3DIDA

Crystal structure of the f87m/l110m mutant of human transthyretin at ph 4.6 soaked
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
b'CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Zn2+-binding sites in human transthyretin: implications for amyloidogenesis and retinol-binding protein recognition.
pubmed doi rcsb
molecule keywords Transthyretin
source organism Homo sapiens
molecule tags Ligand binding protein
total genus 24
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3didA00
4WNSA 1KGIA 3I9IA 4TLKA 5EN3A 4I89A 3OZKA 4WNJA 3CFTA 1F41A 3GS7A 2TRHA 4Y9BA 2G5UA 3IWUA 1TTCA 4N85A 2B15A 1RLBA 4PWEA 3CN4A 3W3BA 3HJ0A 2H4EA 4DESA 4TQHA 5CLYA 1F86A 2QGDA 3KGTA 4TL4A 1TLMA 3DJZA 1TTBA 3DIDA 3IMSA 3NESA 5JIMA 1ETB1 4TNEA 1QABA 4ABQA 4TLTA 4AC2A 1OO2A 3DJTA 1KGJA 4AC4A 2G9KA 1E5AA 4PVLA 4TM9A 4IKIA 2NOYA 4PWKA 4QRFA 4IKLA 1E3FA 2G4GA 3DK2A 3FC8A 4PWIA 3ESPA 4PWFA 5CNHA 4PWJA 4PWHA 5AKSA 1QWHA 3BT0A 4ABWA 4TQIA 4TQPA 3GS4A 5CM1A 3A4DA 5CLZA 4IKJA 3CXFA 4WO0A 1X7TA 1GKEA 2GPZA 3DJSA 5K1JA 5AKTA 1E4HA 1IIKA 4ANKA 1DVYA 4Y9CA 1THCA 4IK7A 2QPFA 3P3UA 4MRCA 5E4OA 1SN5A 3M1OA 4TLSA 1IJNA 5E23A 3GRBA 4L1SA 5FW6A 3ESNA 3CFNA 5CR1A 1FHNA 1DVTA 4N87A 2H0FA 1ICTA 3B56A 4HJUA 4IK6A 4KY2A 1TFPA 1ZCRA 3SSGA 2ROYA 1DVQA 3TFBA 3NG5A 4QYAA 4Y9EA 1BM7A 1BZDA 3CN2A 1X7SA 3GS0A 4MASA 3IPBA 5AL8A 5EZPA 5A6IA 3Q1EA 4FI7A 4YDNA 1THAA 1TTAA 2FLMA 5AKVA 1G1OA 3FCBA 4ACTA 1SOQA 3IMTA 2TRYA 4HJSA 2QGCA 2G3XA 5JIQA 4PVNA 4TKWA 4ABUA 1DVUA 2H1XA 3KGUA 2B14A 2QGEA 3IMUA 4QXVA 3IPEA 4TL5A 5K1NA 2H0JA 3DK0A 2QELA 3DGDA 3I9AA 3IMRA 3U2JA 1BMZA 3CN0A 3BSZA 4I85A 1ETA1 1GKOA 4PMEA 3TCTA 4FI6A 4TLUA 5CN3A 1DVSA 4Q14A 4DERA 5AL0A 1IE4A 1TYRA 1BZ8A 2H6UA 4I87A 5FO2A 3CFQA 3IMWA 4IKKA 4TQ8A 2PABA 1SN0A 4DEUA 1Z7JA 2G2PA 3NEEA 5L4MA 2QGBA 2F8IA 2G2NA 2FBRA 1ZD6A 3CN3A 3ESOA 3OZLA 4TNFA 4Y9GA 3IMVA 2IGLA 3GRGA 5FW7A 5DEJA 4YDMA 3I9PA 3NEOA 3QVAA 4L1TA 4PM1A 4PWGA 1TZ8A 1BZEA 3DJRA 3IWVA 4Y9FA 2G4EA 1TSHA 1TT6A 5CLXA 4N86A 1SOKA 1DVXA 4ABVA 5L4IA 5L4FA 3D7PA 5IHHA 4HIQA 5FW8A 3A4FA 3CFMA 3D2TA 3DO4A 3GPSA 5JIDA 1Y1DA 1FH2A 2G3ZA 3P3RA 2GABA 3P3TA 3P3SA 3U2IA 2B16A 1DVZA 3A4EA 4PVMA 4IIZA 5E4AA 2B9AA 3GLZA 1U21A 4DETA 1IIIA 4HISA 4MRBA 4HJTA 2B77A 4PMFA 4D7BA 2WQAA 5L4JA 5TTRA 5DWPA 2F7IA 3CBRA 1TTRA 3KGSA 2H0EA 5AYTA 4FI8A 4TNGA 3CN1A 5HJGA 4DEWA 1SN2A 2ROXA 3NEXA 5BOJA
chains in the Genus database with same CATH superfamily
3W9EA 1NBVH 5MP6L 4BSVB 3K6SA 2EE2A 5H4YA 2G9HB 2F54A 3KPRE 3HG3A 1OCWH 1DLHB 1F86A 3KPSD 4WAFA 4DGUA 1CMOA 4IOFD 4M6MH 1T1XB 5D5MB 1LO3H 1ORQA 4QMEA 2A6DA 4XNYL 4ZFGL 2KPWA 2NX5E 2BX5A 3MCKA 4TTDC 3ETBF 4YDZA 5C9KA 4HUNB 4A2DA 4PP1C 1GJWA 4NFCA 2VWEE 3X14A 4OZHA 4HVBA 3D3VB 1WP6A 1A9EB 1TCRB 4MQSB 1CCZA 1ZANH 1XH0A 3OAZH 5C0AB 2BOLA 2Q3XA 3OKDB 5DT1H 4F58L 1KXVC 5K39B 4AIEA 3EGDA 4OGXL 5ECGA 5GXBB 2OM5A 3H7BB 5BV7B 4R0LB 2XN9B 5IBLD 2ERJB 1QSVA 3TONA 4XP1H 3MVSA 5DEFA 3UZQB 1QEWB 2FWSA 1AZUA 5JYLA 2YSSA 4NC2B 3BP7B 3EJUA 1E43A 1OV8A 5E8PA 3TA3C 1XCWA 3AWFA 4TL5A 35C8H 1M6OB 3BQUD 3CVHB 2CHDA 3OXRB 3LQAL 5I6NA 3TCTA 4X6DF 5FYKE 3UG3A 2VISA 1VLXA 4M7LT 1CD0A 3HMWH 4KXDA 1NUNB 2DQCH 2VLRD 2YUZA 3VB9A 4KY1H 2DKMA 2BINA 4DOHB 3EO1A 3QG6A 1FFOB 4PJCA 4AQ1C 1U3NA 2OL3B 4KUZL 2YKLH 3RWEB 4JMXA 2VRAA 3H9SA 2ZYHA 2OBGA 4GUCA 4H8WL 1LE9B 4JFOA 3UJIL 4PJ7F 3ZRSA 4Q9RL 2GCYB 4HEMA 4NNYA 2A6KB 2RFXA 5F3BA 1AHWB 3KGRA 3T1FA 1QHOA 1FN4B 4LNRA 2FJFA 1EIBA 4UV4H 4JY4A 3TNNB 1A1NB 3KLAA 4LRNL 3O3BB 3RPIB 1BXVA 4Z7QE 2A0LC 4JZNB 1KJVB 1Q0EA 4PHXA 4WI3A 5GJTH 2R4SH 4GRLC 5HJGA 4IBUA 4HKZB 3CSGA 4LSPL 3TO2B 4NQUA 2D3LA 5D6DC 4JRFA 4R3SA 2C3XA 1XCQA 1J7VR 1UH2A 5G55A 1X5YA 2ADFH 5SWZA 3SY6A 3CSYB 3UBHA 3D0AA 3B83A 1TTUA 2PWGA 1J9CT 2J20A 1DQDH 3BSZL 5FOBB 3DIDA 5DK2A 4MJ5A 1TZGH 1J0KA 4HXBL 1K2DA 4E2OA 4Y19D 3P0GB 2WINA 1A6TB 4KBPA 2FSEB 3AJ7A 3TWCL 4Q2ZB 3SZ6A 3B9EA 3AXLA 4NDMA 2XV0A 3MJ8A 4JFUA 5CZXD 3GPEA 1J88A 2R29H 3QJSB 3W39B 1M3IA 3FB6A 1BECA 2WZAA 1YAZA 4XO9A 3TASA 3UTOA 4DGVL 3FO9B 2K6WA 1MI5A 2CBMA 2W9EL 3FOMB 5IQNA 4DGYL 2FR4B 2QSVA 1PZDA 1Q9LB 2NMSA 4KRPC 4B9PA 2QJDA 4IK6A 5BS0A 4GSUA 2UWEA 4PJ8B 4YFLI 3HB3D 4M43H 2HT3C 4QOKB 5EOCL 3KR3H 3VWJC 1ANUA 3C6LA 3TEZA 2FIKB 3QW9A 5F97E 1JD9A 4A37A 4YDNA 1A3RH 2YMXH 5I8EB 1KTDB 1OGAE 4JVUA 3EJTA 1LD9A 3ESUF 1S9XA 1XF5A 2MQ3A 4PRPE 4WW2F 5EC2A 5JW4N 4Y4KD 1G1YA 3A6BH 2JKJA 3FOLA 3JVGA 4OQTH 2C9UA 3D18A 2NY0C 4QD2E 5FV1L 2UYLA 4X0NA 3EH1A 1RUQH 4FQQA 1I9JH 1SVBA 4FQHA 1FYTB 1BDYA 2GW5A 4K3HA 4GNKB 3WFCH 3E3QC 1UXLA 3DUSB 5KVGL 4TPRL 1P5UA 3OZLA 1MCRA 4O2FB 3RJQB 2ZUVA 4RNRA 2GIXA 4GRMA 3O9WA 4NZTL 5AW8B 4XWOC 3RTQA 4WWID 1QKZL 1H6UA 3LKSB 4M93B 5AYQA 5ESQB 2DEYX 2XTJB 3BGMB 3BUYA 3DTDA 5GGVH 4NNXB 4Z76A 5BOPA 2SODB 4TVPL 4I7ZC 2CLZB 3IF1A 4UB0L 3ZE2F 1OM3L 2YR3A 4WWPA 5ADOH 2GTQA 5EBWA 3RJOA 4S2SB 3INUL 3EYFA 3HUJE 4J2QA 1RJCA 4X9IA 3VXSB 1NC2D 1T5WA 3GYRA 1V54B 3TYGL 4K2UL 4U3XA 4XWGH 1IQWH 1JMZA 1KV7A 1UCTA 1EEZB 1E4KC 4IBWA 4OD2A 4GW4A 5DJ8A 2RMNA 1YQ2A 5JPMA 4JGNA 3BWSA 2NY2B 2BSTA 4H88L 2WV3A 