3DI5A

Crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
150
structure length
150
Chain Sequence
b'MYQTIEGFLQSWTYETESTQKMLDVLTDESLSQEIAPGHWTLGRVAWHIVTAIPVILSGTGLKFEGETKDYPVPTSAKTIADGYRKVNTAFVEALQSEWTDKDLTTINDFFGRPMPNSIFLMTLINHQNHHRGQMTVLMRQAGLTVPGVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DinB-like Protein
publication title Crystal structure of a DinB-like Protein (NP_980948.1) from BACILLUS CEREUS ATCC 10987 at 2.01 A resolution
rcsb
source organism Bacillus cereus atcc 10987
molecule tags Metal binding protein
total genus 50
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 3di5A00
2OU6A 2YQYA 5COFA 1RXQA 3QTHA 3DKAA 2P1AA 2QNLA 5COGA 5CIVA 2QE9A 2OQMA 4N6CA 5COMA 2NSGA 2NSFA 2RD9A 3GORA 3CEXA 2F22A 3DI5A 2HKVA
chains in the Genus database with same CATH superfamily
4MVQA 1C02A 3EFOB 3SEOA 2R02A 4MVOA 4KNWA 3NRHA 3IQCA 1FAPB 3EH1A 4JVSA 4KC9A 4U9EA 4DBQA 4MTFA 2L81A 4K7BA 4LDKA 3SP1A 2KK1A 1Q0DA 1G5ZA 1OW7A 1ORSC 1TR2A 2OJED 2DGJA 4O6MA 5B3IA 1YYXA 2PP4A 1ZYRF 4FWVA 3VF0A 4YT2A 2LCHA 2XSEA 3ZQVA 2L6FA 4PJLA 4E18A 1R4TA 1L3PA 2O9XA 1WWPA 3K7DA 4DRHB 1MNEA 3S0XA 2A1DD 3M1CB 2AWYA 2QUPA 1LI5A 2G62A 4JE9A 3U8PA 1U0BB 3AG3C 2LSEA 3TJ5A 1BDJB 3WG7C 5JT4A 3GWLA 4IJJA 3ZG1A 1OCCC 1NG1A 1C03A 3EH2A 2EPOA 3R2PA 2YLGA 1OQCA 1Z7Qc 2JX0A 3I5PA 1BR1A 4NQFA 2YLDA 4U5DE 1WOLA 1D0YA 1ORYA 2EINC 3EQLF 4H4KC 5L3VA 2A6EF 1JOGA 3NG1A 1GQAA 2PFDA 5L0IA 1PD0A 5KYXA 1NZEA 1JPNA 1DOVA 3JZ0A 4U5BE 4XPWA 3R7CA 4E7SA 5DQTA 3FOOA 1WN0A 3WHNA 3U0CA 2KNHA 3WAQA 1OR3A 3RKOF 4MTOA 1Y4CA 4K0DA 3W8IA 1EQ1A 3KYIA 3FXHA 4CSAC 1EKYA 4IGGA 1RKEB 2XS1A 4XLNF 3T4RA 3DE8A 4JZAA 4O7GA 2YKZA 4PJJA 2G3KA 4JTAB 1QLEC 4O6NA 4AE4A 3W2WA 2B0HA 3FAPB 3U3FA 5KYUA 2IYLD 1QSPA 3EGXA 3DJNB 4I1OB 2W9YA 4JKVA 4NY3A 5F28E 4AL0A 3LUTB 4LACB 2RSEB 1M6TA 1QZXA 3HKKA 1Q0FA 3E9VA 4N06A 2DYSC 1TWGA 2R7UA 1LIHA 2Q9BA 2J0WA 4OD4A 2W4BA 3SXYA 1AVOB 1OW8A 1T6QA 4EBBA 2KSFA 5IY5C 1LS4A 3MYFA 5E3CA 3RVZA 3M4BA 2LFDA 1YDIA 3ABMC 3GEEA 3K66A 3EHNA 3JSZA 1YAUO 4K1OA 2X0CA 3IQ6A 3BEHA 4IAOA 2KJGA 4JC7A 2JD3A 3TK0A 4C7OB 3ASOC 1YARO 3DI5A 4JJGA 5EK0A 1VYKA 2GA0A 3MLGA 3MYIA 3CAXA 4WGZA 1VYIA 3DMDA 1D1AA 1LKXA 1S05A 2QTVA 4C3DA 3DE9A 2NUTA 5L3QA 2NG1A 2J45A 2XLVA 4MW3A 5KYYA 2IXOA 1TFKB 1PV3A 1ZHZA 2J0XA 4CJOA 1M2VA 4P9TA 1A0BA 2PX3A 4NTFA 2GWWA 1EA8A 3Q6NA 3VYWA 3POVA 3KKBA 2OG2A 5JVEA 2OJQA 3JYHA 3S28A 3AGTA 2GAQA 4ULWA 1NU9C 3VRCA 4U5HA 1OKKA 1Q0GA 