3DHXA

Crystal structure of isolated c2 domain of the methionine uptake transporter
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
b'LDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAPLLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVLGYVLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine import ATP-binding protein metN
publication title The high-affinity E. coli methionine ABC transporter: structure and allosteric regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 23
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09383 NIL NIL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dhxA00
4PWUA 3S1TA 2J0WA 2PC6A 3AB2B 2PA3A 2LVWA 1LK7A 3DHWC 3MWBA 3ENWA 3IXQA 2QSWA 5IT4A 3L7OA 3DC2A 3HHEA 2LQJA 2CDQA 2RQMA 2QMWA 3U7JA 3DDNA 3O1LA 2KO1A 3TUIC 1XTZA 1UJ6A 4M8LA 3K5PA 2ZHOA 3OBIA 1UJ4A 3TUJC 2FGCA 2J0XA 3CEDA 3UW1A 2F1FA 2QMXA 1Y7PA 4LUBA 2H9ZA 5T41A 3OFFA 2F8MA 2RQKA 1YBAA 3MAHA 3IBWA 3NRBA 2I9SA 4IO1A 5JJBA 3ENQA 1YGYA 4X84A 1LKZA 2NYIA 1LK5A 2DT9A 2P9CA 1KS2A 2MDAA 1O8BA 4NMLA 3TUZC 3AAWB 1RWUA 1U8SA 3DHXA 4GO7X 3KWMA 3W7BA 3AB4B 2RE1A 3OFEA 3ENVA 5IS2A 2DTJA 1UJ5A 3P96A 3OFHA 5FIIA 3LUYA 4GMKA 1SC6A 3LOUA 1M0SA 5IT0A 3OFGA 2JOQA 2P9EA 3MTJA 1ZPVA 4GO5X 3N0VA 2JHEA 2QRRA 1PSDA 2P9GA
chains in the Genus database with same CATH superfamily
4O44B 2W7PA 2OPQA 2GZOA 3TOQA 4GKKF 3MWBA 2XZTB 1Y5NB 3QAEA 3DC2A 2F4VJ 4KYZA 2ZZMA 3AOAA 1P9YA 1R0AA 4XPCA 1T9TA 4OQJA 3CO9A 3MM7A 1XC9A 1PC4A 4CCHA 3T3FA 1JLFB 3QPIA 2EC0A 2VKZG 3ZZPA 2UXCF 2HFZA 3CJ4A 1VC5A 3DXBA 3M6VA 2KT2A 1WI6A 1GQEA 1HR0J 1M5KC 1SC4B 4PWWA 1PC5A 4DHVA 1KOHA 3EUNA 4PUOB 3EMTA 2HK3A 3HKWA 1QDUB 4TNOA 1OIAA 2GIQA 2MSSA 5F8LA 1R6VA 2R7VA 1UEUA 4F67A 1LWCA 2XI2A 1H7WA 2W2PP 3T1HJ 2GJ2A 2B5JA 1HNWJ 1NXIA 2HGNA 4FF1A 5CH7B 4PXDA 1K9MT 2EK6A 2WONA 1RBLA 2GO8A 3BSCA 2DEJA 4A48A 1RI7A 2RD5C 4FS2A 2KH9A 3PFEA 2ZBRA 2B6AB 2DH7A 2QE5A 1X4DA 1XTZA 2HNDB 2FY1A 5MLCV 1FRKA 2QEXS 4DFJA 3GZ7A 1HNVA 2V67A 1KLNA 2NUUG 2J6SA 3R1LA 3K8VA 3PHTA 2W7OA 4DMZA 3N28A 4FKXA 2DD8S 3CMQA 3DLGB 3OFFA 3RYLA 2OSRA 2IJFA 1LNQA 3VZHA 1CBKA 5CYQA 1FJCA 3GE9A 3RBZA 1VJWA 5T7LA 4LF5F 1HFEL 1RT5A 1SH0A 2AV5A 5IQQA 2VBZA 1RUSA 3MMBB 4U67Q 1UVLA 5AE2A 1S6PA 5A0YB 1QLNA 2ZH3A 2BQRA 1HI0P 3R7BB 2ZBIA 5BJRA 4C8YA 3QAUA 3W8PA 4RUBA 4Z7YA 3K7RA 1ZM9A 1WC6A 4WPAA 4GO5X 4CM2A 1WC1A 4NXMJ 4DL7A 3KJVB 1M1HA 2Z57B 1U1LA 5KTQA 4QU6A 2MZTA 2L08A 5KG0A 4JI8J 3ET6B 3P5BP 2HRUA 1OPIA 4TY9A 3SCJE 1S79A 2KXHA 3M6UA 1Q8BA 3CCTA 4ZPVR 2V2KA 1WC0A 1VI7A 1T95A 1HHTP 2A6MA 3M9OB 2W2OP 3B78A 2PI4A 4ELTA 4IDKA 3IWXA 1LWEA 3VHQA 3BREA 3TUPA 1JLEA 1T05A 1HNZJ 2YX7A 1NU4A 2VFTA 3QJJA 3CF5Q 3SQOP 1TKZA 1B7YB 2QL9B 4O3OA 2VPWB 1BQNB 4CTAB 2WSFC 4LREA 1JLAA 4MYUA 2MKJA 1KHVA 1WD6A 4OZ2A 1KQGB 2R8IA 4WP9A 1VIOA 4PWDB 2CG8A 1YBUA 4F2RA 4FBTA 3RB4A 3Q89A 4PG8A 1LK7A 1JLQB 2ZHAA 1PAEX 5KFLA 1RTDB 4EUVA 4M5JA 1N4LA 2XI3A 1P9QC 3JTOA 2HNZA 2KFNA 4PG4A 2HFVA 4WZMA 2UUBJ 4LFAF 2HBQB 3DRRA 2DNYA 4HI1A 3B8HA 3FQKA 1UL3A 1MU2A 5D77A 1EETA 4PQUA 3ENQA 1YGYA 1NB7A 3I87A 3DLEA 2V34A 2MJNA 4X65F 4UY85 3C46A 1UWBA 3HHDA 3AA8A 3UDCA 3N6MA 1NKEA 2B7BB 2H5IB 1R8BA 5DJBA 1VQ4S 2V9WA 3FFIB 1T9WA 3I82A 4WIQA 3H2VE 1YJRA 2W4CA 3BGRB 4NLXA 4XAKA 4I64A 4YMEA 3BM7A 1RLCL 4KHRA 4NOHA 5IM0B 1KWMA 4NLYA 1HWUA 1X0PA 2AYGA 2QFJA 5KAKA 3M30A 2KHCA 3GPAA 1FO1A 1Q78A 3DHWC 1AYEA 1VQMS 2G1DA 2DITA 1M1KT 4J9UE 1K73T 3BH7B 2ZHOA 3FZBA 2CJKA 4F2SA 3D66A 2XYPB 3P6YC 4AE5A 1XNRF 4FXWA 4OLPA 3LAMA 5E0OA 2VOPA 5DZ6A 1X4FA 2J7UA 2YNGA 5KOXA 1SIZA 2W9AA 1FRHA 5J2MB 4QU7A 3IBFB 3BS9A 1DLOA 1N5YA 5I4MA 4IQXA 2B0GA 5C25B 4AT1B 3I5AA 2RS2A 4Q44A 4EYIB 2PFFB 1SVDA 2GVDB 1VS3A 4B3TF 3MTJA 3NS7B 2GIFA 4XDCA 2EFOA 3CJSA 1UPPA 3C14B 4M63A 2IHR1 3UCZP 1TKXA 3G71S 4RW9B 4C11B 4ES2A 2A18A 4ED8A 5KT7A 2PGCA 2CQ1A 3PJXA 3HHEA 2L9WA 1S1WA 2DCUB 6FD1A 3SQGA 1HHSA 2G4BA 4AFFA 1G3OA 4RNHA 4WFZA 2FGCA 3PJWA 5HMZA 4NCGA 1T03B 2QLJB 3AHPA 3FK4A 2E9RX 3BGOP 1QJHA 1B3TA 2ZD1B 3HVTB 3ITHA 4MK9A 4NRUA 4EYHB 3MOJB 5E5NA 2DGSA 1X9SA 1GEHA 5KFEA 3CPWR 4W4MA 4ED7A 2BDPA 5KFBA 4E8UA 3SYZA 1KDNA 1W25A 4DSKA 2XSJA 2LLZA 4IFYA 1S1XA 2L3MA 1Y5LB 4O44A 2NR0A 5D0GA 4ZP7A 3K58A 1IR0A 3JSRA 3FBFA 2PN6A 1I94F 4DWIA 3O5TB 1VK8A 2ERRA 1SJFA 1Y5IB 3WC2A 3BDPA 1RWOB 2FLOA 1X4BA 4IH5A 1AUSL 3KHLA 1U1PA 3A8IA 3N4WA 3BGLA 1YKWA 4AYBD 2RVJA 3CJ5A 1ZBTA 2ZZNA 1JLFA 3IC1A 3V6KA 2PIIA 2NUHA 1QY7A 3SI8A 2EPIA 1H38A 3CIZA 2CA9A 1IQZA 3EGVA 1CPZA 1EKRA 5C7PA 3GG1A 4HACB 4UOGA 4HLBA 4PG7A 2X7IA 3UI3A 4QYZK 2OSQA 4PUOA 4ZN3A 4DI6A 1W26A 4WIIA 3PYFA 3FRYA 2V9KA 3IGNA 4DSFA 1WHWA 1WEXA 4J7CA 2B8PA 3QJLA 2QTWA 1RQ0A 3M32B 2RRAA 2GGPB 1M0SA 2DRDA 4FS1A 2HNYB 5BYQA 3HFKA 2EW9A 5EN1A 3JYTB 3POTB 5FJ4A 3OTOF 4F0MA 3BQ2A 2PA3A 2B6AA 2EFGA 2M8HA 3ILLA 4ILRA 4DR7F 4IOBA 1RSCA 5HQMA 5EWEA 2FYXA 1NPPA 2LFVA 1JNZB 3ILOA 5KFKA 3J81j 4IQMA 3R5BA 3DLGA 4LF6J 3UN3A 3HK2A 4WU2A 2VIHA 3G82B 3R6GB 4KGMA 1MN7A 3TNVA 1IBMJ 1UZHA 2I9SA 2FHKA 2D3UA 3J80U 3N01A 3MMBA 2NYIA 4X2BA 4WBFA 5GADI 3D9BA 2O1PA 4ZHRB 3D2WA 1DURA 3PW7A 1FJEB 3QWPA 4OYZA 