUA 4ZHRA 4QWDA 4IOCQ 1HD1A 4KPYA 1U1QA 4IG0B 4FF2A 1UAWA 3CPWR 4USJC 2YTCA 5HI7A 3NBPA 4OZNA 1UVNA 4B9VA 1GH8A 3H25A 2NQPA 1H2UX 2CQ4A 3VR1A 3CD6S 5IZHA 1U1OA 4TYBA 1DTTB 4KTQA 2J9CA 5T41A 3MFHA 1WWHA 2KFNA 1N52B 3QLHA 1KNZA 1ZM4A 2AP6A 3QZ7A 2DD8S 2NLWA 5KFDA 4AE5A 4CO5A 1T03A 2R7VA 5KFCA 3KJVA 1SJ3P 3POTA 4OHXA 1HWLA 4MKBA 2I2YA 2ZE2A 3FMBA 1FDBA 3ENVA 4OHWA 2QIFA 4DL7A 1FJEB 3HF5A 3BSCA 3I31A 2CQCA 4H4MB 4DR1F 4DQIA 3N79A 2OH2A 1SUQA 3SYZA 4ZA1A 2KVIA 3LO3A 3W2VA 5MAOA 3KMSA 1N32F 1UL3A 4NLSA 3MMJA 2CQ3A 4WZQA 1DTQB 2LLZA 2W7OA 3BO2A 2G4BA 4RW9B 2MKHA 3CSKA 3HHKA 1U1MA 3GQCA 2E1CA 4LF5F 2HHSA 4OL8A 1T8EA 2HQ3A 3SSQA 2EW9A 4Y2IA 3PW0A 4JV2A 3FFIA 5M2UA 4Y2MA 1U47A 3D0HE 3LPYA 1S48A 4WU3A 3CC2S 4Q5VA 1N33F 1S0VA 1N5YA 1R6YA 4Y28C 2MPUA 2LXFA 2VH7A 3K58A 4B3SF 4JI5F 1Z2LA 2VG7B 1N54B 4OLOA 4WK3A 2LXUA 5D6GA 1X4EA 3T6JA 2FJBB 2HS4A 1VC5A 4BCAA 4ZVGA 1FESA 4K50A 1JJ4A 1ZPWX 3U1NA 3DRYA 5CZVA 2WBRA 3FJ2A 1HBUB 2GA7A 3CCES 3GB0A 4PUOB 3THVA 4B9TA 2HS3A 4HKQA 4RNMA 2I9SA 3FSYA 2ABYA 3PEJA 2B4OA 5L1KA 2RQKA 1YITS 3HZGA 2JLEA 4NLOA 4WZMA 3R5BA 4B3TF 5A0YB 2W7PA 2FLPA 1NKEA 4KKOA 1OQ3A 2XMTA 3GIKA 4K4WA 3SSRA 3CWJA 4ED8A 3BN7A 3CIMA 1S6UA 1C0UB 2Z2LA 4BWJA 2XG8A 2KH9A 4DV4F 3MOZA 1V3ZA 4N47A 3JYTA 3J7A1 1Q8LA 3QAUA 4DFMA 2DR7A 1LQ9A 3HX9A 1KQKA 3SXLA 2KT3A 4RWXA 4RWWA 2MY8A 3RRKA 2HVIA 2W9BA 4O3RA 4NCGA 3S1TA 2J6TA 4DQRA 3MUMP 1GAOA 3A1YG 1FRXA 1N6QB 1FJGF 1SL2A 3CD0A 4ES1A 2IM1A 5EWEA 3L95X 4HEA9 5AXKA 3RBEA 5GAHU 4OI6A 3Q8RB 4F26A 3MXHP 3RB0A 1T94A 1N4LA 2RUGA 3NAHA 3BJYA 3E8OA 2XS2A 3VAFA 2A3JA 3M8RA 3GYNA 4LF8F 4X66F 4WE1B 3BR9A 2C3MA 4RW8A 2O3DA 2ZC3A 4KFBA 5HBMB 2HLTA 2C3UA 2K1RB 1Y5IB 3A8EA 4B9LA 1JNZB 2RB7A 5J2MB 1UJ5A 3KHLA 3LGNA 1NNDA 4JI6F 1LWCB 2I8EA 3GG1A 5J2PA 2G9OA 3AAWB 2GJIA 3KHHA 2P9GA 3HMJG 1UA1A 3MUTP 1Y5NB 2YNHA 1M5OC 2LA4A 3T5HA 1FK9A 2DGXA 3D28A 3RB6A 2HNDA 3DCAA 2VUGA 1CEZA 4RBVA 2QT7A 1RDRA 2ROGA 2PDAA 4WKYA 3KWMA 4IO9Q 2MKJA 4OI0A 3MD3A 1X0PA 1TR0A 