5KVFE 4A2HA 5EBMA 3L1OH 4K3JL 4XP4H 4P5RA 2YRPA 4ZTOH 4AGLA 2EYSB 4I3SL 3STBA 3JV0A 3PWJB 2E6PA 1ZE3H 3DTUB 4HWNA 3QC6X 5DMKB 1IL1B 3HBPA 5C0CA 4PWKA 3DV6B 5DJYB 4UQEA 5SX5H 2W1NA 3GI9H 2WLLB 4KK6D 2J71A 2DLFH 2VJ0A 2OI9C 1SY6H 3U4BH 5B4MC 5KBNC 3DSFH 2Z93B 5IBLC 3HMXA 4Y5XB 3JTTB 4P46D 2YQ3A 3BPCA 5ISZA 1D9KB 3BZFB 3AU1B 2A9NL 3HI6H 4W81A 4Y9CA 5ALBH 3H3KA 2NNXA 4WI9A 4WTWA 1S7TA 2MIZA 2BPBA 4JO1L 5AB1A 2GI0A 1II4E 4R7DA 2QEJA 1JZIA 4MLSA 4YR6B 5IREA 3MO1A 2WVVB 1HQ4B 1BX2B 3FULA 4TUKL 1AD9A 2EDNA 3T3PE 5IFAL 3FHAA 3L5WA 5JR1L 4UT6A 3A5VA 4XOEA 5F96H 3JV6B 5AVVB 2OJEA 4XP5H 1QSEA 1A7PL 3ALWA 2IH8A 3CIQA 1XF3B 3EF4A 5DMIL 5DZPA 3V0VB 3CNKA 4PVBA 4K5NA 1SYSA 4YK4C 2F15A 2IAMA 4MXWL 2R9HD 2GJ6B 5FO7B 5C09B 2I25N 3C09B 1RJZB 4JFXB 4CJ1A 1J10A 4N0RA 3MYZA 2DQFA 2IADA 4XVSL 3CXHJ 3IMRA 1WWCA 3BKCL 2CGRL 3NIGF 5LCVH 4JDTL 5C08B 4DP6X 2VN5A 2VDOH 3HNVH 3V10A 3U25A 4LBEB 4Q6KA 3U7YL 3MRGA 3BAIA 4PYGA 1KCKA 1NWOA 3KPRD 4WW1A 5JIKA 3QQXA 5JYMA 1NOAA 1AR2A 2CO7A 4JDZB 1HHHA 3SD5A 3GMQA 4AW7A 1OCRB 1KN2L 1P1ZB 2CXGA 1AGEB 2NX5D 1A6WH 4FNSA 3ZTNL 3ULUF 1SOSA 1IGYB 2X4UB 1SF3A 2J1XA 5DI8B 3QQ4B 4E9XA 3UCQA 1YN7A 1JGEA 2WYZA 3MHZA 1I1AA 1SJVA 1KLGB 4IOSD 3AQYA 4QRPB 3WDIA 4X6DB 2WK2A 3GJFA 3GSWB 4HXAL 4M1DH 4NWTH 5CJOH 5LHDA 1SDYA 1GHFH 2CIKA 2CO6B 2K1MA 1RPUA 4BXVA 3UYRH 3UGXA 4HQQH 4PMFA 2VIRB 1JZFA 3FU0A 5BJTA 2X2UA 3BOVA 1CK0L 4ZMAT 2ZYIA 1SN2A 4TOYL 3IBEA 3NA9H 4CBPA 5I19H 4LHQB 3ECQA 1KJ3L 2QPEB 2YBRB 3ABMB 4TN9A 4PJ7B 5E4IA 5A16A 5C70A 5I6PA 4JS7A 4CC0A 1T7VA 4MYWB 5F7DB 3ROOA 4TQEL 3NA4A 5B38G 3RURA 1F58H 4EMZA 5BZDA 1E9PA 1XR9B 2H45A 1SUHA 3IDNB 4YL9A 5G4MA 4CNIB 1PAZA 5JHLL 1UATA 2VLKE 3EHBC 2YMOA 3VVVA 3BLKA 4ZUWA 4AIZB 3HB3C 3MV7A 1JFHA 1U3YA 1FAKT 5FYKD 4F7MA 1HK6A 1K3IA 1YPZE 5E7FA 4LCIL 1TTFA 4IU3B 4CAGA 3GXMA 5IB4A 2JKTM 1SHWA 2FQFA 4JRXE 4PS8A 3RBSA 5GS1C 4GQ9H 4FXKB 3M1OA 1IAIM 4M00A 4I0PB 5GHWH 4X7SH 4F7EA 1TF4A 1G9NC 2NY4D 2XDHA 4HD5A 5HI3C 1JPSH 4QF1B 4D8PB 1E4WH 2FEDD 4DAGL 5T3XL 2BSSA 1N6QH 3BVWA 1Z9SB 2I32A 3QQ3B 3ZQ9A 4UINH 3EG9B 4JFPA 1HNGA 1T4KA 2AP2A 4I8DA 5BV7L 2YAOA 3NQKA 5KW9L 1BGXH 3HS0C 1E6JH 1W0VB 1PX4A 3KM1A 4UTCA 5IB1B 4KKCD 1HFUA 3K5RA 1OW0C 3NSYA 2WXLA 5AOJA 1CYGA 4X5WA 4CC1A 3I9AA 4Z3JA 1BMZA 4KDTA 2IBBA 3FQ4A 3QG7L 3L5JA 3UAFA 2ZX8A 5L8KB 3LNHA 4UQIM 1KTLB 2EZ0D 4OZIE 3ETTA 1P2CA 2FWOA 3WLBA 3D85D 5F7UA 5IFHL 4N1CA 3SN6N 3ARFD 3CVHL 4U1JA 1IGTB 2C3GA 1H5BA 4APQC 4G6JL 1F6FB 5KYUB 5TD4A 5EZIH 3EYUL 1R5IA 3H2PA 4WW2B 4X7TA 3TFKC 5AAWA 2HG5A 2X7LB 4ISVA 3QQDB 4MAUH 3ZXAC 1IM9A 3NJHA 1TJIL 4OGAD 2FL5A 5FA4A 3ZOAA 3UBXI 4B95C 1F00I 4FX5A 5ADPH 3E9TA 1JHTA 1EV2E 2VR9A 3CFKB 2Q3AA 3GBLA 2J1KA 3BC9A 4OTXH 1RH8A 2ODHA 4MS6A 1UGNA 4DN3H 5DWPA 2AJVH 1IM3B 2F58L 2ROXA 3HZVB 3GHPA 4KMLB 2V17L 3QWQB 4LCUA 3QC5X 1P9MA 1UD2A 3OR6A 3GSXA 4P46C 3K6NA 4JM4L 2FHCA 3MODH 1SBBA 3V0HA 1OGAD 2PCPB 1LMIA 3MX0A 4FTVB 5IQ9A 1P7BA 3CFJB 3ZE2B 5J4MA 1FBIH 1PKQB 5AWNL 1IFHH 1PLBA 4H7VA 2I7OA 4NO2A 4OGQC 1G9HA 3F04A 1S3KH 2Z7WA 4QRRE 1PBYA 1BEXA 2Z35A 3RA7H 3LEVH 2X4SA 4QRSB 4XI5D 2A6JB 5LBGA 3SPIA 4PY8J 5DUBA 1HZHL 1ZHNA 3CZLA 3E1ZA 4N0UB 5CJBA 2G75A 3VGAB 43C9A 1NMAL 1BP3B 4HIHB 5D7EA 1QR4A 3EJQA 2CJUH 3VD4A 1UD6A 2NYYD 4BIKA 2COVD 5KVGE 3KLQA 1PIGA 5IHBA 2AABL 3QUGA 3UJJL 3UBXA 2OMVB 4ATWA 1DDTA 4OZGA 1GYAA 2VQTA 2HH0L 1IGMH 3OHXC 4K5MA 4RBPK 5IVXF 2ATKA 4JE0A 1E8WA 3CC5B 4WFEE 2H9GB 2ZF8A 2WGNB 1MFMA 3ALPA 1XCXA 2K70A 2WO3B 2WSKA 4MA3B 3UTTA 3VE0A 3DO3A 3BW9A 1HHKA 1SYVB 3FHEA 4PJ9D 4TVPE 5A6IA 1RIUH 5HGAB 1FV1B 1E8ZA 2FLMA 1SXNA 2OV0A 4Z8FH 4AYDC 3C60C 3H7LA 4PJHA 4GO8A 4CVXA 5I1GH 4XGZA 3CVDA 1NGZA 3BZDA 4FULA 1NFAA 2WUCH 4JGUA 3REVA 2VYRE 1LE5B 2BK8A 2NY5C 1RIHH 3V7AE 2WJ5A 5DC4B 4Y5YA 3OKKB 2D2OA 4M4RA 4FMVA 4JANA 6CGTA 5F9DC 4ZUUB 5CBEB 4CMMA 1U8HA 4D0CA 5F7HA 3IFPA 4MA8H 2WXMA 4S11A 4N2OA 4IKKA 4F2MA 2P8PA 1GCYA 2G2PA 1E30A 3BIAX 3L9EA 4G5ZH 3S0PA 3R18A 2CJ3A 3H0TB 5K9QI 3PCYA 1MN4A 2YXFA 1D7BA 3G5YB 5D96B 2CPCA 4ZG1A 1GOHA 5T5FL 2CO1A 3HFML 4FZ8L 5CP3A 5K93A 3P30H 4QY8B 3W1ZA 1P6FA 3NIGB 5DHYA 2VXQL 4IBLT 3LPOA 3VSVA 4ZW5A 3WIHA 2DJSA 3RP1A 2IQ9L 3VXNA 2BVYA 3ARUA 5JIIA 3CZFB 4YHZH 3ARED 4OUOA 1KB5A 3NZHL 1CU4L 4YGAB 1YY9D 4FDWA 4OV6F 4FZEH 4I48A 3PABB 4U1IB 1XH3B 4A6YB 5JIMA 2BY2A 4XN7A 3UIZA 4KXAA 5MEOA 3G08A 3MLVH 1G84A 1B6DA 1YMMB 4UIKL 3REWA 1X4YA 5E6ID 2JQAA 4WWOA 5E99H 3BP5B 4NEHB 5EH1A 3N1MC 1TLMA 4S1QL 3GHBH 2OXGA 5C8JB 3MYJB 2ADGA 1ADWA 5KVDL 3ABGA 2O26U 3JYCA 3ZIYA 1HESA 4P9HC 4PWIA 2CBQA 2DQUH 3V7AG 2KUTA 1GZPA 2CRIA 2WKOF 2NY4C 1KV3A 3W0WD 4ZOEA 5D6CB 4AGQA 3A4DA 5MERB 1MUJB 4IBZA 4KC3B 4EDXB 3G6JF 3WTVA 3WFEL 2AAVA 1CWVA 1T7ZA 2FHFA 1HIML 1CLZL 5LB1A 3E6FA 2EKJA 2IH3A 3IETB 1N68A 2XT1B 4FQXB 5GRVK 4GSXA 2VMCA 1N8ZA 2XCMC 5CUSH 5EOCJ 3BQVA 4KY2A 5BOZG 1QP1A 1GIGL 1M71B 2AEPH 2C3WA 1XGUB 3M1BB 4JFZH 2CK0H 3BAEH 1AKPA 4U1SA 5B3JF 1MH5B 4LL9A 1BBDL 3BISA 4HA1A 4NUJA 2PKDA 3QJFB 4GMSH 3QA3B 1F6AB 5IQ7H 5KYWA 2BJML 5BRQA 3BPLB 5GSVA 1AQDA 3UBXG 3T65A 3HBGA 4QXWA 1AE6L 1CICD 3MRLA 4R90H 5HDWA 3PE9A 3CUPB 1KDJA 4YBLB 