3DIVA

Crystal structure of laccase from cerrena maxima at 1.76a resolution
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
499
structure length
497
Chain Sequence
AVGPVADNTITDAATSPDGFSRQAVVVNGVTPGPLVAGNIGDRFQLNVIDNLTNHTMLKTTSVHWHGFFQQGTNWADGPAFINQCPISPGHSFLYDFQVPNQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASRYDVDNDDTVITLADWYHTAAKLGPRFPAGADATLINGKGRAPSDTSAELSVIKVTKGKRRFRLVSLSCDPNFTFSIDGHNLTIIEVDSSNSQPLSVDSIQIFAAQRYSFVLNANQAVDNYWIRANPNFGNVGFNGGINSAILRYDGAPAVEPTTNQTTSVKPLNEVNLHPLVSTPVPGSPSSGGVDKAINMAFNFNGSNFFINGASFVPPSVPVLLQILSGAQTAQDLLPSGSVVLPSNASIEISFPATAAAPGAPHPFHLHGHTFAVVRSAGSTVYNYSNPIFRDVVSTGTPAAGDNVTIRFLTNNPGPWFLHCHIDFHLEGGFAVVQAEDVPDVKATNPVPQAWSDLCPTYDANAPSDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of laccase from Cerrena maxima at 1.76A resolution.
rcsb
molecule tags Oxidoreductase
molecule keywords LACCASE
total genus 139
structure length 497
sequence length 499
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2008-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3divA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3divA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3divA03
1GSKA 1SFDA 3V9EA 5B3SB 1YLBB 2EIKB 4NB7A 4YSCA 3UAAA 2VW7A 3ERXA 2EIMB 3AG4B 1GW0A 2IWFA 3EH3B 2IDSA 4PCYA 2VW6A 1KCBA 3FS9A 2R7EB 4KO7A 1E5YA 1JZEA 1A8ZA 1BEXA 1SFHA 2WSDA 4YSTA 3WNJA 2H5UA 5I26A 4NERA 1ET5A 2Q9OA 1MZZA 4QLWA 2BWIA 3FT0A 3T6XA 3CZUB 1NZRA 2P80A 3IN2A 1SHWA 4AI7A 4KNTA 3GDCA 2PPAA 4BDVA 2IH9A 2QPDB 1TEFA 2BP0A 3QQXA 2CAKA 2YAHA 3FU7A 3NJNA 5A7EA 1AQ8A 1JVLA 2CCWA 3PAVA 1W6LA 3BQVA 3S8GB 1VLXA 3NJFA 3ABGA 4KOBA 2UXGA 2EIJB 3WI9A 2CBPA 1ASPA 5D4HA 2BP8A 2XX1A 3AY2A 4G71B 4A66A 3JTBA 2TSAA 4F2EA 1A4AA 2JKWA 1OCZB 3FPXA 3PCYA 