3DI5A

Crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
150
structure length
150
Chain Sequence
MYQTIEGFLQSWTYETESTQKMLDVLTDESLSQEIAPGHWTLGRVAWHIVTAIPVILSGTGLKFEGETKDYPVPTSAKTIADGYRKVNTAFVEALQSEWTDKDLTTINDFFGRPMPNSIFLMTLINHQNHHRGQMTVLMRQAGLTVPGVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DinB-like Protein
publication title Crystal structure of a DinB-like Protein (NP_980948.1) from BACILLUS CEREUS ATCC 10987 at 2.01 A resolution
rcsb
source organism Bacillus cereus atcc 10987
molecule tags Metal binding protein
total genus 50
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 3di5A00
3CEXA 2NSGA 5CIVA 3GORA 2YQYA 3DI5A 4N6CA 1RXQA 2OU6A 2P1AA 2OQMA 2QNLA 2HKVA 5COMA 5COFA 2NSFA 3QTHA 2QE9A 2RD9A 5COGA 3DKAA 2F22A
chains in the Genus database with same CATH superfamily
2R7UA 1TWGA 2XLOA 3KH2A 4O6YA 4PJMA 4U5CE 2H7BA 2VC9A 4MS2A 5JUAA 2EPOA 3GODA 2PBEA 2YQYA 2X51A 2UUHA 3JSEO 4U5DE 2KK1A 3K33A 4N6CA 3RQEA 2YHSA 3T9OA 2P7VA 2FFHA 4JKVA 4YL3A 4O79A 2KC3A 3B0PA 3GEHA 2R9RB 4W8KA 4L6RA 2V3CC 3US6A 3VRCA 3ABMC 4UDVA 4Z9IA 3EHNA 1MNDA 4KNVA 5E2QA 3TQOA 2QUPA 4IARA 1AVOB 1QZXA 1D1CA 2YLIA 3DJUB 2L7AA 2IXMA 2XXAB 4K1OA 4RD9A 2MYSA 4E7SA 3JT1A 4G7HF 4JW1A 3WAQA 4JTAB 2EIKC 1JPNA 3DE8A 3QW1A 3KMIA 4D4XA 2Q9CA 1FAPB 2C03A 5JS5A 4H4KC 4AE4B 1BR4A 4PFPA 3WG7C 3AGUA 1FMWA 1VLTA 2YVKA 1ZW3A 5KYXB 1FFHA 1YZAA 3O10A 1OCOC 4U9DA 5L0IA 4HFKB 1FNTc 2HKVA 1M2VB 2ZXOA 1OW7A 4YL1A 3U5SA 2IOQA 1V74B 3UMHA 1K04A 4EUKB 2UUIA 1VYIA 2G3KA 3NMIA 3ZVRA 1DOWA 1L7CA 3KL4A 4XQ1A 1HMOA 2AP3A 2Q4FA 1Z7Qc 1EQ1A 4OD5A 1HW1A 3LAYA 4U5EE 1G4US 3NKEA 2NUTB 3SXKA 1TR2A 1IW7F 2PX3A 2V26A 1Q0DA 3RW0A 1CGOA 1LE2A 4G7OF 1YA9A 1JOGA 3M4CA 4PR9A 2G62A 3QVZA 1OCCC 1ZVZA 3ZTZA 3Q7LA 1V55C 2EPKX 3B9QA 1E86A 3OA1A 4MTOA 5B1AC 1W2WA 1VOMA 2Q3TA 3LLIA 5L3QA 2GA0A 2YL0A 3Q6MA 4BG0A 2KQ9A 3GM1A 3RVZA 2LD6A 2R7XA 1QQ3A 2R02A 1T5OA 2BC5A 1O3UA 2FAPB 2P6VA 3FVYA 4OIRF 2BE5F 3M1CB 4NTFA 4QI2A 3TD7A 2XSEA 3RF3A 2WZGA 4N06A 3CEXA 1VYKA 4ZLDA 2JD3A 3RIPA 2RSEB 2XXAA 2J7PD 3JYHA 4OIPF 2YZSA 3C62A 4NCQA 1PD1A 1QVXA 1OW8A 2BL2A 2XL8A 3U8VA 5DQTA 3SXMA 1MMAA 1N1CA 3ZSUA 1OCRC 3Q6NA 2J9VA 2HV7A 1SF8A 5L3VA 4OD4A 3ZQYA 4U5FE 3L0IA 4RBNA 4XPXA 1EKYA 2VH3A 1YYXA 2LSEA 2GFHA 2HJMA 1BR2A 1TQGA 2Y3DA 3JCUQ 3K1IC 5BQGA 5KYWB 3PHF2 1ZU5A 1M6TA 5CI8A 3C8GB 2NSFA 3WODF 3LJBA 3A11A 4LDQA 4N6HA 3GANA 4EBJA 3N2ZB 5DS4A 4JRZA 1M2VA 4A2NB 3EHMA 5L0FA 1E83A 1SR2A 3DKAA 