3DI3A

Crystal structure of the complex of human interleukin-7 with glycosylated human interleukin-7 receptor alpha ectodomain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
118
Chain Sequence
KDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGQKKLNDLCFLKRLLQEIKTCWNKILM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biophysical Studies of the Human IL-7/IL-7Ralpha Complex.
pubmed doi rcsb
molecule keywords Interleukin-7
molecule tags Cytokine/cytokine receptor
source organism Homo sapiens
total genus 33
structure length 118
sequence length 141
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01415 IL7 Interleukin 7/9 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.50 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 3di3A00
3DI2A 3DI3A
chains in the Genus database with same CATH superfamily
3D87A 3QAZA 4D2DA 1EKUA 3HOXD 4DKFA 1BGEA 2B8XA 1M4BA 5D28B 4BBSD 2D48A 4A3CD 4JA3A 3FKID 3L5XA 4IU8A 1ETEA 4GBZA 4BXXD 1HIJA 5A2NA 3HOYD 4U4WA 2O27A 5L6YC 1Y6ML 3BPLA 1HUWA 3DUHC 1PY2A 1SCFA 4TPGA 3WCYI 2B8UA 5IP7D 4I77Z 1GNCA 3LB6A 1F45B 1BBNA 4A3ED 1A7MA 1Y1VD 4U4TA 1ITFA 5C44D 3Q1SI 4NN7A 1Z7CA 2H24A 2Z3RA 3DI3A 3HMXB 3DGCL 4OH3A 4ZWCA 1Z92A 3OQ3A 1CYLA 1ITMA 1CN4C 1Y1WD 4A3FD 1M4AA 4O6KA 4GBYA 5FUCA 4MHLA 1BUYA 2B91A 1ITIA 3LB6B 3G6DA 4DOHA 2IL6A 1RW5A 4ZW9A 4DKEA 3IRHA 2PSMA 3TGXB 2JA8D 1YKBA 1J7VL 2CFPA 4GS7A 1PV6A 4YBQA 3AYHA 1V7MV 3UEZE 2OQPA 2B8YA 1HIKA 3G9VB 1KF9A 4NN6A 3SE3B 4IU9A 1Y14A 4GC0A 1RFBA 1NBPA 2B8ZA 4W6VA 4A3KD 4A3BD 3B5KA 1BP3A 3UX9A 4IKXA 1IL6A 4A3MD 1HWHA 5D58A 1M48A 2R7ZD 2LAGA 3I4ND 2Q14A 5C4XD 3UF5A 4PYPA 4IKWA 3INKC 4XNIA 2XUTA 3N06A 5D22A 2CFQA 1VLKA 5GXBA 2VUMD 3EJJA 3QB1A 4YPGC 4BBRD 1D9GA 1I1RB 1RCBA 2GMFA 2Q98A 3WDOA 4Q65A 4XNJA 1FYHA 3H0GD 4FA8E 2R92D 4TPHA 5IYDD 1AXIA 3NCEA 4LDSA 2R93D 3O7PA 1ILKA 4LRLA 3NCBA 4EXNA 4BY7D 1ALUA 1EERA 2Q7NB 3SE4B 4DKCA 3HOVD 4O9HA 1BGCA 4Z5RD 3NCFA 2ERJD 3D85C 4BY1D 3O7QA 4IKYA 1Y6NL 3DLQI 1IJZA 1IARA 3D48P 5D71A 1GA3A 3HHRA 3I4MD 1HWGA 4IKVA 1CD9A 5C3ED 4YDYI 4U4VA 4GRWA 4ZYRA 1WCMD 1LK3A 5IP9D 5A2OA 2Y5YA 1Y6KL 2JA5D 1CSGA 5EQHA 3NCCA 4NI9A 3PO2D 3HOUD 3S9DA 4X51A 3N0PA 