5I75B 4RMUA 1VENA 5JZ7D 4OGYH 5C2BL 3RVVD 3BWZA 3SO3B 4LPCA 3O6FB 4JN2A 4JFDA 5I17B 1EFXA 3RY5A 4PB0H 2PTTA 1X5HA 3FT1A 1FPTL 2PWFA 3LZNA 3GSRA 4UZSA 4XN1A 4P23B 2YPKA 5EU5A 3N55A 4N2LA 2DWDA 5CSGA 4HJIA 4RMRA 3SE3C 2CA4A 3B5GA 3ULAB 1RKRA 1U95B 1NSNL 3ME0A 1KXVA 1DUZB 3K46A 2VLKD 1GMEA 1DEDA 4GW1A 4K7PY 3RGVD 2YEVB 3Q8EA 4U1HB 5GZOD 1RULH 1QBLH 4J8RB 4LF3A 2FD6L 1DANT 2HWZH 1WHPA 2WWMD 2Y7NA 4HIIB 4LP8A 4HOXA 1ZSDB 4JRXD 1JDAA 1EHKB 2QV2A 1A1MA 5FYKU 4J3SA 1CF8L 2HKHH 4L4TB 1LWRA 2R1WB 3E6HB 1P7HL 3LMJH 3D3VE 4HH9A 5C0RH 2P8LB 5AD0B 1HNYA 3QISA 2W92A 3JV5A 2GUOB 5C0AE 1RIVH 2WVTA 2C1OB 4KHXL 3NSXA 2AK1H 2AQ2A 3MR9A 2ENSA 2TRHA 1XGPA 3BHBB 4ODVH 4ZO6A 1J05B 5F2FA 4QHKI 1A6AB 4NN6B 3EJZC 5J9PB 2NYYC 2VH5H 5HHNB 1EXGA 5JXAL 2Q9OA 4OFIA 4ZJ9A 4NKDA 1VA9A 5EOQL 2OTUA 1TPXC 3N41F 4Z7OE 2HTKC 2EUZA 3FYIB 4F80A 3RL1A 4RQQA 5L2KA 3RILA 3UBFA 1OPGH 3GSNH 1TEFA 1IKOP 1L6ZA 1J48A 1B88A 2C5DC 1DJXA 4PJ9C 4FOMA 1O9ZA 2GI7A 1L7TL 1TNNA 4GT0A 1IBGL 1NCJA 2R56H 4OCNC 2I9LB 3S96B 2AXGA 3T0DA 2XKNA 2WLJA 2BH0A 2VLJB 1H15B 4JKWA 3SSGA 5K9QG 4M3JA 4GRLA 2Y7LA 5JIHA 3LZOA 3CU7A 5DD5H 3T8VA 5HD8D 3UEQA 3MRPB 5IG7B 3ARYA 3D5OF 1MSPA 4XP9H 3MCG1 1QTSA 4B96A 3VGFA 1WICA 3X12A 3KVQA 2R1XA 3OD3A 5JNYB 1G94A 5AOLA 3B9VA 3MJ6A 4AEHL 3SGDH 2HTLC 3RDTB 5IVXB 3SE8L 1U3HA 3PL6C 3KM2A 1A4AA 1E7VA 4RA3A 1X5XA 1YY8B 1MIEH 2O6CA 4NHUA 2QR0B 1U8LB 5DURD 1F3DH 4HPYL 1JDDA 3GLEA 3VWKD 1BYOA 5IEKA 2L7QA 4N26A 5DDHB 5TF1H 1DFBL 4MAZA 2FO4A 3RVTD 5BRZB 3MSPA 3OTTA 1WFJA 2ZP8A 3JWNE 4WGVB 2HFEA 4M7JH 5C0JA 4YPGB 4M5SA 1NIDA 5I1DA 1E2VA 5KS9E 4KKNA 4QRRD 5LAPA 5IT2H 3VI4E 3LN4B 1ZVNA 3ARVA 3GM8A 4PGBA 4U33A 2VDKH 5D1QE 1JZ5A 4WTZA 1OANA 5SWQB 1R0AL 5DZAA 3D4YA 3QSKB 1Y6KR 5TF0A 3KPMB 4X4ME 3VWJA 5DRXB 4U6YA 4G8EB 2Y7SA 4PJGE 2NUPB 1L5GA 5AYUL 3R8BB 4HISA 1KPRB 3WEAA 1JGVL 4Q74A 2D7MA 3ZT5A 1SFHA 3B3BA 3V6FB 2XG5B 4WFED 5D1XB 3DNKA 3BP4B 1JK9A 4TNGA 5E9AA 3PWUB 2JVUA 5F44A 3M7OA 3GTNA 1TYEB 2D31B 3HI5H 4J23A 3F58L 5FGBC 3TIDB 4C8XA 2JI2A 3U0WL 5FYLH 5HY9B 4TVPD 1S9YB 5DGQA 3DVFA 1ZGLP 2R0KL 2ESVA 4DT2A 5JORB 2GB2A 1EJ6A 4HBCL 4X80H 3Q2WA 4PJFA 2JK5B 4TULH 4EI5D 3HR5B 5J1AB 2NY3C 1BOGA 3HE7B 4J27A 2B1AL 4FRWA 2TSBA 5KG9B 1KWGA 4PJBE 3WN5C 2YA2A 4GAJL 4LSQH 3S98A 2MPAH 3H9HA 1CFBA 4FG6D 5TPWH 3BGFC 3LKQA 2XJLA 4R97B 1CFMA 2AJXL 3VA6A 4C57C 3SIKA 3JWNG 3GGWA 3KAAA 2H2SD 1GGYA 1AXSB 1J9TA 1KC5L 5ECJE 2LT9A 1DJWA 5AOMA 2R39A 1SMOA 1TZIB 3ML9A 1UOKA 2J12B 1DJZA 3PAVA 3MAWA 5FFGA 2E8ZA 1Q72L 2EXTA 1CICC 1BXUA 4QYAA 4WK0B 5DYOA 2EH8L 2R8SL 3LJ3A 1UYWL 3ZY7A 1VCAA 5J11C 1MFAL 3FU8A 1E4KA 1JNLL 4JY5L 4KZCA 1SXSA 2NTFA 1REIA 3KS0J 1XT5A 1AZCA 3EYQC 3G6JB 1D5BA 2XTJE 5F7BA 4HMEA 2DKUA 2QQLL 2XLLA 2ZWKA 2OP4L 4JO4H 3ARBD 4PREB 2G0KA 1HL9A 1QBAA 1ZLWK 4RRPM 4WWKD 4HT1L 2XN2A 3NACL 5C07D 3MRFB 5ERWA 1U58A 4ZPTB 1WBZA 1A5FH 4NBZB 2XY1A 1SDDB 4TLUA 4E5XB 3LQAC 2OSXA 2XQYK 2YA1A 3D0VB 4GRWH 3UGEA 4JRYE 4UM9B 3CFQA 2AKRA 5T1JA 2PABA 1T0NA 4XH2A 4K4KA 4LASL 3ARRA 3DMMD 4R84A 5JPNC 2WWMC 1ZLVH 1KXTA 2VN4A 4OCYL 3S7GA 4W9EC 3CVBA 5KVDE 1T1YA 1UM4L 3Q01A 3OKNB 1MCSA 3PWLA 4Z0XB 3RUGF 2Q76A 1XGQA 1G7JB 3CVIL 3MOQA 3OPUA 1JF1B 4OB5H 4QRUB 4NAQA 5FYJH 2GY5A 2HLAA 1ZA3B 4MDJA 4H8WC 4HEPA 4B9GA 1WAAE 4CKVX 4A66A 1INQB 4RZCB 3BDYH 2D03L 4QHMB 2EDFA 1F13A 5IJVA 2YD3A 4PB9H 3WHXB 1HI6B 1F11B 2VXTH 1KLUB 1SDAB 1XIWA 2VDNB 4PV1C 2A73A 5INCB 2VO5A 2VL4A 5T1KB 4HCFA 1S8DB 3ZKXB 4AV5A 4O5LH 2BFVL 1TTRA 4H26A 5F3HB 3TN0B 5HVFB 3ZJAA 1CURA 5HTSA 4JG0H 4OFKA 4TUJA 3U9UA 4WY7H 2ZAHA 3UL4A 3GMRB 5K9JL 3PXJA 5E4EB 4KGJA 3I2CL 1B2YA 1U6AL 3LIZL 5E1GA 3EOAA 2GBUA 1R3HB 3BIBX 1ZS2A 1NL0L 2ZTBA 1E0OB 3ZN6A 2QPDB 2ADIB 2AXJA 1RI8A 4A6YL 3WMQA 2DWEB 3ULUL 5D7JD 4ZFZB 5HYJB 4HG4J 4WUUE 1P7KB 4L23A 4MNGA 1UH3A 4ODUB 4FNQA 4NBXB 2ZYSA 1KIRB 4E9TA 4A2EA 1T89C 4RFNC 2EP6A 4OCLC 4BFKA 3BPNC 2P47B 4ZO8A 1CIDA 3RGHA 5CEXA 1CDYA 5IQMA 2DBLL 2KS0A 1RD6A 1B4TA 3VXUB 2WOBA 4HUVB 3GMPA 3MBEC 4QT5A 2WXRA 1YQVL 2AW2A 4KKLC 3MUZ1 3ESNA 3EH5B 3O6MH 4JQIA 4NIKB 3LPWA 4ZMXA 4H1LA 3R8QA 2XWJB 2XQYA 3IDIA 2QMKA 4HJJL 2CJTA 4ODSH 3N41B 5A1AA 1RZIB 5LGHH 3FO2B 1A14H 1OSYA 2ADJB 4JPIB 3NP3A 1IV8A 3MROA 2WY3B 4KPHL 2QQKH 1IAIL 2DIAA 3DGGA 4HIEB 4F7TB 2BIHA 4XAKE 3PS6A 4H8UA 3KWUA 3T71A 4CMHC 4IEFB 5IHZB 5JMOC 4NO3B 5I2IB 1B2WH 1JHKL 1I7RA 3HPLA 4NT6B 4HCRH 1HE8A 3K2IA 4RGOL 4P9ML 2Y69B 3O8XB 3OX8A 4QRPE 3D3VD 2VZ1A 2W38A 4FP8H 3CVCA 4Y2OA 5DFVC 3D12B 4JPWH 4F37F 1NCAL 4POZD 5C0AD 5BO1L 3QXAA 4BZ1L 1NM4A 4P4KC 3DV4A 3KLDA 4KTYA 3ZE0F 3IMWA 1ZJAA 3SBQA 3LN5B 4M61B 5A2AA 4AVHA 4DO4A 3GMLB 4ZPVB 2UY6A 3GBNH 2AQNA 2XN9D 2V3EA 2ZG3A 4LU5L 1KIQB 3QCUH 1XF2B 2H6PA 4LCCC 4BSWB 2IVFC 5GS1A 4LKCA 5AW0B 3WS3B 1GZQB 1RVFL 4JHAH 1JVOA 4F27A 3F6IA 4H13C 1CPUA 5EUKA 1P4BL 5E8NA 4Y7MA 4PD4J 1N7MH 3VD7A 1YUHA 5ICXA 1EHXA 1GVIA 3FQWA 3MV8B 1FNEA 3M45A 3CQFA 5E08L 9CGTA 4G8AC 4EZMA 3PWPA 1E8XA 4UZGA 1FZKA 1G0YR 5LJYH 2NY1C 4OCRH 1GMIA 2H0EA 2G2RB 2XXFA 2NQ3A 3HS0A 4FNLL 4N0FB 4EF3A 3VD5A 3UYOD 5IVZA 5TK2A 2DTSA 5I74C 2GSIB 1KPVA 1JTOA 4L3CA 1DBMH 1F41A 4PRHA 