3DI5A

Crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
150
structure length
150
Chain Sequence
MYQTIEGFLQSWTYETESTQKMLDVLTDESLSQEIAPGHWTLGRVAWHIVTAIPVILSGTGLKFEGETKDYPVPTSAKTIADGYRKVNTAFVEALQSEWTDKDLTTINDFFGRPMPNSIFLMTLINHQNHHRGQMTVLMRQAGLTVPGVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a DinB-like Protein (NP_980948.1) from BACILLUS CEREUS ATCC 10987 at 2.01 A resolution
rcsb
source organism Bacillus cereus atcc 10987
molecule tags Metal binding protein
molecule keywords DinB-like Protein
total genus 50
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 3di5A00
2NSFA 2F22A 2NSGA 3GORA 3DKAA 3DI5A 2YQYA 2OU6A 3CEXA 2RD9A 5COGA 1RXQA 5COFA 5CIVA 2P1AA 2QE9A 2OQMA 2HKVA 2QNLA 4N6CA 5COMA 3QTHA
chains in the Genus database with same CATH superfamily
1H9GA 3O39A 3GWLA 4YWQA 1XWJA 1NZEA 1JPNA 4XPXA 1SMYF 2H7OA 2V3CC 2GAQA 2LIGA 5FZTA 2R25A 3K66A 2ZXWC 3GEIA 4K7BA 2M64A 1ORYA 3K1IA 3L8JA 4MNDA 5EGYA 4XLPF 4CSAA 3RFYA 4BJ5A 3BEHA 1DOWA 1A7DA 2H7BA 4FWVA 4U9EA 1GM5A 1YYJA 2HZ8A 3G4XA 4PJLA 1NBBA 3N0TA 3B29A 4LDRA 5CIVA 3MX3A 3ECSA 1QKRA 1ZHZA 2PX0A 4GQHA 2KJGA 1ZYRF 4JW1A 4DBQA 1UG7A 3L1MA 1QLEC 4ULWA 1YVIA 2OQMA 2W9YA 4MW8A 1YDIA 2G3KA 2R02A 4JE9A 3RH3A 3W8IA 4EBKA 3UGOA 5TJ5E 2H7VC 3DXJF 4YJWA 4YT8A 2EPOA 3QTHA 3K1IC 2ZD9A 5T3WA 2XLVA 3WHNA 1EQ1A 1K40A 1L7CA 4JCZA 5DLJA 1OR3A 5BQIA 2GWWA 3ZSUA 4U5FE 2V26A 1G4WR 3RIPA 1EA8A 4I1MA 5L0JA 2VASA 2Y3HA 3U3FA 4NTAA 3X1OA 2HSBA 3KL4A 1WATA 3SNHA 1MNEA 4NY3A 5COGA 3U9JA 4G7HF 5IY5C 1RCPA 4CS8A 2B0JA 4ULVA 1SR2A 2W4MA 1SZIA 4YL3A 2Q3TA 2A6HF 2RSEB 3MYIA 2A1DD 1Q0KA 3T6BA 4BJ1A 4R32A 2Q9CA 3V5ZA 1JPJA 4OIPF 1YA9A 2UUHA 3LLIA 5KYWA 3R7CA 2ASRA 2J9WA 3EG9B 5E2QA 1LI5A 2Z15A 3Q7GA 2P7VA 4CS9A 2OOCA 3FAJA 3SYNA 2CNWA 2ZXPA 1GGQA 3IQ6A 3CZ6A 3V5YA 1TWAA 2IXPA 3HJCA 3FOOA 4BEMJ 1D0XA 4KBLA 3U2LA 1CPQA 1Q0MA 2X0CA 4E0IA 3CEXA 2RD9A 4CIHA 3U2MA 1KU2A 3O10A 1LPEA 1K04A 5L3QA 1VYKA 4U5CE 3RVZA 3L8IA 3RYLA 1Y6DA 4JJFA 2R9RB 4FX5A 1YARO 4JIOA 3KYJA 2R7UA 4G7OF 3B0UX 5KYXA 3IHUA 1Z63A 4C7OB 4IB4A 5F28E 1SF8A 3DE8A 3AG4C 3S0XA 4D4XA 4EHPA 1OXKA 3DZAA 3FOPA 2KQ9A 3JYYA 3OEOA 4OD5A 3ZC4A 4EIYA 2P0NA 4EUKB 5JVEA 5L0GA 1RMVA 1AUEA 2LFFA 2OG2A 2VC9A 2PBEA 1M2OA 3ABMC 3TOMA 1UFBA 1O87A 2J0XA 4JTDB 3LNRA 2BL2A 3SXYA 1CGNA 1K05A 2F22A 1FFHA 2YKZA 3GORA 2MHRA 5F5FA 5L0IA 4BJTA 1A7VA 2W45A 1OCCC 3EG9A 4JJGA 1NFNA 4LLEA 3JCUQ 4YT4A 1OQCA 4PJJA 2O9XA 3ABLC 3ATPA 3RQGA 1VOMA 