4A2EA 1GS8A 3SBQA 1NIBA 1BXUA 1M56B 1OE1A 2XLLA 4DP0X 3ZX1A 4GYBA 3IN0A 4BK5C 2QDWA 1IBZA 2PPCA 3HEIB 6PCYA 5I5IA 2I7OA 2HZHA 1BXAA 3DTUB 2CALA 4Q89A 2AVFA 3PAZA 5TK2A 4ENZA 1A65A 3PPSA 2I85A 3UACA 1M9WA 2FQFA 2FNWA 1TKWA 2B3IA 2Y69B 4L0PB 1ETJA 5PCYA 3CVCA 3FQYA 1RCYA 2PLTA 1KGYE 3FU7B 1AANA 4KO5A 3ZDWA 4G7RB 3QJSB 1ID2A 1GR7A 3AW5A 1PNCA 2CUAA 3H4FA 5I5JA 3QPKA 4YSOA 2XWZA 3AG2B 1QHQA 1T5KA 2XXGA 3RYMA 1NIEA 2AZAA 2VW4A 3FSVA 4AKOA 1J5DA 1KDJA 4YL4A 1AZRA 4WKXA 3GXUB 1TEGA 1JZIA 1SJMA 1J5CA 2DV6A 2VSKB 1OCRB 2QDVA 3ASOB 1ZIBA 3S3BB 2IDTA 1JXDA 3T6WA 2VN3A 2BW4A 2X87A 3D12B 4G72B 1ZIAA 4YVUA 3UAEA 4DP6X 4DP7X 2J55A 4DP9X 4W1TA 1J9TA 3PAUA 1KBWA 4M3HA 3OM3B 4HCIA 3NSCA 2FQGA 1PCSA 5B1KA 1SHXA 1DYZA 3NSDA 2BZCA 2ZONA 3NJMA 3IE9A 1OV8A 2PCYA 1WA2X 3FU8A 1SDDB 4KO9A 4BWWA 2ZXWB 1CURA 1PLBA 2UX7A 2WO2B 4GP5B 1CYXA 2NRDA 3NJLA 3QJQB 1A3ZA 2XUWA 1JZJA 4A2GA 2BZ7A 1I53A 5D4IA 1WA1X 3TBCA 1BAWA 1CC3A 1L9RA 3EF4A 2N0MA 2YQBA 3C75A 2Q5BA 1AACA 2Y1AA 2AANA 3EH5B 1GYCA 2IDFA 3X1FA 1NINA 1SF3A 1URIA 2GC7C 3QJUB 4E9YA 3FYEB 3FU9A 5PAZA 2GI0A 2UXTA 3S3DB 4QKTA 1ZDQA 4KNSA 2GB2A 4YSUA 2E86A 2GSMB 3CVBA 3X1EA 2IH8A 3X2QB 3JT2A 1JXGA 1ILUA 1OF0A 2XV3A 4JHVA 1ET8A 1IC0A 4UANA 4JKNA 3KW8A 1PZBA 1AR1B 4X4KA 2BO0A 1FA4A 3IEAA 4NAJA 4PAZA 1L9PA 5I28A 5B7EA 4Q8BA 4N8UA 1PMYA 1AG0A 1MZYA 2GC4C 2VSMB 4YSEA 3U25A 3DKHA 1CUOA 3AG1B 6PAZA 1WS8A 7PCYA 3OMIB 3NJKA 1NICA 2HRHA 3SBPA 4DP4X 2DYRB 3FSZA 4YSAA 1GY1A 5I6NA 2IDUA 1RKRA 2FWLB 2YAQA 2GBAA 2A3TA 1NDTA 4W9ZA 3NJJA 3T71A 1GY2A 1KYAA 3S3CB 1ADWA 4CSZA 2PCFA 3OD3A 7PAZA 4YSQA 1AZBA 4G70B 4DP1X 1QLEB 1WA0X 3H56A 3S8FB 1BXVA 2EILB 2XX0A 2QT6A 2XU9A 2HRGA 4KOCA 1PY0A 5F7BA 3WKQA 2OV0A 4HIPA 4BXSV 2H3XC 4TXVB 1A4CA 4KNUA 4DPBX 5B1AB 1A4BA 2DYSB 