1OXKA 1Z23A 2J7PD 2P61A 4LDRA 5CIVA 4XWJA 5L0DA 4CS9A 1RKCA 4GQHA 3T9OA 3TJ6A 4FAPB 5K0IA 3JTLO 1E2XA 5KYWB 1XZPA 3RH3A 1L7CA 2HFIA 2P0NA 2XS8A 1SR2A 2BE5F 1APCA 3EG9A 1MMGA 3LS1A 5CI9A 2J9BA 2VCCA 5A6JA 3S84A 2ICWG 5D92A 1S7ZA 2G3VA 4DRJB 3SZRA 3B0PA 2OEVA 2Y39A 4Q4ZF 1JPJA 2VCAA 4Z9IA 2Q3TA 2WZGA 4JJFA 4LLCA 3L1MA 3GM1A 2ZPAA 3PDMP 3NMKA 4U5GA 3U9MA 3ZTZA 2X51A 4J7TA 5COGA 4CIPA 2D5RB 1OW6A 2YHSA 4C3BA 3C8GB 4U5EE 4N6CA 2A0UA 4PACA 5A6AA 3ATPA 1YVIA 2LP4A 2MHRA 2PBEA 3ECSA 3FDQA 4XTKA 3F46A 3N24A 4R32A 4MQ9F 1Z63A 4MVRA 3EJNA 4G7HF 1O5HA 4N6HA 3H2VA 4PJNA 1V74B 4YT8A 3LLKA 2R7SA 1M56C 2NUPB 3ABKC 3OA1A 3MX3A 1G4WR 1CGNA 2W4MA 2YL3A 3E70C 1ZU4A 2B0JA 2YL7A 3VM6A 4CX9A 3M15A 1QQ3A 2PNOA 2YQYA 3TOMA 4DOZA 4BJ6A 1HY5A 2ZD9A 4N4WA 3V7OA 1IZMA 3SXZA 3O55A 1T6IA 4J32B 4JW1A 3IHUA 3U3BA 3HNJA 3IEEA 5L0CA 5GPGB 2EIJC 2P6VA 2R7OA 3L0IA 1CGOA 1T01A 3QMKA 1GS9A 2R25A 1LPEA 2IBFA 3DZAA 4LERA 2WZFA 1SMYF 3W8HA 2E87A 2HMZA 1U6HA 4YT4A 3B0VC 5COMA 3RYLA 2EPNA 1HE9A 3DM5A 4XEFA 3L8JA 5FCLA 1BR4A 4UDVA 1RCPA 2P7VA 4BG0A 5TJ5E 2PX0A 4BJ1A 3KYJA 1KTMA 1Z6AA 2LD6A 1MNDA 5E3AA 2WVOA 1J8MF 3C7JA 4XLPF 3FHDA 5JRAA 2Q4FA 2Q9CA 2XL8A 4MTGA 1AEPA 3EGDA 3RF3A 2HV7A 5JS5A 1HMDA 1LI7A 3FOPA 3JYYA 2Y3DA 4JCZA 2GFHA 4FESA 1BZ4A 1RJ9A 2A68F 1LS1A 1Q0KA 1D0XA 2W45A 3Q7GA 2HSBA 1FFHA 1NU7D 3CQZA 3NYMA 4O79A 2C04A 4CS8C 2VH3A 3LEVA 1OKKD 1YLMA 3S29A 4EWCA 4CIHA 2IOQA 4JTCB 1A41A 1NLXA 4G0HA 1MQVA 3G50A 5T3WA 2ZXWC 3MBGA 3C8GD 1EI7A 3LAYA 4CS8A 4CBEA 3NMJA 2VB6A 1YZAA 5AGFA 2YWAA 4Z9JA 2WZLA 3H65A 1J8YF 1H7IA 2CGEA 4CSAA 3UGPA 3DAFA 4P9FA 3V5XA 1HW1A 1TWCA 2WL8A 2YLIA 1I5NA 2KYHA 3KL4A 3MFNA 3LNRA 2CNWD 1WATA 1DOWA 2LFFA 3JRMO 1U89A 5E2QA 5E33A 1NFNA 3UMKA 2R7VA 5JUAA 5B1BC 2L9JA 2WVQA 5KYXB 3AOUA 2KC3A 3N2ZB 2ETSA 3K33A 1E84A 4ONSA 4BJTA 2EILC 2XM0A 2I15A 3ZIBA 2AWCA 2KW3C 2Y3BA 1T6UA 1WASA 2JPUA 4OD5A 2HJMA 2OCCC 2C03A 5DS4A 1BBHA 1D0ZA 2I8BA 3C18A 3EZHA 3GORA 4HFFB 4XPYA 5F5HA 4I44A 3DAGA 3RW0A 5L0HA 1YYJA 4AE4B 1ZW3A 4CDYA 4C7OA 3GANA 4DXWA 4ZLDA 2Y69C 4E0HA 3DD7A 3EPVA 4HFKB 3EGXB 1A7DA 1I4ZA 2XXAA 4JCHA 2OU6A 3A11A 3ZSUA 3CSKA 5L0FA 3TULA 1K05A 1YA9A 2A69F 2HS5A 2IM8A 1V55C 1JMWA 1HMOA 1VTMP 1FMWA 4D4NA 3PHF2 2FFHA 4RDAA 1FTSA 2CCYA 1MMNA 3EZIA 4U9DA 1AUEA 1TKNA 1D1BA 4GEHA 3S9OA 4KBLA 2GDCA 2R7QA 1TWAA 1WGWA 4KI2A 3JCUQ 1E86A 2CDQA 5BQHA 1CPRA 1FMVA 3GODA 2IXNA 2EIMC 5JLIA 1BR2A 1Z5ZA 3EHMA 4O6YA 4W8KA 4BJ6C 3L8IA 2DI3A 4PFPA 3V5YA 