1U89A 3MYFA 2R7RA 4MVUA 4PACA 3UGPA 1AEPA 2A0BA 2LFFA 4WGZA 4XLNF 4YT8A 4JEBA 1A7DA 2O9XA 3EQLF 4YT4A 4MVRA 2CDQA 4JTDB 1K40A 2EINC 3JYYA 3ZG1A 3ASNC 4U5BE 3UMIA 4DVZA 2VASA 3C63A 4XEFA 2NUTA 2YEVA 2OKUA 5B1BC 4IRUA 3TJ5A 5L0DA 1D0YA 1PD0A 2XLDA 1LIHA 1PCXA 4I44A 3ZDLA 4CDAA 2GDCA 5KYUB 1OR2A 256BA 4CS9C 5COMA 1WWPA 5COFA 2Q00A 1C17M 3LEVA 3ABKC 1A0BA 3ASOC 3O6XA 4O7GA 3O55A 3EG9B 2QE9A 3DAFA 2WZFA 2W4BA 2OCCC 3M79A 4J32B 3DXJF 3FXHA 2B0JA 3IQ5A 4IJJA 3DAGA 4OIOF 1YARO 3SXYA 1C03A 1M2OA 1OKKA 4JJGA 2KNHA 4BEMJ 5CIVA 3H65A 3SP1A 3VAYA 4JC7A 1F1MA 1VK5A 3DD7A 5T3TA 5EK0A 1OW6A 2YRFA 1HE1A 2XM4A 1WATA 4KC9A 1I4YA 4EHPA 4J7YA 5IY5C 2P1AA 1CGNA 2W45A 2OOCA 4FWVA 1T6IA 2QNLA 2EILC 1NBBA 5AGFA 2OG2A 2R7QA 1HE9A 2ETSA 2EIMC 1MMGA 1MMNA 4XEKA 3S84A 3I5PA 3SNHA 4YT2A 1JR8A 4XTKA 3I5QA 4P9FA 3V5ZA 3EJNA 3LLKA 3ZQVA 1KU2A 1LVKA 1M56C 4O6MA 5KYWA 1R4TA 5F5HA 2HMQA 3J06A 2R7WA 1ORYA 3C8GA 5DS5A 1E84A 4JIOA 5DS6A 5L0CA 2J8WA 1D1AA 1BZ4A 2KJGA 3IHUA 2R7VA 1G4WR 1SMYF 2A1DD 1FMVA 2VCAA 4CS8A 3NDBB 1LI7A 5D91A 4YT5A 3GORA 1I5NA 2HFIA 4KBLA 2R7SA 3L8JA 2VCCA 4AK9A 4CJGA 1NLXA 1ZHXA 4JEAA 1HMDA 4KNWA 3W8IA 2OU6A 2C04A 2P0NA 4Q7CA 5JVEA 3DM9B 1ORJA 2NPUA 3AG2C 3AG3C 3H2UA 4J7TA 3UMKA 4AL1A 4C3EA 3AG1C 4XPYA 2VB6A 1GQAA 2HSBA 2IM8A 2I8BA 2YKZA 3DMDA 4JVSA 3LNRA 4P9TA 1WASA 1WGWA 5KYUA 3LNMB 4HEAJ 3RYLA 1WTYA 2J9BA 3KPHA 2AVKA 1FTSA 5E33A 3K1HA 2ZXWC 4BJ6A 1T01A 3ZTMA 1HW2A 1FFTC 1YVIA 3AJMA 1H7IA 1RCPA 3EG9A 1VB5A 2ZPAA 3L1MA 1JMWA 1Y4CA 2ASRA 4NTBA 4RDAA 2XL4A 1MNEA 2E87A 3EH1A 2L6FA 5JLIA 4CIHA 3HTKC 2LP4A 4Z9JA 3NYMA 4NQFA 1RXQA 4HFFB 4MTFA 1J8MF 4BPMA 2DYRC 3OEOA 4JJFA 3HNIA 3VF0A 4E7ZA 5KYYB 1BBHA 3LS0A 4IGGA 4LDKA 1Z3IX 3B0VC 3LESA 1ZYRF 3GM2A 1H9GA 2AWYA 3HJCA 1ZHZA 2GAQA 2WB7A 4XLPF 2TMVP 3U3FA 2CNWA 5DVWA 2CYDA 3CQZA 2PP4A 3JRTA 4YWQA 4Q5SF 4DBRA 2HSQA 4M63A 3ZIBA 5B3SC 5BUOA 2L9JA 2LCHA 4O6NA 2DYSC 3OWTA 1DOVA 3DZAA 3S0XA 5F5FA 3ITFA 4LLCA 4W8PA 1MQVA 1O5HA 1LKXA 3U0CA 2XLVA 3NKDA 3O39A 2VCBA 2CCYA 4G7ZF 4CDYA 4BJ5A 2XLEA 1VTMP 1K05A 1UG7A 2YL7A 3Q7GA 4QI0A 3T6BA 4A4AA 1V54C 3NMJA 3TJ6A 4IB4A 2AWCA 4I1MA 3V5YA 4CDVA 2PF4E 2XLMA 3T4RA 1B68A 3KYJA 4BEJA 3FOOA 3ATPA 1Z63A 5F28E 3POVA 3EZIA 1T6UA 2JPUA 3NMKA 1RJ9B 1WN0A 4U5HA 5AC5A 1SYQA 3QTHA 3GM3A 1LS4A 2EIJC 4I3MA 4LACB 5DQZA 3DJNB 3CAXA 3K7DA 1NFNA 1E85A 4GQHA 1Y6DA 3U9JA 1YLMA 3L8IA 1IZMA 3ABLC 2F22A 1SZIA 1ORSC 4OIQF 4E18A 1RKCA 2A0UA 2D4UA 1OQCA 1L3PA 1D0ZA 