1BR4A 1T01A 3HTKC 2CW0F 4RD9A 5COFA 4DBRA 3I5QA 1ZVZA 4G7ZF 2R7TA 3E9VA 3C8GA 2J46A 2DB4A 3EGDB 1APCA 4BJ5C 1FR0A 4AE4B 2NUTA 1OKKA 2DI3A 2J7PD 2QE9A 1KTMA 1T6UA 2UUIA 2Y3DA 4LACB 2HKVA 1NU9C 2EIJC 5KYUA 3NMIA 2J8WA 5A6KA 5BQHA 5K0IA 5E33A 3SXKA 4J7TA 2DGJA 4DVYP 5A6JA 3GANA 3U8PA 1J8YF 2EPLX 3DKAA 4J32B 4MVRA 3C8GD 3EHMA 4I1OB 4CJGA 1TWGA 1TFKB 2AVKA 4Q7CA 1L3PA 4I3MA 2HS5A 4CDYA 1IZMA 5AC5A 5JRAA 3PCVA 3ZDLA 4QI0A 2Y69C 4O79A 1VLTA 2Q4FA 4NC3A 3TJ5A 1IW7F 1Z23A 3WG7C 4NCQA 3FDQA 3M15A 3N24A 2X51A 4PACA 3O6XA 2A0BA 4JKVA 3JZ0A 4FAPB 3GM2A 2YL0A 2FFHA 1M2VA 2WL8A 1J8MF 3R2PA 2CYDA 4YL1A 4C3BA 1NSGB 1QQ3A 1E84A 3V7OA 2HJMA 1H9TA 3AG1C 4P9FA 3RQEA 3EFOB 4C3DA 1BBHA 3KH2A 4PFOA 3LUTB 2R7VA 2EPMX 3LNMB 2XLHA 1D0ZA 4IRUA 1MMDA 3EGXA 1JMWA 5F5HA 1RXQA 4Z9JA 4CDAA 4OIRF 3A11A 4FESA 3US6A 2WZLA 2VH3A 4ONSA 4MTFA 2XLMA 2NUPA 1MQVA 1V4AA 3MYFA 5D91A 2YL7A 4XWJA 2ETSA 1FMWA 1HMDA 4MVZA 4XPYA 2JD3A 5E3CA 2NUTB 3JTLO 3LEOA 5A6BA 1GS9A 1JRAA 3ZQYA 1JR8A 3M79A 1ZW2A 3NRHA 2XM0A 2PP4A 3HNKA 4ZLDA 3NDBB 1VYIA 3DAGA 3DD7A 1GQAA 4OIOF 1LKXA 1R4TA 5AGFA 1Z7Qc 1MMAA 4Z9HA 4WABA 4G78A 1HW2A 4KC9A 3UMKA 4Q5SF 1EKYA 1T6IA 2Y39A 4MVMA 5BUOA 5A6AA 3DAFA 3HNJA 3MLGA 3NYMA 5CI8A 4W8PA 5JT4A 1OXBA 2HMQA 3RF3A 4AK9A 3T4RA 4LERA 4JC7A 3SP1A 4I44A 2WZFA 4BPMA 1QZXA 1ST6A 2XS8A 2LD6A 2YVKA 3HLZA 3SXZA 5EK0A 5JSLA 5COMA 1Q0FA 1LS4A 2A68F 3JSEO 4GEHA 3ZTZA 2IBFA 3K7DA 4P9TA 2KC3A 2XL6A 3W4YA 2EPNA 2KNHA 5T1DB 4EWCA 2Q00A 1D1BA 1V74B 2NPUA 4L6RA 4CJOA 4MQ9F 5JUAA 4DOZA 3CQZA 4LDKA 2JX0A 1XZPA 1FFTC 1YZAA 2EPKX 5CI9A 1O3UA 4E17A 4Z9IA 2J45A 4M63A 4DXWA 2L7AA 2R7OA 4PJMA 1KNYA 2BE5F 2IXMA 1T5OA 3VRCA 1MMNA 1VLSA 2DYRC 4GYTA 3W8HA 2L81A 2Y3BA 5L0CA 4QI2A 3T6JA 1HE1A 3GM1A 3S28A 3TQOA 2LSEA 3G4ZA 3T6GB 3NYLA 2R05A 4RBNA 2OJQA 4YT5A 2PNOA 3C7JA 3VM6A 1C17M 5DS6A 3C8ZA 3ZG1A 3U8VA 1ZHTA 5B3SC 2ICWG 3OA1A 1A0BA 1I5NA 2CDQA 2G62A 3AOUA 4CS8C 3MBGA 4WGYA 3ZWIA 5KYWB 1LIHA 4ANJA 5JLIA 1G4US 4BG0A 3WODF 2TMVP 2QUPA 2R7WA 4U5GA 2Q7RA 3UGPA 1MMGA 1ZZPA 3K33A 1R5ID 3LAYA 4IARA 4WGZA 1VTMP 2A69F 1YAUO 3W2WA 2NUPB 1U89A 5GPGB 2J9VA 3VYWA 1G8XA 1BR2A 2LCHA 1JAFA 1CGOA 2IM8A 4PFPA 2XLEA 4A2NB 2M4EA 2I15A 4IJJA 2NG1A 1DOVA 3L0IA 3NG1A 1V54C 4JTCB 2HV7A 4ZLCA 2P6VA 3IQCA 3EQLF 2J9UA 1OR2A 3MFNA 1OW8A 2LFDA 2PF4E 2ZPAA 1WGWA 2Q9AA 4XPWA 2OCCC 2VCCA 3IQ5A 5E3AA 4U9DA 1U6HA 2EIMC 4C7OA 4DRHB 2XXAB 3FMSA 1ZW3A 2EILC 1RKCA 3LLKA 1HMOA 3LS1A 3ITFA 5A69A 5KYNA 