4EBQL 4V1DA 1G9ML 2Y7OA 1HYRC 2X4OB 1JCVA 5KSBF 3N3EA 3SPGA 3VFUA 4AUJA 2ITDB 4L2YA 2A6IA 5AQ0A 3VSUA 4ZFOA 2CMRH 3LRKA 3QRBA 8CGTA 2W07B 2OMWB 1KUMA 3QEQE 2UVFA 3WKNA 4N6QA 2BRQA 2XX0A 2EEDA 3QQ9D 2EADA 4ZW7A 3SDAB 5CCGE 3SDDB 3R1GL 1AZZC 3RIKA 5DWUH 1KCVH 4ZX5A 3L54A 1BXXA 3L95A 4APQA 2NSQA 5EFIB 1CL7H 3BFWA 5D1ZB 1GC1L 1SEBA 1BG9A 3E8UH 4HWZB 2L7EA 2VR4A 1TJXA 5AKTA 1ZHLB 2V2XB 4PJAA 1T0MA 1RUPL 2AJSH 4QRTB 1F97A 4XVUC 3PHQA 3W9DB 1MREH 2ZXAA 4M6NL 2I9TB 1J0JA 1BMWA 4H4NA 1OD9A 5GGQL 1PIFA 3FF8A 1PSKH 2VITB 4L8BB 3RYMA 4OLXH 1H3WM 5D1QD 3ZTDC 5B1CA 1VEPA 3NJXA 1PGRB 1AO7A 2WLIB 4OCWL 1IARB 1O7VA 4U4IA 3TTYA 1M7DB 2OZNA 25C8H 3OLDA 1GAFH 1EEYA 3ZDXE 4G9DA 1S7VA 3H3PL 1XH2A 1UEYA 3VXQA 2VXSH 2BRRH 3ETBJ 1E9QB 4L3EA 4P46A 4WCYL 3QDMB 4J3OH 3MV9B 3U9PL 4PBWD 3ARWA 5LGYA 3IPEA 1MJUH 2A9AA 1CS6A 2J73A 3BYTA 1QW8A 2GC4C 3T2NL 3MOAL 1ETA1 4WZ9A 3MLRH 2Q8BH 3SOBH 2VE6A 2PXYD 3PUCA 4DEUA 4NGHH 3EDDA 4LT7A 3GBMH 3H9YA 1I1YB 4MCZB 3NZSA 4PJ8D 4KJWD 2B1HH 2HJLB 3IRPX 3MNMA 3AB0B 3WI9A 2DMKA 2EDYA 2DYPB 4PUBL 3OHXA 2IFGA 5HHVL 4HK0B 1Z9NA 2ZOLB 4FTVE 2HRHA 3WY1A 3ZE2E 4L37B 3TVMC 1RY7B 4MA7L 4Q0XH 5T3ZE 5I6LA 3EYVA 1PKQE 1J5IA 3VGHA 4TSAL 4YDVB 4KVNH 5DGRA 2XZAL 1CE1L 1E5ZA 1WZAA 2EDKA 4IYKA 1EAPA 2UXTA 1I9IH 4N0UE 4YDIH 3S36X 1UXMA 2APBA 2EIZA 1FZOA 3C60A 3MRMA 5EU7C 4LVEA 4PIRF 1J1PL 5AAMC 2X4NA 3DHJA 1FYTD 3R19A 1CYXA 5BVPL 4F15C 1NCBH 1HNFA 3LIUA 3RUGB 2GITB 1JF5A 2XWDA 4U1LA 1X5LA 3C5SA 3DUUB 3MNWA 3QEGH 2ZYRA 2ZQKA 1MCWM 3TBYA 2FJGA 1BSIA 3VFOA 1LJMA 4E36A 2XZCH 2XTJD 2W95A 4OIFA 4P05A 2Y0SA 1OB0A 1HL5A 4GSQA 5IUSA 3BVDB 4MCNA 4LVHC 2Y07L 3GM0A 4F7KA 1BVKB 1T4WA 1H0DB 1WFMA 1MFEL 2VL5B 1NANH 4OUUA 2LVEA 2ARJB 3UXFA 5IB3B 1KZYA 4GFXA 4AG4L 3L3GB 3O2WH 3BKYH 1WAEA 4JRYD 3IJEA 2YD9A 2OMTA 4K55A 5CZRA 1DO5A 1HXMB 1C5DB 1QW9A 2XXMB 2W60A 4OFDA 4UIMB 4OIIH 4NQDA 5ITFB 4XO3A 2IIJA 5D2LA 2NY2D 3KBEA 3BIKA 3CXHK 2GAZA 2ICWB 3RWFB 3MGOB 3TBVA 1OY3B 4G1MA 3IXTB 1OTSC 5JUEH 1FCGA 3L3JA 1UXSA 1M56B 2HMID 1EO8L 4LP5A 3IFLL 3PQYB 3IJ9A 1BFVH 2NW2B 5F7YC 3AUWB 1U93B 3CFCL 2OYMA 4TUOA 3JUZA 2JJUA 3SJVA 4ZT1A 4HK3N 2BVQA 4DHLA 4RIRB 3RGBA 4FYSA 5DS8A 2ERJC 2K0RA 4IQHA 2OTWA 5IQLA 1VADB 3HG1A 1D9KD 4NQCB 2D9QB 2VSDA 3MRQA 2X2IA 2AQ3A 4XNMA 4XCCL 4MAYA 4RAUA 4YHYB 1NC4A 1KIPA 1DBJH 4DP7X 3KNBB 1AGCA 4YX2H 1M53A 3QE5A 4U1GB 2IFFH 4MSWA 1C1EH 2DOCA 4WUUD 3HZKB 1S5IL 4APXA 1TJGH 4XCEB 3D1MC 3PHOA 1O5DT 1VPOH 3WFDL 1YJDL 4DVBA 3LXCA 4ZMNA 3HRZB 1BBJB 1F42A 5F7FA 2GJ6D 3O41A 5C09D 2DL9A 2Y7QA 3LKRB 4KXZH 4BQ8A 1D3CA 1SJMA 3ZE0B 4F8LA 4WHYG 3KVPA 2WBXA 3TYFB 5DVOA 3CPLA 2D7TL 1MELA 4LLDB 4DP0X 1A2YA 1ZLUH 4PCKA 2PETA 1QRNA 1AHKA 2WOYA 2X9XA 3BEVB 1BFOB 1ES0B 2JB6B 4IRZL 2VR8A 2VDNL 2R83A 3I3DA 9PCYA 4XMUA 3SDCB 1RLBA 3X1NA 4XAKD 2QTVA 2IPTH 6PCYA 4LAQH 2ATPA 3OB0H 2EDQA 2ZG2A 2ZUUA 5DVNA 1IEBB 2EIDA 1UJTA 4FMFA 4HIJA 3G04A 3S37H 1UGKA 1CJYA 3SQBB 2B7DT 1WZMA 3V8CA 3HAEB 1IU1A 1BIIA 4PWJA 3B2VL 1BMGA 1G7QA 1SLWA 4QRPD 3DETD 3VRLF 4K7FB 1Q0XH 3SE3A 3LS4L 2FNWA 3WMSA 3IU3A 5T8IA 4JPVL 1NQBA 4ZOAA 3BFOA 4FQJH 5D2NB 3VUAA 2JELH 4P3CH 5KSBB 5KBLA 4Z95L 1JPEA 2BNRB 6FABL 3NCJH 1A3QA 2WNXA 1OAQH 4FCAA 1A6VL 2CK2A 4FF9A 4X83A 3SKMB 4CVUA 4FADA 1N5AB 1NEPA 2OPCA 4LLWA 3RWGA 3C6SA 1ADQA 1WZLA 2BSRB 1X5IA 1KCBA 2R2HA 5AVYB 4YEFA 4ZZFA 1T5XB 4J1UA 1BM7A 3I6GB 1UCBH 2JXMA 5CIPB 1HSBA 4AYFA 4GUOA 4FG0A 3FXIC 4AWJC 1EJOH 5K59F 1QFWM 1G1OA 4BCZA 5ACZB 2FGWL 1MEXL 1RUMH 4HS6A 2WAHA 3VNYA 4KNUA 1I1CA 1BM3L 4DZBB 3ZIMA 2LV4A 2QGEA 2YJLA 2J1YA 5EZJA 1TZHA 3GEFA 4YDKH 5BRPA 3BN9D 1WS7A 2XWBA 1BG1A 3KYNB 3VXMB 2RQ8A 5CEZE 4G1EB 1KTCA 3O45B 3GSQB 1AJ7H 1G7LB 1A66A 2PWHA 3QYCA 4L4TE 1MWAA 3EFDL 4I0PD 3TJEH 5A2FA 3MXWL 5LWYH 4O58H 2G2NA 2YO3A 4EIZC 2DWYA 1XAKA 3QEQD 2GJJA 3EGSB 1GS8A 5FM8A 4HV8A 3DVNA 1WRFA 3LPFA 4OF6A 2R4RL 4R5XA 3LKOA 3BUIA 3GINA 2C3VB 3RWCB 2QKIA 4M29A 5IOPB 3JTSB 5IHHA 3U46B 2OMXA 1UASA 2Z4QA 4HX1A 5DCCA 5IGXH 4K15A 1NGYA 3NBNA 1DVZA 2X3CA 4WSKA 2N0MA 2Y9RT 5EV7A 4N25A 4EVNA 3FQTB 1YZZA 5B1AB 1WA2X 1O6VA 4HJEA 1G7MA 4L1BA 1DUYB 2Z1KA 4KQ3H 4K3DH 4YXLL 3V9FA 1G7IB 1LQSR 2D7QA 3WNMA 3V4UL 3MI6A 4NZRL 5E5LA 4Z7WF 3LV3A 4FG2A 2H32B 4L0PB 3VRIA 2DQDH 3HC4H 1W8OA 4PJIF 3PL6A 4F7PA 3N1QC 5GRJH 4TQHA 1QO3B 4MMXB 2IO5A 5ALCL 2BZCA 4QXGH 1Q9OB 3IJHA 3HC0A 5IB5B 1OOWA 4O00A 5IMLA 1F18A 1MCJA 3QORC 4DH2A 2OMUA 1WIPA 1G87A 1NEZB 3TL5A 3GJEB 1VACB 5E0QA 1U91B 2NY2C 4XMVA 1KCRH 4XVJL 3K2UH 4EN2A 3C08L 5L6YL 2W9DL 4D0BB 4ZS7L 2HMIC 3WLWC 3TURA 4Y2NA 3JQOB 2XWCA 2DQHH 2Y36L 2X0WA 1BZ7B 1IVTA 4RFEA 1AY1L 1IM3D 2HJFA 5IVXE 1OKEA 4ORGB 3HMXH 5CLTA 1YNLH 4OFVA 3L4TA 1XQ4A 2BVUA 2ZSVB 4H40A 3OLIA 3CZJA 4G80A 4JJ5A 3EKCA 3OG4B 1D5MB 2C9RA 5DK0B 4GQPH 1CI3M 4UOQA 4N2HA 4KKAC 2BHUA 4GBXC 5BRZE 1D9KC 5EZLB 3QZWG 1U8CA 2I5YL 5DD0L 4FTVD 5J1SC 3QHTC 2K8QA 1E40A 4AYGA 3ML8A 5FGBA 4QYOB 1I7TB 3W0WA 2AV7A 2GFBA 3WNIA 1ZLEA 4DFIA 12E8H 4A04A 2JKSA 5INDB 2FJHA 4UT6H 2XX1A 3C6EA 1R46A 4YHLL 2A9ML 4OFYD 5EEUA 3RIFK 5BUPA 4XE5B 4QRAA 2ZKHH 3QRLA 2X87A 5I66A 4ELMA 1H8NA 4O2EA 1NFKA 3R0MA 3R7RA 