2GQQA 4OZNA 2RS8A 2ALYB 1APSA 4U7CA 2OMOA 4ENOA 4V1Ak 3K5NA 4OI2A 3CVKA 2BKPA 3LPEA 3OUYB 4LMZA 4X4RA 5M2PA 4M5GA 5K8MA 3KJVA 2BBEA 2KYXA 2E5LJ 2ZITA 3NGKA 4QWCA 2OH2A 2AYBA 5KFYA 3ET6A 4P74A 2KRRA 2F3JA 2E1CA 3L7OA 1CULB 1GTEA 4TVAB 4C98A 5FDLB 1Q5VA 1VDHA 1U6BA 4EFAC 3TVZA 3NGDA 3BO3A 2KFYA 4OIXA 1UJ6A 3JQJA 4P72A 4ED0A 3VAGA 3SEOA 2F7VA 1T9UA 2GA7A 3OPKA 2O66A 1AXQA 4AD6A 3PZPA 3VAFA 1S1TB 2YQ1A 1LFWA 1SKWA 3F44A 3M9MB 3U1LA 2QO3A 4OZJA 4WTOB 1RHUB 1BQNA 5AXNA 4CTAA 5F8GA 3OR2B 4ZCMA 3PW5A 4KJIA 2C2EA 5KFSA 3HKZD 2K3KA 3HXMA 4PWDA 4ANDA 4YS2A 1RAHB 4DG1B 4B02A 4Y2CA 2HMIB 5AT1B 3NOGA 4TY8A 2P9GA 3W2WB 4M5NA 2J0WA 3FSXA 2VODA 3S8SA 4MKVA 2DEIA 3BJYA 3E01B 2GW8A 1R31A 2GCFA 2QN6B 1RAFB 4WCEQ 5AXLA 3RRGA 3MMAB 1PGZA 3KLFB 3CUNA 2HQIA 3RUBL 8AT1B 2JSXA 2LMIA 4Q8EA 1FA0A 2QZ8A 3QIPB 2ZNZA 4C3LA 3LH2S 4ZVQB 4NCBA 4QZVB 3AJDA 1HBNB 2BVZA 3CMAS 1C0UB 2CYYA 4G3IA 4U9RA 3MR6A 3NNAA 5T41A 4DF4A 3F73A 4Y3CA 5I42B 3HHLA 3TJAA 2BR0A 1H2VZ 4YR0A 1X60A 3F41A 2QT7A 3DMJB 4NYOA 4OZ1A 1FEEA 2R3VA 3BGRA 2BKNA 4OFZA 4K2JA 1KN6A 3CD0A 3HZEA 3IFEA 2C3PA 1VRTB 4NLPA 4GKKJ 4YQWA 5IM0A 1VJQA 4N8OA 1JMTA 3VAKA 1XR6A 3VQTA 1UVNA 2YX4A 2GHWA 5IWAF 4ZJQA 1OSDA 5DM7Q 4X62J 3PW0A 1B4SA 1F2GA 3D67A 1T3NA 1L3UA 1P1LA 3FBEA 4CRJA 4O3SA 2LKZA 1K1SA 1H74A 1IM4A 4KFBB 2HIQA 3O1LA 4G1QB 5B0CA 5I3PA 3VTIA 3FRZA 4A8WA 3SV3A 2M0GB 3V4IB 2BJ1A 4CLKA 1QUPA 4M5DB 1F3VA 4ID8A 1HQ2A 1IBKJ 4JI2F 4ZVEA 2RKIB 3CJKA 3RGIA 1DFDA 5M2RA 1ZA2B 4DV1F 1SKSA 4NLOA 4JI6F 3M8YA 2L9NA 5LOQA 5C25A 3FQLA 1U1OA 4M5HA 4YUDA 4NPOA 4DX6A 2XWXA 3W5YA 4ZLLA 3PIOQ 3A1YG 2YWEA 4K4VA 1RAOA 3UCUP 4Q5VA 1RWPB 5A76A 3C14A 1U25A 2QA4G 2EXUA 1N36F 3DRPB 4RW9A 4PRFA 2EBGA 4OI3A 3W63A 5G0RB 2A10A 2HFOA 2VQFJ 3CJ2A 2NYHA 2DISA 3LTOA 2FJWA 3F0NA 2J9DE 3TEHB 4U6PA 3J7A1 1LXNA 1T03A 3DOKA 2K3IA 2DGTA 5E3QA 3OBIA 2Y8WA 3BYPA 2HQ3A 2MQPA 4L73A 2E1PA 5HVHA 3HMJG 2BA9A 2ZD1A 3BZQA 3HVTA 5A8KB 1NDLA 1C1BA 5JXSA 2R42A 3LAKA 4FKYA 1TMMA 5D4OA 2BQUA 2YH0A 4R8UA 4X64J 1RE1B 2YNHB 1RBAA 1RWUA 1UFKA 2R7SA 5KFJA 2C2ZB 3PW2A 5GAEU 3MEKA 4UQGA 1V3ZA 4YY3F 3SCLE 2CQ3A 2P5VA 1VC6A 2RT3A 4O3NA 4DSJA 4DFPA 1RB0A 4DV7F 2LEPA 2W01A 1SH2A 3CJ8A 2HRYA 4I4BA 3WDOA 1VBXA 1FXLA 2HVIA 4OI0A 4JI1F 1FWLA 4RW7B 4PQAA 2CUYA 2UUCF 2VBYA 1HI8A 2XMAA 3PRVA 1BXNA 1E6VB 1OY8A 3LWMA 2F40A 5A8RB 4QYRA 3TX8A 2H54B 3DM2B 4URGA 2CFXA 2BANB 4A8QA 3BN7A 3H5XA 4G65A 1U45A 2D1CA 4X84A 4AXJA 2BZ2A 4AXIA 4IO9Q 3C8YA 1FNMA 1T9VA 3HM9A 3M32A 2HHQA 3T19A 2IAJB 2GGPA 4C8NA 1MWZA 4TU7A 2HNYA 4FNHA 1AB8A 4OV1A 2CPZA 1S9EB 4EI2A 3JYTA 3POTA 1TUGB 4QPXA 3D4JA 1V6HA 2G2YA 1DJ0A 2VOOA 3BPSP 5HLFB 1NSPA 1PSDA 2D9OA 1I1GA 2DNZA 3GONA 1YSJA 4M5MA 4P10A 1M90T 1YRUA 1RABB 4Y34A 4M1KA 3M6XA 2EKNA 1HQUB 2FIUA 1NCLA 4ALZA 2KJVA 1BHNA 4KY3A 4JOUA 1WG5A 5LMUF 1MG7A 1HLWA 3VVTA 5HJYA 1YJWS 2DNRA 4QR1A 2CVEA 2F8HA 2NS1B 1P6TA 4NLDA 6AT1B 2OP5A 1GXLA 3BSAA 3QT7A 4H4MA 2IYIA 2V94A 3QGIA 2OIHA 3EE3A 1TKTB 3EPIA 1F2HA 2RJZA 1T11A 3CXCR 5AE3A 2W25A 2R7WA 4JUZA 1QSSA 2J7WA 3NAIA 3OUYA 2U1AA 4DX7A 3PX0A 1TAUA 1IUJA 2ZUAA 2XQCA 3K2YA 4K0KF 3R5DA 3W2VB 4DU7A 4NLTA 2JHEA 1FCAA 4FN5A 3N6NA 2CQPA 2WB1D 4IOCQ 1CULA 1Y0HA 2HIYA 3DXSX 2ZH2A 3C66A 5EWGA 1G2EA 5E3PA 4ZVTB 1TU0B 3CCJS 1HMVB 4Y2KA 1XNRJ 1X4AA 1EB0A 4U96A 4RKUC 4LF4F 3RZAA 2Q3PA 4B9LA 3UD3P 3CB4A 5CHCB 2M8DB 1S1TA 1ZYQA 4KHPF 3WQPA 2R2UA 3A12A 4IH7A 1NB2A 4LBHA 4CO0A 2HBZB 2RDIA 1HBOB 5A2QY 1HBUB 1KRPA 5ETPA 2DNKA 3I9V9 5LSRA 2J9EA 1BGXT 5SZTA 2WVFA 4B3TJ 2HHXA 4FYVB 1BQXA 4DR5F 1UAWA 3DDIA 5GAGU 1Q95G 3O3LA 4HL9A 4USHA 4ZK7M 4DG1A 4OI1A 3A4TA 3CTRA 1RU2A 1YJUA 3W2WA 2H4WB 3HT0A 3M2UB 1NDCA 4KIAA 2ZFHA 2Y1RI 5L39A 3E01A 4FDFA 1DAXA 3HFVA 1QSLA 2CQ0A 1NJIT 3CC4S 3KK3B 3MMAA 1S48A 4DR6F 4P9SA 4DL6A 3KLFA 5KFIA 1YQHA 1M5SA 1TQLA 2KM8C 3JXOA 2XY7A 3QIPA 4M5KA 4S0MA 2CPYA 4H4KA 1HBNA 1C0UA 4CLUA 1KP6A 2B3TB 3M2VB 3PEHA 4XIUA 1S0NA 5LXRA 3FCVA 3B4DA 5I42A 1VOMA 4I7FB 4UOCA 2KU7A 3NG8A 2AMCB 1N32F 4TQRA 4RW4B 5KFXA 2D41A 2DRAA 3DMJA 2XEXA 2HRTA 3CCUS 3TZXA 1BMQB 2PEBA 2W9CB 3BKTA 1NHKL 1NH7A 2H5EA 2FHJD 4N41A 1VRTA 4DSIA 2HAIA 5ADZA 3Q22A 1FFGB 4I56A 2DGOA 3D3CJ 1I94J 4ZA1A 1R7IA 1DRZA 5D78A 1WJ9A 3RB0A 2QL7B 5F8NA 2HWIA 4DV6J 2Z8QA 3T1YF 4FXVA 4EEYA 2RMLA 4DR3F 3X3UA 1VFJA 5HP1B 2RILA 1MROB 1PYTA 3JS9A 4KFBA 1DTQB 4G1QA 4ANCA 4ZMMA 4B9TA 3ZTPA 2QSWA 2VASA 4NEYA 2BJ7A 2C2MB 3V4IA 2R7OA 2KO1A 1JXVA 2BJ9A 5KFPA 4RUAA 4QW8A 4FP9A 2V63A 2XS5A 2RKIA 1XN9A 4C8KA 1AW0A 2F1FA 3S6EA 4HDHA 5HJXA 1IKXB 5CQGA 1RHMB 2XMVA 2RQKA 4HR2A 4Z7CA 1T3OA 2Z58B 3L3CA 3P4UB 1V3RA 2KN4A 2DNHA 3T5JA 2R7UA 1JK9B 2HQFA 2HKEA 3BB5A 2MXYA 1DTTB 3OTDA 3KK2B 2V50A 1W2IA 3GIJA 1DHMA 1ZM2A 4F0KA 3OTOJ 2DR6A 4WFAQ 3MFHA 2UVRA 1REGX 3ELHA 1RAGB 3DRXA 3DRPA 3PEJA 2EFPA 4GMKA 4DV2J 2PSZA 1WKKA 2CQHA 3E2EA 5G0RA 1VMBA 3IR6B 2ZOFA 2FJXA 2VD3A 4NMXA 2R8JA 1D3WA 2XMTA 2CQGA 2W8KA 4DSLA 3GJRB 2LVWA 1NJXA 5KFRA 4RL1A 2AW0A 3MF5A 3TRGA 4C8MA 4L74A 3H98A 4B9MA 2F4VF 3Q8QB 2VL1A 3NNCA 2NPFA 5DGBA 3R5CA 5L9XA 1VHFA 2M9KA 3DGPB 1XBWA 5A8KA 4LFCF 1QE1B 1KVIA 2Y0BB 4HH0A 1VLOA 1Y9OA 1NUEA 4B9SA 3BR8A 