3AJMA 3ZQVA 1T9KA 2NSGA 2PFDA 4DJ9A 1TR2A 5A6BD 2KYHA 1QPUA 3GODA 3Q6MA 1WASA 3DM9B 3DI5A 3GWNA 4CS9C 4EBBA 3EGDA 3M4BA 2JPUA 1HE9A 4YN0B 4D4NA 5AC4A 2KGOA 3NYJA 1LI7A 1ZHYA 2OJED 2LQGA 3DMDA 2YLGA 3FVYA 4IWBA 4BJ6C 4KNWA 4CBEA 3AG3C 2KSFA 4K0DA 5JS5A 1S7ZA 1N1CA 2YLDA 4LDQA 2IYLD 1E83A 2YWAA 3PHF2 4JZAA 5KYYB 2CGEA 3HNIA 1SYQA 1ZHWA 3QVZA 3AQCA 3C8GB 4A4AA 1JOGA 1HW1A 4IGGA 4E7ZA 3TK0A 3B0PA 3CSKA 2YZSA 3C18A 2HMZA 2NSFA 3AGUA 2WVNA 4JURI 4XLNF 4EKWA 5B3IA 3ASOC 2C04A 4NTBA 5BQGA 2R03A 2KW3C 4JTAB 2IXNA 4DVZA 1V55C 2EIKC 3I5PA 4BJ6A 1Q0DA 2HFIA 2XS1A 4MTOA 4U5HA 5DS4A 1Z3IX 3K6BA 1PD1A 2XLWA 4XQ1A 2MWQA 1A41A 5D92A 5KYUB 3C63A 5HSWA 4C3EA 2CCYA 2FGYA 4YK5A 2YL3A 3I4UA 1AVOB 3B9QA 3TOLA 3ZTMA 4PK4A 3UMIA 1RKEB 2XL4A 2AWCA 2QNLA 1G5ZA 2CNWD 1LE4A 3EH1A 3WAQA 4HE8D 1E86A 2A0UA 3S90A 3LS0A 1TWHA 2QY9A 3ASNC 4MW3A 4JCHA 2YRFA 3G50A 4XEVA 3QVYA 1AEPA 3M1CB 4JEBA 4W8KA 3TJ6A 3L34A 2ZXOA 3SZRA 1Z5ZA 3KKBA 4MVOA 3S29A 4WJ0A 4K1OA 1S05A 2VB6A 1VMAA 2W4BA 2I8BA 4N4WA 2YEVA 1OW6A 4XEKA 4HFFB 1TQGA 1ORSC 3F46A 3QZCA 3GM3A 5DQZA 4XTKA 2WZGA 4OIQF 1PD0A 4CX9A 3DM5A 4H4KC 3O55A 3AGTA 2OKUA 2PX3A 1Z6AA 3EGXB 2J0WA 5DS5A 4O6NA 2XM4A 5JP7A 2R7XA 1NFOA 3VF0A 4YT2A 3KPHA 2VCAA 1VB5A 256BA 2R7QA 3EFOA 2XLOA 5L0HA 2AWYA 2D4UA 1D1AA 3NKDA 3OWTA 4KNVA 1D1CA 1TKNA 2QTVA 4RDAA 3DJNB 4CSAC 5B1BC 1CPRA 1YA7O 1CGME 3K1HA 2WB7A 5EHHA 5FCLA 1FNTc 1NG1A 3U5SA 3EZIA 4CS7A 1LM3B 2E87A 4OD4A 4DRIB 3RKOF 1OCRC 4U5EE 2XL8A 3EH2A 3IQTA 3T9OA 2GFHA 3AQBA 3CAXA 2FAPB 2KK1A 2XSEA 1XZQA 4NQFA 4F4BA 4IAOA 4JEAA 4KI2A 4PR9A 3RW0A 1WOLA 1LS1A 2L6FA 3EHNA 3JRMO 5T3TA 3Q7LA 1WN0A 1ZU5A 3FAPB 5B1AC 1FTSA 2VCBA 3KMIA 1RJ9A 4YL0A 2HJ3A 3M4CA 1FMVA 2L6HA 1ORJA 4B6IA 5KYXB 1OW7A 3BRJA 4AE4A 1M56C 3U3BA 3U9MA 3JRTA 1RKEA 3KYIA 1BZ4A 3GEHA 3X2QC 1OCZC 3JT1A 1PV3A 1YYXA 1LE2A 4NTFA 1H6GA 2YHSA 3ZIBA 1YJGA 3DJUB 5DQTA 2QLAA 1PCXA 4LLCA 4U5BE 4U5DE 2OU6A 1QVXA 3A9CA 3EZHA 3V5XA 2R7SA 2GDCA 3HKKA 3EJNA 4DRJB 4HFKB 4UDVA 1OCOC 1F1MA 1D0YA 2WVQA 1FAPB 2D5RB 2J9BA 2WVOA 4H54A 4AX2A 3ABKC 5L3VA 3ZVRA 2EINC 1VK5A 3HNLA 3QW0A 4MVSA 4EBJA 3UMHA 2OEXA 4JVSA 4MVQA 3C62A 1M6TA 1Y4CA 1E85A 3U0CA 3B0VC 1QSPA 4O6YA 2HUJA 2L9JA 3NKEA 2H8AA 3SEOA 3IEEA 1I4YA 2DYSC 1WTYA 3H65A 3QMKA 3QW1A 1WWPA 3RQFA 4IAQA 1Q0GA 2AU5A 4N06A 4X0RA 4O7GA 4QDLA 4BEJA 4CIPA 1E2XA 2HV6A 4AL0A 4P6IC 2IXOA 1NLXA 3UR3C 3NMJA 4Q4ZF 2XXAA 3GEEA 3Q6NA 4JRZA 4N6HA 4O6MA 2Q9BA 3DE9A 1C02A 1H7IA 3LESA 