3TJHD 5DJ0B 3WN5A 2QHRH 4NRZB 3ILQD 5FCSH 2CLRB 1EHLL 3Q1SL 4R96A 3LEYH 4ODTL 1MY5A 2FVNA 3KPOB 3BT2L 3NN8A 5I1HH 1OAKL 2Y7MA 3KWWA 2RJMA 3WJLA 3V0IA 3ZQXA 1IT9H 3DXAA 4H25B 1ZHBB 5IP4A 5I30L 2ENQA 1UXWB 3VGBA 2VQ4A 3FUKA 4ZNEE 1AZVA 5FW8A 5H35B 4HOMA 2QFPA 3I74A 3O3DB 1G5GA 4OZFG 1UWGL 4PVMA 4UT9L 2EDXA 3ZE1F 1ITBB 1FAIH 1WEJL 1R3KA 4DKTA 1KMGA 3GJFH 4ODWB 1TTGA 3L3KA 1F4XL 4O51B 1I3RA 4CSTA 3W11C 2BP0A 2Z31C 3QRGL 3IGAB 3DVGA 5LXGL 3VTTA 2N1KA 1FZMB 3CDFA 5D71L 5DJ6B 1Q0YL 1FLTX 3JWDL 4PTUB 4ERSH 5A2KH 3IXAA 1JPFB 5MEPA 1SHXA 2Q7YA 4XBPB 4PRAB 2BP8A 1LGVA 4X6CA 5EO0A 5F89A 1JGUH 5JPNA 4J3BA 2ZOWA 3L3IB 4YHOL 4G8GA 5I76B 1JZJA 1CR9L 1LEGA 3CV5A 3VM7A 4PYHA 1E65A 3II3A 2V8MA 3G6JE 1I9RL 1JXKA 3LCYA 4PI0A 3VYPA 5SX4I 4CDHA 2GK0A 2Z8RA 3T8XA 4BK5A 3VJ6A 1PY4A 3P3UA 4BJLA 2HLEB 2E47A 1B0WA 2J8UF 3VXTB 4XPTL 2BNQB 5DXWA 2OZ4A 3ULUD 4N5ED 4NSKA 2PTVA 1YMMD 1X5GA 5FKAB 5DEGB 2RGSA 5GGRB 1BW8A 1DEEB 4QTHA 1KGCE 1IKFL 3OKLA 4XAWH 5B3JE 5T1LA 2F68X 1CFQA 1RUKH 2Q0ZX 1FFNA 2BIPA 1GTNA 3PNWB 1UA3A 5CINL 3AWEA 4MHHG 5HGDB 1RZ8A 4I0PC 5BQDA 1A4CA 1MG2C 3X3GH 5A2IH 2Q87A 3F62A 3FT9A 5F93C 1ONQB 3IMUA 1LO5A 3RX5A 1FVDB 5E03A 3BSZA 4F9PA 1WS8A 1VGKA 1NIFA 4BQBA 1IGFH 1PQZA 3SCMA 2VXUL 5C92A 2BIOA 4FQXD 4JFVA 2HP4A 1T89A 4TQ8A 1OE3A 1NM9A 1TVBA 2AEOA 2HZHA 1HOCB 3COOA 4M62H 2P49B 1S78C 1I3GL 2P3YA 3BVNB 5FKPB 1OAXL 3ZK0A 5D7LA 1ND0B 3IU4H 1T6BX 3EDKA 3MBEA 3IB4A 3BZ4B 3ILEA 4WEUD 1HN1A 2IPKB 3D69A 4X6CE 4LPYA 5D7HA 4F8TA 5I18L 3VFPB 3LHPL 4ES9A 4I88A 4QGTA 4Y16B 4X4XB 5CCHE 4UNVA 1O6SA 4IBSA 4X7DC 5H94B 3U4EA 2ENYA 1U8QA 3IRCA 3K8LA 4OJAA 5HYJE 2P7TA 1AGDB 1KDIA 3SKNA 4KJQD 4JQXC 1EXHA 1P5VB 4HLJA 2CRYA 2N01B 1B4JL 1TZAA 3MFGB 3ILPA 4E5XG 4GSRA 5DA4A 3F01A 1V55B 3O6FD 3EFFB 1OT1A 4NN5B 1MHCA 1ZWIA 3K0YA 4LO9A 4YZFF 1MVUA 1U8JA 2ED8A 2I27N 1L0YA 4P23D 3L2NA 3UP6A 4I2XA 2UZIL 3QXDB 4LCWB 2X2YA 1XF4A 4Z77B 4L9DA 4P4KA 3UDWC 1EZLA 3ARPA 1ETB1 4UDUB 5FA3A 5A2LH 3ESVF 1B3IA 2IWEA 1ZGLA 4YIQA 3L4WA 2YS4A 3PREA 2VDOB 1J0HA 4PRIB 4PW4A 3RFZB 4JO8A 1H19A 4NHCL 4JFEA 1I7UB 5EA0L 1RPKA 4LHUA 2CKBB 3EZJB 5CEZD 1CFTA 2J5LB 1WYJA 3VFWA 4MD0A 2WWNA 1D6VH 3IKKA 5BVJA 2R69L 3S5LA 3OAYH 4L4TD 2M1KA 5AVUB 4Z7WB 4NQVB 3O2VL 4PJIB 2DQTH 4G7VL 1IJNA 3OVUB 4A7VA 2IEPA 4PY7B 4XPHH 2C3HA 5GGTL 2VABA 2X10A 5HYSB 1HEZB 4X6FA 2Y5QA 2G3MA 3NTCH 3BZEB 1N3NA 1X44A 4XO8A 5E24E 1MW3A 4ADIA 3BVVA 3PP4L 1YN6A 3KEHA 1B3JA 5BZWA 4MFHA 4DQOL 2RD0A 5EIVA 4WNQA 4GAFB 2P46B 5E2UH 3NJFA 3O3EA 1U2HA 5IOKA 3OHMB 4Y8AA 4H2CA 4RFOH 4S1DD 4BFFA 1JCKA 2MH4A 3ZR5A 3VGDA 2DWXA 4NPKA 4FLHA 1ZT4A 3HA0A 3QEUA 3DX6A 3AS0A 1TO5A 3FT2A 3JWOL 3QDHA 2QQQA 1MHEB 5B39B 3VQLA 2DYRB 3MRKB 4XRCB 3IJSB 1NBVL 3V5KA 4Z7UF 4PGEB 5FW7A 1EO5A 2CCLA 4JM2F 2EEBA 1A1OA 1XCTA 4FQIL 2BHFA 2F8OA 4OU3A 5HPOA 2AJ3A 2Q8AL 2DS4A 2I07B 2K6YA 5CLXA 4FABH 4JFYB 1LO3L 1U92B 5M94B 1J8SA 5BUGA 2QPSA 4GIOA 1AH1A 5FB8A 2EC8A 5C07A 1GRWA 2G3ZA 5CP3H 4NRYB 1MY7A 1RP8A 2QADB 5FO9B 3RDTD 4X5XA 4AT6B 4H8VA 4HUXA 3MRRA 1ZANL 3BEWA 4PJ6A 1NDMA 1ZK9A 4XCFH 4FHBD 5DT1L 2VDRH 4ZDHB 3WIHH 2X6MA 4JREB 4E0RB 4HDIB 1AI1H 2NCMA 2EABA 3G5VA 5C0EA 5BRZD 4CVZA 1P4LA 4AVJA 2WPGA 2O5XL 4FJ6A 5DJZB 1KB5H 4K3EH 2XACC 4EIUA 3OQ3B 3S5YA 2RB8A 1QA9A 3MLWH 4AVKA 4ZUTB 3P4OA 4XP1L 4BCXA 4IBVA 3L1EA 4OIAA 2V8LA 1M2VB 3F5WB 1Q8MA 1MCKA 3ZRCC 2XWXA 2X4RA 3ZE1B 3ULUC 2OSWA 4N5EC 4X99B 4J12A 3GKZA 3N5AA 4MXQC 1BZ9B 4N3UA 3MBWA 5EU3A 2FJSA 2DBJA 2OX5B 1CZ8H 4JN1H 4WJKB 3FB8A 3VFSA 4DCQA 4Z7NF 4NXSA 35C8L 3QDME 4R4NC 2IALA 4KDWA 1XV8A 3UTSB 4AH2A 2BC4A 2VR6A 2B4CL 3TVMA 1N12A 1TJMA 5E4OA 5HHQB 3FONB 2CHXA 3IDGB 5FW6A 3WHE0 3HMWL 4X9BA 4N87A 4CU8A 3N6YA 3GSOA 1M1XA 5D8JL 4LSUH 1I7ZA 2FX9L 3HNSH 4NRXB 2YKLL 3B7UX 3QPQD 5AAMA 4GEIA 4KVCH 3Q1EA 4GAYA 3BAWA 3HE7D 4ZTEA 1NPJA 4FQXC 5DHXB 1QTYT 3FUIA 3PP3H 3S5LG 2IQAB 2J8UB 4HS8L 2NW3B 5DF0A 1ETJA 1X5KA 2WP3T 4R4FH 5LQBH 4GKSB 5DZLA 4YHPA 3CN0A 1P7QB 3PG2A 2BCKA 4NUGH 5J0BA 3UCRA 1IZKA 3HLKA 3LSOA 3BLBA 5TK4A 4BH7A 1YEJL 5GJTL 4R2GD 2R4SL 2BZ7A 3SPVA 4R7NB 5DQDH 1N26A 4N8VA 2P5PA 2G9HA 3GHEH 4XN5A 4P2QB 4EUPB 3QB7C 1DLHA 5DUPH 4QDGA 2ADFL 2JIXB 4HOZA 3MNDA 5D5MA 5I75C 2J56A 3QVAA 3RUGE 3P0YL 4XXDB 1QLRA 3D34A 3AY2A 5DSCA 1HXYB 3RNQA 1CBVH 1DQDL 3SO3C 3TNMA 1R5VB 1AS8A 3QPKA 4YO0B 1OSPH 2ZNXA 1AACA 3GXIA 1BJ1H 4M48H 3S3PA 3UX9B 2LU4A 1TCRA 4P23C 4YGVB 3CLFH 4E9WA 5LDUA 2MOGA 1FO0L 3LXUX 1W8EA 5KTEH 2WYTA 3IDMA 1T0OA 3ZBMA 4AIXA 2R29L 3G5WA 2ZT9C 4HG4K 2J2ZB 4UM9D 2XN9A 4WHCA 5IHLB 1KENH 4RH4A 3CFBB 1IC7H 1KGCD 1QNZH 4MNHB 4NWUL 5DZNA 1QEWA 4IMLB 1MFBH 1JPTH 3T2QA 1G9MC 5TE6H 1OP5K 1C7TA 4AQAB 1I4FB 3MU3A 3VFNB 3KH3A 3L17A 3IMSA 1WZ1H 3K72A 3BUTA 5IW6B 3KJ6H 3ROLB 1A3RL 3GBEA 1GGCH 2A77L 2ZOUA 1NGXB 2ZCKH 3PQYE 3LZFH 1G1KA 1A7OH 3EDJA 1X5ZA 3CVHA 3HW7A 4X4YA 1A3LH 1X5JA 3RZCB 3OGOE 3DC0A 3G3LA 4JY6B 4NN6C 4PG2C 1K8IB 3A6BL 5T1KD 2WBJB 3HG2A 4WHTB 1F8TL 1JJUA 3F3HA 3WKYA 1B0GB 1RUQL 1RK1B 2ZXCA 3WJJC 1I9JL 1ZT7A 1HCFX 2KC0A 4G5AA 4NQCE 1KB9J 5EUOE 4LVOB 1FFOA 3DO7B 4NFDA 4XPGH 3WFCL 2PYEB 2NR6D 3L7FB 4ZFFA 4WI4A 3DKHA 