2YNHA 1RKJA 2AYMA 2XNQA 3DLLQ 1JJHA 2DNLA 3M6WA 2VPXB 1RT2B 2ACYA 4DQSA 2EWHA 3MDFA 2VUGA 4ECXA 4YDDB 1XNQF 2YKNB 2BE7D 1OSCA 3B54A 2EFVA 3IMQJ 5B08A 4L76A 2FJAB 4QBUA 4DPYA 2FZGB 4DZ6A 3HSGA 2RDJA 1HNWF 3TR5A 1SUQB 4IG3B 4RW7A 4RW6B 4CT9A 2HPUA 4B3OB 3HJFA 3UR0A 5KG1A 1U1QA 1GT8A 1JLBB 1E6VA 4TYAA 5A8RA 3IG1B 4USVA 1HPZB 3DM2A 1RWNB 1RAEB 3G9CA 2H4YB 2UV8A 4KSEB 4DLEA 3G6YA 4OHZA 1M5VC 3IM8A 2HFNA 5ETOA 2XTJP 1RKIA 5A6WA 1U7LA 1TK8A 2J8AA 4DCJB 3QBCA 3DI6B 3MR2A 3AXMA 1CLFA 1B7FA 2BKOA 2PMZD 1YLXA 3SV4A 3DLHA 3C16B 3IM9A 5KG4A 3RBDA 2R8KA 2HQCA 1K1QA 2YWHA 1S9EA 1SJQA 4TKTA 3LPYA 1FT8A 5KT5A 3NGRA 4WE1B 5HLFA 5K5MA 3UD5A 2NQPA 1TUWA 2ZUGA 4OZ5A 3DRSB 1PYOB 3TJ9A 4NLSA 4Y28C 1F1BB 1HQUA 4TYBA 4F3OA 3ZNUA 5F8JA 2CQIA 3VGVA 2C42A 1JQGA 1X5OA 4CH1A 4NXMF 3GFZA 4NZ7A 2LEAA 5U47A 3QRRA 3OHAA 1KTVA 2XHWA 4DPWA 3KG0A 1U6FA 4JI8F 3PFOA 4ZITA 2Z2YB 3ZZUA 2IRYA 2CZ9A 4CLFA 5CYJA 2AX0A 1RISA 4TU8A 1NSKL 4RNFA 3I55S 2W1BA 1Y10A 5F9NA 4PAAA 3AXKA 1TKTA 5J2QB 3MURP 3MUVP 3MR5A 4TN2A 2YTCA 1OY6A 3TVYA 5KFTA 4CO3A 2ALZA 3SIPB 4DUYJ 4OYPA 2G9OA 1TL5A 5A6PA 5KFUA 5IWAJ 1WHXA 1HYSB 1X4GA 3W2VA 3ULHA 1GMUA 2K06A 3U1NA 3CO0P 1S59A 4XO0A 2VC0A 1XEZA 2JOQA 4ETXA 2HS3A 2M70A 1LW0A 4YR2A 4NL5A 1HMVA 4CLWA 2C2NA 3D28A 2FZKB 4ZKAA 2VBWA 4ZOSA 3E3XA 2IRUA 2Z2MA 4ZVRB 5DRKA 1RHKB 4HYKA 5B0GA 4JI2J 3NNHA 4MIAA 4CNZA 3HO1A 2BJ3A 5CD4A 3ZZOA 3G4SS 4DQRA 2KXNB 2ZE2B 3HT3A 1RGVA 1HBOA 3LWLA 1HBUA 4DV1J 4U95A 1RT7B 1IBLF 3GSIA 3D6FB 1CJUA 3IBWA 1RA6A 4WTYA 1RHQB 3KMSA 2LQBA 2CNOB 5DG7A 2DT9A 3GWCA 4DV0F 1D0EA 1HHQA 3CCSS 3N79A 1X5PA 4HEA9 1TZ0A 5LSOA 2F9JA 2VQEF 3M2UA 2HVDA 3FUYA 3R5GA 2DH8A 3EZ5A 4RU2A 4JYAF 1RTIA 2CZ4A 3KK3A 4LR9A 2XLKA 2CPXA 2GJIA 2JX2A 5H9EK 3OL9A 2G2OA 1R0CB 2OPPB 3CIMA 4CLPA 1NRKA 3D6TB 4PKDB 1UMJA 1CJVA 2K7KA 3H5UA 3PO5A 3MFIA 2DRBA 2JL9A 4I7FA 4R25A 4F8RA 2VJUA 5DQGA 4RW4A 2WVBA 4MTPA 1FDDA 3MEEB 1BC6A 1Q16B 1Y7PA 4DUZF 2IM3A 1N48A 4IG0B 1IKYB 1HARA 4GC7A 4ED1A 3TX0A 3GP9A 4UUXA 3JSMB 5K8PA 4YY3J 3O8WA 1UVJA 2MLYA 2NLWA 3H0PA 1YWXA 2BM0A 2MMYA 4UZCA 1CEZA 2Y3YA 4KV8B 3R2CJ 2IYGA 2HSEB 4JI1J 1RCOB 1JWWA 5HMWA 5HP1A 4ICLA 1MROA 1WOOA 3OLBA 4WWSA 1DTQA 1MLAA 3TO8A 3IR7B 2HHTA 2YWKA 2DHAA 4ZS6A 1FHTA 1YJ9S 1P1TA 2G1HA 2OPRB 3GTYX 1HL6A 4ECRA 1GFWB 2WK4A 1UW9A 2CRLA 2VG5A 1X8DA 2Q79A 1UZDA 1IKXA 3M1VB 3DNCA 4OX9F 4Y65A 5E3CA 2KFZA 5DDQC 7FDRA 2XGPA 4WU3A 4UTGA 1WC4A 4ER8A 4FVCA 2KTQA 1DTTA 5C42B 5ETQA 2GQCA 3V4MA 2WTFA 3HVRA 2MB0B 4PZVA 1VQYA 1ZPWX 1ZOTA 4LRFA 3GV8B 2POKA 4D3GA 1AZSB 3GU0A 2DTJA 4ES1A 2E1MC 4DU8A 3HJVA 4LVOP 1NBEB 2H1YA 2ADCA 2YKMB 1B64A 3U02A 3EZUA 2V4JB 5LMUJ 1YITS 2XCAA 2DR5A 1HBMB 1F9FA 3BSNA 1HWLA 4QWAA 5F8HA 4ZVOB 3W66A 3EICA 1L3SA 2R2SA 3QYYA 2HQDA 2KXFA 2QSFA 3DGPA 2A6OA 1QE1A 4GC6A 2IRXA 1WOPA 4KT0C 1E6YB 3K8WA 4C7QA 1DQ9A 2VB6A 4I6AA 2CJ9A 1TV6B 1RT2A 4I6WA 4DPUA 2NXEA 4QWDA 4OJHA 3V6JA 3NCQA 1VRQC 4ZVHA 3R6LB 1RAJA 2YKNA 3IO1A 2D7SA 3FKBA 4BCAA 3AD9C 1ACMB 3VF0B 3ZTSA 4XK8C 2B4UA 1WC5A 3KLGB 1GMVA 1SUQA 5B0BA 1JLCA 4RW6A 4C0BA 4CLYA 5EWFA 1GXUA 2HFUA 4B3OA 1YBTA 2V2VA 3NCRA 2M2BA 1F5CA 4LF9J 2BUNA 1REVB 2V8PA 4KHPJ 1K0TA 3IG1A 1X9WA 5JVGQ 3THPA 2WBMA 3MAQA 1HPZA 3RB3A 1RWWB 3TUIC 3NBPB 4A4JA 2QV6A 2CWKA 1EX8A 1WC3A 5CABA 1GXTA 2JC0A 2F9DA 2AQ4A 2RQCA 4LF6F 4W98A 3DI6A 3T1AA 1TVRB 3BO2A 1RZMA 2DGXA 2CNLB 5L38A 5J2NA 1IBMF 1RK8A 2P2CB 4CP5A 4F0HA 3HDSA 1S6OA 3UDEA 1N33F 1HI1A 3TYTA 2I5JB 5KG7A 4NXNJ 4KO0A 4WE1A 3NY0A 3GCXP 3ZTRA 3IWLA 5C5JA 1N52B 1D9AA 3DRSA 4USIA 3PR5B 2OEJA 3D6HB 4DQQA 2MQOA 2MKIA 1TAQA 4Y2IA 1SC6A 5IT0A 4F7VA 4LSNB 1D09B 2E5LF 2CNNB 4O23A 5CCLA 5L9NA 2XNRA 2E1RA 2C3MA 1FF2A 1N32J 4AUKA 5HROB 2MPUA 5ETVA 3N6LA 5IC6B 4WK1A 1U0HA 4JI5J 2YKPA 4BHQA 2JEJA 1TTHB 3R8YA 2C3YA 2C2DA 2YXLA 4O3PA 3VR1A 4NA3A 4P2FA 3KKFA 1W2BR 3K5PA 2ZH4A 2M7SA 2BE2B 5J2QA 2MJUA 3SMZA 4WXWA 5KG5A 1UEKA 1U0SA 3EJMA 4RLEA 4U8VA 2K8GA 5E7OB 3D7SB 2QX0A 3DOMB 1HYSA 3FDSA 4K8RA 4N76A 2B8QA 1KVJA 2J5AA 2UP1A 2HS0A 1UKUA 4N77A 4V19X 3RB6A 3AB4B 5GAEI 2R7TA 2FGOA 5BR8J 2KM8B 2XMMA 3EDQB 4A47A 4PCQA 4F4ZA 3WX8A 3GIIA 2C2OB 2Y0SD 5K20B 3M9NB 1R8AA 3J7YU 3R7SB 2KZZA 1N54B 1T94A 1VQKS 2XMJA 3MECA 4ZVFA 1VK3A 4NI2B 2ZE2A 2MQNA 4M5LA 2UZAA 1RT7A 2XG8A 4BC9A 2HZVA 3TW0A 4CLLA 3L7PA 4IUFA 2JH3A 5KFDA 4FYDA 5E3AA 3FZ2A 4AL6A 3KFWX 5D0EA 4JV5F 3TA1A 1S6UA 2LDYA 2I38A 3PACA 2BACA 1XMOF 1ZZNA 1J5OB 1CQMA 2HVHA 4O3RA 1BLUA 1K47A 2I8EA 1CJKA 1JNRB 2I1RA 3P96A 1OYDA 3PYEA 2XZWA 1XMBA 2RSQA 2CPFA 2OPPA 1JKHA 1WOSA 2K1RB 3RG6A 1IQTA 3KMQA 4Y0FA 3UDVA 3BEGB 3MCSA 4Q2MA 3QWUA 4DS4A 2W2NP 4LFCJ 3KLIB 4X62F 3I6PA 2WW8A 3ENWA 2ROPA 3CJ3A 4J9SA 1NSQA 1RT3B 4B3SJ 3PRDA 3MEEA 4J5OA 5KFMA 1UA0A 2D9PA 2CNKB 5L1KA 4HVZA 4I68A 4IG0A 4WFBQ 1IKYA 3OXGA 1UJ4A 2ZM6F 3MTKA 1FE0A 3NS5A 5IFMA 2QYCA 1TL3A 4MKBA 2CAJA 1LFPA 5F8IA 3MEGB 3JSMA 4IFVA 3NCPA 3C6UB 4ZDNA 2QIFA 1KLMA 3I4PA 5D4NA 1XNQJ 1IBKF 4R5PB 2MYFA 4CLSA 3TA0A 2ZH8A 4KV8A 3M8PB 4OL8A 1S4EA 5K8OA 2VG7B 4C8LA 2GV1A 2LA6A 3MM9B 1URRA 3HPOA 2RIJA 2RHQB 4QJVA 4ZPBA 4EBCA 2DYAA 2MHEA 1J2VA 3V6DB 2A0FB 5E2QA 3CWJA 3C6TB 3PIPQ 3CDWA 