4E0HA 1ZU4A 2GA0A 1RJ9B 1MNDA 4OINF 3FHDA 1O5HA 3NMKA 5L0DA 3UNGC 3JYHA 3S84A 2R7RA 3PMRA 5L0FA 3J06A 2P61A 4E7SA 1BR1A 4XEFA 1I4ZA 2Y3GA 1W2WA 3H2UA 4N6CA 4ER9A 1OKKD 4MTGA 4CDVA 4J7YA 3LEVA 2AP3A 1TFOB 2J7PA 2C03A 3H2VA 1TWCA 4MVUA 1C03A 3S27A 2B0HA 2XLDA 1EI7A 1NU7D 3AG2C 3LJBA 3JSZA 2LK4A 5KYYA 3B71A 2HSQA 3FXHA 1BDJB 1M2VB 1A7EA 3F47A 3N2ZB 2YQYA 4PJNA 2L6GA 5HV9A 5DVWA 3PDMP 1T6QA 3VAYA 3W2VA 1M57C 3EPVA 3S9OA 1YLMA 1YZCA 4G0HA 1B68A 4MS2A 2IOQA 3E70C 4E18A 2G3VA 3RVYA 3POVA 3TD7A 2YLIA 2MYSA 2XRHA 2P1AA 2YL1A 3DWWA 2OEVA 1LVKA 4J30B 1HY5A 2A6EF 3SXMA 1ZHXA 2LP4A 2BC5A 4AL1A 1U0BB 4HEAJ 2ZXRA 3TULA 3IPMO
chains in the Genus database with same CATH topology
2NSFA 2F22A 2NSGA 3GORA 3DKAA 3DI5A 2YQYA 2OU6A 3CEXA 2RD9A 5COGA 1RXQA 5COFA 5CIVA 2P1AA 2QE9A 2OQMA 2HKVA 2QNLA 4N6CA 5COMA 3QTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NSF A;  2F22 A;  2NSG A;  3GOR A;  3DKA A;  3DI5 A;  2YQY A;  2OU6 A;  3CEX A;  2RD9 A;  5COG A;  1RXQ A;  5COF A;  5CIV A;  2P1A A;  2QE9 A;  2OQM A;  2HKV A;  2QNL A;  4N6C A;  5COM A;  3QTH A; 
#chains in the Genus database with same CATH topology
 1H9G A;  3O39 A;  3GWL A;  4YWQ A;  1XWJ A;  1NZE A;  1JPN A;  4XPX A;  1SMY F;  2H7O A;  2V3C C;  2GAQ A;  2LIG A;  5FZT A;  2R25 A;  3K66 A;  2ZXW C;  3GEI A;  4K7B A;  2M64 A;  1ORY A;  3K1I A;  3L8J A;  4MND A;  5EGY A;  4XLP F;  4CSA A;  3RFY A;  4BJ5 A;  3BEH A;  1DOW A;  1A7D A;  2H7B A;  4FWV A;  4U9E A;  1GM5 A;  1YYJ A;  2HZ8 A;  3G4X A;  4PJL A;  1NBB A;  3N0T A;  3B29 A;  4LDR A;  5CIV A;  3MX3 A;  3ECS A;  1QKR A;  1ZHZ A;  2PX0 A;  4GQH A;  2KJG A;  1ZYR F;  4JW1 A;  4DBQ A;  1UG7 A;  3L1M A;  1QLE C;  4ULW A;  1YVI A;  2OQM A;  2W9Y A;  4MW8 A;  1YDI A;  2G3K A;  2R02 A;  4JE9 A;  3RH3 A;  3W8I A;  4EBK A;  3UGO A;  5TJ5 E;  2H7V C;  3DXJ F;  4YJW A;  4YT8 A;  2EPO A;  3QTH A;  3K1I C;  2ZD9 A;  5T3W A;  2XLV A;  3WHN A;  1EQ1 A;  1K40 A;  1L7C A;  4JCZ A;  5DLJ A;  1OR3 A;  5BQI A;  2GWW A;  3ZSU A;  4U5F E;  2V26 A;  1G4W R;  3RIP A;  1EA8 A;  4I1M A;  5L0J A;  2VAS A;  2Y3H A;  3U3F A;  4NTA A;  3X1O A;  2HSB A;  3KL4 A;  1WAT A;  3SNH A;  1MNE A;  4NY3 A;  5COG A;  3U9J A;  4G7H F;  5IY5 C;  1RCP A;  4CS8 A;  2B0J A;  4ULV A;  1SR2 A;  2W4M A;  1SZI A;  4YL3 A;  2Q3T A;  2A6H F;  2RSE B;  3MYI A;  2A1D D;  1Q0K A;  3T6B A;  4BJ1 A;  4R32 A;  2Q9C A;  3V5Z A;  1JPJ A;  4OIP F;  1YA9 A;  2UUH A;  