1WU3I 4YUEC 1N1FA 5C65A 1BGDA 1M4CA 4NEMA 2L3OA 1V7NV 4OAAA 1IRLA 3MZGA 4ZWBA 5EQIA 4NI7A 3UF2A 2C35A 2HYMB 4J4LC 1F6FA 4QIQA 3QT2C 3H3VE 1BCNA 1EXZA 4TPJA 4D2CA 5D6KA 4NKQC 2Z3QA 4UVMA 4WRLB 4IKZA 2O26A 2LMSA 4A3DD 3NPZA 2INTA 1EVSA 4YB9D 1PV7A 2O6IA 5IYBD 5LQBA 5TS9A 4DKDA 1JLIA 3DI2A 2L3YA 3VA2A 2E9WC 4ZS7A 4A3LD 3PIWA 3EW3A 3PO3D 1QVNA 1AX8A 4NEJA 5FHXA 1M4RA 4PS4A 1P9MB 1D9CA 4JREA 1IK0A 1HULA 4YQXA 4RS1A 5FLMD 5D72A 3HHCA 3L5WI 3HOZD 1RHGA 4A3JD 1CNT1 4APSA 5D59A 1INRA 4NN5A 4A3GD 3QWRB 4CNIC 4EXPA 4ZF7A 4LEPA 4JR9A 5D70A 4D2BA 1AU1A 3QB7A 1ITLA 1HZIA 1M47A 2B90A 3OG4A 1LKIA 3BPOA 2V8NA 2JA7D 1PVHB 1PW4A 5KNHI 3BPNA 3OG6A 4A3ID 1LQSL 1A22A 3PIVA 2CYKA 2B63D 2JA6D 4J05A 1M49A 5C7XA 1HGUA 5IYCD 2B5IA 3BESL 2XQBA 2ILKA 1B5LA 5EQGA 1PW6A 2D9QA 1PGRA 1EMRA 1FG9A 4A93D 5E4EA 2KZ1A 3HOWD
chains in the Genus database with same CATH topology
2B91A 3D87A 3NCFA 3QAZA 2ERJD 4Z5RD 4DKDA 1JLIA 3D85C 1ITIA 3LB6B 4BY1D 3G6DA 3DI2A 4DOHA 2IL6A 1RW5A 2L3YA 3VA2A 1Y6NL 4MHLA 2E9WC 4ZS7A 3DLQI 1EKUA 1IJZA 4DKEA 3IRHA 4A3LD 3HOXD 2PSMA 3PIWA 3TGXB 2JA8D 1IARA 4DKFA 3EW3A 1YKBA 3PO3D 1J7VL 1BGEA 3D48P 1QVNA 2B8XA 4GS7A 5D71A 1M4BA 5D28B 4BBSD 1GA3A 1AX8A 3HHRA 3AYHA 1V7MV 2D48A 3UEZE 2OQPA 4NEJA 5FHXA 2B8YA 3I4MD 1HWGA 4A3CD 1M4RA 1HIKA 1CD9A 3FKID 4PS4A 1P9MB 5C3ED 1D9CA 3G9VB 4YDYI 4GRWA 1KF9A 1IK0A 4NN6A 1HULA 4YQXA 1WCMD 4RS1A 3SE3B 5FLMD 1LK3A 5D72A 5IP9D 3HHCA 1Y14A 1RFBA 3L5XA 1NBPA 1Y6KL 2JA5D 1CSGA 3L5WI 2B8ZA 3NCCA 1ETEA 1RHGA 3HOZD 4A3JD 4A3KD 4BXXD 1CNT1 4A3BD 3B5KA 1BP3A 1HIJA 3UX9A 4NI9A 3HOYD 2O27A 3HOUD 3PO2D 3S9DA 1INRA 4X51A 5L6YC 4NN5A 4A3GD 3N0PA 1WU3I 1Y6ML 4YUEC 3QWRB 1IL6A 3BPLA 4CNIC 4A3MD 4EXPA 4ZF7A 1HWHA 1N1FA 1HUWA 3DUHC 5TS9A 1BGDA 1M48A 5D70A 2R7ZD 2LAGA 3I4ND 1M4CA 1PY2A 4NEMA 1SCFA 1AU1A 2Q14A 3QB7A 3WCYI 2L3OA 1V7NV 3UF5A 1IRLA 5C4XD 2B8UA 3MZGA 5IP7D 3INKC 4NI7A 3N06A 5D22A 3UF2A 3HOWD 2C35A 2HYMB 1ITLA 4I77Z 1HZIA 1M47A 1VLKA 2B90A 4J4LC 1F6FA 3OG4A 1GNCA 1LKIA 3LB6A 1F45B 3BPOA 2VUMD 3EJJA 3QB1A 4YPGC 4BBRD 1BBNA 1D9GA 1I1RB 1PVHB 2JA7D 4A3ED 1RCBA 3QT2C 1A7MA 1Y1VD 2GMFA 1ITFA 2Q98A 5KNHI 3BPNA 3H3VE 1BCNA 5C44D 3OG6A 4A3ID 3Q1SI 4NN7A 1LQSL 