2JH3A 3BREA 4OZ1A 2MQQA 2MGZB 1Q86T 5KFHA 4C98A 3MF5A 3OR1A 4OQJA 2GHWA 5L38A 2JVOA 1KONA 5M2PA 1HBMA 1VOMA 2Y0SD 5F8GA 2W9CB 1S6OA 2EI5A 3RRHA 3PZPA 3BM7A 2B3TB 1T7PA 2W9AA 4TNOA 1BD6A 2HHHF 4PKDB 4ECXA 5E0OA 3ZZZA 2CQ0A 3CGIA 4LF7F 2N3OA 2CJKA 5DDPC 1V6HA 2KJWA 2VFUA 2YWGA 1ZM9A 3TAQA 2HHQA 4F4WA 3BZQA 3CT9A 3UCGA 2WSEC 2ZH2A 3HHLD 1NK7A 3DNCA 3H59A 1EP4A 4FVMA 2M9KA 2UUAF 1L3UA 1VRUA 2ASYA 3THTA 3RBDA 4QZVB 1TKTA 3S8SA 4ELUA 1QLNA 1HARA 2KZMA 4AFFA 2U2FA 2MHNA 2AJ4A 2HHVA 1T05B 2EG2A 5B0FA 2DR9A 3CC7S 1X4GA 2XC9A 1XNQF 1NKCA 2NSBA 2HNZA 2WB1D 2XMJA 2RQMA 5JVGQ 3RTVA 2XMVA 3LALA 2KB2A 2UVWA 1S6PB 3NBPB 4EEYA 3H5UA 2QO3A 4QWBA 3UFCX 5KFPA 5J2NB 2IJNA 1KTQA 4CO1A 2GMLA 5KFGA 3IRWP 1KHWA 4CIOA 2OP5A 4O3PA 1RWUA 3MM5A 1FTCA 2A2DA 3BGFA 3PX4A 2UU9F 4UY8T 3LP2A 3IG1A 3SDEB 3MEEA 2IVMA 1T3NA 2I5JA 2IRXA 4QIFA 2CJ9A 1F60B 2DRBA 4KJIA 1Q7YT 2MZTA 3RZAA 5BYQA 2NXUA 3OHBA 1YRUA 2DT9A 1IBMF 1TVRB 1HQUA 2VA2A 1WTFA 5CCMA 3D5MA 2J7KA 1W25A 1H0HB 2D9PA 4KC5A 1JLCA 5BYSA 1FT8A 2RDJA 4ECUA 4J9MA 2RQ4A 1FDDA 5GAGU 3KG1A 5E3PA 3VZIA 1N6QA 1U25A 3SFUA 3AA8A 3KHRA 2BYCA 3U7JA 4NCGB 2VC0A 4PG5A 2V4JB 2DH9A 5G0RB 2R2TA 5L1JA 1VI7A 4I4BA 3GILA 3W2VB 3CEDA 3LF0A 4U7UK 4RW8B 5A8KA 2E9ZA 1KLMB 1NH7A 2JC0A 4RNNA 4WE1A 4H4MA 1VBYA 1DQ8A 2RKIB 1WEYA 1WG5A 4P6QA 4FF1A 3G86A 2VQFF 5KFAA 3W3SA 3DRRB 1UVLA 2D3ZA 5IQQA 3DLHA 4DBQA 2QSFA 1UJ6A 1FXLA 2DVIA 1TL1A 3KJVB 2DHSA 2VZ9A 1U24A 2HNYB 5B0GA 1RTHB 3NNHA 3OPKA 3MMAB 4OI4A 2AX0A 2L9NA 3D1OA 2X1AA 1B64A 2DNOA 3OSNA 2ALZA 3R1HA 4CH7A 1B0PA 4ETXA 3AHPA 2QLWA 1FRJA 5F8NA 2J9EA 5KG2A 5IT0A 3H2LA 5B0EA 3DC2A 5KT5A 1YGYA 3DU5A 1MWYA 2GGPB 2VASA 1FKOB 1JMTA 4MYTA 4ZPCA 2YNIA 2FJWA 4Y6IA 1P1LA 4LIRA 2EBEA 2JJ4D 2JLGA 3TUIC 1R43A 3M9MB 3QGPA 3KNAA 5KAKA 1PSDA 2HMIB 1X5TA 1X5SA 1RTJB 2B4PA 5EGYA 1RISA 2JX2A 1HYSB 5LJ3Y 3OXLA 4DSEA 4NXMF 3I0RB 2OFHX 3DOMA 2WTFA 2V9WA 2VFSA 1YJWS 4F50A 3EXYA 1VQOS 5KFFA 1BQMB 4I56A 3IC1A 2AYGA 3TI0A 4GO5X 3BF4A 2XI3A 3UDCA 