3LLI A;  5KYW A;  3R7C A;  2ASR A;  2J9W A;  3EG9 B;  5E2Q A;  1LI5 A;  2Z15 A;  3Q7G A;  2P7V A;  4CS9 A;  2OOC A;  3FAJ A;  3SYN A;  2CNW A;  2ZXP A;  1GGQ A;  3IQ6 A;  3CZ6 A;  3V5Y A;  1TWA A;  2IXP A;  3HJC A;  3FOO A;  4BEM J;  1D0X A;  4KBL A;  3U2L A;  1CPQ A;  1Q0M A;  2X0C A;  4E0I A;  3CEX A;  2RD9 A;  4CIH A;  3U2M A;  1KU2 A;  3O10 A;  1LPE A;  1K04 A;  5L3Q A;  1VYK A;  4U5C E;  3RVZ A;  3L8I A;  3RYL A;  1Y6D A;  4JJF A;  2R9R B;  4FX5 A;  1YAR O;  4JIO A;  3KYJ A;  2R7U A;  4G7O F;  3B0U X;  5KYX A;  3IHU A;  1Z63 A;  4C7O B;  4IB4 A;  5F28 E;  1SF8 A;  3DE8 A;  3AG4 C;  3S0X A;  4D4X A;  4EHP A;  1OXK A;  3DZA A;  3FOP A;  2KQ9 A;  3JYY A;  3OEO A;  4OD5 A;  3ZC4 A;  4EIY A;  2P0N A;  4EUK B;  5JVE A;  5L0G A;  1RMV A;  1AUE A;  2LFF A;  2OG2 A;  2VC9 A;  2PBE A;  1M2O A;  3ABM C;  3TOM A;  1UFB A;  1O87 A;  2J0X A;  4JTD B;  3LNR A;  2BL2 A;  3SXY A;  1CGN A;  1K05 A;  2F22 A;  1FFH A;  2YKZ A;  3GOR A;  2MHR A;  5F5F A;  5L0I A;  4BJT A;  1A7V A;  2W45 A;  1OCC C;  3EG9 A;  4JJG A;  1NFN A;  4LLE A;  3JCU Q;  4YT4 A;  1OQC A;  4PJJ A;  2O9X A;  3ABL C;  3ATP A;  3RQG A;  1VOM A;  1BR4 A;  1T01 A;  3HTK C;  2CW0 F;  4RD9 A;  5COF A;  4DBR A;  3I5Q A;  1ZVZ A;  4G7Z F;  2R7T A;  3E9V A;  3C8G A;  2J46 A;  2DB4 A;  3EGD B;  1APC A;  4BJ5 C;  1FR0 A;  4AE4 B;  2NUT A;  1OKK A;  2DI3 A;  2J7P D;  2QE9 A;  1KTM A;  1T6U A;  2UUI A;  2Y3D A;  4LAC B;  2HKV A;  1NU9 C;  2EIJ C;  5KYU A;  3NMI A;  2J8W A;  5A6K A;  5BQH A;  5K0I A;  5E33 A;  3SXK A;  4J7T A;  2DGJ A;  4DVY P;  5A6J A;  3GAN A;  3U8P A;  1J8Y F;  2EPL X;  3DKA A;  4J32 B;  4MVR A;  3C8G D;  3EHM A;  4I1O B;  4CJG A;  1TWG A;  1TFK B;  2AVK A;  4Q7C A;  1L3P A;  4I3M A;  2HS5 A;  4CDY A;  1IZM A;  5AC5 A;  5JRA A;  3PCV A;  3ZDL A;  4QI0 A;  2Y69 C;  4O79 A;  1VLT A;  2Q4F A;  4NC3 A;  3TJ5 A;  1IW7 F;  1Z23 A;  3WG7 C;  4NCQ A;  3FDQ A;  3M15 A;  3N24 A;  2X51 A;  4PAC A;  3O6X A;  2A0B A;  4JKV A;  3JZ0 A;  4FAP B;  3GM2 A;  2YL0 A;  2FFH A;  1M2V A;  2WL8 A;  1J8M F;  3R2P A;  2CYD A;  4YL1 A;  4C3B A;  1NSG B;  1QQ3 A;  1E84 A;  3V7O A;  2HJM A;  1H9T A;  3AG1 C;  4P9F A;  3RQE A;  3EFO B;  4C3D A;  1BBH A;  3KH2 A;  4PFO A;  3LUT B;  2R7V A;  2EPM X;  3LNM B;  2XLH A;  1D0Z A;  4IRU A;  1MMD A;  3EGX A;  1JMW A;  5F5H A;  1RXQ A;  4Z9J A;  4CDA A;  4OIR F;  3A11 A;  4FES A;  3US6 A;  2WZL A;  2VH3 A;  4ONS A;  4MTF A;  2XLM