1A22A 1Z7CA 1EXZA 2H24A 3PIVA 1FYHA 2Z3RA 3H0GD 4FA8E 3DI3A 2R92D 2CYKA 3HMXB 4NKQC 2Z3QA 2B63D 5IYDD 1AXIA 3NCEA 4WRLB 3DGCL 2R93D 2JA6D 1ILKA 1M49A 1Z92A 4LRLA 2O26A 1HGUA 3NCBA 5C7XA 3OQ3A 1CYLA 4EXNA 5IYCD 2B5IA 3BESL 4BY7D 2XQBA 2LMSA 4A3DD 1ALUA 2ILKA 1B5LA 1EERA 1PW6A 2Q7NB 1ITMA 3SE4B 4DKCA 1CN4C 2INTA 3NPZA 1Y1WD 1EVSA 2D9QA 1M4AA 1PGRA 4A3FD 4O9HA 3HOVD 4O6KA 1EMRA 1FG9A 4A93D 5FUCA 5E4EA 2KZ1A 2O6IA 5IYBD 1BUYA 5LQBA 1BGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DI2 A;  3DI3 A; 
#chains in the Genus database with same CATH topology
 3D87 A;  3QAZ A;  4D2D A;  1EKU A;  3HOX D;  4DKF A;  1BGE A;  2B8X A;  1M4B A;  5D28 B;  4BBS D;  2D48 A;  4A3C D;  4JA3 A;  3FKI D;  3L5X A;  4IU8 A;  1ETE A;  4GBZ A;  4BXX D;  1HIJ A;  5A2N A;  3HOY D;  4U4W A;  2O27 A;  5L6Y C;  1Y6M L;  3BPL A;  1HUW A;  3DUH C;  1PY2 A;  1SCF A;  4TPG A;  3WCY I;  2B8U A;  5IP7 D;  4I77 Z;  1GNC A;  3LB6 A;  1F45 B;  1BBN A;  4A3E D;  1A7M A;  1Y1V D;  4U4T A;  1ITF A;  5C44 D;  3Q1S I;  4NN7 A;  1Z7C A;  2H24 A;  2Z3R A;  3DI3 A;  3HMX B;  3DGC L;  4OH3 A;  4ZWC A;  1Z92 A;  3OQ3 A;  1CYL A;  1ITM A;  1CN4 C;  1Y1W D;  4A3F D;  1M4A A;  4O6K A;  4GBY A;  5FUC A;  4MHL A;  1BUY A;  2B91 A;  1ITI A;  3LB6 B;  3G6D A;  4DOH A;  2IL6 A;  1RW5 A;  4ZW9 A;  4DKE A;  3IRH A;  2PSM A;  3TGX B;  2JA8 D;  1YKB A;  1J7V L;  2CFP A;  4GS7 A;  1PV6 A;  4YBQ A;  3AYH A;  1V7M V;  3UEZ E;  2OQP A;  2B8Y A;  1HIK A;  3G9V B;  1KF9 A;  4NN6 A;  3SE3 B;  4IU9 A;  1Y14 A;  4GC0 A;  1RFB A;  1NBP A;  2B8Z A;  4W6V A;  4A3K D;  4A3B D;  3B5K A;  1BP3 A;  3UX9 A;  4IKX A;  1IL6 A;  4A3M D;  1HWH A;  5D58 A;  1M48 A;  2R7Z D;  2LAG A;  3I4N D;  2Q14 A;  5C4X D;  3UF5 A;  4PYP A;  4IKW A;  3INK C;  4XNI A;  2XUT A;  3N06 A;  5D22 A;  2CFQ A;  1VLK A;  5GXB A;  2VUM D;  3EJJ A;  3QB1 A;  4YPG C;  4BBR D;  1D9G A;  1I1R B;  1RCB A;  2GMF A;  2Q98 A;  3WDO A;  4Q65 A;  4XNJ A;  1FYH A;  3H0G D;  4FA8 E;  2R92 D;  4TPH A;  5IYD D;  1AXI A;  3NCE A;  4LDS A;  2R93 D;  3O7P A;  1ILK A;  4LRL A;  3NCB A;  4EXN A;  4BY7 D;  1ALU A;  1EER A;  2Q7N B;  3SE4 B;  4DKC A;  3HOV D;  4O9H A;  1BGC A;  