4WFXA 2OPRA 2OHDA 3Q8YA 1KKHA 9RUBA 3M4XA 4NLQA 1YZ6A 3AD8C 3LALA 1FXRA 2VQFF 2AT1B 3M1VA 3UDLA 3DDNA 4IYQA 3CDEA 5J2PB 2VFSA 3M05A 1H7XA 1WEYA 3OV7A 5C42A 4ITSA 5D0RA 1FJ7A 2RRNA 1FRJA 5KT2A 2MKKA 4G1IA 4ZP9A 2XGQA 1AZSA 2D3OR 3RAQA 4CT8A 4X64F 2MZ1A 4YFUA 5GAGI 4NRTA 4DF8A 2YKMA 3EXYA 4LQ9A 5DO2A 1NJZA 3HSZA 1RBOB 2V4JA 1TL4A 2SXLA 1FX4A 1XJWB 1HBMA 4OYWA 2UVVA 5HQ8A 3LOUA 2IC3A 1Q7LB 1FX2A 5D8HB 4Q2LA 1L5UA 2MY8A 3S01A 2YKAA 3Q0AA 5CXTA 5AJ3F 3AA9A 1D8ZA 4P71A 5DQHA 1N56A 2MZSA 3Q83A 2CPIA 2OEMA 2ZDOA 2DBBA 5HATA 3GJQB 5FLXY 1E6YA 2DIVA 1YK9A 1D9FA 4LFBF 1VRUB 1TV6A 2OEKA 1WSVA 1U48A 4F02A 3R27A 2E5GA 4ED3A 3UD4P 3LA0A 2XY5A 2G2ZA 2U2FA 2MHNA 5KFFA 3KUGA 4N7TA 2DNGA 5ETSA 5KOWA 4X4UA 4E98A 5B7WA 4GO7X 4O4GB 4PG5A 3KLGA 1RWXB 2CPHA 1SL0A 3OFEA 4YDXA 2AEMA 4EWTA 1IJFB 2KT3A 4I2PB 2DK2A 2HLUA 1HKAA 2N4CA 3KYLA 3VGSA 1S1VB 3D5MA 2ZBQA 2CDRB 1S49A 1O0PA 2DGWA 1JXLA 2AU0A 3OL6A 1FXDA 3MCNA 1AROP 1R6YA 4DLGA 2V2QA 4KPCA 3TA2A 2KI2A 4J9QA 1IBLJ 4ILMA 4IRDA 2LYVA 2PMWA 2IM1A 1IWAA 1PG5B 1U2FA 2J7KA 1J5EJ 3IA0A 4G6VB 4W90B 3PRBA 3HHLC 2LQ5A 1MNEA 2CXEA 1TVRA 1IKWB 3UW1A 2ZH5A 4DV0J 4P7TA 3PYDA 1IR1A 2Q6CA 1A0OB 2FVQA 2VQEJ 1FDNA 1PCAA 2VFUA 3W9HA 2NZ4A 4JYAJ 4WZQA 2IFXA 1FDBA 5B09A 3UFCX 3UNGC 1GNKA 2YPZA 5KT3A 2LP4A 4A8XA 5EGYA 3MPWA 4LSNA 3BBBA 2NPIA 1FFWB 3UN2A 5CYMB 4QYZJ 2VICA 5B0FA 5GADU 2IVMA 1Q8LA 1FK9B 2WBRA 4CO4A 2MGZB 2OJ3A 5HROA 3VAMA 3OJSA 4E0DA 3H2UB 2LQ8A 4HHHA 2PO4A 3OSNA 2E29A 4DUZJ 1H73A 2IVYA 4UUWA 5F3TA 1ZETA 4L6V3 1Q8IA 4XTTA 2BE2A 1DBDA 2QMWA 3Q24A 1WI8A 3THTA 4QR0A 3KLEA 2OKQA 1NAQA 4B3MJ 2KB2A 3X1LB 3HSDA 2WZ1A 1UEVA 1DARA 2Q6BA 3BGUA 3NGSA 1F3FA 5CAAA 1K8AT 1IVZA 3AQPA 3DGVA 4OYOA 2OPQB 2M5YA 3VAHA 1KONA 4ELVA 3KUEA 2XHCA 1JXEA 1Q0NA 1BQMB 2R7RA 1SL2A 1RAIB 4MIBA 1RT4B 4DJBA 1VQ7S 1Q8KA 2PMHA 2NSBA 4IR9A 2RF2A 1UJ5A 2AJ0A 1F5BA 2RH3A 5ITHA 2RU9A 2E9ZA 2E1AA 2OD6A 1VQ5S 4QW9A 3CC7S 1Y00A 2B9XA 1N6QB 5F41A 4DL3A 3CJ0A 3LP0B 4WKYA 4A8FA 3U27A 1FRMA 3TP2A 4NI2A 2JEGA 4UW2A 2LECA 1WDTA 4OX9J 1PILA 2VPYB 1U2RA 1OQ6A 1RJJA 3KJNB 1V5IB 8RUCA 4WF9Q 4F25A 2HVEA 1U2CA 2EFQA 4JV2A 4GKJJ 2ZVIA 4LT6A 4FPRA 3CCQS 3Q8VA 4ZP8A 2QFIA 3DDKA 3SSSA 3ILJA 1IWGA 3OT9A 2HLTA 1JJCB 4Q43A 2CQ2A 2B5JB 4DX5A 4OLOA 2MQLA 2WAQD 4MFBB 2IMWP 3NXZA 3OHBA 1OPZA 1TK5A 1J5OA 2V8GA 4Q0BA 1YG0A 3W64A 3BSOA 2WSEC 4DPTA 2DO4A 4GVBB 1SXLA 2QLWA 4TLQA 1WTBA 2JLEA 4NLGA 1IKVB 2YY3A 2HZCA 2Z0GA 3QGHA 2LDIA 3QT8A 2K1RA 3HCXA 4HDGA 1UP1A 3GJTB 1PKUA 2ACMA 3MAAB 1S1UB 3KLIA 1OJ4A 1CVJA 1QUVA 5CYQB 4DV6F 4KGZB 2AZ1A 2HHHF 3F56A 2KL8A 4B3RJ 4KGXB 2PC6A 1FRXA 3MPDA 3V2UC 3O6QA 1RT3A 2MKHA 3GILA 1MMLA 4BWJA 1SQGA 2QGFB 3JAMY 2AEFA 4K4UA 4NE9C 4JI4J 3P45B 3FBBA 1ITPA 2GFFA 3W62A 2P6TA 3MEGA 2YQ0A 1X4EA 4I0WA 3C6UA 4MT1A 4X4VA 3FBCA 1OMSA 4R5PA 1CC8A 1NZAA 2OPSB 1KBRA 1B0PA 3EM1A 3BKFA 3M8PA 3NWGA 1ZA1B 1PAUB 2VG6B 3EVMA 4MH8A 1A7GE 4OYBA 2CQBA 2RHSB 2YNIB 2UXBF 4G1PA 3W65A 1RHRB 4NYPA 4RUHA 1FWKA 2MEWA 3H4DA 2OUGA 1FVSA 3V6DA 3C6TA 4ETZA 2HNDA 3UVJB 4IDKB 1WF1A 4DV2F 1LWEB 3MR3A 1FESA 2R2RA 1MW7A 4JI7F 5F0WA 1WWHA 1YZ7A 1VCTA 3G6XA 4C8ZA 4WKRA 2Q1LA 3TI0A 3FMBA 4DN9A 3H90A 2OTLS 2JWNA 2DHHA 4J9PA 2Y8YA 4FF3A 4O4RA 1VYAA 3TAQA 1TR0A 5A0YA 3B6BA 2FDNA 1N33J 5L1IA 4A46A 3G86A 4CNYA 2QG9B 2VFVA 3U1MA 2YH1A 3OXFA 5THWA 1Q5YA 3Q2SC 2J9DA 3FGVA 1FERA 1GH8A 2JVOA 3K0JA 2I0XA 3ISNC 3G8TA 2UXDF 4CLTA 1S72S 3UPFA 1VQOS 4MYTA 4ZVUB 2VFRA 2AJFE 4PPZA 2BJEA 3KK1B 5H9FK 4YHHF 3I31A 4TLRA 3EGZA 3EZOA 2CJXB 4HKQA 2UV8G 3GSDA 3FJ2A 3R5AA 4DEZA 2PD1A 1RU1A 1R0BG 2L9DA 3DLKB 2G0JA 4J9KA 1SQFA 2FJBB 3KNAA 1RDRA 3AODA 1JLGB 3M7VA 2G0IA 4PYDA 1VRUA 5E33A 4DFMA 3VQSA 1VR6A 3PJ9A 1IBCB 1PJ7A 4J9NA 3I0SB 3P3DA 4I6YA 2JLFA 4USUA 4J9RA 2FLPA 4WJBA 1RWVB 3HI9A 1U8WA 3CCMS 1X5SA 1WKJA 3EVOA 3VVUA 4HHUA 1WHVA 5CZXA 1O8BA 4EZ9A 4C3KA 1LV5A 2UU9F 4OJGA 4I2PA 3E51A 1RAAB 1JLQA 5IT9Y 5AXMA 1RTDA 1S1VA 3Q86A 3ZXWA 4QWBA 3HHKA 1AUDA 2X1AA 1VC0A 5D15A 1SBRA 3H20A 2XO6A 2FY8A 4RX6A 1FWPA 2XYGB 1Q1KA 4LIWA 2QLBB 4DL0C 3RAMA 2YNFB 3R7NB 5A2QU 1F5AA 1Y3KA 1YJ7A 2VC1A 4JV1A 3CD7A 2W24A 2HHSA 3RW7A 2FVSA 1BE4A 2IDEA 4DN0A 3VZIA 2BM1A 1DLOB 1N5YB 4MIWA 1FE4A 1AFJA 4F36A 5HVGA 1Q86T 1R89A 2CWXA 3FEYB 1IKWA 1NDKA 4N8NA 4JV5J 1HW8A 1YJTA 3J81Y 1XMOJ 4F50A 1U1NA 3LGHA 3FFIA 5EDWA 5F0UA 1FRIA 1XERA 4LBIA 1ZH5A 4OJ3A 2X1BA 4ZVGA 1FKPB 4PXCA 2KG0A 2IJRA 3UQSA 5GAHU 1N5VA 2NXJA 2UUTA 1KQSR 2ATLA 3R9LA 1Z2ZA 4AQYJ 4DUYF 4RBVA 3GFYA 1Q79A 1TMJA 3A3NB 5CYMA 2Z56B 5ETKA 1RHJB 3QQCD 4EK2A 1RYSA 4KH0B 2DPJA 1M5PC 2NZCA 2D3O1 2ZM6J 1YHQS 4OI4A 3CDBA 1KC8T 4ED5A 4RNOA 2DY9A 2EKYA 5J2MA 1AFIA 3A13A 4MAKA 5GVQA 5KFWA 5D4PA 3QRPA 2MKSA 3L9ZA 5G4DA 4NZ6A 2ZH9A 4RW8B 1SIWB 1ZAVA 2CJYB 4Z37A 3D0HE 3LP1B 2HFSA 3MGJA 1F60B 1BQMA 5K14B 1VGYA 5KG2A 2GVDA 1RT4A 2YWGA 4Y2MA 3WHIA 4DV5J 3QGPA 2VA3A 1HQEB 3KWMA 2J9CA 3I0RB 2DNPA 4C11A 4QIFA 1KEKA 3D1QA 1N6QA 3M8QB 2ZVSA 3LP0A 1KTQA 2C2KB 1SJRA 3K5LA 1ZTWA 2LQ9A 2MZQA 1T9YA 1Z1ZA 1RTZA 3AJ2A 1WNEA 4HT5A 2EVZA 3OVBA 2Z2ZA 4LF2A 4QPTA 3UCGA 1RXOB 3UNYA 3PHEA 1R8HA 4Q8FA 1XQIA 4Y6IA 3AD7C 3PM9A 1LEOA 