3DIDA

Crystal structure of the f87m/l110m mutant of human transthyretin at ph 4.6 soaked
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
publication title Novel Zn2+-binding sites in human transthyretin: implications for amyloidogenesis and retinol-binding protein recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligand binding protein
total genus 24
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3didA00
4TQPA 3GLZA 3GRGA 2G4GA 1X7SA 3U2IA 1TTAA 3CXFA 4Y9GA 4D7BA 1THCA 4MRCA 4L1SA 4N85A 2F7IA 3OZLA 2GPZA 4PMEA 1IIIA 1TT6A 4TNFA 1E3FA 4PMFA 4TQ8A 3DGDA 2G2NA 4I87A 5FW7A 2QPFA 3GS7A 5CLZA 3KGTA 4YDNA 2G5UA 1QABA 4ABUA 3DJTA 1U21A 2NOYA 4WNJA 4Y9CA 3IWVA 5FO2A 3HJ0A 5DWPA 5AYTA 5K1NA 2PABA 3DIDA 1GKOA 1ETA1 4QXVA 4PVNA 4ABQA 3M1OA 5EZPA 2H0JA 4HJSA 1DVSA 1GKEA 2QGDA 2WQAA 2ROXA 5E23A 1SN2A 5E4AA 2FBRA 3U2JA 3CN0A 1G1OA 3DK2A 3CFNA 3P3TA 5K1JA 5CN3A 1RLBA 4QYAA 1SOKA 4FI8A 1FHNA 1TTCA 3ESNA 3B56A 1DVUA 1DVZA 3I9IA 4PM1A 3NG5A 1BM7A 1KGIA 3CFTA 1ZCRA 3CN3A 3IMUA 5AKSA 4Q14A 4DETA 4TLSA 4ABWA 5L4MA 3BSZA 2G9KA 5CNHA 4IK6A 1SOQA 4Y9EA 4DEWA 1ZD6A 3P3UA 2B9AA 3KGUA 1DVYA 4PVLA 4ABVA 3CN4A 5JIDA 3DO4A 4IKKA 4N86A 1IE4A 1TTRA 4PWGA 4TM9A 4WO0A 3QVAA 3TCTA 1ICTA 3GRBA 5CR1A 3A4FA 2GABA 5DEJA 2B16A 5L4IA 3DJRA 3FC8A 1OO2A 3A4DA 3CFQA 3Q1EA 1X7TA 1QWHA 4HJUA 2IGLA 2G3XA 3ESOA 3OZKA 3I9PA 5AKTA 4DESA 3A4EA 4TLKA 1TSHA 4I89A 3IPBA 2B15A 2TRYA 4ACTA 5TTRA 3IMWA 5CM1A 1BZDA 3D2TA 4IKIA 4WNSA 4PWEA 4TNEA 4TQHA 4IKJA 4AC2A 4IKLA 1ETB1 1F41A 1SN5A 2FLMA 2G3ZA 3TFBA 3GPSA 3IPEA 3DJSA 4TLUA 5E4OA 3NEXA 3NEEA 2QGBA 2H1XA 4I85A 4KY2A 5L4FA 5JIMA 5HJGA 3KGSA 1TFPA 1BMZA 3CN2A 3DK0A 2B77A 2QGEA 4TQIA 2G2PA 3CN1A 3DJZA 3I9AA 3IMRA 5CLYA 4QRFA 1BZEA 3IMSA 5L4JA 2H4EA 5AL0A 3P3SA 2ROYA 1TTBA 4FI6A 4PWJA 2H0FA 4TNGA 4PWFA 3CFMA 4PWIA 3P3RA 3NEOA 5EN3A 4PVMA 3GS4A 2B14A 4TL5A 4YDMA 4HISA 3SSGA 4TLTA 5AKVA 1IJNA 1IIKA 2H0EA 5IHHA 1E4HA 1KGJA 4FI7A 4HJTA 4MASA 1FH2A 4TL4A 5AL8A 3D7PA 3IMTA 4HIQA 1DVXA 4MRBA 1DVQA 4PWKA 4TKWA 5JIQA 1Y1DA 3W3BA 4Y9FA 4AC4A 2H6UA 5FW6A 1DVTA 3BT0A 3NESA 5CLXA 4PWHA 4DEUA 1BZ8A 1TLMA 3FCBA 2F8IA 5FW8A 1TYRA 2G4EA 3CBRA 4N87A 2TRHA 4Y9BA 1THAA 4IK7A 3IMVA 1TZ8A 2QGCA 4L1TA 1F86A 3IWUA 3GS0A 4ANKA 4DERA 4IIZA 1SN0A 3ESPA 2QELA 1E5AA 1Z7JA 5A6IA 5BOJA
chains in the Genus database with same CATH superfamily
4JM2B 4UT6L 4K7FA 5DD3H 5MP6H 4D94A 1OAUL 2A1WH 2MPAH 3KLQA 4XBEH 1Z5LA 3GJFB 2FX8L 3HUJB 3MRMB 5GS1B 4F15B 2QLVB 4HKJB 3HG4A 3N1MC 1DVFC 2OR9L 2Z91A 3RNQA 4LU5L 2DLEA 2G5UA 2LVCA 5C0ND 3HPLA 2GK0B 5DWPA 2Q76B 3HMWL 4BXSV 5KVDH 1F11B 2C9UA 1N6VA 1TZHA 4RX4A 1VZHA 3MYJA 1WGVA 3PXLA 4UNTA 1KTCA 5DRZA 3VFUA 3H53A 5DSCA 4N2DA 4G3YL 3PAZA 4XP9L 4W9GC 5I74B 3VA2C 3S8WA 1YYCA 4G9DB 2E4TA 2XZCH 3IKCA 3SPVA 3UJTL 3WEOA 5DFTA 1GGCH 2ZOUA 2ZUTA 1R9FA 4Y5VB 1MIEL 3C6SA 2QQLH 5T3XE 4KK6D 2J88L 2R69A 3MJ7A 4KVCH 2OMXA 4IKKA 5IF0B 2B08A 1RJZB 3CZFA 2J5LB 4Y8DC 2R0LH 3QEHB 5EIIB 1U8KA 2ZOOA 1BFTA 4U1SB 1CD9B 1E67A 3WIFA 5FYLL 2YEQA 5EZLB 4A2MA 3KJ4B 4D9LH 3TYFA 1XGTA 4QT5A 2DS4A 4LLUB 2AJSH 5ETUB 1VCBC 3WG7B 5BS0E 4OZIA 4IKJA 2D03L 1Z3RA 2FJGA 5F89A 1NL0H 1T0OA 2CK0H 3TFBA 1DCEA 8PAZA 4QTFA 1MHPL 2O6DA 1DVFA 5T1MB 4CGTA 4Y1AB 3GXFA 1BYOA 1ZHLA 3MACL 4FQIL 3L3HB 4A37A 4NIYE 4OF8A 5DRWA 1U6AH 3VJ6B 3MNMA 2PCPA 3ATFA 2PYED 3W11C 4YPGB 4P59L 1MCLA 3SPJA 5E8DL 3B2MA 2Y6SC 1YECL 2X6AA 3S3SA 3DVNB 4Y7MA 4H1LA 3T2NL 4LHQB 1WD8A 4M62L 1QMUA 1TEYA 4DPBX 4PS4H 3RFRA 3VFMB 5E2VL 1RKRA 1A5FL 3IFOB 4Z7UA 5ELIA 3UTZB 3LS4H 4MX7B 4U3CA 1C9SA 2HRGA 4A1RA 4MNHA 1N64H 1U8PA 2VW6A 3MV9B 1SDYA 3BVNB 3FXIC 1LNUB 3QDJA 1IM3A 1FNSH 1SUJA 2E76C 4ODHL 1B90A 4HUWA 5CCHE 5C0GB 5IHZA 4FP8L 1JPEA 4PG9B 3QEGL 5TE6H 3SZ6A 1KCVH 3ARGD 3TBTA 1G6RH 1EMTH 4LKCB 2G4GA 2V33A 3V0HA 1HYSC 1E8ZA 3D30A 4A6YA 4HBQA 3T3MF 3FCGA 5IEHA 1UWYA 2NX5B 2F7OA 2L7QA 4H0GA 1PNCA 5GISH 1NAML 3TIEB 4LEBA 5CUSL 2FO4A 2NY6D 4N1CA 3GF8A 4UILL 5D72L 3L5IA 4XO4A 5INDA 4BK8A 1ZT4A 3VD3A 4IYKA 4M7ZC 3P40A 1C1EL 4DO5A 5E4AA 2VXQH 3QCTL 2XJLA 3U7WL 1AYRA 3O3BB 1CICB 1KLGB 4N1EA 5E24E 1SF5A 3V6FB 1QW9A 2NR6C 1QSEB 4GYBA 1SBSL 2QKIC 2W65B 3L3IA 4TOYH 5EF1A 1KPUA 1T5WA 1XF4B 4OZHE 5LNEA 1NCWH 5KSVB 1FNLA 4QKTA 2DYRB 2P8PA 4CVWA 2V7HB 4LDEB 3VE0A 4U0QB 3WEXB 4G5AA 4JFDD 2JB6A 5CZKA 4UZGA 3RP1A 5L2KD 3AAZA 1SPDA 2W0FB 2Y24A 2APVA 2ZAGA 4JHBA 2XTJC 4AGOA 5GZNA 4JKWA 2JJSC 3GNMH 3QXDA 3RIAF 4EN3B 1K6QL 1PNDA 1BLIA 3ARXA 4PV8A 1IAIM 4K71C 5TGBA 1TSHA 4J3WA 5DK2B 4F9LC 4MSWA 43C9B 5BVJA 2D9CA 1IGFL 2BP0A 2GHZA 1AQKH 2IG2H 3DGCR 4K23H 3EYOA 1QA9A 4U1NB 2BJML 1F3DH 1D3CA 4S0TD 1TO4A 3N43B 3LPGA 4HC1H 3TH3T 3FT4A 4DN4H 1JDAA 1AI1L 4OQTL 4UT9A 3EFOB 2FLRT 4HAFA 1JHKH 3F05A 3NJJA 1P7QB 1NCGA 1PKQB 4GQPH 3MV7D 2X12A 4O9HH 4FI6A 1K9TA 2X2UA 4NENB 4DUWA 4JQIA 1DQIA 4KQ4H 1CK0L 3MBXH 5DHMC 3NP4A 3O3AA 2V5YA 2XA8H 4WCYH 1GY1A 2NR6A 4HIQA 1YEJH 2QKIA 1OAKH 2ILLA 3UMNA 1P7BA 2I5YL 4I4WB 2VRAA 2H6UA 3H3PL 3OQRA 4OLWH 4L3EB 1NCDH 4XMLL 3S35L 3T8XA 3TWCH 3VWJB 4FQ1H 4E5XA 2PYEE 4PJ9D 3D85A 1AO7A 1USZA 