4XEVA 4MW3A 3C18A 2Y3GA 2ICWG 2DB4A 4FX5A 4GYTA 4B6IA 3LUTB 1A7EA 1YYJA 4ONSA 4BJ1A 1QLEC 2KGOA 3EGDB 1LI5A 1D0XA 2XLWA 4EBBA 2Y39A 4C7OB 2R7OA 4CS7A 3S29A 1JPJA 1Q0FA 3EFOB 1S05A 4JTCB 1LE4A 4HE8D 3EH2A 4CSAA 4J30B 3PCVA 4P6IC 5JT4A 3T6GB 4EWCA 4NC3A 3U2MA 1KTMA 3BRJA 5KYYA 4ZLCA 3C7JA 3GWLA 1HY5A 3KYIA 4JURI 4XWJA 3RQFA 1KNYA 2J46A 3U2LA 4KI2A 2H8AA 3I4UA 5JSLA 2KW3C 2M4EA 3JRMO 1XWJA 1OKKD 2MWQA 2A6EF 4MVZA 1VMAA 1T6QA 4JCZA 2L6GA 3F47A 4MW8A 4E17A 5K0IA 5A69A 3M4BA 3JSZA 3TULA 1U0BB 2LIGA 3K6BA 4CIPA 3L34A 3HNLA 4JCHA 3AQBA 4FESA 2XLHA 3MLGA 1LS1A 2HMZA 4MNDA 1Q0GA 4YK5A 3RH3A 5HV9A 1ZU4A 3RVYA 4DOZA 5B3IA 2OQMA 2LFDA 1ZZPA 3VM6A 2OEVA 1O87A 1Q0KA 2PX0A 2H7VC 2HZ8A 3EZHA 3G50A 2XM0A 3K66A 3W4YA 4DRJB 4NY3A 2XL6A 1ZHYA 1CPRA 5A6BA 3QMKA 3C8ZA 4I1OB 2M64A 2KSFA 1BR1A 4ANJA 3E70C 2IXOA 3C8GD 2HUJA 1LM3B 2QY9A 1RJ9A 3RFYA 3U9MA 3DWWA 4ULVA 5L0GA 2R7TA 3G4ZA 2Z15A 1AUEA 1PV3A 3DE9A 4QDLA 1G5ZA 3SXZA 4C3BA 3B0UX 3EGXB 2J0XA 4WABA 2IXPA 2WVQA 3N0TA 3T6JA 4F4BA 4DBQA 1VLSA 5KYNA 4CBEA 1V4AA 2W4MA 3AGTA 3TOLA 2ZXRA 4PFOA 2GWWA 1OXBA 1TWAA 4OINF 1QPUA 4WJ0A 2P61A 5E3AA 2WVOA 1WOLA 3QZCA 1RKEB 3S90A 2NUPB 4Z9HA 5D92A 3EGDA 2B0HA 1NU7D 3M15A 3DM5A 1TKNA 2XRHA 4MTGA 3WHNA 2EPLX 3EFOA 4PJJA 3AG4C 2RD9A 1NG1A 3B71A 4IWBA 2J9UA 3VYWA 4CJOA 5AC4A 1A7VA 3NYJA 5TJ5E 4DVYP 2D5RB 3JTLO 2OJED 1I4ZA 5FCLA 2EPMX 1D1BA 1UFBA 4C3DA 3EPVA 4PJLA 4LERA 3JZ0A 3FAJA 2IBFA 3UR3C 4FAPB 4YN0B 4Q4ZF 3RKOF 4MVMA 3MYIA 4G78A 2OJQA 4CS8C 2H7OA 3ZC4A 1YZCA 3PDMP 3SEOA 4MQ9F 2CNWD 2Q9BA 2YWAA 3IPMO 1NSGB 2R03A 4DRIB 3RQGA 2PFDA 4YL0A 1G8XA 1T9KA 4YJWA 4C7OA 5EHHA 5KYXA 2J0WA 4K7BA 5BQIA 4K0DA 5JRAA 1TWCA 3A9CA 3X1OA 3IQCA 5T1DB 4CX9A 2R05A 3FMSA 4EIYA 4NTAA 3UGOA 2A69F 3FHDA 3HLZA 2NSGA 1ST6A 2A68F 2X0CA 2EPNA 3FOPA 2W9YA 1FR0A 1C02A 1YJGA 5E3CA 5HSWA 2YLDA 1R5ID 1NZEA 1XZQA 3F46A 4BJ6C 4D4NA 4WGYA 1Z6AA 4E0HA 3DI5A 1OXKA 3IQTA 4MVQA 3K1IA 3FAPB 1CPQA 3EGXA 3QVYA 1OR3A 2CGEA 3SYNA 4ER9A 1Z5ZA 3X2QC 3G4XA 5L0JA 1CGME 3W8HA 1E2XA 3QW0A 1S7ZA 2J45A 2L6HA 2XS8A 3NG1A 2A6HF 1YDIA 3KKBA 4LDRA 1TWHA 1RMVA 4GEHA 4DXWA 2LQGA 2JX0A 1RKEA 1H6GA 2NUPA 2HV6A 4U9EA 3S27A 2DGJA 3PMRA 4XPWA 1ZW2A 2CW0F 1BDJB 1EI7A 3SZRA 5EGYA 2YL3A 2WZLA 5A6KA 2Y69C 1LPEA 1TFOB 2YL1A 3NYLA 3TK0A 2HJ3A 2PNOA 1JRAA 3GEEA 2J9WA 3V5XA 3R7CA 2QLAA 1NU9C 4R32A 3LEOA 4EBKA 1MMDA 2J7PA 3UNGC 4LLEA 2FGYA 5A6JA 1QKRA 2KYHA 3AQCA 4CS9A 4DJ9A 5T3WA 4IAOA 2IYLD 3S28A 5JP7A 4BJ5C 4PK4A 