4CH7A 4MFBA 1S0MA 2FUG9 2FVPA 3GYGA 4RNNA 3K57A 1I51B 5KFHA 4CLZA 1C0TB 1BWVA 2DGVA 2HBRB 5K9FA 4KHMA 2HVZA 4GVBA 1RT1B 4PXBA 2XMWA 5IC4B 3VCDA 1WORA 3QT6A 3E8OA 4GVLA 1IKVA 2IDLA 4MJKA 5C2CA 2E7WA 3N5BA 2CQCA 1IN0A 1IXKA 5KFGA 1BD6A 3HP6A 4WYWA 3MAAA 1S1UA 4ZPWR 5AJ3J 2WRMA 3D1OA 3TJ8A 2Z2LA 1PBUA 5IZHA 3P8BB 2H51B 2NXNA 3P5TL 2PT0A 2GHVC 1JIHA 4NCAA 2KVQE 4C2MA 3OXLA 4LFBJ 2KVIA 5EUHA 3C2PA 1UETA 2ASDA 2IIHA 4C8OA 4HACA 2N3LA 4X4NA 1IR2A 4J9MA 2C2RA 2CZVC 1UVMA 5LM7E 4HHJA 1MMDA 3JQMA 2OD4A 2OPSA 3L09A 4KQZA 1GMWA 1RP5A 2HG4A 2F65A 4BBYA 2VG6A 3T6JA 4F4WA 3SFUA 2UVUA 4QCLA 2YNIA 3BO4A 3IRWP 2CQ4A 4QIVA 2KKHA 1N8RT 3MM8B 5DLFA 5JMNA 4RU9A 3PCOB 2BEFA 1L3TA 5CA5A 3TUZC 3A8KA 1FD2A 4C0HA 2V69A 3HF5A 3ETOA 2O67A 3UVJA 1TELA 3M2RB 3IAS9 3R3TA 1LWXA 3GJSB 5FIIA 2FHJA 2WB4A 5B0DA 3J7YI 5JVHQ 4H4OB 1PJ6A 1XMQJ 3G82A 3GIRA 3MZIA 4K4WA 4KAIA 2D3ZA 2ZJQQ 5KFAA 4P2XA 3LP2B 2GX8A 2ZKUA 1NH8A 1WELA 2LQJA 4EMDA 2RQMA 2R2TA 4ZHRA 4ECUA 1SB6A 1V5VA 2B9WA 3MCOA 4LRCA 5AXKA 5HVFA 2AIRB 3MI7X 4WFYA 1MN9A 2WSCC 4TY8B 5IV4A 5DG8A 1N34F 4F3MA 4EGLA 5KFOA 4K2XA 4A8MP 1SH3A 3CD5A 5M2UA 4USWA 2VBXA 2X3DA 5B0EA 4WP8A 1RACB 3KK1A 5I3UB 3PTWA 4DR4F 1EKSA 4QIWD 1P27B 2ILYA 1VHIA 5FDLA 2VDHA 5EX3A 1L3KA 4PG6A 3DLKA 2CVIA 1H2UX 1TKDA 3HHLB 3PO4A 4FYWB 3I96A 2KJWA 1JLGA 1KVKA 4LF8F 3OTCA 4ECSA 2CKWA 3WBZA 4LF9F 2JNJA 3HZGA 2FJEB 4MMOA 3NS6A 3H42A 2V8VA 2B4VA 1S9FA 3DN9A 3I0SA 4DV4J 4KGKA 3K17A 3OR2A 4AL5A 2DXDA 4NLVA 1S76D 2J0XA 4JI0F 2ZOGA 3ZZRA 3EDRB 1SKUB 1VIXA 3QLHB 1TFYA 2HMIA 5J1EB 4YB5A 3NP5A 3OD2A 4TXSA 2LA4A 5KFZA 3T5HA 4NXNF 3W61A 1BY9A 4KTQA 3EWGA 2IJNA 1WHYA 2YNFA 2BQ3A 2PFDA 1GMWD 5HSPA 2IMOA 4ZLJA 1S0VA 1HNXJ 4BWMA 1RA7A 3VV2B 2FZCB 3CJKB 2GNKA 2ZBPA 3IP0A 1S6QB 1JB0C 3TQ1A 4OYIA 4DXLA 3QSIA 1SJ4P 3AB2B 1SL1A 3GLJA 4ZVSB 2HBYB 3W9JA 3KXDA 4MK8A 4JI5F 4ZJLA 3QIDA 5DZ7A 1DQAA 1WTFA 3FSYA 4ID5B 3H2LA 1YDLA 1WSRA 1FKPA 1U1KA 1HD1A 4PYAA 2AHOB 3MD1A 4UF4A 3LF0A 4RZRA 2JVRA 3V81B 3NOCA 2R9LA 3MAHA 3KJQB 5D3GB 4WXOA 3VAIA 1TP7A 2O3DA 3DOKB 2HHHJ 1C4AA 2B9YA 5LJ3Y 2XLIA 2V6AA 3TZYA 1NK4A 5BR8F 3TEGA 1C1BB 2CPJA 4K4TA 2OFHX 1RYRA 3AJ1A 3WIUA 1GX6A 4R8UB 2EI5A 2M4MA 5EX0A 3QZ8A 4M5DA 3ZTQA 2OI2A 2UUAF 1SKRA 1YJNS 5GMKa 5KFNA 1CG2A 3QFHA 3ISZA 3KHGA 2I6WA 2RNEA 2YBVA 5LJ5Y 1PIEA 5E3RA 4RW8A 1SCJB 2XYHB 3LP1A 1YI2S 3OJUA 2UXBJ 1YRXA 3VWSA 2E5JA 5K14A 4A8OA 5KT6A 2QMUB 4ZJOA 4O0NA 3V6HA 1UCNA 4DPOA 3R5JB 2H65B 2FB0A 1HQEA 3T5KA 3D68A 1QSYA 3I0RA 1VQNS 3FCWA 4ZN1A 3AAWB 4C6AA 1C2PA 3M8QA 4JI7J 4ANEA 2J76E 5HK4A 3D1HA 1F0XA 4ECYA 4FBUA 3OFHA 3CNQP 3CT9A 3D0GE 4QWEA 2B51A 4JI3J 3RRKA 4DCPB 3O2IA 1C4CA 4DOZA 3S1TA 1NLKL 3HSJA 1YTYA 3W9IA 3DKDA 3KDOA 3QGGA 4DBQA 2LXUA 2HHUA 2B56A 1H3DA 2JZ5A 2DH9A 3MOZA 5RUBA 1SC3B 1C0TA 4B3SF 3C15B 1HW9A 2C3UA 5D0HA 3GR1A 2UXDJ 4DR1J 1RT1A 3H8YA 2Y9HA 1EZZB 3GIKA 3GIMA 1MMNA 5GMEA 3K5OA 3KG4A 5ETNA 4KE5A 2A2CA 4YHHJ 2BX6A 2BRKA 2XLJA 4CH0S 4QQBA 3BYRA 2Z4PA 1H2TZ 1QD1A 3BF4A 1JJ4A 2OMLA 1G7CB 4LF7J 2LXFA 5KFCA 4K59A 1FJGF 1LW2B 4OX8A 1WF0A 1BWEA 4H4MB 4I67A 3HLUA 2QRRA 1H98A 2DNOA 1U09A 3FSIA 5IXUA 1CQNA 2BANA 2E44A 5ETTA 2ASLA 4X66J 2WOMB 2HHWA 1WG1A 5H9EJ 1NK5A 5L8RC 4DQPA 2IAJA 2X51A 1S12A 2CPEA 2AGOA 1GAOA 2UU9J 2KHDA 3I56S 2AP6A 4QOTA 3BV8A 4U8YA 3MM8A 2M88A 4OZLA 3Q8SB 1QM9A 1YBAA 3N9UC 2RU3A 3ETMA 2XMUA 3D54A 4J90A 2E5IA 3MEDB 2H48B 3M2RA 2R8HA 2NCKL 2VDIA 4OX7A 1NHVA 3A3OB 1VISA 1RWKB 3L95X 3LUYA 4H4OA 3PX4A 4DL4A 2E7VA 4LR7A 4ECVA 1VQ6S 5LMNJ 5IV3A 4EU0A 2HWTA 2YWWA 3FC9A 3LP2A 2HZAA 1NKBA 1N0UA 2W4PA 4EBDA 1Q82T 4NA1A 1XR5A 1NK6A 3ZC4A 1Q4RA 1K0VA 2ILZA 4L3KA 4J9LA 3KUHA 1RTJB 4F4AA 2V8HA 3JTNA 5HAOA 4NX9A 3NMAA 3I5CA 1DY3A 2ASYA 2R8GA 1Y4ZB 3L4BC 4J9OA 4DV3F 7AT1B 1QAIA 4L72B 1LXJA 5I3UA 2AYEA 2BOAA 2YVSA 4U7UK 1S9GB 1NHUA 2BV3A 2Q43A 5DQIA 1SI9A 2QLXA 1D8YA 4ECZA 2PE8A 5LXYA 3T9ZA 1N5QA 4HI2A 1SV5B 3AOCA 5C24B 3H40A 2ROGA 1S77D 1X7VA 3HD1A 3D3BJ 3SSQA 3QT5A 1T0TV 4JP8A 1OS5A 3WIVA 4F4XA 3I32A 4FYYB 2HK2A 1VQLS 2C3OA 3QSYB 1U49A 1J5EF 4DZDA 4LVNP 2XCPA 3KDNA 3QLHA 2YKOA 4ZPTR 2AD9A 2XB2D 2AX1A 4LBPA 2F4FA 4P2MA 2KYZA 4UQTA 2ZOMA 5J1EA 1KHWA 5LL6d 1YX2A 2UXCJ 2YWFA 3NRBA 2JFDA 4DCOB 1X4CA 4WFNQ 2PDAA 3FEXB 4LQ3A 1VQ8S 1QAYA 2DR8A 4DDFA 2AJQA 4MKAA 1S6QA 2OAUA 2CJAA 1T7PA 2C1EB 1K44A 1X5TA 3M2VA 4ZVPB 2ZH6A 4ZCIA 3NGUA 3PKMA 2MQ8A 1SPBP 3HFZB 4B9NA 3N0VA 4M95A 2J0QD 1ZM4A 5F8MA 3NLCA 4ZPAA 1VQ9S 3LQVA 3G87A 1UW4A 2W9CA 4ID5A 2PA8D 4LSLB 3EYZA 3IWNC 2FHMA 2L48A 2ZH1A 4O0IA 1KSPA 1UVIA 3EX7B 4B3MF 4DUTA 3V81A 3I4HX 2APOA 4C48A 4RNMA 2YX1A 2EG2A 4LUBA 2FJVA 5D3GA 4KB7A 3DLBA 1QVGR 3NWRA 1X9MA 4DL2A 2PEHA 2R7XA 4LF5J 5HBMB 5L1JA 1R43A 3OL8A 1UFWA 3KHHA 4RPFA 1U1MA 4OV6A 3QMQA 1HIYA 3ENVA 2A3JA 3DYAB 2IA0A 3QZ7A 4NWBA 4FF4A 5T14A 3RU0A 3BDEA 2GS8A 3J7ZT 4Q7AA 1G1XA 2MZJA 2A1BA 1WEZA 2ZWOA 1FD8A 2V4RA 1EJ7L 1HA1A 2EK1A 1RTHB 2DHGA 2MY7A 3UO0A 2DO0A 3AOBA 3MM6B 2VV5A 4E2FB 3A8EA 2LXIA 1OWXA 4ED4A 1WACA 2ABYA 2KDOA 1WF2A 3VALA 3JTPA 3IS9B 3JSBA 1NK7A 4ZLPA 2ZDPA 2DR9A 4GKJF 3BN4A 3KK2A 3HHLD 1S0OA 3CCRS 1U47A 2J6UA 2V2ZA 1M5HA 1Z2LA 3K59A 5IQ6A 