4CA4A 4QJ5B 5D1XC 2JJSA 3HPLB 5A6IA 1MFUA 3GRWL 3VXUD 4QHUB 4F9LA 3K4DA 4UAOC 3ETTA 1TZHB 4G6AC 3UAEA 3ZKND 1AFVL 1TUPA 4TS6A 1B2WH 3OZ9L 4JG1H 1R5IB 1QFHA 3MYJB 3T6XA 5DRZB 4IMLB 5ERWB 4OJCA 3TM6A 3W5NA 2DAVA 1ZEAH 3HS9A 1U3ZA 3E8UH 1QFWI 2MHAA 4O51B 3RWIB 3JWDL 3JV4A 2ZOLB 2YD0A 4MXVE 5T1LA 3S7GA 3OJMB 3JZYA 1ZHNA 3IWVA 4I77H 4KPHL 1RZPA 4HAKA 4OH2A 5J12C 2AI0H 2MQCA 2V2WA 2Z7YA 2MOGA 3GJEA 4HOWA 4ZW3A 1A8ZA 3RPIB 1MI5B 3AWEA 3T08A 2APBA 3MJ7B 1AS6A 3P4NA 4FHJA 1MAMH 1OM9A 1PLBA 5E23A 4APQB 3BXNB 3VB9A 2XN9A 4OY9A 4PVBA 4X5WA 5IGXL 2QR0A 3HTLX 2JJVA 2WCPA 5D2LF 2OZ4A 5AB0A 4GRWE 2L7EA 3QUMA 2C9RA 1RZIA 1JPFA 1AIFA 1XGTB 2H3KA 2GBAA 4OZIB 1IGJA 4XP4L 4KHXH 4EJ1C 2H2SC 3NSDA 1IC5L 4FFZH 1HCVA 1XB8A 4KAQH 1H8OA 1J5OH 3KYOA 1QSZA 4HLZH 1P9MC 2NY3B 4XT1C 5D1XA 2TSAA 3AABA 1UZGA 3V4VB 1P5VB 1M2VA 3LCYA 5HBBA 4YHOH 1JN6B 5DRWB 3JWNH 5SWSB 4KJPC 5C2BH 2AXGB 3UJJL 4GG6E 4P4RA 4MB4A 3CVIL 2EO1A 1JGUL 3DKHA 2YEZA 3LQAC 3II3A 4AX3A 4P0DA 5HJBA 3GSVA 2WZAA 1FAIL 1TIUA 4FG0A 4H1LB 4X8JA 3X3FL 4JFDE 4X6DF 1N18A 4JY5L 1FV1A 4MQXD 2BXYA 1OPOA 4GW4A 3C5ZD 4PJIA 5L4JA 3IFLL 2IBBA 2EDHA 3HKZA 4LRNH 4Z7UB 1XF5A 2FQFA 3P3RA 3PY9A 2DEWX 2VW4A 4PVMA 1U8PB 1OW0C 2W1NA 4L48A 1WBXA 1OE3A 5C0CB 3I84A 4OFVA 1ZGLM 1MCOL 4Z23A 4F8NA 3HG2A 4X42A 4MRBA 4DNLA 4LCWA 2EDNA 5DZAA 1WFOA 1XMEB 1Q9LA 2D31A 4MVBC 3IU3A 4XXDA 1KJ3L 3ETBJ 2WXPA 3TA3C 5FS5A 1OKEA 3MV7E 3BPLB 2VH5H 3FMGH 3HZKA 4OD1H 1YEDA 3IJYA 5L6YH 4IK7A 4PY7A 3VFOA 4YDKL 2FO4B 3RVVD 1P9MA 1C5DA 4JO1L 4HS6B 1G84A 3CAFA 3ZL4L 5J1SC 1ZT4B 4K5LA 1RL1A 1TTAA 2E3VA 1W8NA 5GHWH 3QCVL 2FSEA 3A23A 5JNYA 2IF7A 2R1WA 3VFSA 1NICA 3WMQA 4X6CA 2YAEA 1A3LL 2GC4C 2RACA 3D07A 1AD0A 1KPUB 1T5WB 1URIA 3B7TA 3ZKSD 5IB2A 1R3IL 1MF2L 3I9GL 4MJIA 2VXVH 3QYNA 3VXUE 5HYQB 4E9LA 3REWB 1DE4A 3GDBA 5EBLB 3T2OA 1KIQB 1NC4A 5HHMB 4BHUA 1YNTF 1OW0A 3QI9C 5AOLA 1A7RH 1Z1WA 4I2XE 1FZKA 3VQ2C 3KPOB 2PW1A 1UD8A 2GCYB 3WY4A 2CNZA 4YHML 4UDTB 3QXDB 2IQAB 3EGSA 4XVUC 4F5CE 1DVUA 3QFDB 2KMWA 4PJDE 2IDTA 1NPNA 1C08A 1J5DA 1UACL 5BVJB 4MSWB 2O1AA 3TTSA 5DJ2B 3LB6C 2X89A 3C09B 3FO1A 4HA1A 2DQUL 2BC4B 1QA9B 2WZ0A 4M61A 1JBJA 3NPZB 5CSZA 3TA3A 5F0PB 1QKZH 2WBWB 4MA3A 1T4WA 4PJ7B 3Q05A 3FT4B 4HWNA 2WQVA 3HNTL 3L1OH 1I7ZA 1AKJA 2IPUG 1RQ5A 1V7ML 3DX6A 3K2UL 4KITB 1A9EA 2H3NA 4DOHE 4YIQB 5EC1A 1BVLA 5F88B 5EULV 2ICWB 1K72A 2ED6A 4AVIA 4BH7B 1SM3H 5B4MD 4K9EH 1ZANL 4YDJA 5CZVH 4MNQE 1MJ8H 1PW3A 1XL4A 3CGTA 2NY1D 3LRSA 4ZODA 5D7IA 1N7ML 4DGYH 4G7VL 2VN6A 2ZCLL 3CVDA 3I3BA 3P11L 3CHPA 1PZ5B 1INEH 2FWSA 4GXVL 5FGCB 1U8OB 1JGDB 2XA3A 1RUAH 4BFBD 4Y4KA 4FEMA 1NUFA 2YA0A 2MNWA 1EO8L 2IQ9H 5EH1A 5J11C 3FSAA 4MD5A 1VFBA 3QI9A 1I8LC 4YHIB 3D85B 4E5XB 5J56B 1F1DA 3PREA 3AB0C 1TKWA 4GS7C 4BFIB 3A3YB 4JRXE 4NXKA 4EE2A 5INCB 1AHWB 2O30A 3F3HA 2N0KA 4HS3B 4I1NB 3PGCA 4G83A 1Z6JT 2AEOA 5J57B 4YWGH 3IDYB 3GSRA 2DQIL 1BVZA 4E42A 3ARQA 2OSXA 2G4EA 2P44B 2FTAA 3ZQ9A 1YCSA 2DD8H 3G5ZB 1TZ8A 3P2DA 1K8IA 4IRJD 2ESVA 1AJ7L 3JV4B 1KJ2H 5T1LB 4GRLD 3GI9H 3NFPB 4JKMA 4ZX6A 4OLYL 3WDJA 4ENEC 2WOBA 5KJ7E 4OZHF 4YZWA 1P4BL 2OMYA 4NM4L 3GJEB 4Q4IA 4CU8A 2XQ0A 3E1F1 4QXGH 1EZVY 3L3KA 3C60D 1LO3H 1SJHA 2E7CA 2F8VA 1KY7A 2XN9B 3CPUA 3TNNA 1TR7A 5KJRL 1ZA3A 3IXAB 5F9OL 3TFKC 3X1GA 3BC9A 5DMYA 3TJPA 3ZL2A 2IFFH 3Q8CA 1QASA 4NKIL 1DBJL 1S6NA 1T7YA 5GRVK 5TK2A 3ZR6A 5KVGH 1KIUA 3PHSA 1JZ4A 4F37K 4OBSA 2YPKB 1ETA1 2AQ2A 2GTQA 3V9EA 4PY8I 3ULVC 4ELMA 4KBPA 4PJEA 3UC0H 3U46A 5HPMA 2PWEA 4ZTEA 4FRWA 2ZF9A 4H8WC 4JUSA 1YJDL 3VXMD 1I8LA 2G2RA 2GB2A 1FYTD 2YPLA 2YXWA 4WFEE 3JYCA 5CN3A 5DVMA 3QG7L 1ZLUK 4N90E 4N2HA 3QYCA 4IQHA 3NMEA 3SE4C 1U3HC 2VERN 4QHPA 4ZMOA 2JI2A 3WNNA 2OK0H 4U1JA 1HH9A 2R2EA 4P4RB 4PP1C 1SXAA 2VZ1A 3DO7A 1HEJC 3BMWA 3QGVA 2YEZB 3DHMA 4FEIA 4MA8L 2VTFA 3U0TA 3GSVB 3RL2A 2DQJL 3LIZL 5MHSD 2X53A 3RTQD 5DEJA 3ZYJA 3VH8A 3CVHH 3DJRA 1FV1B 4ALAL 4K7PL 4X9IA 5T33L 4PJIB 1GC1L 4XCCL 1EFXD 3ATDA 3H7LA 3RZCD 3C2AH 4X6FB 1NGPH 1A1MA 2X4SB 4N0FA 3HZMB 1M9WA 1FNAA 3VQ1C 1EAPA 3QUZD 1J5HA 4NX0A 1PCSA 4Y4FC 4C4UA 1UB6A 4FQLH 3QXTA 2CDEA 3Q44A 2AZUA 1J48A 2MNUA 4U3HA 3LDBB 1JGIA 2D0HA 4OZFA 3Q2NA 3QJXA 4LCWB 1GGBL 5HGHA 2KH2B 1GS6X 5DR5H 3TV8A 1AG6A 1TJMA 3IU3B 3LH9A 3P3SA 4K94L 4M43H 4XXDB 3KWVA 3SPHA 4V1DD 2H9GA 3F00A 3MRRA 3HZKB 4YOKA 4OT1L 1YEDB 3IJYB 5CR8A 1D2PA 5T3XH 4TNWK 4G1EA 5IHHA 3Q48A 3QHTC 1LP9F 1F6AA 4MXVF 5D7JD 5E1AA 4YHPB 1U3HA 3FT0A 5L7XL 1H5BC 4GMTH 1NCBH 3OGOE 4XCFL 1EDYA 5ICXB 3MBWB 3LAFA 4GQQA 5JNYB 3ZE1B 4I3GA 4QHMA 5JQIB 1SYSA 2IGFL 1OOWA 4X6CB 3AG3B 4Z8FH 4BQCA 1TQCC 1YEIL 3D3VE 4JN1L 1EHAA 2Z9TA 4PGEA 1FG2B 4GRWF 2JCWA 5CKGA 4KKCC 1UEYA 2HRLA 1WD9A 2YHGA 5F96H 1KTRL 1OCRB 2GY5A 2QVTA 4GI8A 4XH2A 3SGKA 2EUVA 2J8UA 2BFVL 1QAWA 5GZOD 2WO2B 1EGJH 3DSFL 5GSVA 3ML8A 3MV8A 3TEXA 1P69B 4Y4FA 3VGGA 2F53B 5EA0H 1GZQB 4ODUA 3DJTA 2BO0A 2DW5A 4X7EC 2Q5BA 2N7AA 1DUYA 4W9EC 2CDGA 4MAYC 5DO2C 3ME0A 1WFUA 5IHLB 1OTSD 1MHCA 2QKSA 4MJ6A 1FLRH 2Z35A 4JO3H 2EIZA 1I7ZB 2JCCB 1J9QA 4YDIH 2OS7A 3DX6B 2BRRH 4JHWL 4J6RL 5EC1B 4AEFA 1H5BA 2LABA 1CE1H 4PJAB 4K7PY 4YDJB 3NTCH 