4M63A 3GWNA 3U5SA 3GEHA 4D4XA 3B29A 2F22A 4HEAJ 1GGQA 3H2UA 4DBRA 3TOLA 2R7XA 2OEXA 2EIKC 3I5QA 4YT5A 2YL1A 5CI8A 1M57C 1Y6DA 1TQGA 2NUTB 2Y3GA 5EHHA 5KYYB 3QVZA 4Q7CA 3RQGA 4DVYP 3JT1A 1M2VB 3UMIA 3JSEO 5L0JA 1Z3IX 4OINF 1H9GA 2Q00A 2LIGA 1UFBA 4P6IC 1MMAA 3AQCA 4ANJA 2AU5A 2XLMA 1G8XA 2HV6A 1VLTA 3QW0A 5F5FA 1JRAA 2DYRC 3DJUB 3NKEA 3ZC4A 1A7VA 2ZXPA 4I3MA 4LDQA 3RFYA 256BA 1GM5A 3DXJF 3ZQYA 5A6BA 4HE8D 2H8AA 1H9TA 3IQTA 3EG9B 3WODF 3LNMB 3QZCA 3FVYA 3ITFA 2NUPA 1E83A 1ZHXA 1N1CA 2A6HF 2R7WA 1LM3B 1SZIA 3ABLC 3EFOA 1PCXA 1SF8A 1KNYA 4NTAA 4NCQA 4JURI 2L6GA 4YL3A 1ZW2A 5COFA 1O3UA 3NYLA 3HNIA 3X2QC 2DB4A 5KYNA 2Q7RA 1T5OA 2Q9AA 1LE4A 5D91A 3U8VA 3DM9B 2HSQA 4MS2A 4B6IA 3ASNC 1V54C 4QDLA 4BJ5C 2QE9A 3GM2A 3OWTA 5L0GA 4XQ1A 1NFOA 3QVYA 4X0RA 4Z9HA 3T6BA 2XL6A 4F4BA 5B3SC 4ZLCA 2EPLX 4WGYA 2EPKX 3SNHA 3SYNA 4CS7A 4OIPF 4JEAA 3UR3C 3CZ6A 1YJGA 3B71A 2XLHA 2V3CC 4G78A 2A0BA 2HUJA 2J46A 2OKUA 1A7EA 3NMIA 3BRJA 4YN0B 1TFOB 1LVKA 1ZHTA 4CDVA 3ZTMA 4MNDA 2HJ3A 4J30B 2VC9A 3TQOA 1NBBA 1LE2A 3VAYA 4JRZA 1IW7F 1H6GA 2D4UA 3FMSA 3KMIA 2Y3HA 1I4YA 2UUHA 3DWWA 4PR9A 3ZDLA 4Q5SF 1CGME 3G4XA 3HTKC 2J7PA 3UGOA 1FFTC 2ASRA 3SXMA 3RQFA 2YZSA 5DLJA 3U2LA 1CPQA 4IARA 4NC3A 1SYQA 5DVWA 1V4AA 2BL2A 3NKDA 3PMRA 3QW1A 4JTDB 3T6JA 1RKEA 1YZCA 1D1CA 1ST6A 1HW2A 2MWQA 4L6RA 4YK5A 3J06A 5EGYA 3M4CA 2HKVA 1T9KA 2IXMA 3HNLA 1XZQA 4U5CE 3EGDB 1HE1A 2YL0A 5JSLA 3X1OA 4IB4A 1F1MA 5BQGA 3ZVRA 5DS5A 4IAQA 2YEVA 3AQBA 4J7YA 1RJ9B 2M4EA 5BQIA 3Q7LA 2L6HA 1RXQA 2R7RA 3HLZA 3QTHA 2VASA 2XL4A 3LLIA 4W8PA 3G4ZA 4EBKA 4FX5A 4MVZA 4AX2A 1ORJA 3AG4C 4WABA 2OQMA 2LK4A 2QY9A 3S27A 2BC5A 4IWBA 1C17M 3UMHA 1KU2A 1ZHWA 4MVSA 2IXPA 2NPUA 2HZ8A 5A6BD 4KNVA 1ZZPA 1TWHA 4BEMJ 3HNKA 5T1DB 4U5FE 2V26A 5HV9A 2ZXOA 1ZU5A 2UUIA 1MMDA 3M79A 4JIOA 2XM4A 2R7TA 5KYUB 2MYSA 3NDBB 4E0IA 2Z15A 1OCOC 3IPMO 4XPXA 3GM3A 2R03A 3KH2A 3US6A 1VMAA 2KGOA 1QKRA 4BPMA 2KQ9A 1PD1A 3C8ZA 4CDAA 4A4AA 4E7ZA 4YJWA 3S90A 2WVNA 2P1AA 2M64A 2QNLA 3KPHA 4CJGA 2J8WA 2H7VC 5T3TA 5DS6A 1VK5A 3OEOA 5A6KA 3RIPA 1JAFA 1R5ID 2J9VA 4DVZA 2AP3A 3AG2C 2CYDA 3JRTA 1Q0MA 5KYWA 4OIRF 2CW0F 2H7OA 3LESA 3PCVA 4YL0A 2HMQA 3RVYA 2L7AA 1QVXA 4IRUA 3ZWIA 2XXAB 4A2NB 4MVUA 2TMVP 1W2WA 5DQZA 4PK4A 1XWJA 3K6BA 2XLDA 4YL1A 2XLWA 1YA7O 3V5ZA 1K40A 1M2OA 4QI0A 2VCBA 2R9RB 3DKAA 2XLOA 3UNGC 4CS9C 2AVKA 1OCRC 4AK9A 4JEBA 2J9WA 3Q6MA 1E85A 5B1AC 4G7OF 3IQ5A 4EHPA 3GEIA 5FZTA 2QLAA 3U2MA 4DRIB 3AGUA 3C8GA 4EBJA 3O6XA 