5LSLA 1RWMB 1ZZFA 4D3HA 2GC8A 1NPRA 3H7HB 4OHWA 3Q8RB 4FF2A 2DHXA 3FMWA 2EFNA 1ICEB 2W4DA 2HGMA 2DVIA 2JEFA 1RADB 1U02A 3GYXB 3MD3A 2VONA 2P9CA 4OYMA 1NK9A 2WCXA 4OYAA 2CPDA 3MPYA 4B9VA 4DS5A 2MZRA 5IS2A 1A9NB 3BH6B 3DLJA 3DCAA 1Q53A 4V19J 3K5MA 2M3DA 2B9EA 3OFGA 1RT6B 3AQOA 2MLZA 3VGTA 4Z2XA 4B3RF 3RR8A 1FKAF 3J80Y 1N34J 2WW4A 2RRBA 3GG0A 4NLWA 3IN5A 3C15A 3LANA 1Y3JA 1FI4A 2MQQA 1YRTA 1CS4B 2V5HG 2VZ9A 4TQSA 4URSA 1EQ0A 3OVAA 4JI4F 3GB0A 2V68A 2E66A 4LFAJ 4ZCLA 3CCLS 4Y2AA 1NMEB 1OYEA 3CCES 3TAMB 2XMKA 3QNWB 4DR4J 3PVXA 2QMXA 3G8QA 1ZTTA 2GO9A 1YIJS 2DGUA 4I1TA 2ADBA 1VLYA 5GAHI 4JV0A 3MPUB 2IA6A 4F04B 2VKRA 2Y1LB 4X65J 4IG3A 4F4YA 3CD6S 4OHYA 4IKAA 3QRQA 3MM5B 3DU6A 1LW2A 4YB7A 2ZEJA 4J91A 2FTRA 5FLXU 4LF8J 2B7CB 3A3PB 1O5JA 1EAYC 3THVA 3KG1A 2KZMA 3G96A 2DB1A 2HURA 1JLBA 3MMJA 3MCMA 4H54A 3TQEA 2E5HA 2CJQA 3ZTOA 2DKOB 4BC7A 2G13A 4UOFA 5CCMA 3FEZA 4CIOA 2WOMA 1KQFB 1U26A 4JI0J 4J9VA 3W3SA 6FDRA 2VJVA 2LCWA 1QTNB 3MHYA 2QJ3A 4YB1P 1XIQA 4LIRA 3C16A 1T8EA 2XBPA 4YN3B 4X4TA 3QFWA 1LW0B 1W7WA 3ILIA 2GAGC 5ETRA 1HNIB 4NASA 4MK7A 1O51A 4PABA 3KTQA 1NKCA 1EARA 3MEDA 2HGLA 4IRKA 3GFHA 1QVFR 1LKZA 5MAOA 1LK5A 1M5OC 4QIGA 4ECTA 3PNIA 1VBZA 4N56A 5E41A 3ZZZA 1WDDA 1G6BA 3H5YA 3VGUA 3GQCA 2AF6A 5ETMA 1S7IA 2R7QA 4LSZB 2DGQA 4RO0A 2AKWB 3OR1B 2FVRA 4M5IA 4USTA 1CJUB 2JC1A 2ZH7A 2YPYA 4KC5A 3UWTA 5DG9A 4PWUA 1H6KX 4XDDA 1NDPA 2EEYA 1I3OB 2H3EB 2I2YA 1ROFA 2JLGA 5BYRA 1EP4B 2QYGA 3CJRA 2FC9A 1RTJA 4K4YA 1IM6A 1FVQA 3Q8PB 4ED6A 4F3QA 3EGWB 5HQLA 1DQ8A 2OLWA 4FYXB 4TU9A 1RTIB 4DR2F 2XO7A 3WC0A 1T02A 2W2MP 3KLVA 2XWYA 2VA2A 4CO5A 2DHSA 3H25A 1LWFB 1FTRA 2O01C 4LJMA 1KFSA 1F9HA 1S9GA 1CJVB 2HHPA 3LO3A 3MUMP 2HQGA 3I5BA 2OTJS 1C1CB 3CGIA 4QR2A 2P8IA 3DHXA 5KFVA 1S10A 2IY5B 1XWLA 3LW5C 1FRLA 1SV5A 5C24A 2UUAJ 2BRLA 2YKQA 1UVKA 4USKA 5HMXA 2WVDA 1GK8A 4NZ0A 3T6BA 3RJMB 4I2QB 1UWAA 1O6XA 2H5JB 1GTHA 2FD2A 2G0CA 4IH6A 1VQSA 4P2SA 3QATA 3JB9k 3QO9B 1ZAWA 3RTVA 3KJFB 3K89A 5GMDA 1NZ8A 4MKYA 2XS7A 1U1RA 3W8GA 2M52A 3IRXB 4BS2A 1CJTB 4FVMA 4ICLB 1FDAA 1F6TA 2ZHBA 3W60A 1PBAA 2H9ZA 1LQ9A 3TAPA 2RDDA 1SC1B 1UFLA 3ISND 2XM3A 3RBXA 3W5XA 1V9OA 4PEOA 5F9LA 2VG5B 5K8NA 4NMLA 1ULRA 2RB7A 2ZNYA 3B4MA 4AQYF 3W7BA 3KLHB 2GHPA 5DDRC 3JSYA 1H72C 1Z4UA 3P49B 5B0AA 3DRYA 1FEHA 3US5A 3M8SA 3BBCA 2DY1A 2ZKTA 1ZPVA 4PXEA 4I69A 2DNQA 2LU1A 3RRHA 2HEKA 2IM0A 4LSLA 3SXLA 2W8LA 4UY8T 4DR7J 1FTCA 3Q2TC 1PO6A 3M8ZA 4N47A 3CULA 5IOLA 1D1UA 1QAJA 1S5ZA 2BE9B 3ADAC 4KPYA 4B9UA 2BYCA 4B17A 1OO0B 2KRBA 3CCZA 3EXCX 4OZ0A 5CD4H 4IRCA 2XULA 1XK8A 5HBMA 4ELUA 1Y11A 3PY8A 1FJGJ 2J6TA 1TL7B 2XSFA 2MLXA 3Q8UA 3FVYA 1CSJA 3JAMU 4CYUB 3DYAA 2MDAA 3BQ1A 3HULA 4DV5F 3OTBA 5L46A 4RJVA 1JX4A 1N0VC 2X1FA 3NKYA 2CG4A 1A6LA 1RTHA 2J8SA 2ATCB 3MM6A 1HR0F 5LT5A 4ES3A 1I5OB 3R97A 4OHVA 3IS9A 1R3NA 4NYZA 1KD1T 4UOHA 2DR7A 3AT1B 3T1HF 1MWQA 3SZ2A 1FFSB 1JLCB 2QLFB 3OSPA 2MSTA 3CJQA 3TUJC 3WZ0A 2COLA 2D74B 2BW2A 3DOLB 4YB6A 4LRBA 1R8CA 3H5SA 1D9DA 2ZJRQ 2F8MA 5HO4A 1FKOB 1EIYB 5BXIA 1YJVA 1JJ2R 4K7QA 1HWKA 2E9TA 2BJ8A 5DS7A 3UE2A 3CMES 3PW4A 4UZBA 4LRAA 1U6ZA 4RBTA 1RT6A 2W9BB 3GFXA 1BUXA 2W2QP 2HWHA 3ICLA 1MSWD 2DJWA 1J27A 4DSEA 2QL5B 4C4WA 3T41A 2Q66A 5J2NB 4X4SA 5DDOC 2MQMA 4KKOB 4YOEA 2L41A 2VPZB 4FZVA 1ZS6A 1U4BA 4Q45A 4NA2A 3GMGA 4CI0B 3SFGA 1CS4A 2FPHX 5A8WB 4KO0B 2X3GA 4UT4A 4NLUA 4DV3J 2EC2A 4K4XA 2WVCA 3H4BA 3W5ZA 3MR7A 1QTMA 3CC2S 3QJPA 1H0HB 3TAMA 2W7AA 1GX5A 1Q7YT 4ZCKA 3DFEA 2UVWA 2J0SD 2XY6A 5KT4A 1S4FA 4IO1A 3MM5A 2XS2A 1VBKA 2IPOB 1U0HB 5HANA 5HN0A 3RAXA 4LRDA 2ZZTA 3AY0A 3H59A 2OGUA 3SCKE 1REVA 4X4QA 1B0VA 2E7XA 1B0TA 4C97A 2A2DA 7FD1A 4DQIA 4EZ6A 3NBPA 2N4DA 3CSKA 2AZ3A 1HNZF 2XC9A 1ZM3A 2BJDA 4CO2A 3SDEB 2N7CA 1XMQF 1R27B 2YQ3A 2VH7A 3TZWA 3HHNB 3DU5A 4K4SA 2N7YA 4USMA 4P52A 3AFGA 1N5TA 2DPIA 2DXFA 5J1PA 3NEKA 3G2XA 3EGNA 5IT9U 3SSRA 3GYNA 4CQ1A 2KT5A 1HNIA 5KG6A 2I5JA 4U7UD 4W92B 3PDNA 5I3QA 3ZO7A 2MKCA 3MMCB 3MPVA 4URQU 1LOUA 4FPIA 4R0JA 3FCHA 2WVEA 2Z30B 2N3OA 1AA1B 4PPDA 1NEEA 4HH1A 3MECB 3G6ES 5JJBA 1TL1B 2ZC4A 4A8KA 2B4PA 2GVZB 4ZP6A 3ONQA 4NLRA 2UUBF 1V3SA 3TVKA 3PR4A 4JI6J 3NGTA 1FNXH 4C9DA 1U8SA 3J81U 3D0IE 1FNOA 3OR1A 4RR5A 1URNA 2ASJA 4J37A 1N5SA 3CE8A 4ECQA 4HT7A 3R1HA 3NMRA 3TANA 2P9EA 1N36J 4P75A 3T5LA 3KHRA 4F4KA 2IVFB 1EP4A 1R8PA 4KRWA 3RW6A 4IOAQ 5HMYA 4DFKA 1CJKB 1RLDA 4P73A 4ZPDA 4M94A 3DOMA 2B4OA 4AL7A 3U7JA 2QC3A 3IAM9 1LWFA 2RQ4A 4QIEA 4DV4F 1JKHB 4RBUA 1X4HA 4OX6A 4C0OC 2RUGA 3EPGA 4ZLNA 2CJBA 3AH6A 1R0AB 4P7VA 3S7RA 3MM7B 1C1CA 4X4OA 1RCXB 3CJTA 3NAHA 1KR4A 4OMFG 4ED2A 1EQMA 1TK0A 4C3MA 3PXGa 3JQKA 2D69A 1L3VA 1KS2A 1OQ3A 2AJ1A 3GV7B 2JDJA 2RE1A 5SUHA 2K7JA 1TL3B 1TUVA 4I2QA 3BKUA 4IFVB 2AGQA 2IBOA 2ZWPA 1KLMB 1NJWA 1VQPS 5DDPC 1HNXF 3QO9A 4HTIA 2GQ2A 4DV7J 3IBCB 4DX8H 3D6MB 3NL0A 4A8YA 1LWCB 5H9FJ 3RBEA 3IR5B 4A8SA 2JFKA 2DXEA 2FLNA 1B70B 2EG1A 2GAHC 3IRXA 4WYLA 1CJTA 1XR7A 2WONB 4ZIWA 4FXDA 2UUCJ 1KFDA 3CDAA 4OI6A 3BQ0A 3C3LA 3G6VA 1UA1A 3CDUA 2ZC3A 4RWWA 2NXCA 4K4ZA 3OVSA 1TFWA 4GRSA 1HNVB 3J7AN 2RAQA 1B99A 3CCWA 3ENAA 3HD2A 4EO8A 2JEIA 3BPDA 3PYGA 3KLHA 3B82A 2IM2A 