4PJEF 1TR7A 2WWKO 3ZGIA 3NJIA 4PJDF 4LLUA 5E2WH 3F7LA 1W72B 3ES6B 1S9KC 2AQ1A 2NRDA 4FFZA 5HYJD 3TNNA 2W65B 1JUFA 2EJ1A 2FZ3B 1NFIB 3FBQA 4IS6B 2XPGA 4K3GA 2SEBA 5BZXA 5KSVA 1KJVA 3QXTA 2HRPL 5FLVA 3H2WA 1PD6A 4N2KA 4I85A 4GKZB 1IQDB 4NKMB 5HJ3B 3VXUD 3ZE0E 4U49A 4MZ2A 1XR8B 3QIUB 4GLRH 4XWGL 1IQWL 3IDYB 2ZOKA 3IFNL 2P5EA 4PD4K 1JZ8A 4HHAB 5JQ6H 1O9WA 3SQOH 1IGCH 3EOBB 1NKOA 2X1WL 3I84A 4OBRA 4YDMA 4H20H 4Z5RB 5IKCA 4XP4L 2X4PA 2ODIA 4YQXL 1T2XA 4ZTOL 5FHAH 4AOFA 3DROB 3EYSL 1MCHA 5AOZA 1V05A 4ABVA 2MRYA 4KH2A 1RU9H 1MCEA 2GKIA 2DLFL 3U4BL 1VFMA 2L7JA 3DSFL 4BSJA 3O8XD 4N8VG 3GI8H 3E2HC 1IIIA 2APXA 2Z34A 3FO9A 5J89A 3S8WA 3N42F 5GS0H 4Z7UB 5CJQH 1Q9LA 3HI6L 3MJ7B 4JM2B 5ALBL 1VRSA 3N9GH 1N10A 2H1PH 4L9LC 3SGJC 4QOKA 3G5ZA 5KSBE 2FIKA 2BNRE 5ANME 2COQA 4LCYA 1FVEB 1YYCA 2WYIA 1K9TA 2AJYH 4QAWA 3F12B 1T5KA 3F7QA 4TL4A 3RIAF 2OYLA 5DQJB 3PGCB 5F96L 5D1XC 2K3TA 4XP5L 4LRIC 1YEWA 1OGTA 2VXVH 3BCDA 4IIQA 4BA0A 1HQRA 3MV8D 2ITFA 2BERA 1OARH 1MNNA 5IUCA 4K73A 5T5FA 4OI7A 1FYTA 4POYA 2O5NA 5LCVL 4WU7B 4BUGA 2OR9H 4RMVA 6PAZA 4G3YL 4CW1A 3HRPA 3VG9B 1BZOA 2VXQA 4KJPC 1AYRA 2DLEA 2AXFA 2CKBL 3PY9A 2V7HA 3G6DL 4FXGA 1AP2A 2O1AA 3IGFA 5ESQA 4QJ5B 2DV6A 4NKOB 3BGMA 3ZTJG 3KXFE 1L9TA 5HDLA 1Z9MA 3LNGA 4MASA 2YAEA 3QT2A 1ED3B 4BBWA 3MZTA 4U1KB 2W0FB 2ICWJ 2Y06H 3VYOA 4Z7NB 3HAEG 4JX0A 3SDAD 5TE7L 1ZOXA 4PCTA 3SDDD 3QUYC 3VXSA 4LGRB 4U6TA 5E9DB 3FFCA 3RKPA 4ZMLA 5BW7A 5B7MA 4NWTL 4IDJL 4Y7OC 4ZOBA 5D1ZD 5CJOL 1WD8A 2G3NA 5LAXB 3QORA 1GHFL 1EEZA 2ED7A 3WUWG 3UYRL 2EYRB 3HG5A 1A4JA 5E0FA 4Z7VF 5I0DA 1C5BH 3WE6A 5EB9A 2Z8SA 5B1BB 4AEEA 5KOVC 5I19L 5PAZA 5D70L 1BYNA 1ACYH 2EYSA 1MCQA 1U36A 4GKNB 2R2BB 1SM3L 1J8RA 3P2BA 3AMKA 3WKPA 1IL1A 2YZ1A 3F00A 3FQRA 3DV6A 5DJYA 5KVEH 5CHNB 3AT9A 5DQ9A 1F58L 2WTPA 4CC4C 5DLLA 3M17A 4YLQT 3O11B 2ITEA 2GY7B 3DPBB 4N1HB 1YJDC 1C12A 1NFDF 5BNXD 2BIQA 4H5SA 3QDMD 4GBXA 2ZOOA 4AQ8A 3MV9D 3P4MB 4ZUSB 2V2WB 2B16A 3FTSA 5DRNB 4U0QB 5JDSB 1D2PA 4KHTL 4OR1A 3B5TA 3GF8A 3WCYA 1KG0A 4MBRA 5AVWB 4B41A 4ENEC 3PGDB 4GQ9L 4N22A 1HQ4A 1BX2A 1BOYA 1IEAB 4K7PH 3WV0A 2AK4E 1PAMA 3BGAA 4MNQB 1L6XA 4OAWB 2J4WH 4GEJA 4G6AC 4X7SL 3GS7A 5GHWL 5A3ID 1FNSH 1JPSL 4O4YL 3I6KB 3SY0A 1E4WL 2Q1EA 4EN3B 3RLSA 2DYPD 4AE1A 4ZYKB 3NESA 4HK3J 3TBSB 2I60H 3ZKXC 3EJCA 1N6QL 4DGIH 3TN0C 4TLTA 1RJZA 5CBAB 4UDTB 3VRJB 1KJMB 1W16A 4WJ5B 1L6PA 4UT7L 5C08A 4HJ0C 4WEBL 2B0SH 1E6JL 4LVNB 5I71B 1Z1WA 3RB7A 3M1CA 5DD6B 2OMNA 3BP6B 3VMOA 1F02I 4PLJC 2BOBB 2EILB 3FMGH 5E1AA 4L4VA 1MRFH 4M5YH 3S34L 1F4YL 3QULA 3P4LA 1D5ZB 5E95B 1P1ZA 2IXQA 1AGEA 1LNUB 2EDBA 4HF5L 4P4RB 2BHZA 2X4UA 3ELQA 3TV3H 4M1GH 3INOA 5ABAA 3BUBA 5AZEL 3QQ4A 4HBQA 1XL6A 3VXOA 2O5ZL 1KLGA 4JQIH 5AL8A 5C6TL 2Z31A 4H1LH 2VDLH 3JZYA 3X1EA 1A7NL 1M05B 3CLEH 3EFOB 3IMTA 4FXTA 3U4AA 2IGTA 4L5FL 5EO1B 1FUNA 2MQGA 1PG7H 2VIRA 4CKQA 5ADPL 2IANA 3NK3A 1EUTA 2EO1A 1OALA 3OG6B 4XC3L 3K81A 3C9NA 4RAVB 3I50H 5F8QC 1M9WA 4DN3L 4FFWD 5JHDA 1AXTL 2MNJB 4PJEB 1PZBA 1BAGA 3FB5B 4O9HH 4PJ7A 4PJDB 4YVNA 1A7QH 5AG8A 1T6WA 4C83A 3TCXA 3LRHA 2JB5L 4XBMA 3O8XC 4EKXA 2EE3A 3WS6C 3O3AB 3IDNA 3BH8B 1RZKH 4CNIA 1HINL 2VRKA 3PQYD 4JMNA 1GJIA 3FTGA 1IFHL 3VFMA 5IVNA 2C7UB 2RBLA 4RGNE 5A6MA 5CJ8A 1YVLA 3UEZA 1XBRA 4J3OF 3LEVL 3QJVB 4IU3A 1JE6A 4FL4B 2FECL 4PTTA 3B8SA 4B9ZA 4DEPB 4F57H 1RSFA 3P11H 1JZ2A 1C9SA 3IS0X 3OAWA 1G9NH 3VFTB 2IWGA 4NQCD 3K74B 4G9FB 5CJ5A 5KYYA 1E4XH 1A65A 1CFNA 2ICEB 2JLLA 3G6AB 3MLYL 5DFTA 4OI8A 3W5NA 1RK0B 1QSZA 1AR1D 3APDA 4IBYA 4QF1A 4D8PA 1FORH 2BXZA 2P9RA 5FO8A 3QQNA 4KQ4H 4NN7B 1UB6A 5AENA 1CXLA 4MX7B 4ADJA 5L9DL 1RZGA 1R3IH 4IRJC 2VLRB 5JR1H 3QUZC 1CXHA 2CUHA 2R0WL 3DX9B 3EG9A 4X5PA 4BWWA 1RIUL 1KGJA 4OF8A 3CK0L 3VRLE 3E38A 4HUMB 3N42B 2HT4C 5F6IB 5I1GL 4OZ4B 2F53B 3U30B 4HS3A 4JKPL 4BDVA 4GRWB 4P5TD 3QDGA 2BVPA 1TQTA 1OTTC 2GIYA 1ZSHA 4ODHH 1FLRH 2RQEA 2WJ7A 1THCA 1A6UH 2EECA 4GG8B 2ZCZA 5ICYA 3NCCB 3FTXA 3WJMB 3QIWA 4F9LC 3QWOB 3SDAC 5TDOB 1SXAA 4W68A 3UMTA 2MFNA 4HUWA 4CADB 3N40F 3Q6FB 5KYUA 5GRXG 2D7OA 4U1NA 1UFGA 2L8AA 3FUDA 2DLHA 1R19A 2WB1A 3LS5H 5K59E 2LLNA 5H2BB 1SLVA 2GEEA 1AGFB 5GZNC 2YGNA 4XZ4A 1ZHKB 1SQ2N 3P30L 1FRGH 4JPSA 5CSBA 1DZBA 5AKRA 3NOIA 1MAML 2ILLA 2VB5A 4YVUA 1YYLL 3UDWA 3P9LA 4DJMA 4CUCA 3K4DA 5AZUA 1W72L 3JBG7 4N28A 1WO2A 1CDHA 3BJ91 4FLQA 4F33B 3KL5A 2AITA 2YC1B 4OY9A 1SJHB 5J6SA 2BNRD 3DBXA 5C9JB 1BZ8A 1M42A 4FHJA 3HKFA 1P0SE 3E8VA 1DN0B 2RACA 5L2JA 3D51A 3WDHA 1M1SA 1UJ3B 1Q9WA 2PYFB 3QHFL 1F1DA 3MLVL 3PNRB 2NYZA 5IIEA 2OSLA 2YFNA 8PAZA 4OF5A 3MUY1 4G43B 4B97A 4ECNA 4WHYH 1NICA 5E99L 1Z66A 2GSGA 5IBUB 3V52L 2W59A 3GHBL 1IC1A 2A6JA 2NY7H 4AE0A 1WAPA 4GY4A 3H42L 4LCWE 2LVCA 3RPKA 1J1OL 4Y4FB 2ETWA 2WXGA 3D08A 3D2UA 1JNHB 5HHPB 1DBBL 4M9OA 4Z7VB 5CCKH 1OSZA 3AB0C 1DVFC 1UH4A 2ZSWA 2AQRA 1YEGH 3DX2A 3QDJB 3RVUD 3ULVC 2XFGB 4ODXB 4M02A 4WFHE 3ASOB 3WNKA 4Y4KB 3IGUA 3T09A 2LAAA 4Z78A 5C0DB 4NJ9H 3KXFD 4LGPB 5IW1B 4YHKH 5E2JA 2DAVA 4F8NA 5CUSL 1G7PB 4BFGA 2HUHA 3LXBA 2CLVB 2H41A 3MRIB 2AZUA 3ZZSA 2H4EA 2OCFD 3JWDC 1NFDB 3KJ4B 5C6PB 4WV1C 5I9QB 3BUDA 5F1IB 1K4DB 5DD1L 