1G4US 3B0UX 1WTYA 3B9QA 4LLEA 3U9JA 3K1IC 3O39A 2RD9A 3L34A 2XRHA 3RQEA 1VOMA 4AL1A 4C3EA 2YVKA 1ZHYA 3CEXA 4WJ0A 4XEKA 1VB5A 2J9UA 3K1HA 3K1IA 1B68A 3SXKA 3A9CA 3F47A 3TD7A 4RD9A 1FNTc 4OIQF 4H54A 1K04A 3AJMA 2CNWA 5A69A 1OCZC 3O10A 2YRFA 2OOCA 4XEVA 4BEJA 4YWQA 1QPUA 1VLSA 3C62A 1ZVZA 2PF4E 2ZXRA 3N0TA 4I1MA 4GYTA 2EPMX 3HJCA 3AG1C 1RMVA 4DJ9A 1JR8A 3NYJA 4MW8A 5JP7A 4MVMA 1OXBA 4RBNA 4OIOF 3LS0A 2FAPB 5AC4A 1O87A 1NSGB 4PJMA 4PFOA 3W4YA 3T6GB 4EIYA 2LQGA 2XLEA 3C63A 4EUKB 4ULVA 5AC5A 5BUOA 2NSGA 2NSFA 4E17A 4QI2A 2R05A 4G7ZF 4EKWA 3LEOA 3W2VA 4BJ5A 4ER9A 3LJBA 3FAJA 3I4UA 2WB7A 1FR0A 1UG7A 4NTBA 2FGYA 5HSWA 2H7BA 1OR2A
chains in the Genus database with same CATH topology
2OU6A 2YQYA 5COFA 1RXQA 3QTHA 3DKAA 2P1AA 2QNLA 5COGA 5CIVA 2QE9A 2OQMA 4N6CA 5COMA 2NSGA 2NSFA 2RD9A 3GORA 3CEXA 2F22A 3DI5A 2HKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OU6 A;  2YQY A;  5COF A;  1RXQ A;  3QTH A;  3DKA A;  2P1A A;  2QNL A;  5COG A;  5CIV A;  2QE9 A;  2OQM A;  4N6C A;  5COM A;  2NSG A;  2NSF A;  2RD9 A;  3GOR A;  3CEX A;  2F22 A;  3DI5 A;  2HKV A; 
#chains in the Genus database with same CATH topology
 4MVQ A;  1C02 A;  3EFO B;  3SEO A;  2R02 A;  4MVO A;  4KNW A;  3NRH A;  3IQC A;  1FAP B;  3EH1 A;  4JVS A;  4KC9 A;  4U9E A;  4DBQ A;  4MTF A;  2L81 A;  4K7B A;  4LDK A;  3SP1 A;  2KK1 A;  1Q0D A;  1G5Z A;  1OW7 A;  1ORS C;  1TR2 A;  2OJE D;  2DGJ A;  4O6M A;  5B3I A;  1YYX A;  2PP4 A;  1ZYR F;  4FWV A;  3VF0 A;  4YT2 A;  2LCH A;  2XSE A;  3ZQV A;  2L6F A;  4PJL A;  4E18 A;  1R4T A;  1L3P A;  2O9X A;  1WWP A;  3K7D A;  4DRH B;  1MNE A;  3S0X A;  2A1D D;  3M1C B;  2AWY A;  2QUP A;  1LI5 A;  2G62 A;  4JE9 A;  3U8P A;  1U0B B;  3AG3 C;  2LSE A;  3TJ5 A;  1BDJ B;  3WG7 C;  5JT4 A;  3GWL A;  4IJJ A;  3ZG1 A;  1OCC C;  1NG1 A;  1C03 A;  3EH2 A;  2EPO A;  3R2P A;  2YLG A;  1OQC A;  1Z7Q c;  2JX0 A;  3I5P A;  1BR1 A;  4NQF A;  2YLD A;  4U5D E;  1WOL A;  1D0Y A;  1ORY A;  2EIN C;  3EQL F;  4H4K C;  5L3V A;  2A6E F;  1JOG A;  3NG1 A;  1GQA A;  2PFD A;  5L0I A;  1PD0 A;  5KYX A;  1NZE A;  1JPN A;  1DOV A;  3JZ0 A;  4U5B E;  4XPW A;  3R7C A;  4E7S A;  5DQT A;  3FOO A;  1WN0 A;  3WHN A;  3U0C A;  2KNH A;  3WAQ A;  1OR3 A;  3RKO F;  4MTO A;  1Y4C A;  4K0D A;  3W8I A;  1EQ1 A;  3KYI A;  3FXH A;  4CSA C;  1EKY A;  4IGG A;  1RKE B;  2XS1 A;  4XLN F;  3T4R A;  3DE8 A;  4JZA A;  4O7G A;  2YKZ A;  4PJJ A;  2G3K A;  4JTA B;  