3U8PA 4IAQA 4AE4A 2YLGA 5A6BD 1GGQA 2R25A 2Q7RA 3LS1A 1YA7O 3MFNA 4N4WA 4BJTA 1QSPA 1XZPA 1Q0MA 3B29A 4JZAA 1A41A 2LK4A 4G0HA 3HNKA 2MHRA 4X0RA 1YAUO 2I15A 3U3BA 2DI3A 4E0IA 1ZHTA 3R2PA 3V7OA 2WVNA 5A6AA 1J8YF 2NG1A 4U5GA 1M57C 4ULWA 3CZ6A 3W2VA 3MX3A 3MBGA 3ZWIA 2Q9AA 4PJNA 4AX2A 5BQHA 3IEEA 5L0HA 3AOUA 1JAFA 2IXNA 2WL8A 3N24A 1OCZC 1TFKB 2G3VA 3S9OA 3TOMA 3HKKA 4JE9A 2Y3BA 4H54A 2AU5A 3E9VA 4MVOA 3GEIA 3IQ6A 5GPGB 4EKWA 4AL0A 2ZD9A 1Z23A 3W2WA 3HNJA 3FDQA 1NFOA 4DRHB 1ZHWA 3ECSA 1U6HA 2Y3HA 1GM5A 1APCA 5FZTA 5DLJA 1H9TA 5COGA 2QTVA 4CSAC 3CSKA 2ZXPA 5CI9A 2XS1A 3GWNA 3NRHA 1GS9A 2L81A 2OEXA 1EA8A 3BEHA 4MVSA 3H2VA 2HS5A
chains in the Genus database with same CATH topology
3CEXA 2NSGA 5CIVA 3GORA 2YQYA 3DI5A 4N6CA 1RXQA 2OU6A 2P1AA 2OQMA 2QNLA 2HKVA 5COMA 5COFA 2NSFA 3QTHA 2QE9A 2RD9A 5COGA 3DKAA 2F22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CEX A;  2NSG A;  5CIV A;  3GOR A;  2YQY A;  3DI5 A;  4N6C A;  1RXQ A;  2OU6 A;  2P1A A;  2OQM A;  2QNL A;  2HKV A;  5COM A;  5COF A;  2NSF A;  3QTH A;  2QE9 A;  2RD9 A;  5COG A;  3DKA A;  2F22 A; 
#chains in the Genus database with same CATH topology
 2R7U A;  1TWG A;  2XLO A;  3KH2 A;  4O6Y A;  4PJM A;  4U5C E;  2H7B A;  2VC9 A;  4MS2 A;  5JUA A;  2EPO A;  3GOD A;  2PBE A;  2YQY A;  2X51 A;  2UUH A;  3JSE O;  4U5D E;  2KK1 A;  3K33 A;  4N6C A;  3RQE A;  2YHS A;  3T9O A;  2P7V A;  2FFH A;  4JKV A;  4YL3 A;  4O79 A;  2KC3 A;  3B0P A;  3GEH A;  2R9R B;  4W8K A;  4L6R A;  2V3C C;  3US6 A;  3VRC A;  3ABM C;  4UDV A;  4Z9I A;  3EHN A;  1MND A;  4KNV A;  5E2Q A;  3TQO A;  2QUP A;  4IAR A;  1AVO B;  1QZX A;  1D1C A;  2YLI A;  3DJU B;  2L7A A;  2IXM A;  2XXA B;  4K1O A;  4RD9 A;  2MYS A;  4E7S A;  3JT1 A;  4G7H F;  4JW1 A;  3WAQ A;  4JTA B;  2EIK C;  1JPN A;  3DE8 A;  3QW1 A;  3KMI A;  4D4X A;  2Q9C A;  1FAP B;  2C03 A;  5JS5 A;  4H4K C;  4AE4 B;  1BR4 A;  4PFP A;  3WG7 C;  3AGU A;  1FMW A;  1VLT A;  2YVK A;  1ZW3 A;  5KYX B;  1FFH A;  1YZA A;  3O10 A;  1OCO C;  4U9D A;  5L0I A;  4HFK B;  1FNT c;  2HKV A;  1M2V B;  2ZXO A;  1OW7 A;  4YL1 A;  3U5S A;  2IOQ A;  1V74 B;  3UMH A;  1K04 A;  4EUK B;  2UUI A;  1VYI A;  2G3K A;  3NMI A;  3ZVR A;  1DOW A;  1L7C A;  3KL4 A;  4XQ1 A;  1HMO A;  2AP3 A;  2Q4F A;  1Z7Q c;  1EQ1 A;  4OD5 A;  1HW1 A;  3LAY A;  4U5E E;  1G4U S;  3NKE A;  2NUT B;  3SXK A;  1TR2 A;  1IW7 F;  2PX3 A;  2V26 A;  1Q0D A;  3RW0 A;  1CGO A;  1LE2 A;  