4JCWA 2CK0L 3BAEL 3N04A 4MJIE 3ATAA 4ZTPH 2FBJH 3A0OA 3II1A 5T33H 5AB9A 5HGGS 1FIGH 5EEYA 4KMTH 1KXHA 3OKKA 5IQ7L 5LG1A 2HKAA 4AI7A 5K9OB 3P0VH 1GKEA 1IJ9A 2WB7A 3ECBB 5CBEA 3GMMB 1ACCA 3HHMA 4NCDA 3NCFB 1A7RH 3ARGA 2RCSL 5EN2B 5EULV 5GRVL 1UM5H 1JIBA 2ORBH 4G7RB 4OGYL 5ETUB 5I0VA 1NC2B 2FQGA 4PB0L 3G5YA 2WSDA 3FT4A 1HHJB 3D4CA 4WI7A 5CGYD 1E6OL 3TO4C 4EIBA 1TKWB 4CN4A 1JN6B 1N2RA 4QY8A 2YKKA 3WIIH 4N1EA 3SGKA 3D09A 4X42A 4FFWC 4ZSOB 1YEHH 3SQRA 4PBDA 1N70A 1N5YH 5ESVB 1CQYA 5DJAB 4ESKA 2PCFB 1R24B 1UM6H 1IAII 3HHSB 5C6WH 3UZVA 5EU4B 2Y5EA 2G60L 3LIZA 5T5NG 3GC3A 4XZUA 3W38A 2TSAA 1ET5A 1XH3A 2AK4D 3I9GL 1JF6A 1FZJA 2HKHL 3CZGA 4E41B 3A4AA 4HUUB 5IMKB 5FAAA 1CXEA 1TYRA 1YMMA 5FPIA 3B2UC 3ORJA 4LLQA 4Y89A 5ILTH 3KBPA 3HUJF 1NMBL 4EDWH 2VC2H 1RIVL 3OWEA 3PGFL 2GTZA 2EXWD 3FL7A 1UA7A 4P9HH 1AG6A 3IDJA 5C8JA 3MV01 4ODVL 5IR1B 3P02A 4N5UA 2IG2H 3S4SG 4Z3FA 2PPCA 1DBAH 3RWIB 3D39A 2UWEF 1D2OA 1WBXB 2AGJH 4YXKH 3KLLA 5J57B 5IJKC 4YHYC 3NGBB 2NDGA 3L8QA 1DDHB 2XV6B 4EDXA 2FO1A 2GABA 4HKBB 3ZE1E 3K1KC 1OPGL 3U2IA 3E1F1 4GYBA 2CG9X 2W0LA 3MRBB 2J8OA 1Q9KB 2CUAA 4NCC1 1MAKA 4PRBB 1T03H 3MA7A 1QR1B 1HCVA 3QK0A 2PWEA 4YH6A 5C0BA 1ZPUA 3HRZC 4HHGA 3UTSE 4BFIA 3TF4A 3RHWF 4I89A 5I1KH 1SBSL 2AVFA 1M71A 4YDJA 5C0FB 5EEZA 1WFOA 1INEL 2M83A 2DDQH 2QDVA 4O02B 5E1QA 5A7EA 1WLHA 5KSAB 3TZVA 1D6EB 3KBHE 1INDH 4OSUL 4BZ1A 2K4AA 5FUZL 2XYCA 4KI5E 4S1RH 4PI2A 4TM9A 3EDEA 2Z91B 3LY6A 4RX4A 1BVNT 5CILL 1JWUB 3ZKNC 4XP9L 3LNEA 1FI8C 3LH8A 4U3SB 3NH7L 4HC1A 2Z7YA 5DS1A 3CUPA 3O3UN 3SDCC 4WO4C 2F18A 2ITCA 1NTDA 4MJ6B 2J8UE 2E7DA 3O4LA 3L9RB 4LL4A 4HZLA 4NO0B 2V9QA 1SN5A 5EEXA 1AKJB 2UY7B 4P23A 1JS4A 1M7IB 2YAMA 2BDNH 4X9GA 3IDUA 5TF1L 4YLCA 1ULVA 3FU7B 3DX3A 3CZUB 2CBOA 1DUZA 3TBWB 4M7JL 4Q6YA 5D2NC 4P2QE 2WHVA 4RGMC 4YWGH 2HFFB 3MNZB 4RGND 4J8RA 2WXOA 4XCYB 5IT2L 4FI7A 1DQML 3QCVH 1ADQH 4NC0B 2BO0A 3UO1L 4QLWA 4UQ3A 3VD3A 1N67A 1QSFA 1ZSDA 4GT7A 2J43A 1H8OA 2D7PA 4ZAKD 3FSWA 5FC9A 5DR5L 1OF0A 4G71B 1IX2A 2NXYC 4KH9A 3UPCA 3SBWA 3E6HA 4X4KA 5IMOA 2Z0BA 4OFPA 2QZ5A 5LNGA 4QXTB 2C1OA 3LEXB 1GW6A 2BNUB 2BNQD 3NPZB 3BHBA 5F8RC 1KACB 2HVKA 2Q7AA 5GJSH 4W9IC 1J05A 3WKQA 4J3VA 5JXEA 3HI5L 3JWOC 3K6SB 5I16A 4KV5F 4PG2A 2VMJA 3ESOA 3ZL4H 2X3BA 1LLAA 2F54B 5FYLL 3FCGA 2PR4H 2IDCA 3LQMA 4X6BA 5LBSL 1BZEA 1FE8L 1MWAH 3RVUC 4X80L 2ZXBA 1ORQB 1ECZA 1YEEH 4YSDA 2VNCA 5EF0A 1DE4B 3GMOA 4XO5A 1J18A 3MCKB 4P49A 2K78A 4P2RA 1MFCL 5HDQH 2O5YL 3KEDA 2XJKA 3CSBA 3S3JA 3X14B 2NNAB 2ZPKL 2R1YA 4S10A 3C8DA 1CF1A 1JK8A 4WLCA 3V0FA 2MPAL 5TPWL 3S96A 4GW5A 3IBOA 4LZKA 2J88H 5L8JB 2VLJA 5EF1A 1S3RA 5DZ9A 4P04A 1RMFL 5BOJA 3SDYH 5B8CA 1P6AB 2DQIH 4N0YH 5HGHA 3DURA 1MLBA 1JGDB 1WG3A 2C9AA 3MRPA 2PYEE 2DQEH 2VQ1A 3LPGA 4JHZA 3Q8FA 2YSSB 3ATBA 5DHEA 2A5UA 1EZVY 5I1JH 3HZYA 5DHVA 2EVJA 4P5MB 2NY6B 4HWUA 1S7XA 5E8PB 3RIFF 1UEMA 3H54A 3V6BR 4ABWA 2AJZB 3KPQA 5EORH 3K7UA 4F8QA 1U42A 2PO6A 1YY8A 3RG1C 4MMXC 2UX7A 4TUUA 1BD2A 3OLEA 1TJHH 4ZQKA 1Z5LA 2VISB 3FS9A 4AITA 4G72B 1A5FL 3OZ9L 2B4CC 4NZUH 1R33A 1E28A 1UZ6E 4J6RL 1JZGA 5I15L 3QG6B 3VW3H 4LLMB 5IESL 2DJMA 4IU2B 5SV4A 5MEQB 2A9CA 2B20A 1EUUA 4J3WA 3PHAA 4LCWD 4MGXA 3TCLB 3H9SB 1NBZB 3CSTA 3KYKH 1DO6A 4L9LA 3RU8H 3SGJA 4DGWC 2PW1B 2NZ1A 4OB5L 4I0CC 4PS4H 5FYJL 5H4ZA 4Y5VA 5DRXA 4NNYB 2QBWA 2RALA 5F3BB 3WYRA 2WYHA 1HEHC 4LNRB 1D5IH 1FVCA 4XOCA 4DP8X 3BDYL 4WGKA 4PRPB 4JY4B 5KSUA 3KLAB 1O7DE 3DK0A 3OC8A 2RAMA 3QXWA 5D1XA 1OF2A 2FX7L 3QPXL 1K5NB 2JKRM 4LRIA 3PWUA 1LK2B 5D9SA 5DYFA 4CSZA 2D31A 2EXYC 4LEEA 3DOSA 4CGTA 4EI6A 5LGKA 3U82B 3NMEA 3MJ9A 5I5MA 1PY0A 4JAMA 1WQVT 1FNGB 4WY7L 4R3SB 1XCQB 1RJYB 5SWZB 3WUZA 3KYOB 2DJ4A 4XNYH 3FYEB 1K8DB 4NAJA 4ZFGH 3UADA 3TS8A 4ZODA 3DJRA 3ZYOA 5DK2B 4MQXD 3DX4A 4MJ5B 4YSOA 3SGDI 1EGJA 1TT6A 1J5CA 3EOTH 3ZDZF 1ZVSB 4JZOB 4RMTA 3FQUA 3SPJA 1EMTH 3EO9L 4PS7A 3QUMA 3OLGA 2IGFH 5FX3A 3KDMA 2NTSP 5EU6E 5GISL 4F58H 2Q86A 1SJEB 4NDMB 3FO1B 1P69B 4HLEA 1R3JB 3TOPA 3HUJB 2XVKA 4OGXH 1CIUA 5KZCB 4LLAA 2OYPA 1TZIA 1WFIA 2OMZA 1MI5B 3QUYA 4NS0A 3VTAA 5CP7A 1WA1X 1MCBA 4NQXB 4XNXH 1PYWB 1UWEL 2UWEB 3GT6A 3O6ML 4FERA 2HKFL 4H44C 2HFTA 2WKOA 4MA1C 1DQLH 3MREA 1KN4H 1BCIA 2F1EA 3HJ0A 5LGHL 2WNGA 1GGTA 6TAAA 2E6JA 4MDIB 2QQKL 1UADC 1QABA 3ZKMC 5IWLC 2YQGA 1LD9B 2ZUWA 3QZBA 3OL2A 2NSMA 4NLAA 1S9XB 4EIGB 4ZMPA 3T2PA 2WLZA 1XF5B 3LQAH 1B9ZA 3V0DA 3VDBA 5EC2B 4X8JB 4FQCH 1B2WL 4JCMA 3MRFA 2D8KA 1RXLA 3NUKA 3FOLB 4ZPTA 2CR6A 3MRJB 4JGMA 2QADD 2CSPA 3D18B 5I1IL 5E9DE 2UYLB 1B0RA 4CC4A 1IAKA 4FP8L 4UQBA 3ZHDA 5MHSE 3IE9A 5F1NA 1W15A 3L5XL 2XVBA 3AREB 3U83A 1P5UB 1VFAA 4N90E 4RNRB 4GRMB 3O9WB 4H8WH 5J7CC 2E4FA 3QZNA 3H55A 4ONFH 3B3IA 1AQKL 3EXJA 2OZ4H 3QCUL 1I8MA 1EK3A 1ZA3A 5G5DA 4Z76B 1INQA 2MCMA 4DNLA 4RZCA 4QHMA 3M7FB 3IF1B 3WHXA 1IBYA 1RZ7L 3MLTB 3NRQA 4OM1H 2GBTA 5B38B 1LP9A 3ARDB 5INCA 3WTWA 1N7ML 1Q90A 1E27A 1UWYA 1KF9B 3EYFB 4P59H 2EDOA 4LSPH 2BY1A 3TN0A 3UTSD 3DA0A 5I5RA 4L8DA 2ZXWB 4G7YH 5DO2D 4OT1H 4WKZA 4Z9KB 1ASQA 3I3EA 4OCRL 3QUXB 3MA9L 1KTRL 3HNTH 4OD2B 4OLVH 2B59A 3EJYD 2B2XL 5E7BA 3ZZQA 1R3HA 3BSZH 1S5HA 5JPMB 2BSTB 