1QLE C;  4O6N A;  4AE4 A;  3W2W A;  2B0H A;  3FAP B;  3U3F A;  5KYU A;  2IYL D;  1QSP A;  3EGX A;  3DJN B;  4I1O B;  2W9Y A;  4JKV A;  4NY3 A;  5F28 E;  4AL0 A;  3LUT B;  4LAC B;  2RSE B;  1M6T A;  1QZX A;  3HKK A;  1Q0F A;  3E9V A;  4N06 A;  2DYS C;  1TWG A;  2R7U A;  1LIH A;  2Q9B A;  2J0W A;  4OD4 A;  2W4B A;  3SXY A;  1AVO B;  1OW8 A;  1T6Q A;  4EBB A;  2KSF A;  5IY5 C;  1LS4 A;  3MYF A;  5E3C A;  3RVZ A;  3M4B A;  2LFD A;  1YDI A;  3ABM C;  3GEE A;  3K66 A;  3EHN A;  3JSZ A;  1YAU O;  4K1O A;  2X0C A;  3IQ6 A;  3BEH A;  4IAO A;  2KJG A;  4JC7 A;  2JD3 A;  3TK0 A;  4C7O B;  3ASO C;  1YAR O;  3DI5 A;  4JJG A;  5EK0 A;  1VYK A;  2GA0 A;  3MLG A;  3MYI A;  3CAX A;  4WGZ A;  1VYI A;  3DMD A;  1D1A A;  1LKX A;  1S05 A;  2QTV A;  4C3D A;  3DE9 A;  2NUT A;  5L3Q A;  2NG1 A;  2J45 A;  2XLV A;  4MW3 A;  5KYY A;  2IXO A;  1TFK B;  1PV3 A;  1ZHZ A;  2J0X A;  4CJO A;  1M2V A;  4P9T A;  1A0B A;  2PX3 A;  4NTF A;  2GWW A;  1EA8 A;  3Q6N A;  3VYW A;  3POV A;  3KKB A;  2OG2 A;  5JVE A;  2OJQ A;  3JYH A;  3S28 A;  3AGT A;  2GAQ A;  4ULW A;  1NU9 C;  3VRC A;  4U5H A;  1OKK A;  1Q0G A;  1OXK A;  1Z23 A;  2J7P D;  2P61 A;  4LDR A;  5CIV A;  4XWJ A;  5L0D A;  4CS9 A;  1RKC A;  4GQH A;  3T9O A;  3TJ6 A;  4FAP B;  5K0I A;  3JTL O;  1E2X A;  5KYW B;  1XZP A;  3RH3 A;  1L7C A;  2HFI A;  2P0N A;  2XS8 A;  1SR2 A;  2BE5 F;  1APC A;  3EG9 A;  1MMG A;  3LS1 A;  5CI9 A;  2J9B A;  2VCC A;  5A6J A;  3S84 A;  2ICW G;  5D92 A;  1S7Z A;  2G3V A;  4DRJ B;  3SZR A;  3B0P A;  2OEV A;  2Y39 A;  4Q4Z F;  1JPJ A;  2VCA A;  4Z9I A;  2Q3T A;  2WZG A;  4JJF A;  4LLC A;  3L1M A;  3GM1 A;  2ZPA A;  3PDM P;  3NMK A;  4U5G A;  3U9M A;  3ZTZ A;  2X51 A;  4J7T A;  5COG A;  4CIP A;  2D5R B;  1OW6 A;  2YHS A;  4C3B A;  3C8G B;  4U5E E;  4N6C A;  2A0U A;  4PAC A;  5A6A A;  3ATP A;  1YVI A;  2LP4 A;  2MHR A;  2PBE A;  3ECS A;  3FDQ A;  4XTK A;  3F46 A;  3N24 A;  4R32 A;  4MQ9 F;  1Z63 A;  4MVR A;  3EJN A;  4G7H F;  1O5H A;  4N6H A;  3H2V A;  4PJN A;  1V74 B;  4YT8 A;  3LLK A;  2R7S A;  1M56 C;  2NUP B;  3ABK C;  3OA1 A;  3MX3 A;  1G4W R;  1CGN A;  2W4M A;  2YL3 A;  3E70 C;  1ZU4 A;  2B0J A;  2YL7 A;  3VM6 A;  4CX9 A;  3M15 A;  1QQ3 A;  2PNO A;  2YQY A;  3TOM A;  4DOZ A;  4BJ6 A;  1HY5 A;  2ZD9 A;  4N4W A;  3V7O A;  1IZM A;  3SXZ A;  3O55 A;  1T6I A;  4J32 B;  4JW1 A;  3IHU A;  3U3B A;  3HNJ A;  3IEE A;  5L0C A;  5GPG B;  2EIJ C;  2P6V A;  2R7O A;  3L0I