A;  2NUP A;  1MQV A;  1V4A A;  3MYF A;  5D91 A;  2YL7 A;  4XWJ A;  2ETS A;  1FMW A;  1HMD A;  4MVZ A;  4XPY A;  2JD3 A;  5E3C A;  2NUT B;  3JTL O;  3LEO A;  5A6B A;  1GS9 A;  1JRA A;  3ZQY A;  1JR8 A;  3M79 A;  1ZW2 A;  3NRH A;  2XM0 A;  2PP4 A;  3HNK A;  4ZLD A;  3NDB B;  1VYI A;  3DAG A;  3DD7 A;  1GQA A;  4OIO F;  1LKX A;  1R4T A;  5AGF A;  1Z7Q c;  1MMA A;  4Z9H A;  4WAB A;  4G78 A;  1HW2 A;  4KC9 A;  3UMK A;  4Q5S F;  1EKY A;  1T6I A;  2Y39 A;  4MVM A;  5BUO A;  5A6A A;  3DAF A;  3HNJ A;  3MLG A;  3NYM A;  5CI8 A;  4W8P A;  5JT4 A;  1OXB A;  2HMQ A;  3RF3 A;  4AK9 A;  3T4R A;  4LER A;  4JC7 A;  3SP1 A;  4I44 A;  2WZF A;  4BPM A;  1QZX A;  1ST6 A;  2XS8 A;  2LD6 A;  2YVK A;  3HLZ A;  3SXZ A;  5EK0 A;  5JSL A;  5COM A;  1Q0F A;  1LS4 A;  2A68 F;  3JSE O;  4GEH A;  3ZTZ A;  2IBF A;  3K7D A;  4P9T A;  2KC3 A;  2XL6 A;  3W4Y A;  2EPN A;  2KNH A;  5T1D B;  4EWC A;  2Q00 A;  1D1B A;  1V74 B;  2NPU A;  4L6R A;  4CJO A;  4MQ9 F;  5JUA A;  4DOZ A;  3CQZ A;  4LDK A;  2JX0 A;  1XZP A;  1FFT C;  1YZA A;  2EPK X;  5CI9 A;  1O3U A;  4E17 A;  4Z9I A;  2J45 A;  4M63 A;  4DXW A;  2L7A A;  2R7O A;  4PJM A;  1KNY A;  2BE5 F;  2IXM A;  1T5O A;  3VRC A;  1MMN A;  1VLS A;  2DYR C;  4GYT A;  3W8H A;  2L81 A;  2Y3B A;  5L0C A;  4QI2 A;  3T6J A;  1HE1 A;  3GM1 A;  3S28 A;  3TQO A;  2LSE A;  3G4Z A;  3T6G B;  3NYL A;  2R05 A;  4RBN A;  2OJQ A;  4YT5 A;  2PNO A;  3C7J A;  3VM6 A;  1C17 M;  5DS6 A;  3C8Z A;  3ZG1 A;  3U8V A;  1ZHT A;  5B3S C;  2ICW G;  3OA1 A;  1A0B A;  1I5N A;  2CDQ A;  2G62 A;  3AOU A;  4CS8 C;  3MBG A;  4WGY A;  3ZWI A;  5KYW B;  1LIH A;  4ANJ A;  5JLI A;  1G4U S;  4BG0 A;  3WOD F;  2TMV P;  2QUP A;  2R7W A;  4U5G A;  2Q7R A;  3UGP A;  1MMG A;  1ZZP A;  3K33 A;  1R5I D;  3LAY A;  4IAR A;  4WGZ A;  1VTM P;  2A69 F;  1YAU O;  3W2W A;  2NUP B;  1U89 A;  5GPG B;  2J9V A;  3VYW A;  1G8X A;  1BR2 A;  2LCH A;  1JAF A;  1CGO A;  2IM8 A;  4PFP A;  2XLE A;  4A2N B;  2M4E A;  2I15 A;  4IJJ A;  2NG1 A;  1DOV A;  3L0I A;  3NG1 A;  1V54 C;  4JTC B;  2HV7 A;  4ZLC A;  2P6V A;  3IQC A;  3EQL F;  2J9U A;  1OR2 A;  3MFN A;  1OW8 A;  2LFD A;  2PF4 E;  2ZPA A;  1WGW A;  2Q9A A;  4XPW A;  2OCC C;  2VCC A;  3IQ5 A;  5E3A A;  4U9D A;  1U6H A;  2EIM C;  4C7O A;  4DRH B;  2XXA B;  3FMS A;  1ZW3 A;  2EIL C;  1RKC A;  3LLK A;  1HMO A;  3LS1 A;  3ITF A;  5A69 A;  5KYN A;  3AJM A;  3ZQV A;  1T9K A;  2NSG A;  2PFD A;  4DJ9 A;  1TR2 