3DRTA 1I1AD 4N3UA 4X8XA 1H3PH 1A7QL 3LRSB 4P2AA 4JANA 3NT0A 5D7IB 3NJGA 3BQUD 4NKDA 2WXFA 5ABAA 2Q8AH 3IDGB 2HKHH 4JRFA 1BIHA 2HLAA 2ADGA 15C8H 1BWMA 1BQHG 3WUWG 5TH2A 2IANE 4EI5D 4WTZA 3CBJB 3FTZA 4Y4KB 5D1ZD 4PRNB 5E2UH 5IJVA 1BQKA 3PDDA 1O9VA 2X1QA 1CR9L 5D96B 5JTWA 5H37G 3DX9A 5KWYC 4MD5B 1VFBB 3OKNB 4IOSD 1Z66A 3KL3A 2CUAA 4WLCA 3ECVA 1V7NL 1IE5A 4AQ1C 1TKWB 5DC2A 4JM2D 1F4XH 3RWHB 4JFSA 4NZRH 1LE5A 4HGWA 1CUOA 4UT6A 4G11A 2JLLA 3KNBB 5DHDA 4M6ML 3R7RA 2YAOA 5JW4N 4E42B 3FONA 4MAYA 3HOGA 4AGQA 1MJ7L 5FA3A 1ILSA 3SGDI 4BSWB 2ESVB 3BO8B 1NCTA 1BFSA 4HJTA 3B9AA 2MCMA 2VR8A 3DIFA 3OHXB 2OMYB 4EEEA 5CGYD 2P5PA 3NP3A 4X7TB 4ZO9A 5JPNB 1CDUA 3G5XA 4BQ9A 1KFAL 5AW0B 4K2UL 2RA1A 3TNNB 2FCBA 2E7LC 4UAHA 4YC2C 4YL9A 1E7VA 3U9PL 3CHSA 5IOKA 3C6LC 3UTSD 3KJ6H 3D69B 5DEZA 4FFWD 4G8FA 3QR1A 4CMHB 4PJDF 4J3OG 3BAIA 3SKUD 5DS2A 1KIUB 1A0QH 3U30B 1P53A 3R8BB 4ELMB 4PJEB 4JREB 3VXRB 5BPPA 4XC3H 4HMDA 2PWHA 1L7TL 4PRPA 1AH1A 1KLUA 1I3GH 1WQVT 4IU2B 4JLRA 3STLB 4FLRA 5K9JL 4FQXB 1TJXA 4WF7A 5DVNA 4AQ1A 5TF1L 1JZFA 3HJEA 3ZDYB 4Z76B 4S1RL 3RQ3A 4JFFE 4XNZC 3V0VB 3IB4A 1HH9B 1AGCA 1X4YA 3BE1L 1OTUC 4HUVA 2PXYB 4Y16C 1MFCL 4TSCH 2EEXA 1XGRA 1BVKB 4XVTL 3UIZA 1ZSDA 2WTRB 3UCRA 2NY5L 1A6TA 1DQLL 3EFDL 4Y1AD 3Q6FA 4OR1A 2JIXB 4X9FA 3UPAA 2QSCH 1W72B 4YHKH 1A1MB 5E5UB 3WIAA 4N0FB 2XRAH 3KEHA 2QADD 2OYLA 4OFPA 5C2UB 4AGPA 4HOMA 3MLPA 1UA3A 1YA5A 3A6CH 3RTLA 4K3GA 2E7LA 3VI4A 2F5BH 1S9KC 2PWDA 3C6LA 4OZFB 1JGEB 3VFRA 5E1GA 1R1CA 5FC9A 1IAII 1MFEL 3BX7C 1MVYA 3MJ9H 3O6KH 4NJAH 1ZPUA 5HHQB 1BECA 3T8VA 2H9GB 4PGCA 4LVNB 3WKPA 1TQVA 4NRYA 3MV9D 3OAYH 3P73A 4HF5H 1FRGH 4MYPA 5LO7A 5JIMA 2P52A 4P8QA 1F6AB 1DQDH 2R2BA 3QFJE 2OMVB 4TQIA 5E1AB 5F9DC 3RWDB 1WWAX 3L08A 2HWZH 3LNDA 4JPQA 1RERA 2NX5D 1Q9OB 2E27H 4Y16A 3TIDB 1QSVA 4GRWH 4G5ZL 3X13A 5KVEL 1SYSB 4XCEB 1UWXK 3NIGE 1OT1A 1PAMA 3TLRA 1I8AA 2QL1A 2EH8L 1XVSA 1BD2E 2I9TA 5IZ7A 1NAMA 4PGEB 4C56B 4N6RB 4XN1A 1YEGH 3QZNA 4LOUC 5AALA 4B9CA 2BVPA 3MXVL 1F6LL 4M48L 4XH2B 5DD1H 2J8UB 3S6CA 4FADA 4L8SC 5FYKL 1I3RA 2P5EB 3QUXC 1TLMA 5A2LH 1KIPB 3WENA 3OXSB 1JDDA 3MUUA 5FA4A 3FZUD 4JFZL 4Y4FB 3DX4A 1CICD 3HUJE 1FH5H 2NYKA 1U8QA 5BJTA 5LHDA 4DERA 1DEDA 1QSED 4ODUB 4N25A 2IAAC 2HFFA 3BZFB 4EAEA 4DP4X 4UB0L 1BQUA 3SBWA 6PCYA 3QJFA 4NUMA 3WD5H 1EAQA 2ZP0T 1DUYB 3BLKA 2NQCA 3VG0H 3CFEB 4JCLA 4ZXBC 3QIUB 1MHCB 4XC1L 1R17A 4TTDC 3MLYH 2UXTA 4KKPA 4HPOL 4XTRD 3ALWA 4EN3D 4J23A 1GW0A 2JKIS 4GW1A 3SPGA 1S78C 3N41F 2NOYA 1E9QA 3NCBB 4HWZB 2VOTA 3HR5A 2E4FA 2J8HA 1WWWX 5EOTB 4P5MB 3FTWA 3ZL1A 5LKNA 1MCDA 1IC1A 1YPZA 4JANB 5D71H 3ECUA 2CO1A 3U2JA 1DBKL 2I60H 3P3TA 5FM5M 1SVZA 5EZIL 1PDKB 4OCWH 1P7QD 4OQTA 5JOFB 1X5IA 5F6IC 4MZRA 4HX1B 5E6YA 5AQ0A 5DQJB 3EJJX 1QPXA 1BMGA 3ECQA 1CXKA 1HSBA 3QXWA 4L8SA 4AYEC 2HFGH 3QUXA 2B9AA 2G0KA 4L0ZA 3WBDA 5L88H 2HT4C 3QO1A 3ZGHA 4F7KA 4QMEA 4QRPE 4B27A 4DAGL 1OB1B 1AGEA 2W81C 3RY5A 1QBLH 4H40A 2VLJA 3WSQH 5HHOE 3FHAA 3L5XL 4BFJA 4Q9CA 3FTGA 4PLKD 1QPPA 3QQNA 4L3ED 4NKOB 4UTCA 4Y1AE 5EPMA 5I19L 5L8LB 4GXUN 3VWJD 1PJWA 3FONB 2VJXA 1DUZA 1KGXA 1HXYB 3NN8A 5G4MA 3GDCA 2QGBA 3EZ8A 4P9HL 5DVOA 3WMSA 4R4BA 2OYPA 3O2VH 1FFRA 4HWBL 3DARA 3JT2A 3PJSA 1Q0EA 1VDGA 4DPAX 4FLHA 3GRWA 2VWEE 3IDNA 2ATKA 3G5XB 2BK8A 2RAMA 2X88A 1RP9A 3GMNA 5GGVL 4WHTA 1TXKA 5JW5A 3QNXA 5F9JA 1IGYA 3M88A 1GY2A 1CXFA 2ERJB 2ZXAA 5C08D 4CC4C 3QPQD 4OCSH 1YY8B 3KPQB 2EO9A 1MI5D 4LKXA 3CMOL 3O6FC 3UZEC 4APQD 5LAXA 1L6PA 3MLSH 4PRPB 2FYYA 4K5NA 1MNNA 1UD2A 1I7TA 1TETL 3WJMB 4AQ1B 1NJ9A 1MHHA 1TVHA 4ZFOL 3A67H 1HSAA 4MA1C 5AWNL 1EO5A 3II2A 4M1CD 4NAJA 1QQDB 2PTUA 3MRIA 4HSCX 4JX0A 4Z5RA 3K2MC 3HC3H 4MMXB 2DYPA 1BQHB 4FYTA 4HUUB 5DHVH 1XGRB 1MNUH 2YJLA 5FKPB 1I4FA 1J1PH 8CGTA 1XGPA 3QHFH 4X4ZA 4GPVA 2Y7QA 3FH8A 2NY3D 4B95C 3H9SA 5C0RL 2BCMA 4BBWA 3NJFA 2YXMA 5SWSD 3NAAL 2X7LB 5JIIA 4EKJA 2PABA 4NZTL 5I23A 4NUGH 4QXVA 2DTMH 2LFGA 3WTTA 2K78A 4ABQA 1JPSL 3IE9A 1FBIH 1HHGA 2WN2A 3FCSA 5B39G 2OCCB 4F8PA 1I3UA 3SYQA 1J7VR 1J0YA 4Z0BL 3C6LB 1KXTA 2WBJC 3VFRB 4GKZA 1DFXA 3QWRA 4C59B 3ZJAA 1T66D 2IPUK 5JHBA 2X2IA 5I1EH 4CC4A 4UOZA 1R3HA 3FQNA 3ISYA 1BF8A 5CNHA 5IW1A 5F7DA 3UZEA 2A9DA 3O6FA 4MZ3A 4APXA 5F9AC 1WF5A 3QNYA 5C0CD 2R29H 3B2DC 3TTYA 1LO5A 4P2QB 4B97A 3Q6GL 2JKJA 3Q1EA 1UWEH 4HZAA 1BQLL 2ZJSH 2WUCL 3QO0B 4KGLA 4RAHA 3S37L 5IW6A 3MLXL 5AZ2L 4Y16B 1PKQE 3PQYE 2VJ8A 3B2PA 3SO3B 1VGKB 2AK1H 5JOPD 1RPUA 5FUOL 4I85A 2ZZUT 1LD9B 3UGUA 2W59A 4R8WL 2AV7A 5HD8D 3CN1A 3VAEA 4XNMB 4LNVA 5EUOA 2BVPB 2KI6A 3PGDA 4HIXL 2ENPA 3DYOA 4KTDL 3FQ1A 5JDSA 2X40A 2SODB 1UZ6E 4L3EE 2R0KH 2XZQL 3LH8A 4LAQL 4PJXB 5BJTB 1JZ6A 3HHRB 2WBJA 4UV4L 2HFFB 1W91A 4LSUH 5K9QI 4QRQB 3JTSA 1AQHA 5I71C 3IK2A 5TFSH 4O2FA 5HHMD 4YPJA 4PLOB 2F8IA 2EUXA 2WWMD 1TYRA 4X83A 4F7TA 4IBSA 3MO1A 4JRYB 5GZND 1JGLH 3UZQB 2EZ0C 4LHJB 4WHYG 2XWTB 3AQXA 3C75A 2QV4A 4YFEA 4ZUSA 4KH9A 4WVRA 1W8EA 5J9PB 1W80A 1MXGA 3LZRA 1N5YL 1WFJA 4Q9QH 2RTTA 1YPZB 5EEZA 2DLFH 1XCTA 2RJMA 3T3PE 3BZEA 5H2BA 1CBVL 4ZMVA 1F3JB 4W4NA 3IYLW 4UV7L 5GS0L 3EXLA 2AS5M 2X4PB 1MFMA 5DZPA 2J25A 3OX8B 