1V55B 4FAAB 4BXVA 3ZBMA 1PF3A 5B7FA 4DP8X 2HLEB 4BWTA 2ZWNA 5ANHA 2FQEA 2YAEA 3MBWB 2VM4A 4EF3A 1MG3C 2B08A 3CG8A 4HHGA 1NWOA 1EZLA 2XYBA 5I6LA 3NJGA 4RH4A 3FYIB 1BYOA 2H47C 3N55A 1AS7A 1ILSA 3X1NA 2PPDA 4P5RA 3TU6A 2R7EA 1BYPA 1E65A 5TK4A 1OCCB 2HX9A 4DPCX 2YXVA 1NTDA 2JFCA 5D4JA 1NIDA 3NSYA 2YXWA 1W6WA 2XVBA 3KW7A 1PLCA 2IDQA 3ABKB 1J9RA 1JZGA 1KV7A 2RACA 2DWTA 2X88A 4BDVB 2W88A 4FA7B 1ZPUA 5I6MA 1L9OA 2PP9A 1E5ZA 1XMEB 1GS6X 5LDUA 4HZ1A 1E67A 3X1BA 2PPEA 2YAFA 2P80D 3NJHA 4UAHA 3WNIA 1SNRA 1KCWA 1JZFA 1L9TA 2MTAA 3N2JA 1L9QA 3OQRA 3IBOA 4F7KA 1HAWA 1KBVA 4AKQA 1WAEA 2BW5A 1B3IA 1DZ0A 1ZV2A 4F2FA 2OCCB 1ZDSA 4HCFA 1OOWA 4E9RA 2HX7A 1AZCA 1FFTB 1IKOP 1AS6A 1NIFA 2BHFA 4YSPA 3NJIA 1TU2A 2CJ3A 1SF5A 1J9SA 5FC9A 5B1JA 3OMAB 1N70A 1W8EA 4E9TA 3UGEA 3FSWA 3HB3B 4DP5X 4YSSA 1SDDA 3NSFA 1KDIA 1ET7A 1EHKB 2FT7A 2IWEA 4E9WA 2HXAA 5AFAA 1PNDA 1ASOA 3G5WA 3BVDB 2BP8B 2YARA 2AZUA 1XB6A 2FJSA 3X1GA 1XB3A 3FSAA 4BWUA 2J57A 2ZOOA 4AKPA 3WKPA 4N4YB 1PZCA 2FQDA 2VMJA 5EHFA 3T6VA 1GS7A 2WO3B 2PP7A 2EINB 5B1BB 3PXLA 1AOZA 4DP2X 5E9NA 2J56A 3CVDA 1PZAA 2AFNA 4YSDA 4YSRA 3FQ2A 2LLNA 1N68A 1V54B 4CSPA 1QNIA 2XV0A 3WIAA 1J9QA 1MDAA 1AZUA 4JHUA 1RZQA 4HHWA 4K9JA 3TBBA 3WG7B 1R1CA 4WTQA 5F7AA 4A68A 1CYWA 2GHZA 1OCOB 1PLAA 4A2FA 4E9VA 2BP0B 1XB8A 2I7SA 2YAOA 2YAPA 1IUZA 1NIAA 3CDZB 4G7QB 5I6KA 2JXMA 1MG2C 2IAAC 2PP8A 4DPAX 2UXFA 3L45A 2OJ1A 4GP4B 2QPEB 5AZUA 4YVNA 1AG6A 2UXVA 4ZK8A 1JOIA 4A2DA 4G7SB 5IY5B 1JZHA 9PCYA 2MRYA 1AIZA 3ABLB 1ASQA 1OE3A 3UADA 3T6ZA 3EH4B 1NWPA 4E9SA 2DWSA 2YAMA 1E30A 4P5SA 3DIVA 1BQRA 3TA4D 3T9WA 4A67A 3PLYA 3NYKA 5I6PA 3TASA 3EHBB 3NP3A 3QJTB 4E9XA 4HALA 1M57B 4MFHA 2HX8A 1NPJA 4A2HA 4GY4A 1X9UA 3ASNB 5B7MA 2FTAA 1IBYA 3OMNB 2DY2A 2J5WA 1AS8A 4AX3A 3H4HA 3FQ1A 2BWDA 