2F8EX 4WK3A 2FLLA 2AJ2A 3L7UA 5BYSA 2X1GA 5T7LB 1RT5B 4K5SA 3ZFVA 3PV8A 3WX4A 3ZNJ1 4KBIA 1WKLA 1S6PB 2GMHA 2V4QA 3OW2R 4KGVB 5DM6Q 2HYIB 5IT4A 3RR7A 4PR6A 1S99A 1SJ3P 2P6SA 2CQDA 2PI5A 2QA1A 2VHGA 2VG7A 3OLAA 3G8SA 2IC3B 5L1LA 3MM9A 2ZJPQ 4RWXA 2BW7A 1I6JA 3KOAA 1G4CA 1TL7A 1HWJA 5CZVA 4CYUA 5FD1A 3BBFA 5C2GA 1PYSB 3N5FA 2DNMA 2N82B 5DETA 2GMJA 4OYXA 3CW2C 2WHOA 3EVWA 4ERDA 1JLEB 1T05B 2GIRA 3PKYA 3M8RA 1PJ5A 3BR9A 2C28A 1NJYA 1S57A 2MKYA 1ZAXA 4YEAA 2C22A 4K0KJ 1TKZB 2XZDB 3R2DJ 2JRSA 3PG9A 3UN5A 5J2PA 3GV5B 1KNZA 4DL5A 4LF1A 4JI3F 1JLAB 2ZBCA 4JBCA 2HS4A 2V0NA 3M8WA 2BMBA 2FQQB 2B43A 4N5SA 1NSAA 4BDPA 4O3QA 2UUWA 3GR0A 4CO1A 8ATCB 3ZZ0A 4LF4J 2QA4S 3HVWA 1AT1B 3A8JA 5HI7A 3TZZA 2KG1A 2BXJA 3DOLA 3OL7A 1U24A 4DR1F 1HD0A 2Y1JA 1FKOA 4ECWA 2HNZB 3PX6A 2Y1IA 3IGVA 4LR8A 3DRRB 2FHOB 1MWYA 1NNDA 1OY9A 5JUMA 4ATNA 2QA2A 1X0FA 1UTAA 5KFQA 3CCVS 4L3NA 9ATCB 1MU2B 1X31C 4DR5J 2W9BA 1EETB 4PQUB 3V5RA 1Q81T 3DLEB 4LF7F 4KKOA 1UWBB 4OJ1A 4Y00A 2LU2A 3O44A 1M1GA 4JB8B 5D4LA 1HWIA 3HX9A 2FJDB 2VF3A 5H1SV 5A8WA 2NSCA 2AEJA 3W1YC 2VU5A 2HW3A 4DR2J 5DLGA 4OZ3A 4DR6J 2K2PA 3FNNA 2AGPA 4CZCA 4KR0B 1SJ1A 3MUTP 1S7HA 1WUUA 1N88A 4X66F 3OTEA 3BGFA 3M30B 2OELA 2CDQA 1NO8A 2OFGX 4CM0A 3TARA 3OQ2A 3VAJA 4O4GA 2HAFA 2FC8A 4EBEA 3J7Z5 4BLGA 3Q23A 4CWBA 1IJEB 3CEDA 3TWZA 2O5DA 4KH1B 4YP3A 4YR3A 1KOOA 3LGMA 2DNNA 2IBKA 4X4PA 4NEZA 4HTJA 5F3ZA 3GCWP 4F26A 1S97A 2AJ4A 2NXUA 2DIUA 1NK8A 2YNGB 4EO6A 5HL7Q 3KLEB 5D6GA 4H4KC 4L75A 2RUSA 2LEBA 2OO4A 2GMLA 3SDEA 1CC7A 3KNGA 4ZPCA 2ROEA 4R0EA 4USJC 4DPXA 1VBYA 3ZZYA 5J1NA 3T1YJ 5LMNF 3ZZTA 3MXHP 4DR3J 2F5GA 2CADA 3T9NA 2FVCA 3IXQA 2BABA 3SBMA 1ELOA 2RF2B 1P8GA 3LGNA 4IR1A 4ILLA 3MMCA 5ETLA 1QAXA 5DGAA 1TKXB 1EHWA 2R4FA 4K5RA 4M8LA 2EBEA 1S1WB 3I9ZA 1KQKA 1DZ5A 2DCLA 2AWZA 3UR3C 4K50A 3HVAA 1NM2A 1TL1A 3SQGB 2GVZA 4FNIA 2BOPA 4P6QA 5AE1A 4NCGB 4ZIVA 4CDIA 1FK9A 4XPEA 2HHVA 2MGZA 1F9EB 4B08A 4WP3A 1UPMB 2MTLA 5EHHA 1WG4A 2F63A 3ITHB 2JJ4D 3SCIE 2GJFA 4OHXA 2CIMA 4RUCA 1YVFA 5KG3A 2V8DA 3C19A 1T9XA 1NPKA 4Q0BB 2XSJB 2NREA 4IFYB 1S1XB 1NK0A 1SQEA
chains in the Genus database with same CATH topology
4WKYA 4O44B 2J0QD 4A8FA 1ZM4A 2W7PA 3U27A 3X3UA 1VFJA 1FRMA 3TP2A 5HP1B 5F8MA 2RILA 3NLCA 4ZPAA 2JEGA 1MROB 4UW2A 1VQ9S 2OPQA 2LECA 3LQVA 1PILA 3TOQA 4GKKF 4KFBA 1DTQB 3MWBA 2VPYB 4G1QA 4ZMMA 4B9TA 1U2RA 1Y5NB 2QSWA 2VASA 1UW4A 1OQ6A 1RJJA 3QAEA 2W9CA 4WF9Q 3DC2A 4F25A 4ID5A 2PA8D 4LSLB 2EFQA 3EYZA 2ZZMA 3IWNC 2FHMA 4JV2A 3V4IA 2R7OA 2KO1A 1R0AA 2L48A 2ZH1A 4O0IA 4XPCA 4LT6A 4FPRA 5KFPA 3CCQS 4ZP8A 4OQJA 3DDKA 4RUAA 3CO9A 3SSSA 1KSPA 1UVIA 3EX7B 3MM7A 4QW8A 4B3MF 1XC9A 3V81A 2HLTA 4FP9A 1PC4A 3I4HX 2APOA 2CQ2A 4Q43A 4RNMA 2XS5A 2B5JB 2RKIA 1XN9A 4OLOA 4C8KA 1AW0A 2F1FA 2MQLA 2YX1A 2WAQD 4MFBB 3S6EA 2IMWP 2EG2A 4HDHA 3T3FA 4CCHA 4LUBA 3OHBA 1OPZA 2FJVA 5D3GA 1IKXB 1JLFB 3QPIA 2EC0A 5CQGA 4KB7A 1TK5A 2XMVA 2VKZG 1J5OA 2RQKA 2V8GA 4Q0BA 1YG0A 3DLBA 3ZZPA 1QVGR 2UXCF 2HFZA 3CJ4A 3BSOA 1X9MA 2WSEC 1VC5A 4DL2A 3DXBA 2PEHA 1T3OA 2R7XA 2DO4A 1SXLA 3M6VA 5HBMB 3L3CA 2KT2A 5L1JA 1V3RA 2KN4A 2DNHA 3T5JA 1R43A 2R7UA 1JK9B 1WI6A 1UFWA 2QLWA 3OL8A 3KHHA 1GQEA 1M5KC 3BB5A 1U1MA 2MXYA 1DTTB 3OTDA 3KK2B 4TLQA 1WTBA 1PC5A 1W2IA 3QMQA 3GIJA 1DHMA 2JLEA 4NLGA 1IKVB 1ZM2A 2YY3A 4DHVA 3ENVA 2A3JA 3DYAB 2IA0A 3QZ7A 2HZCA 2Z0GA 3QGHA 4NWBA 4WFAQ 2LDIA 1KOHA 3MFHA 4FF4A 2UVRA 3EUNA 2K1RA 5T14A 4PUOB 3RU0A 3BDEA 3DRXA 3HKWA 4HDGA 3J7ZT 1UP1A 3DRPA 3PEJA 4Q7AA 4TNOA 1OIAA 1G1XA 2GIQA 2EFPA 2MSSA 5F8LA 4GMKA 2MZJA 2R7VA 1UEUA 2A1BA 1S1UB 2PSZA 4F67A 1LWCA 2XI2A 1H7WA 1WEZA 2CQHA 3KLIA 1CVJA 3E2EA 1FD8A 1QUVA 2GJ2A 5G0RA 1VMBA 5CYQB 4DV6F 2V4RA 2B5JA 1HA1A 3IR6B 1RTHB 2EK1A 2HGNA 2ZOFA 2HHHF 2DHGA 3F56A 2FJXA 4FF1A 2VD3A 2MY7A 5CH7B 2R8JA 1D3WA 4PXDA 1K9MT 2XMTA 2CQGA 2EK6A 2W8KA 2PC6A 4DSLA 2WONA 1FRXA 2DO0A 3MM6B 3V2UC 2VV5A 3O6QA 1RT3A 3A8EA 2LXIA 2MKHA 3GILA 1OWXA 2GO8A 2LVWA 3BSCA 1NJXA 1MMLA 5KFRA 1WACA 2ABYA 4BWJA 2KDOA 1WF2A 2AW0A 3JAMY 3MF5A 3VALA 3JTPA 4C8MA 3TRGA 4A48A 3IS9B 3H98A 1RI7A 2RD5C 4K4UA 4FS2A 3JSBA 4B9MA 2F4VF 2KH9A 1NK7A 3Q8QB 3PFEA 2B6AB 4ZLPA 2DH7A 2VL1A 3NNCA 2NPFA 2ZDPA 2GFFA 2QE5A 5DGBA 1X4DA 3R5CA 5L9XA 2DR9A 1VHFA 2M9KA 1XTZA 3BN4A 4GKJF 2HNDB 2P6TA 3HHLD 3MEGA 3KK2A 5MLCV 2FY1A 1FRKA 2QEXS 1X4EA 4DFJA 3GZ7A 4I0WA 1S0OA 3CCRS 1U47A 3C6UA 1HNVA 2J6UA 4X4VA 1M5HA 1XBWA 1Z2LA 5A8KA 1KLNA 3K59A 4LFCF 2NUUG 5IQ6A 2J6SA 1QE1B 1KVIA 5LSLA 4R5PA 3R1LA 4D3HA 1ZZFA 3K8VA 4HH0A 2GC8A 2W7OA 4DMZA 1CC8A 3N28A 1Y9OA 4OHWA 1NZAA 2OPSB 3Q8RB 4FF2A 1B0PA 2DD8S 2DHXA 3DLGB 3FMWA 2EFNA 3OFFA 3RYLA 2W4DA 4B9SA 2OSRA 2IJFA 3BR8A 2HGMA 3M8PA 3NWGA 2DVIA 2YNHA 1RKJA 4WFBQ 2JEFA 2VG6B 2AYMA 3VZHA 2XNQA 3DLLQ 4MH8A 1JJHA 3GYXB 5CYQA 1A7GE 1FJCA 3GE9A 2DNLA 1VJWA 5T7LA 3MD3A 2CQBA 2VONA 2P9CA 4LF5F 1HFEL 2YNIB 3M6WA 1RT5A 2UXBF 1SH0A 2AV5A 5IQQA 2VBZA 2VPXB 1RT2B 2ACYA 4DQSA 2EWHA 4G1PA 2WCXA 1NK9A 3MMBB 4U67Q 2CPDA 3MPYA 5AE2A 4NYPA 4RUHA 1UVLA 3MDFA 2VUGA 1S6PA 5A0YB 4ECXA 1QLNA 4B9VA 2ZH3A 2BQRA 4YDDB 3H4DA 2MZRA 5IS2A 4DS5A 1HI0P 2ZBIA 1A9NB 5BJRA 1FVSA 3DLJA 