3D39A 2JKTM 5DJ0B 1DSYA 1E27B 5HSFA 5LQBH 1HDMA 5CU9A 1OHQA 3QJZA 4EOWL 1Q9WA 4L8SB 2CGZA 4ZOBA 3C12A 2Y23A 3G5VB 1MZZA 3EDEA 1WPCA 1HH6A 2J4WL 4CDGC 4OGZA 4GI6A 2O5YH 2QGDA 3OF6A 3QO1B 4QAWA 1ET5A 2UWEB 4JVPA 5H94A 4WO4D 2BNQB 4ATWA 1OP9A 3VFNA 1YEFL 2VLJB 5F97E 1S7TA 2Y6TE 4U33A 4OIBA 4G8GB 5MEOB 1V3KA 1M3JA 4PRBB 1A64A 1TQBC 2XWRA 3KH3A 5ISZD 5SWSE 3S34H 3D85D 1MAKA 1O5PA 3C5SB 3NIGF 1AACA 4N5EC 4R4BB 3UBHA 1OF2B 1YJDC 2VUOA 3E2HC 5EZOH 5ITFA 2UXGA 5IR1B 3QCUH 2IGLA 3VM7A 4AZ8B 1KUMA 1ZTXL 4KXBA 2BSRB 2BZDA 1OGTB 3IDNB 4JMNA 5CEZE 3KDPB 1QO3A 4PGBA 4JPWH 1JI2A 2I07B 1U2HA 5DD6B 4PWEA 3MLZL 4JM2F 2OW7A 1I75A 2ARWA 2XVKA 3C6EA 3PL6A 2C9SA 4Z7UE 5IIEA 3ULSB 3VM5A 4GG8A 5D7SH 3HUJF 3QNXB 5F9JB 4M4PA 5HJGA 4XNQA 4I1PA 3ILEA 3ISRA 1MCWM 3R0NA 3TURA 4UINL 2UXFA 4KKRA 2C1OA 4ODSL 5CSBA 5F6IB 4ALAC 3VFGH 2PR4L 3F83A 4XTRC 2OCJA 4JFVA 4XO5A 5J0BA 3P02A 1KG0A 2FBJL 4TNGA 4RRPA 4M8QA 1VCAA 3BWUF 3GS4A 2OSYA 2FGWH 1VHPA 3T6QC 4ZK8A 1JCKA 5KYWB 3HZYA 1HSAB 4KWUA 2Q3AA 2NUTA 4H25A 2DWDB 3UYRH 2VR9A 3AU0A 1G9NH 2C4FU 3LEYH 4NLAA 1NCAH 3PP4L 4HWEH 3WFDL 4F24A 3IMVA 2GUOB 2F1AA 2IH9A 4KJWC 2ODHA 4XZUA 1PZSA 3V10A 4OGYL 1DDHA 4YS4A 5JW3L 1JZ7A 1PCXA 1EV2E 2WVVA 5GGSB 4AM0A 3NQKA 1G9ML 1NIDA 3WELA 2GYSA 3QA3A 5F7BA 1BGXL 3CXHK 2B59A 1E3FA 3IS0X 2CO6A 5GRJH 2DWYA 2EE6A 2J7LA 3DUUB 1S5HA 1RH8A 2Y7SA 2XFXA 3LIZA 4FNUA 2H32B 5HHME 5I73B 3BDXA 2CO7B 3TBVB 4AV4A 5HI4D 1DJYA 1CQKA 4QHKJ 1R3HB 3FQNB 3S96B 1LEGA 3O6FB 3A24A 2OKMA 3MZGB 4I18B 4MKTA 4X0KB 2P80A 5FYJL 3KPSA 3UJIH 2GAZA 1ID5I 1LO5B 5F7NC 3A21A 2OP4H 1DN0A 4JM0A 4PJ7E 3ZTDC 1Z5YD 2AEQH 1Q1JL 3RVTD 4LL1A 1E40A 3JUZA 2HT2D 5D55A 4Z7OB 1HOEA 1RUKL 4G1MA 3FO2B 3BFQG 4Y9EA 3UBXG 5BOZG 5D70L 2AAVA 2O5XH 5MENA 2YRPA 3HAEA 3MOAL 3OM3B 4G80B 5BXFA 3CSYA 5AUMA 3RU8L 3FU8A 3SDCA 3U7YL 1IEBB 1OO2A 5I18L 2Z7WA 3BI9X 1PIGA 3K1DA 3ENEA 4H7VA 4KRPB 1CXIA 5JDSB 5FR3A 3WIIH 4RISL 3P4MB 2VDKL 3QJSB 4IKIA 1NBQA 3QJTB 2NW3B 2DMCA 2JB5L 4WKXA 2EVFA 2X9XA 3U48A 4HJ1A 2WLIA 1GOGA 1D5RA 3QS3A 2XTJE 3G5YB 3JTSB 1CU4L 4EQ3A 2VAJA 3P69A 1UFGA 1NBCA 1XGYH 4U1HB 4LLVA 5BQ7B 2CO4A 4EF3A 3CNKA 2XKNB 5HHVH 2Q3ZA 3RBGA 2JVUA 1QLFA 2F53D 4NQCB 3BDYH 4ZUSB 2CIKB 1A4JA 2BSBA 2ZPKL 3J07A 3FUJA 3MRBA 1GCFA 3H54A 4KH2A 4M9PA 4MKMA 2JELL 4ZMTA 2AKRA 4L1HA 3T1FA 3QWOA 5LGYA 4NERA 5ID1A 5TD4A 2WQRA 3DMMB 1QUNB 5FGSA 3D12B 5GXBB 4QTHA 4Q6IC 5H2BB 1WLHA 1OARL 1BAGA 3BZEB 3ORJA 2IIJA 4N87A 4ZUWA 1F97A 3GZOA 1F86A 2D3NA 2XN9E 4X8CA 2N3JA 2EXWC 3D39B 3D2UB 1JZ2A 1TF4A 3LZPA 2EE0A 4H8QA 3KGRA 4BXVA 1Q9WB 4BIKA 1YRKA 2DQDH 4CVXA 4HJEA 1U4EA 5CIPB 1HJCA 1KTKE 2IH3B 2ZWSA 3DHPA 4ZUVA 1RUML 4XP6L 3VFNB 2K70A 5KS9A 1MZYA 1FNFA 3N43F 4MNGB 2OLDA 3X3GH 1DYZA 3QZPA 4Y4KD 4LVEA 5D1XE 3D0AA 3INUL 3IU4L 5AOMA 1EJOH 1YYML 1MH5B 2GC7C 2IEPA 2QHRL 3BGMA 4MB5A 1DBAH 2V3EA 3TBWA 3N9GH 4MXQC 4JAMB 3O6LH 3B83A 3FO0H 3IF1B 2MKLC 1GPOL 3ASNB 1E9PA 1KCBA 3GJFH 2YAHA 1HL8A 1QO3B 2A9BA 1Z3GH 4KZ0A 2OJ1A 4GBXC 3NZHH 4PJIE 1ACXA 3VSQA 5I5MA 5T3ZE 5FWRA 1I53A 3PL6B 4Q6IA 5C70A 5IIEB 1UZ6F 4GG8B 2L4OA 3TBBA 2Q20A 3NRQA 1KJMB 2FT8A 5FF6B 3IEAA 2BH0A 1U91B 2HVJB 1NCCH 2C1OB 1X7TA 1SDAB 4L37B 5IHWA 1UB5A 3CDYA 2NY0B 1UD4A 5IFHH 1A7NL 3QRBA 1MCKA 1IGCL 1HOCB 4LPUA 4PRDA 4LCWE 2AGJH 3GMPA 4QNPE 1TSRA 3HCVB 2BW4A 2R56H 3RIFF 2APTA 3UERA 1CD8A 3BN9D 1OK8A 4KKAD 1BZ9A 4M7KL 1OP5H 3L4TA 4NXSA 1OANA 1H3GA 2Q86B 1W0VA 3WS6C 2NUTB 3WMPA 3H4FA 1N19A 4GIPD 3O4LD 4YBQD 5I0YA 3VGBA 2NDFA 4HGKC 2V37A 1UXWA 5J6HA 2FJFA 3VXRD 1C5CL 3EOAA 4JL2A 2NZ1A 3DV4B 4OCRL 4NRXB 2H1PH 4YDMA 4FQXD 1RZJL 4U6VH 3RI5K 3ZE1E 1G7HA 1R5VA 3GBNL 3V9CA 4F2MA 3KCPA 4JY6B 1H6FA 4X6CE 1G7IA 1S7RA 4PWKA 4TNVK 4W70A 3T5WA 1MQKH 4R83A 2KLSA 5JYMA 1RY7B 2PXYD 1U3YA 4GBXA 4KK8C 1RI8A 1UYWH 4MJIE 4BM7A 1SQMA 1YUHB 2B59B 2V7NA 4KQ3L 4OZIF 1JNNH 3S88L 1IBGH 2JIXD 3BUPA 4W81A 4Y1SA 5F7EL 2WM0A 1WHPA 3H2WA 2F53E 3CHRA 4KC3B 3WV0A 3V8CA 2VAAA 1LEGB 2HP4A 3MKGA 2VDRL 3TJEL 4NO2A 2GAZB 2R23B 4TNFA 3NRFA 5BQDA 7FABH 4P2RA 3CQQA 3WS6A 4JPVL 1QTSA 1DJXA 3UTTB 5K59E 4PJ5B 1K8DA 2GUYA 4ZMPA 2WXOA 3CXHJ 2P5WA 4GQ9H 1I9RL 2EIJB 2VDPB 3ULUL 3GSNB 3HE7B 4ZO7A 4PJAE 3VO0A 2JF1A 3HAEB 1PSKL 4NPYB 4Z7UF 4FQCH 1V3JA 1TZIB 5IQNA 4D2NA 3BVXA 4CDHA 4NYLA 3CSYB 3SDCB 3EO1B 4M7JL 5F8RC 3NYKA 5D7IE 3QQ9D 2X3BA 4L9LB 1L9PA 1BWWA 4OW6A 3F6LA 4HIIB 2E9GA 3PYCA 4QRTA 3QPKA 4HS8L 3Q3GA 3BD4A 4X80L 3GSUA 3MGOA 3KWXA 4KZCA 1KCUH 4ZX4A 2YD4A 2VL5A 2WLIB 1IEAB 1GIGL 2E7BA 4WJ5B 4C56D 2XQYG 4GEJA 3TXAA 3WI9A 2G3XA 3OGCB 4M7LH 4XNYL 3MRHA 3BDBA 4KVPA 4LVOC 1AIZA 2A9ML 4NDMA 4QI3A 2P5ED 4TSBL 5A40E 2XTSA 2YD8A 2BY1A 3R1GL 1NUGA 2VDNB 1S9WA 1QLFB 4H88H 1MLBB 3R4RA 1N70A 5FYJU 1JK9A 4OKVB 1P6AB 1E4KC 1JZ5A 3NCYS 4XNXH 4MAUL 4OLUH 3UZVA 3M1BA 4O58H 4QD2E 3QDHA 1XSJA 2ESVE 1BW8A 2VERA 3NABL 2B20A 3X12A 3K0YA 3MNVB 2AJXH 3G04A 4R90L 3T71A 4BCXA 3QIUD 2C3XA 1KTJA 1F90H 1RZ7L 1QNIA 4L3FA 2Y2TA 5I1KL 3EFFA 5GJSH 3LS5H 5ILTL 1OSZB 4P9HC 1L9OA 5CZXD 4LIQL 4TKWA 3UBGA 1LQSR 2VM3A 2IH1A 4KMLB 5TPWH 1CDBA 1DR9A 4CVXB 3EGDB 3F7LA 1DJIA 2HJLA 3O8XC 3CIAA 