4Z5R D;  3NCF A;  2ERJ D;  3D85 C;  4BY1 D;  3O7Q A;  4IKY A;  1Y6N L;  3DLQ I;  1IJZ A;  1IAR A;  3D48 P;  5D71 A;  1GA3 A;  3HHR A;  3I4M D;  1HWG A;  4IKV A;  1CD9 A;  5C3E D;  4YDY I;  4U4V A;  4GRW A;  4ZYR A;  1WCM D;  1LK3 A;  5IP9 D;  5A2O A;  2Y5Y A;  1Y6K L;  2JA5 D;  1CSG A;  5EQH A;  3NCC A;  4NI9 A;  3PO2 D;  3HOU D;  3S9D A;  4X51 A;  3N0P A;  1WU3 I;  4YUE C;  1N1F A;  5C65 A;  1BGD A;  1M4C A;  4NEM A;  2L3O A;  1V7N V;  4OAA A;  1IRL A;  3MZG A;  4ZWB A;  5EQI A;  4NI7 A;  3UF2 A;  2C35 A;  2HYM B;  4J4L C;  1F6F A;  4QIQ A;  3QT2 C;  3H3V E;  1BCN A;  1EXZ A;  4TPJ A;  4D2C A;  5D6K A;  4NKQ C;  2Z3Q A;  4UVM A;  4WRL B;  4IKZ A;  2O26 A;  2LMS A;  4A3D D;  3NPZ A;  2INT A;  1EVS A;  4YB9 D;  1PV7 A;  2O6I A;  5IYB D;  5LQB A;  5TS9 A;  4DKD A;  1JLI A;  3DI2 A;  2L3Y A;  3VA2 A;  2E9W C;  4ZS7 A;  4A3L D;  3PIW A;  3EW3 A;  3PO3 D;  1QVN A;  1AX8 A;  4NEJ A;  5FHX A;  1M4R A;  4PS4 A;  1P9M B;  1D9C A;  4JRE A;  1IK0 A;  1HUL A;  4YQX A;  4RS1 A;  5FLM D;  5D72 A;  3HHC A;  3L5W I;  3HOZ D;  1RHG A;  4A3J D;  1CNT 1;  4APS A;  5D59 A;  1INR A;  4NN5 A;  4A3G D;  3QWR B;  4CNI C;  4EXP A;  4ZF7 A;  4LEP A;  4JR9 A;  5D70 A;  4D2B A;  1AU1 A;  3QB7 A;  1ITL A;  1HZI A;  1M47 A;  2B90 A;  3OG4 A;  1LKI A;  3BPO A;  2V8N A;  2JA7 D;  1PVH B;  1PW4 A;  5KNH I;  3BPN A;  3OG6 A;  4A3I D;  1LQS L;  1A22 A;  3PIV A;  2CYK A;  2B63 D;  2JA6 D;  4J05 A;  1M49 A;  5C7X A;  1HGU A;  5IYC D;  2B5I A;  3BES L;  2XQB A;  2ILK A;  1B5L A;  5EQG A;  1PW6 A;  2D9Q A;  1PGR A;  1EMR A;  1FG9 A;  4A93 D;  5E4E A;  2KZ1 A;  3HOW D; 
#chains in the Genus database with same CATH homology
 2B91 A;  3D87 A;  3NCF A;  3QAZ A;  2ERJ D;  4Z5R D;  4DKD A;  1JLI A;  3D85 C;  1ITI A;  3LB6 B;  4BY1 D;  3G6D A;  3DI2 A;  4DOH A;  2IL6 A;  1RW5 A;  2L3Y A;  3VA2 A;  1Y6N L;  4MHL A;  2E9W C;  4ZS7 A;  3DLQ I;  1EKU A;  1IJZ A;  4DKE A;  3IRH A;  4A3L D;  3HOX D;  2PSM A;  3PIW A;  3TGX B;  2JA8 D;  1IAR A;  4DKF A;  3EW3 A;  1YKB A;  3PO3 D;  1J7V L;  1BGE A;  3D48 P;  1QVN A;  2B8X A;  4GS7 A;  5D71 A;  1M4B A;  5D28 B;  4BBS D;  1GA3 A;  1AX8 A;  3HHR A;  3AYH A;  1V7M V;  