4UF7C 1X9RA 2TSBA 3AG3B 5B1JC 2GIMA 2XV2A 2XXFA 3ABMB 2FT8A 1F56A 3NP4A 1BQKA 4AZUA 4GXFA 3FPYA 2UX6A 3MX0B 1AAJA 1BQ5A 1FWXA 1JVOA 1PAZA 3GYRA 2VM3A 3QJRB 4E9QA 8PAZA 3NT0A 1WS7A 3SBRA 1HFUA 1V10A 4HAKA 1UATA 5I6OA 4M4RB 1JXFA 3CDZA 2W8CA 3QJVB 1HAUA 4GP8B 1JERA 4HCGA 5AKRA 3UABA 3ZIYA 2FT6A 3AZUA 2IWKA 3V9CA 2PPFA 1NPNA 5I5MA 1OE2A 1RZPA 3SQRA 1L9SA 4KO6A 1AZNA
chains in the Genus database with same CATH superfamily
5H4ZA 1T6BX 1B0IA 3TURA 2VW7A 2Z3FA 3NA9H 2PYEE 1GW0A 3HG1D 3OV6A 1XAUA 5D7JD 3H0TA 5IMKA 4FXLA 3RURA 1BX2B 1YSOA 12E8L 4X7TB 1H0DA 4UM8A 4PJIE 4BBWA 4JFOB 3K2MC 4XZUA 4UU9A 4HFUL 3S35H 4YX2H 4M7LH 5F2FA 1P53A 5LN4A 4AI7A 2AITA 2P7TB 5F70A 4DN4H 3R06B 2FEJA 5AW7B 1OCWH 3OAWA 4PP1C 1EUTA 1MPAL 1EXUA 2YWZA 5SWSD 5C71A 5JOPD 2CZNA 1A6ZB 1QLEH 1FNEA 3NJNA 4MA7L 5E4EC 1AQ8A 3J8F7 1CICC 1OSZA 1B6UA 2NXZC 3GSNL 3K72B 3X14B 3CDYA 5DVPA 2XWXA 4HPHA 3GLZA 1J5OL 2O5YH 4ZYKB 3MJ7B 2UXGA 5JQ6H 1MHPH 3MLSL 2ENSA 2V6HA 4I0KA 2JKTM 2WLYA 4JY4A 1A4AA 4JX0A 3OPZL 3ML9A 4QTHB 2OMWB 3MCYA 5D72L 5T33H 2RCSH 4PYHA 5BXFB 3SBQA 1DL7L 1GGYA 2ZX7A 4J3UA 2FGWL 4JDTL 4HAFA 3GT6A 4KUZL 5JPNC 5E2JA 4F7TB 4XRCB 3KLSA 3S37H 1E9OB 5IFJA 1CDGA 5ANME 1LD9B 3Q6GH 4K7PX 1UWEH 2NPLX 2K6ZA 1BXAA 2QKIC 4QEGA 3AXLA 4WEBH 3P4MB 5I5IA 1ITCA 2AVFA 3QDMD 2NXZB 3QS2A 2HMID 3MAWA 1KGWA 2BVPB 3DX8B 4HIXH 3BQUC 1H6EA 4Y1AB 2WCPA 4LL4A 4EKXA 1LNUB 2P5PA 3LRSA 1ZHNB 2Z0BA 3INUH 3DROA 4UQ9A 5E2WL 1SJEA 1UM4L 5FGBA 3PV7A 5EF3A 4JKKA 2ADFH 1AANA 4PY8I 2Q1EA 4BKLB 4XBGA 5EMYA 1JXKA 4PV8A 1ETZA 2FSDA 4GS7C 5C08E 3ARGC 3ZHFA 3QNZA 4PJFA 4AMKL 1I9RL 2YPVH 1IEBB 3M1OA 3OKMA 2FX8H 1I1FB 3LRMA 3OJDA 1JK9A 1T5KA 3KL5A 2GSGA 4BCXA 2MCPH 2NR6A 1N64H 1ZPLA 1A1NB 3AWEA 1KDJA 3LZOA 1RH8A 4M7ZC 5LBSA 3ZHLA 3BFWA 