3MFIA 1HNIA 2XY5A 1DLOB 1JLGA 1TUVA 1V3SA 4MK9A 3TQ1A 2NR0A 4ZP7A 1UMJA 1SJFA 5KFOA 1X9SA 2DO4A 5L1IA 3OFFA 1U6FA 3T1YF 3UR0A 1X8DA 3RAQA 3CXCR 2LQ5A 3GFYA 2FJVA 1RT6B 1S9EB 3KK3B 3UNGC 3NNAA 2FC8A 2D3UA 2ROEA 4XPCA 4RW6A 4R5PA 2YKNB 3OFHA 2AF6A 1U8SA 1XR5A 2XSJB 1UVIA 3M05A 3QLHB 1C4CA 1N36F 2U1AA 3M1VA 5D3GB 1FF2A 3VAHA 2OJ3A 2AYBA 4XIUA 2GHPA 2YWHA 1IBKF 1RKIA 1VC6A 3C6TB 1QE1A 3N28A 2K7JA 4Z37A 4TU9A 3BS9A 5B0BA 1UVKA 1BQMA 1NK0A 4QW8A 3B4MA 3EGZA 1Z1ZA 2LA6A 2ZOGA 3O2IA 4WCEQ 1MMLA 2CYYA 3PV8A 4UQGA 4M5DA 2DGOA 2IRYA 4HH0A 3N5FA 1NHUA 3V6KA 2BVZA 2HFOA 1RTJA 4JOUA 2XMWA 2XGQA 1NK6A 5JUMA 2Z0GA 2BACA 3CDAA 5F41A 4HT7A 4ECRA 2HGNA 2X1GA 4DL2A 4ES3A 1DAXA 4CO3A 3M8SA 3K7RA 3C6TA 3W2WA 3N6NA 2PIIA 2FD2A 2OPPA 3DLJA 4DV1F 3NWGA 4GMKA 3EUNA 2WSFC 1VRUB 3I82A 3NS6A 4IG0A 1R7IA 2FGCA 2J8AA 3WDOA 2GO8A 5E2QA 3K5PA 4LIWA 4MMOA 5EWGA 1HHSA 3ZZOA 1X0FA 2OIHA 3GFZA 2HVHA 2KM8C 4JBCA 5CYQA 1U1RA 2OSRA 1TL1B 1FA0A 1PC4A 2UV8A 4R5PB 3G8TA 3G71S 2KDOA 4C8LA 2ZVSA 1V3RA 3OTEA 4X4PA 4D3HA 1WHVA 3UDLA 1K73T 2J0SD 2B51A 2VPWB 2MZQA 1U7LA 3KK1B 1AUDA 4F3OA 1KFDA 3KLHA 1CC8A 5I3PA 5CYMA 2DGSA 5KG0A 3FCHA 3HVTA 4QOTA 2QV6A 4QJVA 2FVSA 3RR8A 4RUAA 4D3GA 4TN2A 1U45A 4JI4F 2GW8A 1SJQA 2WOMB 4RNFA 3AJ1A 3IS9B 3J81Y 4L72B 3H4BA 1VJWA 4RBTA 1H2TZ 3S6EA 2F9DA 4LFBF 2HZCA 3PKYA 4J5OA 4CH1A 3Q8QB 4LQ3A 2OD6A 3PW5A 1JIHA 2JLFA 1P1TA 2FHJA 2MQNA 2OPQA 4NWBA 4OX9F 3RU0A 2HMIA 1M5PC 2AD9A 3IN5A 1O0PA 3NGDA 1SI9A 3PIPQ 3I87A 3LW5C 4IOBA 4G1IA 1HBOB 1ZPVA 4ECTA 5IWAF 4MJKA 3SZ2A 1C0TA 3MR5A 1G7CB 4FS2A 1VIOA 4HTIA 2O1PA 3DOKB 3OHAA 2BUNA 1R0AA 1WACA 2BABA 3I4PA 5J1EB 1VQ8S 5FJ4A 3CDBA 5IXUA 3SCKE 4QIGA 1JLQB 4ZLPA 2DGVA 3WC0A 4U67Q 5KFRA 4IR1A 2XZWA 2DNMA 1GXLA 1Q53A 1JLEB 2OD4A 4B02A 4I2PA 4J9KA 4AXIA 2FLLA 1RT1A 4TXSA 4XDDA 4P7TA 4FXVA 5J2QB 5C42A 4FP9A 2OMOA 1NHVA 4MK8A 3V5RA 4DL3A 4DR5F 2MSTA 1RTDB 4EGLA 3RRGA 2AYMA 4FZVA 4Q2MA 3F73A 1X4DA 4AUKA 1Q4RA 3H2UB 4NLVA 3QO9A 3MOJB 2HHTA 3EGWB 3F56A 