2D48 A;  3UEZ E;  2OQP A;  4NEJ A;  5FHX A;  2B8Y A;  3I4M D;  1HWG A;  4A3C D;  1M4R A;  1HIK A;  1CD9 A;  3FKI D;  4PS4 A;  1P9M B;  5C3E D;  1D9C A;  3G9V B;  4YDY I;  4GRW A;  1KF9 A;  1IK0 A;  4NN6 A;  1HUL A;  4YQX A;  1WCM D;  4RS1 A;  3SE3 B;  5FLM D;  1LK3 A;  5D72 A;  5IP9 D;  3HHC A;  1Y14 A;  1RFB A;  3L5X A;  1NBP A;  1Y6K L;  2JA5 D;  1CSG A;  3L5W I;  2B8Z A;  3NCC A;  1ETE A;  1RHG A;  3HOZ D;  4A3J D;  4A3K D;  4BXX D;  1CNT 1;  4A3B D;  3B5K A;  1BP3 A;  1HIJ A;  3UX9 A;  4NI9 A;  3HOY D;  2O27 A;  3HOU D;  3PO2 D;  3S9D A;  1INR A;  4X51 A;  5L6Y C;  4NN5 A;  4A3G D;  3N0P A;  1WU3 I;  1Y6M L;  4YUE C;  3QWR B;  1IL6 A;  3BPL A;  4CNI C;  4A3M D;  4EXP A;  4ZF7 A;  1HWH A;  1N1F A;  1HUW A;  3DUH C;  5TS9 A;  1BGD A;  1M48 A;  5D70 A;  2R7Z D;  2LAG A;  3I4N D;  1M4C A;  1PY2 A;  4NEM A;  1SCF A;  1AU1 A;  2Q14 A;  3QB7 A;  3WCY I;  2L3O A;  1V7N V;  3UF5 A;  1IRL A;  5C4X D;  2B8U A;  3MZG A;  5IP7 D;  3INK C;  4NI7 A;  3N06 A;  5D22 A;  3UF2 A;  3HOW D;  2C35 A;  2HYM B;  1ITL A;  4I77 Z;  1HZI A;  1M47 A;  1VLK A;  2B90 A;  4J4L C;  1F6F A;  3OG4 A;  1GNC A;  1LKI A;  3LB6 A;  1F45 B;  3BPO A;  2VUM D;  3EJJ A;  3QB1 A;  4YPG C;  4BBR D;  1BBN A;  1D9G A;  1I1R B;  1PVH B;  2JA7 D;  4A3E D;  1RCB A;  3QT2 C;  1A7M A;  1Y1V D;  2GMF A;  1ITF A;  2Q98 A;  5KNH I;  3BPN A;  3H3V E;  1BCN A;  5C44 D;  3OG6 A;  4A3I D;  3Q1S I;  4NN7 A;  1LQS L;  1A22 A;  1Z7C A;  1EXZ A;  2H24 A;  3PIV A;  1FYH A;  2Z3R A;  3H0G D;  4FA8 E;  3DI3 A;  2R92 D;  2CYK A;  3HMX B;  4NKQ C;  2Z3Q A;  2B63 D;  5IYD D;  1AXI A;  3NCE A;  4WRL B;  3DGC L;  2R93 D;  2JA6 D;  1ILK A;  1M49 A;  1Z92 A;  4LRL A;  2O26 A;  1HGU A;  3NCB A;  5C7X A;  3OQ3 A;  1CYL A;  4EXN A;  5IYC D;  2B5I A;  3BES L;  4BY7 D;  2XQB A;  2LMS A;  4A3D D;  1ALU A;  2ILK A;  1B5L A;  1EER A;  1PW6 A;  2Q7N B;  1ITM A;  3SE4 B;  4DKC A;  1CN4 C;  2INT A;  3NPZ A;  1Y1W D;  1EVS A;  2D9Q A;  1M4A A;  1PGR A;  4A3F D;  4O9H A;  3HOV D;  4O6K A;  1EMR A;  1FG9 A;  4A93 D;  5FUC A;  5E4E A;  2KZ1 A;  2O6I A;  5IYB D;  1BUY A;  5LQB A;  1BGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...