4WWPA 2I25N 2A6IB 12E8H 2YUVA 3KBFA 4JPKL 1PS3A 1IIKA 2G75B 4KQ4L 5CILL 5D7IF 5JXED 1OCRB 2VDOL 3PL6A 4I3SH 3E6HA 1RMFH 4CAGA 2DMKA 4D0BA 4LPTA 1MFDH 3GKWL 2X87A 3LRGA 5HGGS 3T0WA 5IHWA 1MHCA 5EU3A 3BH4A 1NBCA 1YC7A 4PSPA 4LSRH 2SODB 4HJJH 4YFLF 5BOJA 4YHNB 5JMOC 3LVEA 4P57A 2OMVB 4ANKA 4N2OA 2XNAA 3SIKA 1NCWL 1LP9E 3HMXH 5CEXB 1TO4A 1W0VA 1M2VB 2R2EB 4KJYB 1I1AA 4ZX6A 5CINL 2C9RA 5EO0A 1GJWA 5FECB 3E3QC 4ETYA 3HBPA 3W9DB 2ADIA 3K6SB 2B1AL 4WJG3 1B6DA 1SOQA 4GMTL 1WFMA 1S7TB 3A4FA 5I0DA 4QYOA 1K6QL 1R24A 2L7UA 4HUVB 3D2TA 5JR1H 4KRMB 4P2OA 4Z6AT 2J21A 2GVYA 4NS0A 4DCQB 1XGYH 2ZTBA 3B2DC 5IHUL 4JRXE 1NM9A 4P3CH 4YAQB 3T4AB 4HS3A 3U0PB 4PJGA 1PG7L 5SX5K 1C5DB 1M7DA 4QRSA 3KYKH 5I17A 3DI3B 4YXLH 2CBTA 4JCLA 4X9HA 5ADOL 4XAKE 1G6RB 1UA3A 4ZDHB 1NDMB 3PRZA 4XNUL 5JIMA 2UXTA 2GPZA 3QWRA 4NBXB 3SOBL 2HLFD 5CJBA 3PQYE 1OP5K 5LGYA 2EZ0D 4QHNA 3KGTA 4PRPB 1GZPB 3KDMA 3FUHA 5AL8A 3LXUX 1RVFH 2IH8A 3GMMA 1K8IB 1JFQH 2DMCA 1K5NA 1WVZA 3QXUA 4NIYE 1ILUA 3OAZK 3TEYA 3UBXB 3RBSA 4WGKA 4FQIH 3N06B 3HPJA 5B3JE 2CE6A 3T8VA 4I89A 2BIMA 3P77B 1MRCL 3TIEB 2HTLD 2VNCA 1FA4A 2J25A 7FABL 4V1DB 2Y22A 1T89C 1RL1A 1Z3RA 4JGUA 4NZRL 1DJWA 1E5BA 2VUKA 1FRGH 1G9HA 4W9JC 2DI9A 2H1LM 1DBJH 1EHLL 7TAAA 5DD3L 4JQXA 1MNNA 4U31A 3VB9A 5C2UB 3NJKA 3CVHH 3VXNB 5EFIA 1T3FA 3NZUA 4R8WL 3LQAH 3FQRB 2ADJB 4IIZA 3ZT5A 3DV6B 4TPRL 2MCMA 3SDCB 4K9EC 5IVZA 5K59E 1P4BH 3IGLA 4MMZB 4TSBH 4L3ED 5B38A 4YHPB 1RKRA 2XV6B 1YEGL 2JKIS 4OJEH 1FL5A 1M05A 4PS4L 4IS6A 2OK0L 4LOUC 5J11B 2R2HB 4L5FL 4ZS7H 5FA4A 1A9EA 2NY7L 1Q9WA 5KS9B 3KPSD 4KZ0A 4KZCA 3ISWA 3AWGA 4HH9A 2Z8VC 5F7MC 5IR1A 4WEUD 5IUSA 1MPAH 1IARB 5F7BA 4LP8A 3LPFA 3C09C 3R0NA 4TXVB 5D70L 2P1YA 4U1NA 4X4ME 4APQC 2E7LA 3VU2A 3T6QC 4KJWC 1J5OH 2MHAA 5I17B 4BXVA 