A;  1CGO A;  1T01 A;  3QMK A;  1GS9 A;  2R25 A;  1LPE A;  2IBF A;  3DZA A;  4LER A;  2WZF A;  1SMY F;  3W8H A;  2E87 A;  2HMZ A;  1U6H A;  4YT4 A;  3B0V C;  5COM A;  3RYL A;  2EPN A;  1HE9 A;  3DM5 A;  4XEF A;  3L8J A;  5FCL A;  1BR4 A;  4UDV A;  1RCP A;  2P7V A;  4BG0 A;  5TJ5 E;  2PX0 A;  4BJ1 A;  3KYJ A;  1KTM A;  1Z6A A;  2LD6 A;  1MND A;  5E3A A;  2WVO A;  1J8M F;  3C7J A;  4XLP F;  3FHD A;  5JRA A;  2Q4F A;  2Q9C A;  2XL8 A;  4MTG A;  1AEP A;  3EGD A;  3RF3 A;  2HV7 A;  5JS5 A;  1HMD A;  1LI7 A;  3FOP A;  3JYY A;  2Y3D A;  4JCZ A;  2GFH A;  4FES A;  1BZ4 A;  1RJ9 A;  2A68 F;  1LS1 A;  1Q0K A;  1D0X A;  2W45 A;  3Q7G A;  2HSB A;  1FFH A;  1NU7 D;  3CQZ A;  3NYM A;  4O79 A;  2C04 A;  4CS8 C;  2VH3 A;  3LEV A;  1OKK D;  1YLM A;  3S29 A;  4EWC A;  4CIH A;  2IOQ A;  4JTC B;  1A41 A;  1NLX A;  4G0H A;  1MQV A;  3G50 A;  5T3W A;  2ZXW C;  3MBG A;  3C8G D;  1EI7 A;  3LAY A;  4CS8 A;  4CBE A;  3NMJ A;  2VB6 A;  1YZA A;  5AGF A;  2YWA A;  4Z9J A;  2WZL A;  3H65 A;  1J8Y F;  1H7I A;  2CGE A;  4CSA A;  3UGP A;  3DAF A;  4P9F A;  3V5X A;  1HW1 A;  1TWC A;  2WL8 A;  2YLI A;  1I5N A;  2KYH A;  3KL4 A;  3MFN A;  3LNR A;  2CNW D;  1WAT A;  1DOW A;  2LFF A;  3JRM O;  1U89 A;  5E2Q A;  5E33 A;  1NFN A;  3UMK A;  2R7V A;  5JUA A;  5B1B C;  2L9J A;  2WVQ A;  5KYX B;  3AOU A;  2KC3 A;  3N2Z B;  2ETS A;  3K33 A;  1E84 A;  4ONS A;  4BJT A;  2EIL C;  2XM0 A;  2I15 A;  3ZIB A;  2AWC A;  2KW3 C;  2Y3B A;  1T6U A;  1WAS A;  2JPU A;  4OD5 A;  2HJM A;  2OCC C;  2C03 A;  5DS4 A;  1BBH A;  1D0Z A;  2I8B A;  3C18 A;  3EZH A;  3GOR A;  4HFF B;  4XPY A;  5F5H A;  4I44 A;  3DAG A;  3RW0 A;  5L0H A;  1YYJ A;  4AE4 B;  1ZW3 A;  4CDY A;  4C7O A;  3GAN A;  4DXW A;  4ZLD A;  2Y69 C;  4E0H A;  3DD7 A;  3EPV A;  4HFK B;  3EGX B;  1A7D A;  1I4Z A;  2XXA A;  4JCH A;  2OU6 A;  3A11 A;  3ZSU A;  3CSK A;  5L0F A;  3TUL A;  1K05 A;  1YA9 A;  2A69 F;  2HS5 A;  2IM8 A;  1V55 C;  1JMW A;  1HMO A;  1VTM P;  1FMW A;  4D4N A;  3PHF 2;  2FFH A;  4RDA A;  1FTS A;  2CCY A;  1MMN A;  3EZI A;  4U9D A;  1AUE A;  1TKN A;  1D1B A;  4GEH A;  3S9O A;  4KBL A;  2GDC A;  2R7Q A;  1TWA A;  1WGW A;  4KI2 A;  3JCU Q;  1E86 A;  2CDQ A;  5BQH A;  1CPR A;  1FMV A;  3GOD A;  2IXN A;  2EIM C;  5JLI A;  1BR2 A;  1Z5Z A;  3EHM A;  4O6Y A;  4W8K A;  4BJ6 C;  3L8I A;  2DI3 A;  4PFP A;  3V5Y A;  4M63 A;  3GWN A;  3U5S A;  3GEH A;  4D4X A;  3B29 A;  2F22 A;  4HEA J;  1GGQ A;  