4C8YA 3V6DA 1XNQF 3QAUA 3DCAA 1Q53A 4V19J 2YKNB 3C6TA 4ETZA 3K5MA 1OSCA 2M3DA 2HNDA 4IDKB 3K7RA 1WF1A 4DV2F 2EFVA 1LWEB 3OFGA 5B08A 1ZM9A 1RT6B 3AQOA 3MR3A 4GO5X 2FJAB 1FESA 4QBUA 2R2RA 4Z2XA 1MW7A 2RDJA 4JI7F 3TR5A 1HNWF 5F0WA 1WWHA 1SUQB 4IG3B 4RW7A 3G6XA 4C8ZA 4B3RF 4DL7A 4RW6B 4CT9A 3RR8A 4WKRA 1FKAF 3KJVB 2Q1LA 3TI0A 3FMBA 4DN9A 3J80Y 2HPUA 2RRBA 3GG0A 4NLWA 3IN5A 2JWNA 2OTLS 1U1LA 3LANA 5KTQA 4B3OB 1Y3JA 2MZTA 4QU6A 3HJFA 2L08A 5KG0A 3UR0A 2MQQA 4J9PA 5KG1A 1YRTA 2VZ9A 2V5HG 1U1QA 4FF3A 4O4RA 1GT8A 2HRUA 1JLBB 4TQSA 4URSA 1E6VA 3OVAA 3TAQA 1OPIA 4TYAA 4JI4F 5A8RA 1TR0A 3GB0A 3IG1B 4TY9A 3SCJE 2E66A 1HPZB 1S79A 3DM2A 4ZCLA 2KXHA 3M6UA 5A0YA 3G9CA 2FDNA 1Q8BA 3CCLS 5L1IA 2UV8A 4KSEB 4Y2AA 3CCES 4DLEA 3TAMB 2XMKA 3G6YA 4OHZA 3CCTA 4ZPVR 3PVXA 2V2KA 2QMXA 1M5VC 1VI7A 4A46A 1T95A 1HHTP 3G8QA 2HFNA 3G86A 4CNYA 1ZTTA 1RKIA 2GO9A 2VFVA 3B78A 5A6WA 3M9OB 1U7LA 1TK8A 2J8AA 2PI4A 3U1MA 1YIJS 4ELTA 2DGUA 4I1TA 4IDKA 2ADBA 2YH1A 1VLYA 3OXFA 5THWA 3IWXA 1LWEA 5GAHI 3DI6B 3Q2SC 3MR2A 2J9DA 3FGVA 1FERA 1CLFA 2JVOA 4JV0A 3K0JA 1B7FA 1GH8A 2IA6A 3BREA 2I0XA 3ISNC 3G8TA 1JLEA 2VKRA 1T05A 2PMZD 2UXDF 3SV4A 2YX7A 1S72S 3UPFA 4IG3A 4F4YA 3DLHA 1VQOS 1NU4A 3CD6S 4OHYA 4IKAA 5KG4A 2VFTA 3MM5B 3QJJA 3RBDA 2R8KA 3CF5Q 3DU6A 4MYTA 1LW2A 4YB7A 2VFRA 2AJFE 1K1QA 2YWHA 1TKZA 2FTRA 4PPZA 1S9EA 2B7CB 1SJQA 4O3OA 2BJEA 2VPWB 1O5JA 1BQNB 3KK1B 4TKTA 4CTAB 3KG1A 3THVA 2KZMA 2WSFC 3G96A 3LPYA 1FT8A 5KT5A 2DB1A 4WE1B 4YHHF 1JLBA 3I31A 1JLAA 4TLRA 5HLFA 3EGZA 3MMJA 5K5MA 4MYUA 2NQPA 4H54A 4HKQA 2ZUGA 3GSDA 2UV8G 2MKJA 3FJ2A 4OZ5A 3DRSB 3R5AA 4DEZA 1KHVA 1WD6A 4NLSA 2E5HA 4Y28C 2CJQA 4BC7A 1HQUA 2PD1A 1KQGB 4TYBA 4F3OA 2R8IA 5F8JA 2G13A 2CQIA 5CCMA 1VIOA 2L9DA 3DLKB 3FEZA 2C42A 4CIOA 1X5OA 4PWDB 4J9KA 4F2RA 4FBTA 4CH1A 2WOMA 1KQFB 3RB4A 1U26A 4NXMF 4PG8A 2FJBB 3GFZA 3W3SA 4NZ7A 2LEAA 6FDRA 3KNAA 1LK7A 5U47A 1JLQB 1RDRA 2ZHAA 2LCWA 5KFLA 1RTDB 1JLGB 4EUVA 3OHAA 1KTVA 2XHWA 3MHYA 3KG0A 1N4LA 1U6FA 4YB1P 4JI8F 1VRUA 2XI3A 3PFOA 4LIRA 5E33A 1P9QC 1T8EA 2XBPA 3JTOA 3ZZUA 4DFMA 2HNZA 3VQSA 2KFNA 2IRYA 4PG4A 4WZMA 4X4TA 5CYJA 4LFAF 2AX0A 1LW0B 1RISA 3DRRA 4TU8A 4RNFA 1HNIB 3I55S 2DNYA 5F9NA 4J9NA 3I0SB 3P3DA 4MK7A 1O51A 4HI1A 4I6YA 3KTQA 2JLFA 3B8HA 1NKCA 3FQKA 1TKTA 4J9RA 3MEDA 1UL3A 5J2QB 1MU2A 3MURP 2HGLA 3MUVP 2FLPA 3MR5A 4TN2A 4WJBA 4IRKA 5D77A 3GFHA 3HI9A 2YTCA 1QVFR 1EETA 3TVYA 4PQUA 3ENQA 1YGYA 3CCMS 5KFTA 1LKZA 1NB7A 5MAOA 1X5SA 1LK5A 3I87A 4QIGA 4ECTA 1M5OC 3DLEA 1WHVA 5CZXA 2MJNA 3PNIA 4CO3A 4X65F 1O8BA 4EZ9A 3C46A 4UY85 4C3KA 2ALZA 1LV5A 1UWBA 2G9OA 2UU9F 4OJGA 3HHDA 1VBZA 1TL5A 3AA8A 4I2PA 5A6PA 4N56A 3E51A 5E41A 3UDCA 5KFUA 1JLQA 3N6MA 3ZZZA 1NKEA 5IT9Y 2B7BB 1WHXA 1R8BA 5DJBA 5AXMA 1VQ4S 1HYSB 1X4GA 1RTDA 1G6BA 2V9WA 3W2VA 1S1VA 3GQCA 3H5YA 3FFIB 4QWBA 3HHKA 1AUDA 3ULHA 2AF6A 2X1AA 1VC0A 1SBRA 3I82A 3H20A 3H2VE 1YJRA 2W4CA 2R7QA 3BGRB 4NLXA 2DGQA 4XAKA 4I64A 3U1NA 3OR1B 2FVRA 4YMEA 4RX6A 3BM7A 4XO0A 2JC1A 2VC0A 1XEZA 1Q1KA 2JOQA 2HS3A 4LIWA 4ETXA 2ZH7A 2M70A 4KHRA 1LW0A 2YNFB 4NOHA 3RAMA 4DL0C 4YR2A 1F5AA 1Y3KA 2VC1A 4KC5A 5IM0B 4NLYA 4NL5A 1HWUA 4JV1A 3CD7A 3UWTA 1HMVA 2W24A 2HHSA 1X0PA 5DG9A 2AYGA 3RW7A 4PWUA 2FVSA 3D28A 2QFJA 1H6KX 4XDDA 4ZKAA 5KAKA 2VBWA 4DN0A 3M30A 4ZOSA 2I2YA 3VZIA 2KHCA 1ROFA 3E3XA 2BM1A 2JLGA 1FO1A 1DLOB 1Q78A 3DHWC 5BYRA 1N5YB 2IRUA 1FE4A 2Z2MA 1EP4B 4MIWA 1VQMS 5DRKA 2FC9A 1AFJA 2G1DA 4HYKA 2DITA 1RTJA 1M1KT 1Q86T 1R89A 3FEYB 4K4YA 5B0GA 1FVQA 1IKWA 3Q8PB 4ED6A 4N8NA 3EGWB 1HW8A 4F3QA 3NNHA 1YJTA 4MIAA 3J81Y 4CNZA 1DQ8A 3HO1A 2OLWA 3ZZOA 4TU9A 1RTIB 3G4SS 4F50A 4DR2F 4DQRA 1U1NA 2XO7A 3WC0A 1T02A 1K73T 3KLVA 2KXNB 2ZE2B 2XWYA 3HT3A 2ZHOA 1RGVA 1HBOA 3LWLA 1HBUA 3FZBA 2VA2A 4CO5A 3FFIA 2CJKA 5EDWA 2DHSA 3H25A 4F2SA 1LWFB 1RT7B 1FTRA 3P6YC 5F0UA 1IBLF 4AE5A 1XNRF 2O01C 4FXWA 4OLPA 1FRIA 4LJMA 1XERA 3LAMA 5E0OA 2VOPA 1ZH5A 1KFSA 4OJ3A 3IBWA 1S9GA 1X4FA 2HHPA 2X1BA 2J7UA 2YNGA 4ZVGA 1FKPB 4PXCA 1RA6A 4WTYA 5KOXA 1SIZA 3LO3A 2KG0A 2W9AA 3KMSA 3MUMP 1FRHA 3UQSA 3I5BA 1N5VA 2LQBA 5GAHU 2OTJS 1C1CB 5DG7A 2DT9A 5J2MB 3GWCA 3CGIA 2UUTA 4QR2A 4QU7A 1KQSR 2ATLA 4DV0F 1D0EA 1Z2ZA 3BS9A 3DHXA 4RBVA 4DUYF 5KFVA 1DLOA 3GFYA 1S10A 3CCSS 1N5YA 3N79A 1X5PA 1XWLA 4HEA9 1TZ0A 5I4MA 5LSOA 1Q79A 2F9JA 5CYMA 3LW5C 4IQXA 1FRLA 2VQEF 3M2UA 1SV5A 5C24A 2BRLA 2B0GA 2YKQA 1UVKA 5C25B 3I5AA 2RS2A 2DH8A 3EZ5A 4RU2A 5HMXA 1RTIA 4Q44A 4JYAF 4EYIB 2CZ4A 1RYSA 4NZ0A 3T6BA 3KK3A 4I2QB 4B3TF 2PFFB 1VS3A 2XLKA 2CPXA 2DPJA 2GJIA 1GTHA 2JX2A 3MTJA 2FD2A 3OL9A 4XDCA 1M5PC 2EFOA 2G0CA 2OPPB 3CIMA 4IH6A 1VQSA 4P2SA 3JB9k 1NRKA 3QO9B 1YHQS 4M63A 2IHR1 1ZAWA 4OI4A 4PKDB 3RTVA 1UMJA 3UCZP 1TKXA 3CDBA 3G71S 4RW9B 4C11B 4ES2A 2A18A 1KC8T 2K7KA 4ED5A 4RNOA 4ED8A 2EKYA 5KT7A 2PGCA 3H5UA 2CQ1A 3PJXA 3PO5A 3MFIA 3HHEA 4MKYA 2L9WA 1S1WA 2DCUB 2XS7A 5J2MA 6FD1A 1AFIA 2DRBA 4MAKA 1U1RA 2JL9A 5GVQA 5KFWA 5D4PA 4I7FA 4R25A 4F8RA 3SQGA 2M52A 1HHSA 5DQGA 3IRXB 4BS2A 2MKSA 4RW4A 4FVMA 4ICLB 5G4DA 2G4BA 1FDAA 4NZ6A 4MTPA 4AFFA 1G3OA 4RNHA 2ZH9A 4WFZA 1FDDA 2FGCA 3PJWA 5HMZA 4NCGA 4RW8B 1SIWB 3MEEB 1BC6A