4G7O F;  1YA9 A;  1JOG A;  3M4C A;  4PR9 A;  2G62 A;  3QVZ A;  1OCC C;  1ZVZ A;  3ZTZ A;  3Q7L A;  1V55 C;  2EPK X;  3B9Q A;  1E86 A;  3OA1 A;  4MTO A;  5B1A C;  1W2W A;  1VOM A;  2Q3T A;  3LLI A;  5L3Q A;  2GA0 A;  2YL0 A;  3Q6M A;  4BG0 A;  2KQ9 A;  3GM1 A;  3RVZ A;  2LD6 A;  2R7X A;  1QQ3 A;  2R02 A;  1T5O A;  2BC5 A;  1O3U A;  2FAP B;  2P6V A;  3FVY A;  4OIR F;  2BE5 F;  3M1C B;  4NTF A;  4QI2 A;  3TD7 A;  2XSE A;  3RF3 A;  2WZG A;  4N06 A;  3CEX A;  1VYK A;  4ZLD A;  2JD3 A;  3RIP A;  2RSE B;  2XXA A;  2J7P D;  3JYH A;  4OIP F;  2YZS A;  3C62 A;  4NCQ A;  1PD1 A;  1QVX A;  1OW8 A;  2BL2 A;  2XL8 A;  3U8V A;  5DQT A;  3SXM A;  1MMA A;  1N1C A;  3ZSU A;  1OCR C;  3Q6N A;  2J9V A;  2HV7 A;  1SF8 A;  5L3V A;  4OD4 A;  3ZQY A;  4U5F E;  3L0I A;  4RBN A;  4XPX A;  1EKY A;  2VH3 A;  1YYX A;  2LSE A;  2GFH A;  2HJM A;  1BR2 A;  1TQG A;  2Y3D A;  3JCU Q;  3K1I C;  5BQG A;  5KYW B;  3PHF 2;  1ZU5 A;  1M6T A;  5CI8 A;  3C8G B;  2NSF A;  3WOD F;  3LJB A;  3A11 A;  4LDQ A;  4N6H A;  3GAN A;  4EBJ A;  3N2Z B;  5DS4 A;  4JRZ A;  1M2V A;  4A2N B;  3EHM A;  5L0F A;  1E83 A;  1SR2 A;  3DKA A;  1U89 A;  3MYF A;  2R7R A;  4MVU A;  4PAC A;  3UGP A;  1AEP A;  2A0B A;  2LFF A;  4WGZ A;  4XLN F;  4YT8 A;  4JEB A;  1A7D A;  2O9X A;  3EQL F;  4YT4 A;  4MVR A;  2CDQ A;  4JTD B;  1K40 A;  2EIN C;  3JYY A;  3ZG1 A;  3ASN C;  4U5B E;  3UMI A;  4DVZ A;  2VAS A;  3C63 A;  4XEF A;  2NUT A;  2YEV A;  2OKU A;  5B1B C;  4IRU A;  3TJ5 A;  5L0D A;  1D0Y A;  1PD0 A;  2XLD A;  1LIH A;  1PCX A;  4I44 A;  3ZDL A;  4CDA A;  2GDC A;  5KYU B;  1OR2 A;  256B A;  4CS9 C;  5COM A;  1WWP A;  5COF A;  2Q00 A;  1C17 M;  3LEV A;  3ABK C;  1A0B A;  3ASO C;  3O6X A;  4O7G A;  3O55 A;  3EG9 B;  2QE9 A;  3DAF A;  2WZF A;  2W4B A;  2OCC C;  3M79 A;  4J32 B;  3DXJ F;  3FXH A;  2B0J A;  3IQ5 A;  4IJJ A;  3DAG A;  4OIO F;  1YAR O;  3SXY A;  1C03 A;  1M2O A;  1OKK A;  4JJG A;  2KNH A;  4BEM J;  5CIV A;  3H65 A;  3SP1 A;  3VAY A;  4JC7 A;  1F1M A;  1VK5 A;  3DD7 A;  5T3T A;  5EK0 A;  1OW6 A;  2YRF A;  1HE1 A;  2XM4 A;  1WAT A;  4KC9 A;  1I4Y A;  4EHP A;  4J7Y A;  5IY5 C;  2P1A A;  1CGN A;  2W45 A;  2OOC A;  4FWV A;  1T6I A;  2QNL A;  2EIL C;  1NBB A;  5AGF A;  2OG2 A;  2R7Q A;  1HE9 A;  2ETS A;  2EIM C;  1MMG A;  1MMN A;  4XEK A;  3S84 A;  3I5P A;  3SNH A;  4YT2 A;  1JR8 A;  4XTK A;  3I5Q A;  4P9F A;  3V5Z A;  3EJN A;  3LLK A;  3ZQV A;  1KU2 A;  1LVK A;  1M56 