5EMYA 4AL8L 3ABMB 5TDNA 4AJ0A 1QR4A 4N9GB 3Q0HA 3WE6A 1VFMA 1C12B 4KDWA 4P9ML 2ZKWA 4ELME 4PJEE 4ZUVB 1A6WL 2C8NA 3I6KA 4JHVA 3WAKA 5KAQF 3L95A 3UBXB 2VDQL 2J1YA 4PJ7F 4XHJD 3B6SA 4Q9RH 4MCYA 5DQDL 1XQ4A 2YPLE 4W9FC 5KYNA 3N50A 2R9HC 2EVJA 5IQ9A 1I9IL 3EKCA 2JE8A 3B9EA 4KKBC 4DZBA 4XN7A 1THCA 2ORBH 5KSAC 5KYUA 4LOVA 4XOCA 3UL4A 4OB5H 2Q2LA 5FDWA 1E4KA 1JWSA 3LIUA 2PW2A 4U1GB 3NJVA 1AGDB 4HMCA 3MRJA 2WP3T 1CD1B 2C7UB 3C5JB 1FLTX 2VLLA 1ZT7A 2IOOA 3GB7B 3SCMB 5A2CA 2H8PA 3DBSA 5AB9A 3OPZL 2W88A 3WEAA 3EJCA 4C57C 1RURL 3ZZ1A 4MGXA 1BQSA 2WZPD 5E5LA 1BEYH 4Q6IB 2F1EA 4X7FC 1SFDA 3SQOL 4PSRA 4J3SA 3CZLA 4GKNB 3G6JB 4B9JA 3WJJC 3DX1A 1MCSA 3VMNA 4PV1C 4JB9H 1REIA 2YGNA 2HZHA 4G43B 5JO5B 2DQEH 1UB5B 4DH2A 4HWBA 2KZ1B 3G7TA 4R7DA 1ECZA 5BV7H 1SRDA 1SXZA 2PO6B 1OXYA 3V4UH 1U58B 1E4WL 2XCMC 3O8XA 5E08L 4NUPA 5LJYH 5HYJD 4JKPH 2Q6WA 4MBOA 5ANMB 1XZ0B 3PG2A 4KRLB 1GTNA 3WFCH 2EYRB 1ZVHA 2R69H 2VSMB 4N0YH 4U1KB 5E8NA 5J6HB 3FQUB 3MR9A 4R7NB 3EOAB 5KSAA 1UM6H 1IKOP 3HI6L 1E50A 2OMTA 2AQQA 5EWIH 1FO0B 5L4FA 2D7TL 1ITBB 1FE8L 4S2SB 1G7IB 5DFVC 4ZFOA 3H1ZA 1HZHH 3CLEL 4H4NA 1ZLWK 4DN3H 4OFDA 3GMLA 5FWQA 4C56E 2F74A 1I82A 3MAWA 3P4OB 1R5WA 3NACL 1WAPA 3L6FA 4TPRL 3TP4A 2J8UE 4DVBB 3IFPA 5CILL 5CBEA 2HLEB 5EU6A 3V4VH 3ZKMC 4U7KA 3WJJA 3WKQA 1JZEA 3BESR 3V0WL 1N0LA 3U82B 4NI6A 1UUNA 2FX7H 1TCRB 2FWOB 4WWID 3UTOA 2BY2A 3EJQA 1MFBH 2A7BA 3D25B 1FPTL 2B4CL 3E6FA 1AP2A 3F84A 1U92A 4GKSA 4H1LH 4DUVA 1D7BA 4ZYKB 5CEZH 4ES8A 2CA3A 5AZUA 4WK4B 5CCJA 3FO9B 1DCLA 1W2KT 5CLWA 2LT9A 4MD4A 2DKMA 3MV11 4WW1A 5KOVC 1CF8H 3RAJH 5DRNA 3TO4C 1E5AA 1K8DB 3PGFH 4ONHA 2A77L 3HG5A 3GLZA 4AEEA 1CDCA 4PS3A 4BK5C 4GAJH 4PJIF 1PLGH 1XEUA 3O11A 1L0XA 4ZFFA 3L9RA 3TPUB 3HNSL 4YDVB 2WLJA 5CD5D 4CKQA 4NYLB 2Z4TA 4P2QD 1ZY9A 3GK8H 1ZHKA 4Q6KA 2NXZC 5E6ID 3NGBB 2OR7A 2XPGB 2JI3A 2CKBL 3FU6A 2NY7L 3P4LA 1GOHA 3P2TA 3Q3GB 1KB5B 4J3OD 4JPKH 3SOBL 3MGOB 1M42A 1VPOH 2MPVA 4OF3A 4QNPF 4ZW8A 4YBHA 3MJGX 1DEEB 1KN2H 5L8JB 1IEHA 1QFWL 3QAZB 5GS0C 1NGXB 2XIBA 3GM0A 4UTBH 3PPEA 1ZXKA 2Q7AA 4H5SB 2ARJQ 1CZ8H 4R2GC 4NDMB 3OVUB 4HJ0C 4RWYL 2X4OB 2XBDA 4I13B 2IPKA 1OPGH 3GUTB 3TA4D 3ARFA 1HNGA 3P3UA 1LDSA 1S9WB 5KTEH 1U93B 5DHYA 4Z7WB 4G9FA 2MTPA 4PR5A 3HE6C 1XH2A 4A7VA 3ZE1F 4ONFL 4R3SB 3TO4A 4X6CF 1ML0A 5ESQA 1K2DA 3ARBC 1KYFA 4DGVL 1ESOA 1SLUA 4MCMA 1HEZA 1KEMH 1BDYA 2JI1A 2OMWB 2VUKA 4JRYD 3T0EA 5EU4A 4PTUB 1T89C 4DP2X 5I16B 4JW3A 1J11A 5IB4A 4OGAD 1DQVA 4C55A 3M17A 2DWSA 3Q1SH 4FXGC 4X5PA 1BQ5A 1J87A 1E5BA 1AZRA 4DFHA 5FM4A 2JJTA 3EGXA 2IDQA 3K1KC 4NCC1 1TTBA 1LMKA 1R33A 3WE6B 3TZVB 1IC4H 4JFYA 1MRFL 5FHAH 3I02B 5JIPA 3FAWA 4Q2ZB 3W0WA 1JPGB 3LSOA 4PRPE 1A3ZA 2CUHA 2OL3B 3B6SB 4YNYB 1M6OA 3LKOB 4MCYB 3WFZA 4IEFA 4ADGA 3PAVA 5IBLC 1ROWA 5SV3A 5JIQA 5K59F 1J5CA 3MGTA 4DZBB 4UNVA 1OALA 1M7UA 2JKSA 4FULA 3LRHA 4J28A 4ZT1A 1QI5A 2HFEA 4N5UA 1HHKB 4KNUA 5FYLE 5GGTL 1IGIL 3VDAA 3CLFL 5KYUB 4JJOA 4PJAF 2BNQD 2QVFB 3HE6A 4KMTH 5FIEA 5GGQH 3WFEH 1JWSB 4AVJA 3HNVH 3DOIA 3QXVA 1CBJA 1LLAA 1OZTG 4NP4L 1CG9A 4U2YA 3SGEH 2BZCA 3Q2WA 3BZ4B 4IMKC 1ZT7B 3LXUX 5D7IF 5C07A 4G8GD 1P1ZB 4D8PA 4M5TA 2H8PB 1XF3A 2Y9RT 3FQXA 3ARBA 1MRCL 3ZDZB 3U0WH 3RVXD 5DGRA 1NTDA 1QRKA 3G9AB 5DDHA 3BD3A 4OLEA 3WNMA 4KJQD 1E3ZA 2YXVA 2Q8BL 2A6JA 1ETZA 4PMFA 5DUML 5LVEA 4LDLB 1OAQH 1EZSA 1NM9A 1HI6B 2E8YA 4NOFA 3VI4E 5G2NA 5DEGA 3UG3A 4Y9CA 4FXGA 4R7DB 1G7MA 3AVEA 2Q7YB 4WEUD 3NUKA 3OSVA 3KYKL 4TVSa 3RKDD 1M7DA 1CXHA 1G9MC 3C08H 2Q6WB 1M56B 3E38A 1O9WA 3KZ8A 3BHBA 1VEOA 1QG3A 5DK0A 5J4MA 5EEXA 1ED3A 1L9TA 3J2PA 4U4IA 4UWQB 1RUPH 4F8LA 2ZOKA 5IQ7L 5CEYA 5DHEA 2YN3A 4HLZG 5AKSA 3L5WA 2B1HL 2P48B 4NNXB 3MR9B 1AQ8A 3BWSA 2VDML 3C8HA 4JM4H 1ONQA 5KSAB 1QSFB 3PF2A 4PUBH 1RHHA 1DVYA 2CMRL 4AE0A 4Y5XA 5CGMA 4XB8A 3QUMH 3L2NA 4Q7DA 4E41D 5I8KH 1TZGH 4IMKA 4A7UA 1WEJL 2HTLC 1RULH 3MKKA 4HJIA 3LKNA 2CD0A 4NHCL 3W9EA 3UYOD 3CDZA 1R34A 1IKNC 1WBZB 1F45A 3L6FB 3A6BL 1Y1UA 2LGNA 4XCNA 4ZQKA 4ELMF 4PJEF 1T04B 5DZNA 3OAUH 3CSFA 4K9JA 4UYQA 4UIKH 1VENA 2Q2EB 4N22A 4XP1L 4CAGA 4RH4A 1FG9C 2EVGA 1N0LB 3D18A 3X1NA 4J2XA 1N10A 3SY0A 1EHXA 2AXJA 3OKEA 4CVZA 2JJUA 5I1IH 3QNZA 3ZDYF 3OLIA 1FUNA 4PCYA 2RBLA 4UMGA 1SNRA 5F9WC 1Q9KB 3GTNA 1A66A 3CHQA 5I1AA 5GS2D 5E9NA 4F7PB 5T3ZH 4AENA 4AGNA 1SXBA 3SKOB 1X5ZA 1RIHH 1VSCA 2L04A 1NFIA 3MMEA 4XPTH 4OF7A 1OCOB 2WC7A 4QRAA 1G1CA 3L9RB 5FW8A 4YHNA 5K39B 4CGUB 3VACA 1YPZE 1UGKA 3K3QA 4XBPA 5HHPB 5TQ2L 1ZHKB 2EC8A 5E5MB 5CAYB 1ZA6A 2VZSA 2KDYA 3CZSA 2NZIA 5I66B 1YNKH 2UYLA 1CFVH 2D0FA 2XG4B 1IKNA 3VRJB 4FQPA 5D6CB 1Q72H 2WPGA 1SJEB 4D7BA 2ZUXA 4YSOA 3FQ2A 1IIIA 4OCLC 3T0WA 2YOCA 1DBMH 1F2XK 5AD0A 2EDLA 1RIVH 2UWEE 3A6OA 4PLNC 4ABUA 4TVPD 5HYEA 2BNQE 4KRPD 1A6AA 4G59C 2VLJE 3EUDA 4HCIA 5DD5L 3ZE2B 1NMCB 3LJ3A 3GHBL 3ARFB 4YHYB 2A6DA 2AP2A 2H2PC 1K4CA 2APSA 5LWYH 2HSIA 4IIQC 2YC1B 1J86A 2VDOL 3KM1A 4CW1B 1UHVA 3DK2A 4FKHA 1ASOA 1GTFA 3BUIA 1XF2A 3MBEC 3FT3B 4I3RH 5ESQB 1AQDA 4EIGB 2BVOA 4OCXH 2OFQA 2G0LA 2YGVA 3NJXA 4X6EB 4K4KA 4W6YB 2CRYA 4WI5A 5F1KC 3FW6A 4NQCD 3T0EB 2J8UF 4JFEA 1N8OE 1EZUA 1RSYA 