3H2U A;  4DBR A;  3TOL A;  2R7X A;  2OEX A;  2EIK C;  3I5Q A;  4YT5 A;  2YL1 A;  5CI8 A;  1M57 C;  1Y6D A;  1TQG A;  2NUT B;  2Y3G A;  5EHH A;  5KYY B;  3QVZ A;  4Q7C A;  3RQG A;  4DVY P;  3JT1 A;  1M2V B;  3UMI A;  3JSE O;  5L0J A;  1Z3I X;  4OIN F;  1H9G A;  2Q00 A;  2LIG A;  1UFB A;  4P6I C;  1MMA A;  3AQC A;  4ANJ A;  2AU5 A;  2XLM A;  1G8X A;  2HV6 A;  1VLT A;  3QW0 A;  5F5F A;  1JRA A;  2DYR C;  3DJU B;  3NKE A;  3ZC4 A;  1A7V A;  2ZXP A;  4I3M A;  4LDQ A;  3RFY A;  256B A;  1GM5 A;  3DXJ F;  3ZQY A;  5A6B A;  4HE8 D;  2H8A A;  1H9T A;  3IQT A;  3EG9 B;  3WOD F;  3LNM B;  3QZC A;  3FVY A;  3ITF A;  2NUP A;  1E83 A;  1ZHX A;  1N1C A;  2A6H F;  2R7W A;  1LM3 B;  1SZI A;  3ABL C;  3EFO A;  1PCX A;  1SF8 A;  1KNY A;  4NTA A;  4NCQ A;  4JUR I;  2L6G A;  4YL3 A;  1ZW2 A;  5COF A;  1O3U A;  3NYL A;  3HNI A;  3X2Q C;  2DB4 A;  5KYN A;  2Q7R A;  1T5O A;  2Q9A A;  1LE4 A;  5D91 A;  3U8V A;  3DM9 B;  2HSQ A;  4MS2 A;  4B6I A;  3ASN C;  1V54 C;  4QDL A;  4BJ5 C;  2QE9 A;  3GM2 A;  3OWT A;  5L0G A;  4XQ1 A;  1NFO A;  3QVY A;  4X0R A;  4Z9H A;  3T6B A;  2XL6 A;  4F4B A;  5B3S C;  4ZLC A;  2EPL X;  4WGY A;  2EPK X;  3SNH A;  3SYN A;  4CS7 A;  4OIP F;  4JEA A;  3UR3 C;  3CZ6 A;  1YJG A;  3B71 A;  2XLH A;  2V3C C;  4G78 A;  2A0B A;  2HUJ A;  2J46 A;  2OKU A;  1A7E A;  3NMI A;  3BRJ A;  4YN0 B;  1TFO B;  1LVK A;  1ZHT A;  4CDV A;  3ZTM A;  4MND A;  2HJ3 A;  4J30 B;  2VC9 A;  3TQO A;  1NBB A;  1LE2 A;  3VAY A;  4JRZ A;  1IW7 F;  1H6G A;  2D4U A;  3FMS A;  3KMI A;  2Y3H A;  1I4Y A;  2UUH A;  3DWW A;  4PR9 A;  3ZDL A;  4Q5S F;  1CGM E;  3G4X A;  3HTK C;  2J7P A;  3UGO A;  1FFT C;  2ASR A;  3SXM A;  3RQF A;  2YZS A;  5DLJ A;  3U2L A;  1CPQ A;  4IAR A;  4NC3 A;  1SYQ A;  5DVW A;  1V4A A;  2BL2 A;  3NKD A;  3PMR A;  3QW1 A;  4JTD B;  3T6J A;  1RKE A;  1YZC A;  1D1C A;  1ST6 A;  1HW2 A;  2MWQ A;  4L6R A;  4YK5 A;  3J06 A;  5EGY A;  3M4C A;  2HKV A;  1T9K A;  2IXM A;  3HNL A;  1XZQ A;  4U5C E;  3EGD B;  1HE1 A;  2YL0 A;  5JSL A;  3X1O A;  4IB4 A;  1F1M A;  5BQG A;  3ZVR A;  5DS5 A;  4IAQ A;  2YEV A;  3AQB A;  4J7Y A;  1RJ9 B;  2M4E A;  5BQI A;  3Q7L A;  2L6H A;  1RXQ A;  2R7R A;  3HLZ A;  3QTH A;  2VAS A;  2XL4 A;  3LLI A;  4W8P A;  3G4Z A;  4EBK A;  4FX5 A;  4MVZ A;  4AX2 A;  1ORJ A;  3AG4 C;  4WAB A;  2OQM A;  2LK4 A;  2QY9 A;  3S27 A;  2BC5 A;  4IWB A;  1C17 M;  3UMH A;  1KU2 A;  1ZHW A;  4MVS A;  2IXP A;  2NPU A;  