2XSJA 1S76D 1C0UA 3ETOA 1TZ0A 3H40A 1RK8A 2HWHA 4C2MA 3MEGB 4F2RA 3VAJA 4J9QA 5AE2A 3MPYA 3SCJE 3RAXA 3BQ0A 1BC6A 1NK8A 1WEXA 4A8KA 1SH0A 1R31A 2DNRA 3IBWA 4ED0A 3MR6A 1E6YA 3M30B 4IRDA 3C6UB 3MM6A 2W24A 2ROPA 3PNIA 4NLQA 4Q7AA 2DPIA 4H54A 4ITSA 3LP1A 1S72S 1TV6A 1KVIA 5I3QA 4PQUB 2ZKTA 3IXQA 1YJNS 3MEKA 5IM0B 1C1BB 2IM3A 2N3LA 2NSCA 2N7CA 1S0NA 1Y4ZB 4M5DB 3UPFA 3PY8A 1HI1A 2H9ZA 5K8MA 1KOOA 2FUG9 2C3PA 2HQIA 3PW4A 2KYZA 4C9DA 4KQZA 3DRPA 1SB6A 4ZVFA 1YSJA 2FHJD 4USIA 2HFNA 1REVB 1UWBA 3B78A 1WD6A 3G96A 1JLBA 3PRBA 1T05A 3MM9B 4J9LA 3LP0A 3V4IB 1PC5A 4HI2A 2ZOMA 1IXKA 1O51A 2IFXA 4ALZA 2ZZNA 4DSIA 1BLUA 2WSCC 4WXOA 2R8JA 2BW2A 2GQCA 4P2SA 1IKXA 1VQYA 3OSPA 1S1TB 2W4PA 4ED1A 1XC9A 1F0XA 5CZXA 2X3GA 2QLXA 5HP1A 4YR2A 3VALA 3IR6B 3BO3A 2XLKA 1FDAA 1HBNA 4OJGA 1Y00A 3FRYA 4ECSA 5B0DA 1L3SA 2DBBA 3M4XA 1Q1KA 1K1SA 3CIZA 4PRFA 1S99A 2B9XA 5A6WA 4HHJA 2MZJA 4NA1A 5HMZA 2ZJQQ 1U6BA 1VMBA 3IO1A 3J80Y 4YEAA 1Q78A 5HROB 2E5GA 2B56A 2V4JA 3AB2B 2BXJA 5G0RA 2OPSA 1OPIA 2ZOFA 3AY0A 3M6UA 5BYRA 4QW9A 3T5JA 1X4CA 2UUCF 3OUYA 2R2SA 3BQ2A 5H1SV 1SC6A 1YWXA 4DSLA 4A46A 3HI9A 2CQPA 3B8HA 4QIEA 1QY7A 4UQTA 3M2VA 1OS5A 3OTDA 5E3CA 2CPFA 3NCPA 3HKZD 2IVFB 3SI8A 2C22A 1REVA 1QAYA 4C8MA 1MROB 5FD1A 2JOQA 4CO2A 2D1CA 4G1PA 1VQ9S 4RU9A 1MSWD 3IRXA 2Y1JA 1W2IA 3HHLA 4WYLA 3VTIA 3NCQA 4CO4A 2F4VF 5KT2A 4CTAA 1HQEA 4A8FA 1FKAF 1HWJA 3W2WB 3THPA 3T1HF 4KR0B 3ZC4A 5AE1A 1RT4A 5K8OA 1M90T 2CQHA 3QIDA 4Y3CA 2WHOA 2VBZA 1NJYA 3FRZA 3OUYB 2R8KA 4W90B 2PC6A 2DCLA 5GAHI 1U26A 4NMLA 2DTJA 2XNQA 5E7OB 4NLWA 1UVMA 4LSNB 3KLEA 3CDWA 3OXGA 3IAS9 2ZH8A 2VOPA 4HT5A 4Q45A 2AYEA 2E9TA 5B7WA 3BN4A 4OZ5A 1K0TA 2ATLA 2DHXA 4LSLA 4DV5F 3MEGA 4AL6A 4J9PA 4C0HA 3MWBA 3KLGB 4WIIA 1S1UB 2W9BB 4BBYA 3NCRA 4GO7X 2DGUA 4A8XA 2V5HG 1WF0A 1U1LA 3S7RA 5I3UA 2DNYA 4JYAF 2RILA 3HXMA 1MWZA 2HVZA 3MMBB 1TFWA 4DN9A 2ZFHA 4C8OA 1RI7A 3E51A 2C2EA 4O3SA 2DNLA 2RIJA 2B0GA 1IJEB 2CPYA 4Y00A 2J7WA 3CVKA 5B09A 2COLA 4PR6A 4RW4B 5DM7Q