5JQ6L 1N5AB 1JV2B 2ZNWA 4O2CA 1EMTH 3V4VH 1XF4A 3VG0H 1G6RA 1K8DA 2EEAA 1KG0B 5DRNB 3X13B 1P7KA 2E47A 1E5CA 1U8HA 5IG7B 3DVGB 5GZNA 2B08A 3WFHA 4NN6B 3HE7C 1NKOA 2R29L 1MFAH 2M26A 4KDVA 2CM6A 3VQLA 3C8KA 3VD9A 2DQIH 4RWYL 4YDKH 1TSHA 1F11A 3V0HA 4NGHL 3MXVL 3S36H 3NRFA 2WKOA 2VLRE 3R19A 3P54A 4JZJA 2E5EA 3C5ZD 4XPAH 4BK5A 3L3JB 2VIRA 3TU6A 4BRVA 1JL8A 1BYPA 2BPBA 4RISL 3VGBA 4DPCX 4YNYA 3V0VB 5CGMA 4GW4B 1W8NA 3DX6A 2VMFA 4RAVA 1OEZW 2WVUA 4JGMA 5INCB 3AC0A 1YAIA 2WWKO 3P40A 1B4JH 5DYOA 4X6EA 1ERNA 2LU3A 3KWVA 2D8KA 2GJ6E 4F7PB 5IHHA 1E5ZA 1NGXA 3DVNB 3AXIA 4HS6A 1KCWA 3GXMA 1NBVH 2VO5A 2UYLA 3HZVB 1NCBL 3K46A 1ZK9A 5FGRA 3S3SA 4JFEA 2P52A 4C59B 5KTEH 2WVSA 2OTUA 3PDDA 2CHZA 4NJAL 3TNMA 4IBYA 1GGUA 1KBVA 5DMIL 3B34A 4LXFA 4M61A 3QDJD 4NHUB 1R75A 5ANMB 5A2KH 1XVSA 4YIQA 1H6TA 4X5PA 4Q4EA 3EO0B 3F83A 4N3TA 3MLSH 3WLWC 1H8OA 1JIBA 2QSVA 3DX3A 3OJVC 4P57B 1GSMA 1T20B 2IQ9L 1BZ7A 3G5VB 4ECNA 1W0VB 2R2EA 4YZFE 4NQED 1MCDA 1CGWA 4XAWL 2PO6A 2DOCA 1Q72L 3FXIC 1WZLA 2DM4A 5EWIL 1T83C 1UOWA 1KLGA 5CLXA 4DOHE 1AE6L 2YA1A 2O72A 3GHBH 1I7TB 4K71C 5KBPA 1X5FA 4H26B 3KPLB 1GZHC 3QWOA 4RAUB 3BH9A 3PV6B 4OJYA 3QYNA 3L95A 1S9KC 3W37A 2P49B 5FGBC 3X1GA 1XGQA 4J23A 3WDHA 1CL7I 4PCKA 2OP4H 4ELMB 1INQA 3HHSA 4PVNA 2GY7B 3MA7A 3MV01 4X6FA 5IHUH 4O51A 5HPOA 2PW1A 3F7KA 2IGFH 1L0XA 3Q8CA 5FB8A 2VTFA 4ZFOL 1OAXL 4K3EL 3CQPA 1S7WB 4JFDA 1MCHA 4CADB 2ITCA 3CVDA 3OJMB 4XPTH 2YRBA 3LQAL 4CSTA 3QYCA 4QHKI 4G43B 5A2BA 3KPSA 3P1VA 2HJKB 4LPCA 3RY6A 4IOIB 4JO4L 5CSGA 1SEQH 3BZEB 4YXHH 1P1ZA 4B5ZA 2YEQA 2WQUA 5FM5M 1FSKB 5INDB 2H2SD 4G42A 4NQDD 4R0LA 4HUKB 3B2XA 1CICA 4M6NH 3V5HB 3RJOA 2GUOA 5E5LA 1RZGA 3UTPD 2X4UB 3WKMH 1NOFA 1UD5A 2AK1H 2XZZA 1U58A 3HRZA 3K71A 1F41A 1F90H 1G1YA 2NZ9D 4DPAX 3HFMH 5F1NA 