C;  4O6M A;  5KYW A;  1R4T A;  5F5H A;  2HMQ A;  3J06 A;  2R7W A;  1ORY A;  3C8G A;  5DS5 A;  1E84 A;  4JIO A;  5DS6 A;  5L0C A;  2J8W A;  1D1A A;  1BZ4 A;  2KJG A;  3IHU A;  2R7V A;  1G4W R;  1SMY F;  2A1D D;  1FMV A;  2VCA A;  4CS8 A;  3NDB B;  1LI7 A;  5D91 A;  4YT5 A;  3GOR A;  1I5N A;  2HFI A;  4KBL A;  2R7S A;  3L8J A;  2VCC A;  4AK9 A;  4CJG A;  1NLX A;  1ZHX A;  4JEA A;  1HMD A;  4KNW A;  3W8I A;  2OU6 A;  2C04 A;  2P0N A;  4Q7C A;  5JVE A;  3DM9 B;  1ORJ A;  2NPU A;  3AG2 C;  3AG3 C;  3H2U A;  4J7T A;  3UMK A;  4AL1 A;  4C3E A;  3AG1 C;  4XPY A;  2VB6 A;  1GQA A;  2HSB A;  2IM8 A;  2I8B A;  2YKZ A;  3DMD A;  4JVS A;  3LNR A;  4P9T A;  1WAS A;  1WGW A;  5KYU A;  3LNM B;  4HEA J;  3RYL A;  1WTY A;  2J9B A;  3KPH A;  2AVK A;  1FTS A;  5E33 A;  3K1H A;  2ZXW C;  4BJ6 A;  1T01 A;  3ZTM A;  1HW2 A;  1FFT C;  1YVI A;  3AJM A;  1H7I A;  1RCP A;  3EG9 A;  1VB5 A;  2ZPA A;  3L1M A;  1JMW A;  1Y4C A;  2ASR A;  4NTB A;  4RDA A;  2XL4 A;  1MNE A;  2E87 A;  3EH1 A;  2L6F A;  5JLI A;  4CIH A;  3HTK C;  2LP4 A;  4Z9J A;  3NYM A;  4NQF A;  1RXQ A;  4HFF B;  4MTF A;  1J8M F;  4BPM A;  2DYR C;  3OEO A;  4JJF A;  3HNI A;  3VF0 A;  4E7Z A;  5KYY B;  1BBH A;  3LS0 A;  4IGG A;  4LDK A;  1Z3I X;  3B0V C;  3LES A;  1ZYR F;  3GM2 A;  1H9G A;  2AWY A;  3HJC A;  1ZHZ A;  2GAQ A;  2WB7 A;  4XLP F;  2TMV P;  3U3F A;  2CNW A;  5DVW A;  2CYD A;  3CQZ A;  2PP4 A;  3JRT A;  4YWQ A;  4Q5S F;  4DBR A;  2HSQ A;  4M63 A;  3ZIB A;  5B3S C;  5BUO A;  2L9J A;  2LCH A;  4O6N A;  2DYS C;  3OWT A;  1DOV A;  3DZA A;  3S0X A;  5F5F A;  3ITF A;  4LLC A;  4W8P A;  1MQV A;  1O5H A;  1LKX A;  3U0C A;  2XLV A;  3NKD A;  3O39 A;  2VCB A;  2CCY A;  4G7Z F;  4CDY A;  4BJ5 A;  2XLE A;  1VTM P;  1K05 A;  1UG7 A;  2YL7 A;  3Q7G A;  4QI0 A;  3T6B A;  4A4A A;  1V54 C;  3NMJ A;  3TJ6 A;  4IB4 A;  2AWC A;  4I1M A;  3V5Y A;  4CDV A;  2PF4 E;  2XLM A;  3T4R A;  1B68 A;  3KYJ A;  4BEJ A;  3FOO A;  3ATP A;  1Z63 A;  5F28 E;  3POV A;  3EZI A;  1T6U A;  2JPU A;  3NMK A;  1RJ9 B;  1WN0 A;  4U5H A;  5AC5 A;  1SYQ A;  3QTH A;  3GM3 A;  1LS4 A;  2EIJ C;  4I3M A;  4LAC B;  5DQZ A;  3DJN B;  3CAX A;  3K7D A;  1NFN A;  1E85 A;  4GQH A;  1Y6D A;  3U9J A;  1YLM A;  3L8I A;  1IZM A;  3ABL C;  2F22 A;  1SZI A;  1ORS C;  4OIQ F;  4E18 A;  1RKC A;  2A0U A;  2D4U A;  1OQC A;  1L3P A;  1D0Z A;  4XEV A;  4MW3 A;  3C18 A;  2Y3G A;  2ICW G;  2DB4 A;  4FX5 A;  4GYT A;  4B6I A;  