4MWFB 2RQEA 1PTZA 3PDOB 2XXFA 3F04A 3B2VH 1NEZA 3LZFH 2WAQA 3AREB 4K8RD 4LLDA 4UUJA 4MHHI 3DMMD 3FFOA 1EO7A 2VR4A 3CC5A 5KOMC 3POHA 4DKFL 3Q2CA 4CC1A 2R0WL 2XETA 1HE7A 1HHJA 2VM9A 3NCFB 4RSYA 3WO3B 3CQFA 3T77B 2XLLA 4XWOD 2R0ZL 5EO0A 4EIUA 3D2UD 5E4EC 1E4XI 1AC0A 3SIKA 5KW9H 3CHOA 1FP5A 3L7FA 4OD3L 4HFWA 4R96B 4OV5B 1YEEL 1BHGA 4YK4B 4ZPVB 2IO5A 1D2OA 3ARTA 2CJ3A 2G75A 3AY4C 2CSPA 4NJ9L 1MREH 3O0RH 3SE8L 3WUWA 4IIQA 3QJOA 3O3DA 3QRLA 3VMPA 2VIRA 4RETB 3Q8BA 4Y4HB 3QUKA 4Z77B 4D8PB 5C07B 4WGWB 1I1CA 3IGAB 1NCIA 3MBEA 2LHAA 2XBTA 3IMTA 3MRDA 1EXUB 2IDUA 2F0CA 2BWQA 4G8IB 5B21A 4AQ8C 5GRUL 1A7PL 1CL7H 2WQSA 1X44A 3ARDB 1DBBL 2A6JB 3IJEB 1FAKT 3QJQB 2FEDC 2GTZB 1SN0A 4F3FA 2QPUA 4XE5B 1D6VH 3HG1A 4M1DL 5DGQA 1UZ8A 3FS9A 4LHUG 2QMJA 1MPAH 1ZHBA 1B0WA 3B4NA 1M7DB 1T5XB 1PX3A 2GITA 3DDGA 3PL6D 3QHZH 4XPGH 2WWNA 1FIGL 3HRZB 1EUUA 1JPTL 1MKFA 1NANI 4FOMA 1FVCB 1HAWA 4ZSOA 5DK0B 3WIHL 4JFHD 2NT1A 3EJYD 3L3JA 1JF1A 4IRSD 2YEVB 1BX2A 3LNHA 2ZOKB 4LLQB 4XNUL 5CEYB 1T83C 1X5LA 1BJ1H 1AKPA 4UM8A 2NY0D 2VCOA 4KXDA 2WOYA 3FTVA 3L5WB 4MMYA 4OCMC 4BYHA 4PU2A 4E9QA 1GKOA 5F1SA 1YDPB 3TNMB 3V7AG 2WYIA 5IKCB 2VLKA 1RHHB 5DJXB 2CGRH 3AY4A 4Z7OE 3LKRB 4RFOL 4Y5XB 2I9LA 2WQAA 3CLWA 2IDFA 1FFTB 2V8LA 2X44D 2ADFH 2W60B 1P1VA 1WVZA 2VZVA 2K6ZA 2AC0A 4RMWA 3BKYL 1ZOXA 3WNKA 4OIIH 4P5TD 2FATL 2XQYK 2DYSB 3CN3A 1OAXH 4AQ8A 4ANWA 4UQAA 5EUOE 1P6FA 1F8TH 2OTPA 5J1TC 2ZUQB 4KTEL 4BKSC 4P3CH 3ULUC 4FABL 3PP3H 3QZWG 3IN0A 1PQZA 4KO7A 4J39A 5KBNC 2VISA 3O3EA 2F58L 2AJYL 2XC8A 3D18B 4ZOCA 4ZTPH 3SY0B 1QWHA 2IWGA 1A65A 2GG1A 2PPEA 2UZYA 4WUKL 1D7CA 2CHXA 2NRDA 3OKEB 4CVZB 4C58B 1RU9H 4YEFA 5I1CH 1J1XL 5JMRA 1JERA 1T0NA 3MNDA 3QWNA 4NOBA 4RAUB 3HB3B 1DN2A 2W0LA 5IM7B 1YQVH 5CJQL 2AXFA 2FUQA 4NFDA 3TN0C 3DJSA 4KJYB 4BK4A 3L1GA 1KYUA 4KKZA 4BCZA 4FXLA 4NQCE 2BDNH 1RSFA 1T83A 3VYPA 1LYQA 2EC9T 1NFIB 3UO1H 3PNWA 4FDWA 3IMSA 5ADOH 3KHQA 4KO9A 2WXNA 4ZOAA 4QCIA 2Z8VC 1X5FA 2BSSA 3APFA 3SE9H 4OZFH 1UWGH 4N1HB 2Z92A 3BVTA 4TRPL 3UTTD 3I6GA 3K72A 1QVOA 5A2BA 3MOQA 4PJ5D 5DT1L 1DVXA 1JIBA 4HV8A 3VI4F 1FFNA 1UT9A 4E9WA 5I1JL 3D39E 1T4KB 1FN4B 3HE7D 4H8WH 5LCVL 3RX9A 1A14H 2PWGA 3EO0A 2YMXH 5CMAB 3SDCD 3GKWH 3O2DH 3W2DH 2E56A 1N6QH 1IFRA 2VQ1B 1TMQA 2ZICA 3CCHB 1DQMH 4RBPH 1CFSB 1KPVB 2M1KA 4KY1L 4PGZA 3F7QA 2FWUA 1ZVNA 1GAFH 4Z7IA 43CAA 1K4CB 5F9WB 4MAZA 1CPUA 1S9XA 2ZX6A 4AL8C 2YN5A 2MWCA 2EE3A 5IT2H 2N4IA 3TN0A 3HVNA 4BZYA 1TYJA 1HC1A 1B4RA 5AG9A 2BX5A 3LN4A 4LARL 5B1KA 3D9AH 4RCAA 2WNWA 1R3JA 3DA0A 3HS0C 5CO1A 5C86A 3UPRA 2Z0UA 4Y2LA 1QX1A 1NFAA 3P0VL 2FJSA 5DMIH 5FOBB 4KXZH 2Y36L 4WHDA 1FI8C 3MU3A 1TQSA 2I32A 4N2GA 1AGBA 4NWTH 2KDGA 1T7ZA 4OZ4A 2F9BT 1NEZB 1DVZA 4DPCX 5E9DA 4PJXF 5JR1H 4FA6A 2VDLL 4PTTA 5EORL 3EHBC 5E5RB 3IBOA 2W0PA 2NT0A 3WTUA 1HHJB 1ZS8A 4HDIA 3WS3B 3CK0L 1OAYL 3MREA 4BCYA 3JTBA 1ZS2A 4IS6A 2XIDA 3N85H 5EO0B 3RL1A 3EYVB 1KENL 1F58L 4Z95L 2DEYX 5DD3L 3KXFB 3VXSA 4YO0A 3L7FB 2HKFL 2N59A 3EJZD 4OJYA 3V8OA 1LK3H 4LEOB 3N55A 2OJZL 4NN7C 4LP8A 4Q0XH 3PPSA 1AGFA 2K3HA 1FORH 4IIQB 3MNWB 3O3DB 1YPZF 4F8OA 3DOSB 2VIRB 3BYTA 5CN1A 3SO5A 3QUKB 2DQGL 2AV1B 1TNNA 1MVUA 4XNBA 5C0EB 4LB8A 2FD6H 1LHZA 3GIVB 4PIBA 5KVDL 3TYGL 3HS0A 1JYVA 3MJ8B 1YY9D 2R4SL 1IAIL 4UBDC 1B2YA 3TBSA 3BH8A 4AYDC 2QVIA 4AQEA 4W9CC 4DO6A 5K9KB 5KSBB 1L9NA 1SEBA 5IREA 1NCOA 2CHDA 4YE4H 4JFPA 1GGCL 3RWGA 3AG2B 3H9HA 1CLCA 3PWJA 4F3FB 3DTUB 2UWEF 4UT6H 3SCMD 1M57B 1VEPA 2QQLL 2ZYSA 5AL8A 2YZ8A 5AVSB 2VN4A 4P4KC 1OAUH 35C8L 3HG1B 1K3IA 3CFIC 1UZ8B 4LSSL 4QXUL 1HE8A 2FB4L 1NBYA 1XR8A 1ZHBB 2FX8H 3P77A 2GITB 5ESAA 4C4KO 3L4XA 5E2WL 5L0QC 2R0LL 1CLYH 4NGHL 1AANA 2M26A 2OR9H 3WLBA 4LU5H 3L3JB 5LBSH 1JF1B 3KPSE 3WO4C 5E4EB 1LWRA 1OEZW 4KXCA 4P5RA 4PRIA 4MMYB 5I30L 2PO6D 4NQDB 3UTTE 1IQDA 3K2KA 4MCZB 4G3YH 4FLOA 4XP9H 2QQNL 4PMEA 4WW2C 2B4CC 5I8EA 5MERA 1PX8A 5FAAA 3UJTH 1WE5A 2WO3B 3O81A 3K6SA 2QV2A 1MIEH 2VQTA 2C4FT 2QMKA 3WFBL 4BFKA 3FT2A 2Z31D 5KANG 4U1LA 5EEWA 4LCYA 1HIMH 1U8HB 3U4BL 2YD7A 3V0EA 2CR0A 3CDFA 5E94B 2GIMA 2DPKA 1PZDA 5FYLH 2UZYB 2A2QT 3JTTA 3FU0A 4HIJB 1AMYA 3EO9L 2V2TA 1SXSA 3ZRFC 2E6PA 1TU2A 5JIDA 1MWAL 2FHFA 1KJ2B 2XXCB 1MHPH 3T6VA 4LBAA 1ZGLP 5BMFL 2NPLX 2CG9X 3RJOA 5LGJB 5C0DA 3MACH 4FQIH 4LCIL 4YFDB 1Q90A 2JH2A 5B39A 4HOXA 4P59H 1B6DA 5E8DH 5D2NB 5GISL 2J3SA 4TQHA 1YECH 3C87A 3ZE0E 2VDRB 4RZKA 4URTB 1TITA 4LHUB 4WW2A 1ID2A 3HI5L 1MAJA 4M62H 1VGEH 1I1FA 1NWOA 2A4CA 2WYZA 5DVLA 5TQ0H 5L8KB 1PEZA 2VE6B 5E2VH 4DFIA 2BSEA 1A5FH 1NGYB 4GUPB 2O4EA 4KZDL 1EEYB 4YXHH 1A7OL 2I69A 3GTTA 4ODHH 3QG6A 4FP8H 3D08A 4AW7A 4MMZA 3VVVA 1IJNA 4UQ2B 1KCWA 3CFUA 2F19L 1TJIL 1MCRA 2H0PA 5DJAA 2KLRA 5KS9E 1NDMA 1D5MB 4RFNB 5LG1A 3UH8A 3VUAA 3K71A 2CKBA 5LAPA 1XH0A 5FW6A 43CAB 5HI5C 1XMWA 4FE9A 4BINA 4YSCA 1S9XB 2E7MA 4J1UA 4Z7OF 1TOXA 2FIRT 3CVHB 3MROB 2CJSA 2EO7A 5JA9A 5CUSH 3QDGD 2IPTL 4O5LL 4H26B 2HLFC 1KC5L 2B1AL 4DP7X 5D72H 1BM3L 1CGUA 3QZWB 3KS0H 1ODAA 4FFTA 2IG2L 4OIFA 5D4QA 1HN1A 4RSVA 4IOFC 4NLHA 6PAZA 1I9JH 1A6UL 5IJBC 3GBML 5I75B 1C1EH 3ZBMA 3QCTH 3FNKA 2H6PA 2P42B 5E2TL 1AGBB 2K8MA 