A;  5A6B D;  2KYH A;  1QPU A;  3GOD A;  3Q6M A;  1WAS A;  3DM9 B;  3DI5 A;  3GWN A;  4CS9 C;  4EBB A;  3EGD A;  3M4B A;  2JPU A;  1HE9 A;  4YN0 B;  4D4N A;  5AC4 A;  2KGO A;  3NYJ A;  1LI7 A;  1ZHY A;  2OJE D;  2LQG A;  3DMD A;  2YLG A;  3FVY A;  4IWB A;  4BJ6 C;  4KNW A;  4CBE A;  3AG3 C;  2KSF A;  4K0D A;  5JS5 A;  1S7Z A;  1N1C A;  2YLD A;  4LDQ A;  2IYL D;  1E83 A;  2YWA A;  3PHF 2;  4JZA A;  5KYY B;  2CGE A;  3HNI A;  1SYQ A;  1ZHW A;  3QVZ A;  3AQC A;  3C8G B;  4A4A A;  1JOG A;  1HW1 A;  4IGG A;  4E7Z A;  3TK0 A;  3B0P A;  3CSK A;  2YZS A;  3C18 A;  2HMZ A;  2NSF A;  3AGU A;  2WVN A;  4JUR I;  4XLN F;  4EKW A;  5B3I A;  3ASO C;  2C04 A;  4NTB A;  5BQG A;  2R03 A;  2KW3 C;  4JTA B;  2IXN A;  4DVZ A;  1V55 C;  2EIK C;  3I5P A;  4BJ6 A;  1Q0D A;  2HFI A;  2XS1 A;  4MTO A;  4U5H A;  5DS4 A;  1Z3I X;  3K6B A;  1PD1 A;  2XLW A;  4XQ1 A;  2MWQ A;  1A41 A;  5D92 A;  5KYU B;  3C63 A;  5HSW A;  4C3E A;  2CCY A;  2FGY A;  4YK5 A;  2YL3 A;  3I4U A;  1AVO B;  3B9Q A;  3TOL A;  3ZTM A;  4PK4 A;  3UMI A;  1RKE B;  2XL4 A;  2AWC A;  2QNL A;  1G5Z A;  2CNW D;  1LE4 A;  3EH1 A;  3WAQ A;  4HE8 D;  1E86 A;  2A0U A;  3S90 A;  3LS0 A;  1TWH A;  2QY9 A;  3ASN C;  4MW3 A;  4JCH A;  2YRF A;  3G50 A;  4XEV A;  3QVY A;  1AEP A;  3M1C B;  4JEB A;  4W8K A;  3TJ6 A;  3L34 A;  2ZXO A;  3SZR A;  1Z5Z A;  3KKB A;  4MVO A;  3S29 A;  4WJ0 A;  4K1O A;  1S05 A;  2VB6 A;  1VMA A;  2W4B A;  2I8B A;  4N4W A;  2YEV A;  1OW6 A;  4XEK A;  4HFF B;  1TQG A;  1ORS C;  3F46 A;  3QZC A;  3GM3 A;  5DQZ A;  4XTK A;  2WZG A;  4OIQ F;  1PD0 A;  4CX9 A;  3DM5 A;  4H4K C;  3O55 A;  3AGT A;  2OKU A;  2PX3 A;  1Z6A A;  3EGX B;  2J0W A;  5DS5 A;  4O6N A;  2XM4 A;  5JP7 A;  2R7X A;  1NFO A;  3VF0 A;  4YT2 A;  3KPH A;  2VCA A;  1VB5 A;  256B A;  2R7Q A;  3EFO A;  2XLO A;  5L0H A;  2AWY A;  2D4U A;  1D1A A;  3NKD A;  3OWT A;  4KNV A;  1D1C A;  1TKN A;  2QTV A;  4RDA A;  3DJN B;  4CSA C;  5B1B C;  1CPR A;  1YA7 O;  1CGM E;  3K1H A;  2WB7 A;  5EHH A;  5FCL A;  1FNT c;  1NG1 A;  3U5S A;  3EZI A;  4CS7 A;  1LM3 B;  2E87 A;  4OD4 A;  4DRI B;  3RKO F;  1OCR C;  4U5E E;  2XL8 A;  3EH2 A;  3IQT A;  3T9O A;  2GFH A;  3AQB A;  3CAX A;  2FAP B;  2KK1 A;  2XSE A;  1XZQ A;  4NQF A;  4F4B A;  4IAO A;  4JEA A;  4KI2 A;  4PR9 A;  3RW0 A;  1WOL A;  1LS1 A;  2L6F A;  3EHN A;  3JRM O;  5T3T A;  3Q7L A;  1WN0 A;  1ZU5 A;  3FAP B;  5B1A C;  1FTS A;  2VCB A;  3KMI A;  1RJ9 