3LUT B;  1A7E A;  1YYJ A;  4ONS A;  4BJ1 A;  1QLE C;  2KGO A;  3EGD B;  1LI5 A;  1D0X A;  2XLW A;  4EBB A;  2Y39 A;  4C7O B;  2R7O A;  4CS7 A;  3S29 A;  1JPJ A;  1Q0F A;  3EFO B;  1S05 A;  4JTC B;  1LE4 A;  4HE8 D;  3EH2 A;  4CSA A;  4J30 B;  3PCV A;  4P6I C;  5JT4 A;  3T6G B;  4EWC A;  4NC3 A;  3U2M A;  1KTM A;  3BRJ A;  5KYY A;  4ZLC A;  3C7J A;  3GWL A;  1HY5 A;  3KYI A;  4JUR I;  4XWJ A;  3RQF A;  1KNY A;  2J46 A;  3U2L A;  4KI2 A;  2H8A A;  3I4U A;  5JSL A;  2KW3 C;  2M4E A;  3JRM O;  1XWJ A;  1OKK D;  2MWQ A;  2A6E F;  4MVZ A;  1VMA A;  1T6Q A;  4JCZ A;  2L6G A;  3F47 A;  4MW8 A;  4E17 A;  5K0I A;  5A69 A;  3M4B A;  3JSZ A;  3TUL A;  1U0B B;  2LIG A;  3K6B A;  4CIP A;  3L34 A;  3HNL A;  4JCH A;  3AQB A;  4FES A;  2XLH A;  3MLG A;  1LS1 A;  2HMZ A;  4MND A;  1Q0G A;  4YK5 A;  3RH3 A;  5HV9 A;  1ZU4 A;  3RVY A;  4DOZ A;  5B3I A;  2OQM A;  2LFD A;  1ZZP A;  3VM6 A;  2OEV A;  1O87 A;  1Q0K A;  2PX0 A;  2H7V C;  2HZ8 A;  3EZH A;  3G50 A;  2XM0 A;  3K66 A;  3W4Y A;  4DRJ B;  4NY3 A;  2XL6 A;  1ZHY A;  1CPR A;  5A6B A;  3QMK A;  3C8Z A;  4I1O B;  2M64 A;  2KSF A;  1BR1 A;  4ANJ A;  3E70 C;  2IXO A;  3C8G D;  2HUJ A;  1LM3 B;  2QY9 A;  1RJ9 A;  3RFY A;  3U9M A;  3DWW A;  4ULV A;  5L0G A;  2R7T A;  3G4Z A;  2Z15 A;  1AUE A;  1PV3 A;  3DE9 A;  4QDL A;  1G5Z A;  3SXZ A;  4C3B A;  3B0U X;  3EGX B;  2J0X A;  4WAB A;  2IXP A;  2WVQ A;  3N0T A;  3T6J A;  4F4B A;  4DBQ A;  1VLS A;  5KYN A;  4CBE A;  1V4A A;  2W4M A;  3AGT A;  3TOL A;  2ZXR A;  4PFO A;  2GWW A;  1OXB A;  1TWA A;  4OIN F;  1QPU A;  4WJ0 A;  2P61 A;  5E3A A;  2WVO A;  1WOL A;  3QZC A;  1RKE B;  3S90 A;  2NUP B;  4Z9H A;  5D92 A;  3EGD A;  2B0H A;  1NU7 D;  3M15 A;  3DM5 A;  1TKN A;  2XRH A;  4MTG A;  3WHN A;  2EPL X;  3EFO A;  4PJJ A;  3AG4 C;  2RD9 A;  1NG1 A;  3B71 A;  4IWB A;  2J9U A;  3VYW A;  4CJO A;  5AC4 A;  1A7V A;  3NYJ A;  5TJ5 E;  4DVY P;  2D5R B;  3JTL O;  2OJE D;  1I4Z A;  5FCL A;  2EPM X;  1D1B A;  1UFB A;  4C3D A;  3EPV A;  4PJL A;  4LER A;  3JZ0 A;  3FAJ A;  2IBF A;  3UR3 C;  4FAP B;  4YN0 B;  4Q4Z F;  3RKO F;  4MVM A;  3MYI A;  4G78 A;  2OJQ A;  4CS8 C;  2H7O A;  3ZC4 A;  1YZC A;  3PDM P;  3SEO A;  4MQ9 F;  2CNW D;  2Q9B A;  2YWA A;  3IPM O;  1NSG B;  2R03 A;  4DRI B;  3RQG A;  2PFD A;  4YL0 A;  1G8X A;  1T9K A;  4YJW A;  4C7O A;  5EHH A;  5KYX A;  2J0W A;  4K7B A;  5BQI A;  4K0D A;  5JRA A;  1TWC A;  3A9C A;  3X1O A;  3IQC A;  5T1D