2HZ8 A;  5A6B D;  4KNV A;  1ZZP A;  1TWH A;  4BEM J;  3HNK A;  5T1D B;  4U5F E;  2V26 A;  5HV9 A;  2ZXO A;  1ZU5 A;  2UUI A;  1MMD A;  3M79 A;  4JIO A;  2XM4 A;  2R7T A;  5KYU B;  2MYS A;  3NDB B;  4E0I A;  2Z15 A;  1OCO C;  3IPM O;  4XPX A;  3GM3 A;  2R03 A;  3KH2 A;  3US6 A;  1VMA A;  2KGO A;  1QKR A;  4BPM A;  2KQ9 A;  1PD1 A;  3C8Z A;  4CDA A;  4A4A A;  4E7Z A;  4YJW A;  3S90 A;  2WVN A;  2P1A A;  2M64 A;  2QNL A;  3KPH A;  4CJG A;  2J8W A;  2H7V C;  5T3T A;  5DS6 A;  1VK5 A;  3OEO A;  5A6K A;  3RIP A;  1JAF A;  1R5I D;  2J9V A;  4DVZ A;  2AP3 A;  3AG2 C;  2CYD A;  3JRT A;  1Q0M A;  5KYW A;  4OIR F;  2CW0 F;  2H7O A;  3LES A;  3PCV A;  4YL0 A;  2HMQ A;  3RVY A;  2L7A A;  1QVX A;  4IRU A;  3ZWI A;  2XXA B;  4A2N B;  4MVU A;  2TMV P;  1W2W A;  5DQZ A;  4PK4 A;  1XWJ A;  3K6B A;  2XLD A;  4YL1 A;  2XLW A;  1YA7 O;  3V5Z A;  1K40 A;  1M2O A;  4QI0 A;  2VCB A;  2R9R B;  3DKA A;  2XLO A;  3UNG C;  4CS9 C;  2AVK A;  1OCR C;  4AK9 A;  4JEB A;  2J9W A;  3Q6M A;  1E85 A;  5B1A C;  4G7O F;  3IQ5 A;  4EHP A;  3GEI A;  5FZT A;  2QLA A;  3U2M A;  4DRI B;  3AGU A;  3C8G A;  4EBJ A;  3O6X A;  1G4U S;  3B0U X;  1WTY A;  3B9Q A;  4LLE A;  3U9J A;  3K1I C;  3O39 A;  2RD9 A;  3L34 A;  2XRH A;  3RQE A;  1VOM A;  4AL1 A;  4C3E A;  2YVK A;  1ZHY A;  3CEX A;  4WJ0 A;  4XEK A;  1VB5 A;  2J9U A;  3K1H A;  3K1I A;  1B68 A;  3SXK A;  3A9C A;  3F47 A;  3TD7 A;  4RD9 A;  1FNT c;  4OIQ F;  4H54 A;  1K04 A;  3AJM A;  2CNW A;  5A69 A;  1OCZ C;  3O10 A;  2YRF A;  2OOC A;  4XEV A;  4BEJ A;  4YWQ A;  1QPU A;  1VLS A;  3C62 A;  1ZVZ A;  2PF4 E;  2ZXR A;  3N0T A;  4I1M A;  4GYT A;  2EPM X;  3HJC A;  3AG1 C;  1RMV A;  4DJ9 A;  1JR8 A;  3NYJ A;  4MW8 A;  5JP7 A;  4MVM A;  1OXB A;  4RBN A;  4OIO F;  3LS0 A;  2FAP B;  5AC4 A;  1O87 A;  1NSG B;  4PJM A;  4PFO A;  3W4Y A;  3T6G B;  4EIY A;  2LQG A;  2XLE A;  3C63 A;  4EUK B;  4ULV A;  5AC5 A;  5BUO A;  2NSG A;  2NSF A;  4E17 A;  4QI2 A;  2R05 A;  4G7Z F;  4EKW A;  3LEO A;  3W2V A;  4BJ5 A;  4ER9 A;  3LJB A;  3FAJ A;  3I4U A;  2WB7 A;  1FR0 A;  1UG7 A;  4NTB A;  2FGY A;  5HSW A;  2H7B A;  1OR2 A; 
#chains in the Genus database with same CATH homology
 2OU6 A;  2YQY A;  5COF A;  1RXQ A;  3QTH A;  3DKA A;  2P1A A;  2QNL A;  5COG A;  5CIV A;  2QE9 A;  2OQM A;  4N6C A;  5COM A;  2NSG A;  2NSF A;  2RD9 A;  3GOR A;  3CEX A;  2F22 A;  3DI5 A;  2HKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...