1SBSH 5E99L 3BGFC 4ZDHB 5E9DB 5C1MB 1DJGA 2CWRA 4W9DC 3VGDA 1T0MB 5ENWA 1VLXA 3ARSA 3LN5A 1XEDA 4Y2OA 3QPXL 2XJKA 4R4NC 4LEEA 4L8DB 3MREB 3LEVL 3JQOB 5KBPA 4P5KB 1RZFL 4GAYB 3BUQA 5CP7A 2EYTA 1K6QH 3FQWA 1E7UA 1NOAA 4YO0B 4FFVC 4Z0XA 1GS7A 1IGFH 4KZDH 4J8RB 1KACB 2P8MA 3NPSB 4X5LA 2BJMH 3TWCL 4OM0L 5IOPB 3TZVD 3VFVB 2D7MA 4F7EB 2YSSB 1OT2A 2EQDA 4K0OA 4MLIA 3LV3A 1UTDA 1XIWD 3L17A 5BS0B 2DWXA 3V0IA 3ZRCC 1S9VA 4PRHA 4G70B 4NO0A 3IM1A 4X9HA 3FULA 4XBGB 3QIWD 2LAGB 4BA0A 2XY1A 1MVUB 1VZGA 1QRNA 1UEMA 2VDQB 2ZF8A 3A22A 3KR3H 3IXTA 1CTMA 1B2WL 3I6SA 2WMPB 2XWJB 3IDMA 1YMMA 2ZUYA 5HTSA 1CK0H 5KYYB 5GGTA 2L0DA 5TDOB 4NNPH 4JFPB 3KPTA 5EG6C 3PWJB 3EYQC 3RRQA 4NQSB 5AKRA 2I5YH 2VLRA 4FX5A 3H3PH 1XR8B 4JY4A 4XMLH 3P77B 4DQAA 1ORSA 3S35H 2I7SA 3F6IA 4ERSH 2FLBT 2PN5A 2X87A 3FRUB 4FJZA 5FO7A 4YQXL 3X14B 3GRWH 5SWZD 1Y7VA 3GMOB 5D93C 4DT2A 4KRNA 4P2RE 4PRIB 1M1XB 1X5JA 3NDZE 1AFVH 1GGIL 2N01B 3OZ9H 2PPFA 2MQ3A 3CFDA 1BJ8A 1MIML 1JXFA 2P5WE 4L3CB 2IDSA 3BKCL 5MERB 4N8PA 2APWA 4Z3TA 2PMZA 3JWDH 2QGCA 1GRWA 3BWZA 2E6QA 3RIAK 4KPHH 3UMTA 2KKQA 4CILA 3O9WB 1IGTB 3FT2B 4U1LB 1QSFD 1YEKH 4L8BA 2BIIA 3ZT6A 2VRKA 3TVMC 2ICWI 5IGXH 2CRIA 5KG9A 2EEDA 1EZLA 4QYOA 2QDWA 3HN5A 3GSQB 1URLA 3DV6A 4DEPC 1JVLA 4XB3A 1IC5H 4RGOL 1CFTB 4AIZB 4M93B 2ZKXA 4QEGA 3SGEI 5FK9B 5L0QB 1DSWA 2C9QA 3CWGA 3CMGA 5FYKE 2OXHA 4PG2C 5C0DB 3FB7A 1QACA 3L5HA 1AQMA 3NG5A 5ACZB 3UJJH 3D06A 1RK0A 2A0LD 4L5FL 3OKDA 3QQ4B 2VH5L 3K4ZA 1JGUH 4OD1L 1NDTA 3V6ZB 5L6YL 1HHIA 4EUPA 1F3DJ 5DRXA 4WW2B 1FAIH 5IV2A 3G08A 4IU3A 3OJ2C 5IQLA 3X3FH 5GS2H 4JY5H 1EJ6A 1I1FB 1KBKA 1L4IA 3IGFA 4TULL 3LEXB 3ILQC 1V3LA 3IFLH 4LNRB 5GHWL 3H4HA 4DKAA 4NNYA 3S5LA 4OFYA 1DQJA 1MJJA 3CFBA 3ROLA 1LL1A 1Z9SA 2DQCL 4IOIB 3TVMA 1NDGA 4G6KL 5EZJA 5AVXB 4MZIA 3MRLA 4MMZB 5J1AA 5ACLA 4I3SL 1MCOH 4PW3A 2DM7A 4D9RE 5IROD 3DJZA 3K71B 1MHEA 2NYYD 1IM9D 2JK5B 1PMYA 1BBDH 3RGVA 1U30A 3GHEL 1T80A 5KSUA 1N5AA 2IALA 3NCJL 3SDYL 4YDKH 1A1NA 5IWLA 4JO1H 4UZUA 2NTFA 4PG2A 1HESA 5A3IC 5C3IA 2IMMA 4QJ4B 4HCRL 3ZL4H 2COQA 5MI0C 5C0JA 2QVMA 3Q8FA 3I6LE 1OSYA 4R84A 3QCVH 4BRVA 1FVDA 1NKRA 2DLHA 1KNOA 3ZDZE 2W38A 3PHOB 1UD6A 3L1OL 3QIBC 3R7QA 4LF3A 1WS8A 1U3NA 1DZ0A 3ARUA 1THAA 3ZKXB 1A3LH 1NSNL 2DWEA 3IETA 4P46B 1JTPA 2IWEA 4Z7NB 1SM3L 1YNLL 1R3IH 1MF2H 4K9EL 3I9GH 1X5GA 5CLTA 3SB3A 2WVSA 3AWFA 4CNIA 1WYJA 2PP7A 3IKKA 4Y9GA 5DS8B 2F5AH 1S8DB 5AW4B 3AQYA 4A6YL 3WN5B 3RWJB 3MUGA 2PCFB 2GW5A 2UY7B 3BLPX 4YHMH 4AV5A 1EQWA 1JXDA 4Z7VA 3QUYD 4K8RH 1UACH 3ARED 4Z0XB 5AYUL 3NCYP 1RUAL 3GD1C 12E8L 5B38A 2DQUH 2JKRM 4GRWB 4N0UA 1VEMA 4JGNA 3EUUA 2IQ9L 1D5ZB 3B37A 3O45A 4NO3B 2Z7UA 1GSMA 3GMMB 3PWNB 4PJGA 4GXFA 3ZE0F 1FSKC 2XOTA 1S9VB 3HNTH 4PRHB 3L3DB 1QSFE 5K1VA 3PUCA 4QJ3B 3D8MA 2VSDA 3MYZA 4DHLA 3K2UH 1FHNA 1OGPA 1XWVA 5AW3B 4U05A 3GGWA 1E6OL 1SYVA 2WINB 3BVUA 3IXTB 4YVNA 1H15B 4YWGL 5CIPH 1ZANH 2ICEC 2ADIB 2OJEB 1EEUA 1YMMB 3UTQA 5JMOC 3PWLA 4K3EH 3E7JA 3QQDA 2DD8L 4WRLA 2GJ6D 1N7MH 3QIBA 2ZCLH 3SDDC 4GG6B 3BAEH 4Y4HD 4L8CB 3P11H 2F68X 3F2LA 4ODXB 5HHNB 3JBG7 4GXVH 4YSTA 3JV0A 3IRPX 3D4YA 4M3KB 2XX0A 4JY4B 3V6OA 1T3FB 4ZS6C 5I28A 3VCLB 2JXMB 5I17B 1PS3A 2D9QB 3DI3B 1U2CA 1IT9L 2CLRA 2H26B 1EO8H 3ARDD 5KBDA 5FECA 1DANU 1JTTA 5E8EA 3BUYB 4RIRB 3WAJA 3LQMA 2KZBA 5JLZB 5E4OA 4HUKB 5DEFB 2OTWB 4M4RB 4FA7B 1DDTA 4ZAKC 2EIKB 5C3TA 1KGWA 5IVXA 3UC0L 4F1ZA 4GW5B 4XVOA 4CVUA 2DQIH 1MCPH 5E7BA 5FO9B 3OJDB 5I6XB 3E80A 1UXLA 4LPCA 5DC0A 5T5FL 4N0RA 5AAMC 3GMRA 3WIHA 1WZMA 2BS8A 1XFPA 3GXTA 4OLYH 1FQ9C 5D1QC 2QFRA 3B5HA 5E8OB 1FWXA 1NGWA 3LKQA 5IB5A 3G6JF 2OR8A 4NM4H 2CALA 2QPEB 4OZGA 3EJUA 2X10A 2ICEA 2XZAL 3KPPB 3DBXA 3LHAA 5KJRH 3CDGA 5GSRA 1FZMA 4C83A 2GTWB 3L1FA 3SDDA 5KG9B 4W4OC 2RB8A 4KUCD 4KKLC 3B9KA 4NKIH 1S7SA 1DBJH 4QYOB 4N2KA 1WRFA 1ET8A 3KPMB 4AYBA 3S9DB 1T1XA 3F12B 4RGNC 1SUHA 3LRLA 1KY6A 4JO2H 3VFWA 4JDTL 3TEUA 9CGTA 2GSGA 4MDJA 4BH8A 4FQLL 3ZE2E 5HYSA 2CBTA 4NRZA 3DSNA 4J3UA 2Y25A 4RWHA 4TQ8A 4AI7A 1YAIA 2OXHB 2IAMA 3D0VA 3QG7H 3HLAA 1CFNA 1EVUA 3FB7B 3QORC 4MHHG 3EOTH 3KGTA 4ZAKA 1YMHA 3UXFA 1CL7I 1ZMYA 3EYSL 3Q2LA 4GY4A 4NM8L 2OMZA 3BJLA 4WFHD 3FFCA 3HB3D 4MA8H 3DLQR 3M1OA 5T3XL 2DQJH 3LIZH 5F71A 3TO2A 5IV2B 5HGDB 1HFUA 1UKSA 5AAMA 1GZPA 4D7PA 4K7PH 1UCBL 3T0EE 3B5TA 4HCGA 3TESA 2HVKA 5I8CA 2O5ZL 1GC1H 4XCCH 5D1QA 1AS7A 2KBGA 1K85A 5T8IA 1NCBL 4PV9B 4QHKI 1G0XA 3B3IA 4ABWA 1J0HA 2ZP8A 1OL0A 3S5LB 2QHLA 4DOHB 3CFBB 5A2KH 1CFQB 1Z9SB 1B0GB 3JVGC 4FG2A 4LSQH 4MNQB 2E86A 2L7UA 5J1AB 4W4OA 2O72A 3NJKA 3EDDA 1AR1C 4RMUA 3W0WE 3N1FC 2UUDH 1GGBH 3QDMA 4HHAA 2XY2A 4YAQB 1YQ2A 1HHHA 4K94H 3LD8B 2HAZA 3HAEH 5EN2B 1VADA 3RGVB 5HPOA 4OT1H 1TVBB 3QS2A 2AJ3A 4N2OA 5KSUB 5EA0L 4XOEA 2IALB 1SEQL 3OKLB 3RWCA 2FK9A 2CR3A 3HFFA 4L9DA 5JQ6L 4HLJA 5L7XH 4Z3HA 1LO0L 2UY6A 2CH8A 4XCFH 4MD0A 1DL7L 5C07E 5T1DH 4DCQB 5A6MA 2WN3A 1H3WM 1I1YA 1O9ZA 2IGFH 2XQYA 4PWIA 3MCKA 5F6HJ 1XTMA 4A55A 1JVOA 2B14A 5JHDA 1YEIH 4Q6YA 2YGQA 3TOPA 3U2SB 3SKNA 1NCUA 4RFEB 3TWYA 2EXYC 1CE1L 4LL9A 3MUJA 2HMID 4WEEA 3VXNA 1WK0A 3PABB 3DSFH 2Z93B 3DUSB 3KYNB 1JFQL 