B;  4CX9 A;  2R05 A;  3FMS A;  4EIY A;  4NTA A;  3UGO A;  2A69 F;  3FHD A;  3HLZ A;  2NSG A;  1ST6 A;  2A68 F;  2X0C A;  2EPN A;  3FOP A;  2W9Y A;  1FR0 A;  1C02 A;  1YJG A;  5E3C A;  5HSW A;  2YLD A;  1R5I D;  1NZE A;  1XZQ A;  3F46 A;  4BJ6 C;  4D4N A;  4WGY A;  1Z6A A;  4E0H A;  3DI5 A;  1OXK A;  3IQT A;  4MVQ A;  3K1I A;  3FAP B;  1CPQ A;  3EGX A;  3QVY A;  1OR3 A;  2CGE A;  3SYN A;  4ER9 A;  1Z5Z A;  3X2Q C;  3G4X A;  5L0J A;  1CGM E;  3W8H A;  1E2X A;  3QW0 A;  1S7Z A;  2J45 A;  2L6H A;  2XS8 A;  3NG1 A;  2A6H F;  1YDI A;  3KKB A;  4LDR A;  1TWH A;  1RMV A;  4GEH A;  4DXW A;  2LQG A;  2JX0 A;  1RKE A;  1H6G A;  2NUP A;  2HV6 A;  4U9E A;  3S27 A;  2DGJ A;  3PMR A;  4XPW A;  1ZW2 A;  2CW0 F;  1BDJ B;  1EI7 A;  3SZR A;  5EGY A;  2YL3 A;  2WZL A;  5A6K A;  2Y69 C;  1LPE A;  1TFO B;  2YL1 A;  3NYL A;  3TK0 A;  2HJ3 A;  2PNO A;  1JRA A;  3GEE A;  2J9W A;  3V5X A;  3R7C A;  2QLA A;  1NU9 C;  4R32 A;  3LEO A;  4EBK A;  1MMD A;  2J7P A;  3UNG C;  4LLE A;  2FGY A;  5A6J A;  1QKR A;  2KYH A;  3AQC A;  4CS9 A;  4DJ9 A;  5T3W A;  4IAO A;  2IYL D;  3S28 A;  5JP7 A;  4BJ5 C;  4PK4 A;  3U8P A;  4IAQ A;  4AE4 A;  2YLG A;  5A6B D;  1GGQ A;  2R25 A;  2Q7R A;  3LS1 A;  1YA7 O;  3MFN A;  4N4W A;  4BJT A;  1QSP A;  1XZP A;  1Q0M A;  3B29 A;  4JZA A;  1A41 A;  2LK4 A;  4G0H A;  3HNK A;  2MHR A;  4X0R A;  1YAU O;  2I15 A;  3U3B A;  2DI3 A;  4E0I A;  1ZHT A;  3R2P A;  3V7O A;  2WVN A;  5A6A A;  1J8Y F;  2NG1 A;  4U5G A;  1M57 C;  4ULW A;  3CZ6 A;  3W2V A;  3MX3 A;  3MBG A;  3ZWI A;  2Q9A A;  4PJN A;  4AX2 A;  5BQH A;  3IEE A;  5L0H A;  3AOU A;  1JAF A;  2IXN A;  2WL8 A;  3N24 A;  1OCZ C;  1TFK B;  2G3V A;  3S9O A;  3TOM A;  3HKK A;  4JE9 A;  2Y3B A;  4H54 A;  2AU5 A;  3E9V A;  4MVO A;  3GEI A;  3IQ6 A;  5GPG B;  4EKW A;  4AL0 A;  2ZD9 A;  1Z23 A;  3W2W A;  3HNJ A;  3FDQ A;  1NFO A;  4DRH B;  1ZHW A;  3ECS A;  1U6H A;  2Y3H A;  1GM5 A;  1APC A;  5FZT A;  5DLJ A;  1H9T A;  5COG A;  2QTV A;  4CSA C;  3CSK A;  2ZXP A;  5CI9 A;  2XS1 A;  3GWN A;  3NRH A;  1GS9 A;  2L81 A;  2OEX A;  1EA8 A;  3BEH A;  4MVS A;  3H2V A;  2HS5 A; 
#chains in the Genus database with same CATH homology
 3CEX A;  2NSG A;  5CIV A;  3GOR A;  2YQY A;  3DI5 A;  4N6C A;  1RXQ A;  2OU6 A;  2P1A A;  2OQM A;  2QNL A;  2HKV A;  5COM A;  5COF A;  2NSF A;  3QTH A;  2QE9 A;  2RD9 A;  5COG A;  3DKA A;  2F22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...