4FNTA 4M7LH 4KOBA 5EOTA 1ODAA 1DBML 2ADIA 5C86A 4HXBH 3TXAA 3T0EA 4KI5D 3U36A 2NQDA 4L2LA 4MNQE 4ZX3A 4W9ZA 3H2QA 3EYOA 2CMRL 4AXWA 3US1A 4LBAA 2MQ0A 5KYNA 2V33A 1K85A 3RVXD 1QZ1A 5CJXC 1OT4A 2APVA 1NH6A 3D7PA 4AQEB 3GNML 3CFMA 2R23A 1KCVL 1S7SA 4E9QA 3OPZH 1FGVH 1QUPA 3VXUA 3BPCB 1T66D 1CL7L 4DGYH 4PJHF 3AS3A 3LRSB 4DTGL 2ISDA 3MRCA 4RDQG 4UYPA 4K8RC 1NGQH 3BPOC 4WI5A 2F7IA 5EOCH 2YARA 4OCMC 4Y16C 4IJ3B 3SKJL 4P2QD 4YS4A 2ADJA 2NNCA 3MO1B 1X5MA 4ETQA 3KE0A 2XUWA 2J7LA 1AD9B 1PSKL 2JIXD 3L5WB 4DP9X 5HHOA 4FS0A 4OLXL 3C5JB 4H0IA 4XPBL 4IEFA 5IHZA 3MTXA 2FUTA 2ALWA 3CU1A 3RWHB 3MCYA 1NGPH 5I2IA 1J1XL 4W9HC 4NN5C 1KB9K 1WFNA 4JEGB 2IAMB 5CR8A 4M6AA 4D9QE 3WS6A 3RGVB 1N19A 2VXSL 1N6VA 2BRRL 4JO5A 4O02L 2DQFB 2IADB 5F6HI 4QPEA 2G5RA 4UTAA 4QTFA 4IKNA 2BMKB 2W91A 1WCQA 3QEHA 4TPRH 4Y4HC 2Q8BL 5HDOA 3MLRL 3MRGB 3SOBL 4JRXB 3JVFC 4ZPVA 3KLHC 4ELKB 4ZI8A 4NM4L 4WW1B 5FYLE 5IJDC 2YUVA 1XF2A 2CO7B 1KZQA 1MF2L 2H0FA 2HLFC 2VDQH 4NGHL 4BSWA 3W81A 3GBML 2DL2A 4PJEE 3T0EE 3VCLB 4PJDE 3MRHB 4HOWA 4YZWA 4H0LC 5I0XA 4FYQA 4OCSH 3T0WA 4XMKH 2V0AA 1NBYB 1YN7B 1JGEB 3F7RA 3PDGA 3V0JA 1I1AB 2HJKB 3INUH 1A6PA 3IK2A 3ZDWA 3R06A 3HG4A 3GJFB 2ALAA 2WXPA 3TYGH 2DQJL 3TBCA 4IRJA 4K2UH 3QUZA 4QXVA 3RZCD 3B2DC 4L48A 4JVWA 3ZMRA 5HP5A 1JGLL 2K45A 3BKJH 3HBQA 5BJTB 4MMZC 4H88H 1GYCA 3ISYA 1U8IA 4UUJA 4K3JH 2X4OA 1DLFL 4P5KA 4G9FE 4RMSA 4MZRA 3KH4A 4DESA 1NCBL 2PYED 1CGWA 1KNOA 3MXVH 5A16B 4RISL 5HHOE 4X50A 2J55A 2PPAA 1DQIA 3ZL1A 3ROOB 3QEGL 5FYKL 3AGWA 5BZDB 1EDYA 1E9PB 1T21B 3BWUC 2EKSA 3LD8B 5GRWA 4AJWA 2A9NH 3D2TA 1M6UA 3JV4A 3MV7B 1CDJA 3OKYA 4ZXBC 4F7MB 4GP8B 3J2PA 5AZ2H 4QRTA 3BH9A 4Z7OF 5GZNA 2F53E 1LXMA 4OBSA 1MW1A 3V0WL 2I9TA 3NFSH 4GRWE 1NGWB 4YFDB 4U05A 2A1WH 5BCAA 4MVBD 3QIUD 5EHFA 4J4PC 2IOIA 4TUKH 2VITA 1L4IA 5HPMB 1RZJL 2WQXA 3DOHA 4L8BA 1PZ5A 3Q3GA 5I1LA 2DQ6A 1KTKE 1UACH 3A22A 5FHBL 3VWKB 3ZO9A 1A7PH 2XSKA 3ZDZB 1EWHA 4R83A 3KWXA 3P69A 1KOAA 3CN4A 3MRDA 2BSSB 1M7DA 4Z0BH 4Y2DB 5FYJE 4Z3TA 3L3OA 2CNYA 4J8QA 1OLZA 3ZMEA 1F56A 3G7TA 4JREC 4XVSH 2QZQA 4JFPB 1HOEA 1T4KB 2H1LM 3K4ZA 3MV9A 3BKCH 4PWFA 2CGRH 1GXEA 4RRPA 4QKXB 4QO1A 4DK3A 4QNPF 3CZSA 4IBQA 2XWEA 3QI9A 3TPKA 4X5WB 3MNVB 4GXUM 4UBDD 1VFUA 3SDXE 2J6WA 1T03L 1F3DJ 2ZUQB 2N59A 2IDTA 1NKRA 2WCPA 5JTWA 3BI9X 4JM2D 4OLWH 4MCZA 3WO4B 1P2CB 1KN2H 2FWOB 4XX1E 4YHMH 5FK9A 1TQBB 1YC7A 1TEGA 1DVFA 3QNXB 3IDXL 1S4IA 1DBJL 2EEFA 1XD0A 4YX2L 1HL8A 2IFFL 1FWXA 1G6RA 1R5IB 4X7TB 5J13B 4HXAH 2HG5B 4KX9A 5DO2C 2I24N 4ISVB 5EO9B 4JFWA 1ZVHA 1IM9B 1GH7A 2JI1A 3HE6C 1VPOL 1O5PA 2FL5B 3FFDA 5KS9F 4GG6A 4WV1A 1Q94B 3VI4F 4TOYH 5K1NA 1SQMA 1UT9A 3U2JA 3QARA 2YOAA 5B21A 4AIOA 1T20B 3UZEC 4Z7VE 3D33A 3MLUL 1DVSA 2WZPA 4Q14A 2X70B 1UHVA 3OJVC 1TIUA 4LSSL 4PJGF 3QDJE 2YPLE 4TQEH 4JPKL 1JNJA 3C2SA 1X6NA 3OR6B 3GSXB 1QPXA 4UOW1 3VI3A 4F37K 2F74B 1QMUA 5JA8B 2XN0A 3MX0B 4U6HA 5IQ9B 3HOGA 3VGEA 2IPTL 4UILL 3BSGA 3B9KA 3FH7A 1H0DA 1AMXA 4NO2B 4GFTB 5CSZA 3LH2L 1EZUA 3TO4A 3GXPA 4LLYA 5IB3A 5DUBB 4HWBA 5E9DD 2G75B 2B08A 43C9B 3TEWA 2CRMA 4FFVC 1YEFH 1NPNA 4AMKH 4B9FA 1Q0XL 2WCGA 1UUSA 5MHSD 2XQBH 1C5DA 4XX1G 1P4IH 3N85L 1LYQA 1OCOB 4GI6A 2Q6WA 3VNZA 5CKAA 4N90D 2JELL 3UBXB 4FMKA 4P3CL 4PJBF 4DAGH 3V7MA 2ATKB 1MXGA 2ICWA 5T3XH 3LKPA 3IXTA 3MUUA 4NUMA 1JZ4A 1E2WA 3CFTA 1OAQL 3IGLA 2WXKA 4KTEH 3M6DA 3UTTB 3VE0B 3SB3A 3BW9B 1HHKB 2VZVA 2FEJA 3HJEA 1ZV2A 1SJXA 1HKLL 5KW9H 3T04D 4KZEL 1UCBL 3O2DL 4AGMA 4JFFE 3KS0H 5E5MB 2Y22A 4C58B 4LSTH 4MMYB 5KN5B 1EJOL 4M7KL 2Z9TA 4CVXB 4PJHB 2VKXA 3TWYA 1DJSA 4GMTL 2DM4A 4NCC2 3HEIB 4K9EC 2E7MA 3RFRA 3CFDA 5CN2A 2X09A 2Y23A 2YLKA 4AKQA 5IJKA 4CMMB 7PAZA 3H1ZA 3CVHH 4YBQD 1ORSA 3FZUD 2MNWA 3IFPB 3HC2A 3PAUA 5G4OA 1BF5A 3D25B 3GRBA 2P8PB 2A83B 3KPLA 4MNQD 3S37X 1R17A 3EYUH 4E41E 1HEJC 3U1SL 2VO8A 3AS2A 4O58L 4PJ5A 5FCUH 4NB7A 2A74B 1HU8A 3MKKA 2HAZA 4RRPG 4LSRL 5F7NC 1TJIH 2WBJC 3OMNB 4ZK8A 4EN3D 1EA9C 3HRZA 3ZYJA 1WWBX 4B3EA 1BBJA 3FTUA 3U7AA 1TMQA 2YHGA 3IVKA 3LVEA 1E3ZA 1NJ9A 3BX7C 4A7QA 1NLBL 4R5TA 4FA8A 5FOJA 1IBBA 1F2XK 4PAZA 1Z0NA 4XP6L 4PJFF 5D7JB 4FKHA 4FFZH 1QQDB 4LDEB 4XBEL 5LG6A 1W0WA 2N4IA 2MKLC 4JHWH 1LEIB 3V6OC 2V17H 5IROD 4PMEA 3UYPA 4I48B 5DEZA 5I8CB 2JB6A 1GOGA 4HSAC 4ONHA 3SDCA 3G08B 3AY4A 2F8IA 5E2VH 4GXUN 4WO4A 3REWB 5IK3A 5AWNH 2FATL 3OAZK 3N0AA 1IEBA 2HT2D 1AGBA 4FQ1H 1A0QH 2OXGB 3JXAA 5GRJL 1XSOA 2X38A 4RETB 2ADGB 1HZHH 4FAAB 1BF8A 4D9QD 5I8KL 4QTIL 3OBAA 3QIUC 1NMAH 3IDYC 3IS1X 5JW4M 4LFHG 3SPHA 1WTLA 1GZPB 4JJOA 4ONGL 1L9PA 3POCA 4HW6A 3UJJH 1KCRL 4KVPA 5GGRY 3BDBA 5ID1B 1ZPLA 2HH0H 5FYLD 3WNPA 1QD0A 5L8LB 2IH3B 2O72A 2Y3NA 2Q10A 1QFUH 3SKMA 4JDVB 2FB4H 3JT2A 4A1RA 3HMXL 1YNLL 2H3NB 2XV2A 3DTXB 3GFUA 1PZAA 1NOFA 4L29A 2E0PA 1UA6H 2NZ9D 1BVNP 2DIBA 4UBDC 5B7EA 4KXZI 5GIRB 3EW3B 2DICA 2YQBA 3ASWA 3OM3B 3T0BA 4U1SB 3IM1A 4IRSC 3DJ9A 1TETH 5IHWA 4IM8A 2KT6A 3MMEA 4DZBA 2OS7A 4X8CA 1JXJA 4Z7OB 5SWSE 5KYWB 12E8L 5GSVB 3MUGA 4TQIA 1V7NL 2GTWA 2ZUXA 4CVWA 3KYNA 1MIML 3T65B 3VXMA 3MRLB 2EO7A 2BSED 1UWXH 1GGIH 2C7FA 4G9FD 3SPCA 3VMNA 2WTRA 4BZ2L 4JN2B 2YLHA 4JFDB 4Y2LA