A;  4YL0 A;  2HJ3 A;  3M4C A;  1FMV A;  2L6H A;  1ORJ A;  4B6I A;  5KYX B;  1OW7 A;  3BRJ A;  4AE4 A;  1M56 C;  3U3B A;  3U9M A;  3JRT A;  1RKE A;  3KYI A;  1BZ4 A;  3GEH A;  3X2Q C;  1OCZ C;  3JT1 A;  1PV3 A;  1YYX A;  1LE2 A;  4NTF A;  1H6G A;  2YHS A;  3ZIB A;  1YJG A;  3DJU B;  5DQT A;  2QLA A;  1PCX A;  4LLC A;  4U5B E;  4U5D E;  2OU6 A;  1QVX A;  3A9C A;  3EZH A;  3V5X A;  2R7S A;  2GDC A;  3HKK A;  3EJN A;  4DRJ B;  4HFK B;  4UDV A;  1OCO C;  1F1M A;  1D0Y A;  2WVQ A;  1FAP B;  2D5R B;  2J9B A;  2WVO A;  4H54 A;  4AX2 A;  3ABK C;  5L3V A;  3ZVR A;  2EIN C;  1VK5 A;  3HNL A;  3QW0 A;  4MVS A;  4EBJ A;  3UMH A;  2OEX A;  4JVS A;  4MVQ A;  3C62 A;  1M6T A;  1Y4C A;  1E85 A;  3U0C A;  3B0V C;  1QSP A;  4O6Y A;  2HUJ A;  2L9J A;  3NKE A;  2H8A A;  3SEO A;  3IEE A;  1I4Y A;  2DYS C;  1WTY A;  3H65 A;  3QMK A;  3QW1 A;  1WWP A;  3RQF A;  4IAQ A;  1Q0G A;  2AU5 A;  4N06 A;  4X0R A;  4O7G A;  4QDL A;  4BEJ A;  4CIP A;  1E2X A;  2HV6 A;  4AL0 A;  4P6I C;  2IXO A;  1NLX A;  3UR3 C;  3NMJ A;  4Q4Z F;  2XXA A;  3GEE A;  3Q6N A;  4JRZ A;  4N6H A;  4O6M A;  2Q9B A;  3DE9 A;  1C02 A;  1H7I A;  3LES A;  4E0H A;  1ZU4 A;  2GA0 A;  1RJ9 B;  1MND A;  4OIN F;  3FHD A;  1O5H A;  3NMK A;  5L0D A;  3UNG C;  3JYH A;  3S84 A;  2R7R A;  3PMR A;  5L0F A;  3J06 A;  2P61 A;  4E7S A;  1BR1 A;  4XEF A;  1I4Z A;  2Y3G A;  1W2W A;  3H2U A;  4N6C A;  4ER9 A;  1OKK D;  4MTG A;  4CDV A;  4J7Y A;  3LEV A;  2AP3 A;  1TFO B;  2J7P A;  2C03 A;  3H2V A;  1TWC A;  4MVU A;  1C03 A;  3S27 A;  2B0H A;  2XLD A;  1EI7 A;  1NU7 D;  3AG2 C;  3LJB A;  3JSZ A;  2LK4 A;  5KYY A;  3B71 A;  2HSQ A;  3FXH A;  1BDJ B;  1M2V B;  1A7E A;  3F47 A;  3N2Z B;  2YQY A;  4PJN A;  2L6G A;  5HV9 A;  5DVW A;  3PDM P;  1T6Q A;  3VAY A;  3W2V A;  1M57 C;  3EPV A;  3S9O A;  1YLM A;  1YZC A;  4G0H A;  1B68 A;  4MS2 A;  2IOQ A;  3E70 C;  4E18 A;  2G3V A;  3RVY A;  3POV A;  3TD7 A;  2YLI A;  2MYS A;  2XRH A;  2P1A A;  2YL1 A;  3DWW A;  2OEV A;  1LVK A;  4J30 B;  1HY5 A;  2A6E F;  3SXM A;  1ZHX A;  2LP4 A;  2BC5 A;  4AL1 A;  1U0B B;  4HEA J;  2ZXR A;  3TUL A;  3IPM O; 
#chains in the Genus database with same CATH homology
 2NSF A;  2F22 A;  2NSG A;  3GOR A;  3DKA A;  3DI5 A;  2YQY A;  2OU6 A;  3CEX A;  2RD9 A;  5COG A;  1RXQ A;  5COF A;  5CIV A;  2P1A A;  2QE9 A;  2OQM A;  2HKV A;  2QNL A;  4N6C A;  5COM A;  3QTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...