1ZTXE 2BVEA 2CAKA 2FAUA 3JVGA 4S0SD 1C16A 1QEWB 3GBEA 4FG6D 2Y5QA 3E6HA 3FB5B 4Z7VB 4Z7WF 3HHMA 1CGVA 4UM9D 4C4BA 4Z3EA 1KIRB 2BOCA 3APDA 1X7QB 3CZUB 4WWKC 1V05A 1LWHA 3F5WA 4PJGB 1NCHA 1L5GA 1T1YA 5I1DA 5K9OB 5E6SB 4YXLL 1QYGL 2F6AA 1HILA 1A6VH 4JHWH 4MLSA 4A7TA 3KXFD 1ETJA 2VNCA 4J6RH 1AD9A 1A3QA 1PZ3A 1P4LA 3GGWB 3O2WL 2FT7A 3PDGA 5DYOA 4AG4L 3WL9A 2KQMA 1A7QH 3EZJB 4HZLA 2IBZY 1XAKA 4DP9X 1L0YA 1OM3L 1JOIA 4BQ8A 1U8NB 3I75A 1CDIA 4WGVB 2IMNA 4Y8AA 3VFPA 3CFKB 4NBXB 3BVVA 1P0SE 5G5DA 3VXTB 5BNXD 4FNSA 3T0VA 3OAYK 2J1KA 2V2XB 2NY2C 3QWQB 1F2QA 4UZSA 1IAOB 5L9DH 2CLRB 3OC8A 4N8VA 1T2XA 3BPNC 3VG9B 1G7QA 5C6WH 5IMMA 3AS0A 4NQQA 5E8EB 2FHCA 3N40F 2HUEA 5F1IB 4P57A 5T1KB 1OP3K 1N8ZA 1V7NH 4QXTB 4OGQC 4WFHE 3RA7L 2ATPA 4JO4L 4P05A 3DO3A 4RNRB 4EN2A 2HA1A 5K69A 4PLJD 3FC8A 4AUYA 3HG1D 3BEVA 4DESA 2NLJA 4KXZI 1O6SA 4XC3L 2Y1AA 3AACA 1BZDA 1LJMA 4NZ8A 4A2HA 4WI0A 4XGZA 3ZDZF 2YKLL 4HJJL 1ETB1 3N0AA 4YJZL 2W9DL 1DFBL 4YZFE 3ZTJH 1ANUA 5TE7L 3ZMRA 1UJ3B 2HJKA 5EIIG 1T20B 3C9NA 1NGWB 3LKQB 5FYJE 4NT6A 2BP3A 2G2PA 5DK3A 3KW7A 1XGQA 2CQVA 4NQDD 4FQQA 4ZNEA 1GVIA 3S98A 4HKBA 3VQMA 4JZJC 2ZQKA 3QBTB 1KFAH 2M8XA 4GB9A 5CJ8A 3ZK0A 5FHBL 1FL3B 4K2UH 2R1YB 5DJCA 3CDGB 5GSRB 2VXTL 1P5UA 4C83B 1WCBA 3SDDB 1T7VA 3B9KB 3H0TA 4TLTA 2IXQA 3BWAA 1AR2A 3E1ZA 4JUTA 4Y5YC 1JI1A 4PJ8C 1T1ZA 3D3VB 3BCDA 5E00B 2NXYC 8FABB 1PLAA 3W82A 4HIPA 2NYZA 3VFWB 5AVYB 2WXGA 1A22B 3CU1A 2VABA 1FO0H 3IJ8A 4JG0L 4X99B 1L7TH 4BH8B 1WC7A 4WUUA 5TDPB 3SZKC 4OFQA 5K9JH 2CHNA 5MEQB 3MCLL 3TX4A 4AXWB 2IAMB 1D6EA 5HVFB 5TF1H 1ND0A 3LHPL 2XV2A 2J71A 4QDGA 2HVBA 2KZKA 4ZD3L 4ZFGL 3CSGA 1GHFL 2C9VA 3MJ9L 4LLMA 1HWWA 3OV6A 4H44C 4Z6AT 3RWFA 2OMZB 1MFCH 4HXAH 2DJUA 2R83A 1D9KB 4AKPA 1U8MA 3CXFA 4HF5L 4XVTH 2ZONA 2WJ5A 2OCFD 4HH9A 4NCDA 5K5YA 3J27A 2NY5H 1OSPH 2B5IB 1DQDL 1DQLH 1GZPB 2Y72A 3EFDH 3K0WA 1MWAA 2PTTB 2H1LM 1AOHA 5I8CB 4JFEE 3C8KA 2E74C 4LSRL 5D1QB 5DMGC 5C0AD 1I85C 3MFFB 3QZMA 4CUCA 5F44A 3FOMB 3B3IB 2E27L 3HJ0A 4EVNB 2DJ4A 4JZJA 5DO8A 2R8SL 3IDIA 5EO9A 4R26L 3OR6A 3RDTB 3JUYA 4LHUD 1GKEA 1HXMA 2IOMA 3KBEA 1CD0A 4ANUA 2HG0A 2X4UA 2BSTB 3WLWD 4AT6B 5JYLA 5K1JA 1YEGL 5AW7B 1I8UA 2CE6A 2ZCHL 4Y5YA 2ADJB 4PJ8A 3FRPA 2EYSA 4RGNB 2IANB 3KXFE 4WENB 1BG9A 2A73B 1VADB 4IK6A 3DI2B 2XG5B 4ZX3A 3EG9B 2M83A 5C09A 4WO0A 3AXLB 3SDAC 3RWCB 2GJZA 4OJFH 4PHXA 4ZUUA 3UDWC 3IVKB 3UOAB 1ROCA 1U8CA 3ESOA 4MD0B 2H5UA 4FFYL 4Y19A 4FQHB 3QSKB 3HI1B 2ZXGA 4G5ZH 5TTRA 1KJVA 1OE1A 2WVTA 5GGRB 1L0PA 2C3VB 1E9OA 5JHDB 1VA9A 5KSBE 2XVBA 3VGAC 3CPLB 3ATBA 1F4AA 1NPJA 3MXVH 3W38A 1I85A 3CXDH 4M48H 2XV0A 4HIEB 3WN6A 5FYKH 1OT4A 2EAEA 2Y1YA 3HG1E 1QHPA 2I60L 4JFZH 4JDVA 3ZE2F 1C16B 2HPTA 2Y22A 3LRGA 4I5BA 4JKKA 1FL6A 4OCWL 3ULVL 3E6HB 2OMUB 1ACYL 1ODUA 3SDXB 3HPJB 2XXMB 1AR1B 2V8MA 3O0LA 1MRDL 4B9FA 4UB0H 1T2JA 4YFLF 2BOCB 4HWUA 4ZG1A 3SYOA 1EBPA 3VI3A 3M7FB 3F5WB 4U6HA 1HCYA 4XC1H 4G8EB 5I1DB 32C2B 2VLKE 3SKMB 4DW2L 4HPOH 4V11A 2AQSA 3SDAA 1CE6A 1HILB 1LILA 4AY0A 3KWWA 2DICA 3UDWA 1AD9B 4LDCA 2YARA 3FTXA 2J57A 2V3FA 5DYOB 2P24B 3WL9B 3ABLB 3B7RL 4JFFB 1G7PA 1VESA 2X4NA 1QOKA 4BE6A 4LFHG 3TT3H 2AK4A 3QB7C 2FT6A 5BS0D 3K6OA 1DBKH 4F33A 3I75B 3RFZA 4X9GA 3VFTB 3MLTA 2WYHA 3HKFA 3K74B 4P2OC 1D5BB 1LK2B 1WH0A 1S7WB 4GMSL 5C3LD 4YHZL 3MGAA 5DZ9A 1NEPA 1ZDSA 1EHNA 3JWNC 3KPRB 1KELL 1SHSA 3GI8H 3N91A 1U8JB 3QH3A 1G7QB 4N8VB 4YLQT 1Q94A 5IMKA 4JJ5B 3HBQA 4XAWL 5IMMB 2WWKO 3N3EA 1KTLB 4PN6A 5DUJA 1N8ZB 5JW4R 2J21A 4QRRA 2R1XA 4LL4A 3G6DL 5HDQL 4I7ZC 1LE9B 2PPDA 3VRIA 3MRGB 5L2JA 1S46A 4DUXA 5IVZA 4NO5B 3ALXA 3BLBA 4WI0B 4XGZB 1J9RA 2Z8RA 3L4ZA 2HJFB 1F1GA 3RYMA 2MCPH 5IFJA 4HWBH 4BGDA 5CZRA 3C9NB 3L3OC 4XCYA 1T22B 1BOGA 4YUEL 5CCKL 1OGAA 3QFJB 4PJCA 3S3DB 2AVGA 3TJHD 1Z5HA 4S1QL 3V4LA 2NW2B 5DJ6B 4LMQI 4XMKL 3QHFL 5AB2A 5GGVH 1P5UB 5ICYA 4AC2A 4XOBA 3IDJB 3H0TB 1HCFX 3JV6B 3BWAB 1YN7B 3ULUE 3QT2A 4JFQA 1MJUL 2FX9L 2WUBL 3O9WD 1BD2B 4NUGL 4R5TA 4WFGE 4JE4B 1N26A 4FTVA 1FJ1B 3CMOH 2VC2L 2CZNA 3BPNB 1NLBL 3BPOB 4PJFA 3B7SA 1TETH 5ESVB 4WEBH 1D6EB 5HGBA 4NC1E 4H1LG 3SJVA 5AWNH 3WY3A 4FI7A 2YD3A 4FXKA 2BNRA 1PD6A 7PCYA 2YD2A 2DM2A 3DECA 3QW9A 3WHXB 3V5KA 4KUCF 1XD1A 4IGBC 2NSQA 4OD2B 2VQ4A 3RIKA 2BCKA 4HH9B 1GR7A 1PZBA 3FOLB 1DSFL 4QO1A 5DF0A 4BWUA 4HG4K 1S2EA 1IBFA 2ZJSL 5C0RH 3AUVA 1JRHI 3L3OA 4IIZA 1N2RA 3DTXB 4B3EA 3NAAH 2KT6A 1KPRB 2JKNA 4NZTH 2JFCA 3BP5B 3AG1B 4A7GA 4NQEA 5E9DE 4IJ3B 1JPSH 4KK9D 1BZQK 1JL8A 1I7UA 2IADB 2F54B 2VRQA 4JR9L 2NSXA 4Z0BH 1AMXA 2W5PA 4AGMA 1R3LA 5E03A 1Q0YL 4RMRA 4OUUA 1SDDB 2TAAA 1CLZH 1FNGA 5I15L 2HG5A 5C9JB 1IAKA 3DIVA 5HHXH 3L2LA 4K9EC 4N2MA 1CT8B 2R0KL 4LIQE 4JPIA 5IB3B 2O6EA 1JHTA 3H7BA 1WHOA 2F2HA 4XHQA 3MXWH 5A43C 1MELA 4YZFF 4ZUUB 4LSUL 5B7EA 4AW4A 4QRPB 2FEEI 3QARA 3S37H 2NNAA 1RJLB 5T5NF 1BM7A 2FVNA 2A9AA 2QBWA 2G5BA 4Y19B 5AW9B 5AZ2H 5HHOB 2HTKD 1HS6A 4IGBA 1CVSC 4KK5C 1XB3A 5DJDA 4HUNB 4N8UA 1HNYA 4UU9B 5FUOH 4B9IA 1JGLL 2XNAB 3R06A 4G6FB 5E56A 4R8WH 3W39B 3QEQA 3RWEA 2CCWA 3VXPA 1IBHA 3P9LA 4MDIB 4POZD 1S7VA 1ZGLB 4HIXH 1ZAGA 1UXSA 3TASA 5F7HA 2IVFC 4KTDH 2BFGA