4DKEH 1OTUD 2P24A 4W9CC 5D70H 5EFIB 1MLCA 1SY6L 5HHPB 3ZIMA 4LHUG 4NHCL 1HIML 4A2DA 3ZT6A 3ZN6A 3E2HC 1BGXL 4JEGB 3CSFA 3AGWA 3BUPA 3QZBA 5CNHA 3WE6A 3MNDA 1EAOA 2BIHA 4K7PY 4AM0A 1WBXB 4XNMA 2E75C 3GBLA 4HWEL 2WQXA 3VA2C 4LCCB 1KTRL 1JPSH 1MIML 4AMXA 4XB7A 5MEOB 3MNWA 1U91B 3MRHA 4G6MH 4GKNA 4HIHA 4I7ZC 4NYLB 2FX9L 3IJYA 2QLYA 3O2VL 1ZVNA 2NY0D 3PU7A 3HN5A 2HRPL 3GFUA 1LD9A 1TQSA 3T2QA 1UQSA 3HUJB 3UCQA 2VSCA 3C2SA 4L1TA 3OMNB 1KC5L 5I66B 3V0DA 1LGVA 2YFOA 3CUPA 4CA4A 1K72A 1MH5B 2BWDA 2R56L 5DQ9A 2DLGA 2DWXA 5C0EA 3T2NL 4ZMNA 4N2FA 4IIQA 2PWEA 4QRPB 1LEIA 3L9EA 4GAYB 3JYBA 3WD5L 3FPYA 4R7XA 3A4AA 1UH3A 5KVMC 1N6QL 4JM2B 5EEWA 2L7QA 2WIIA 3KVDD 3ZKXB 5E8PA 1UATA 1RIHH 4PJEB 2GTWA 3VSTA 4C56E 3VSUA 4HC1H 4RBPH 4QD2E 5KYYA 2QADD 1AQMA 5IW3A 3WXVH 5I0YA 2NTFB 5M95B 1W0WA 2K8MA 4XOEA 1JUFA 2X05A 2L4OA 3RPBA 3TBSB 4K94C 3H9SB 4RX4D 3PJSB 3ULVF 1DSYA 2EIKB 3WSQH 2Y7OA 3SY6A 1RXLA 4OCWH 2Z8RA 3B5TA 3LOWA 5HVHB 1XGTB 2ATKB 1WUZA 3L2MA 1CL7L 1JZEA 1PD6A 4EPSA 4ZMAT 1I1AD 5I26A 5JHLH 3VD1A 3AB0B 3SDCD 1OALA 3MXVH 4PWEA 4RZKA 5D55A 5DGRA 1NLDL 5EBMA 3S36L 4QLWA 1SHWA 2YPLA 4OGQC 1HNFA 4PGBA 2VLKB 2XDHA 4HJ0C 3ZK0A 3ZMEA 3VWKC 2CAKA 3JWDC 1FL6A 5J6GB 2J6EL 4POZC 4F8OA 2KHAA 2YEZA 3P3UA 4FRWA 4I48B 1I8KA 1PZ3A 1X6LA 1ZHKA 3H7BB 4JY6B 5EC1A 3ARZA 5KW9H 2RMNA 1ZJBA 2WIIB 2AXHA 4KOBA 4DKTA 4PR5A 2CO3A 2HVKA 4ORGB 4GFXA 3K80A 2JK5A 3VD3A 1CQYA 3AS1A 3GWJA 3QUMB 2CCLA 3JTSB 4OFYD 4X4YB 1NBYB 2VO8A 1TQTA 2XN9A 3PIQA 4J8RB 5DO8A 1U3NA 1HK6A 4XC1H 2OSYA 4CVUA 2QQNL 3DRQB 2YR3A 3O11A 3BAKA 3U82B 5I71B 5L2JB 3PJSA 2PKDA 2IH3B 2X4PB 4ZUSB 3ARGD 1FVEB 4J3WA 5CR8A 5FPIA 1TJMA 1ZLVK 4AVHA 3HHMA 4EXKA 1OPGL 4HDIA 3GXIA 3FFCE 3IJHB 2DRUA 4MLIA 4N28A 5ID0B 3IMRA 2ADGA 3G6DH 3B6SB 4NLHA 3MBEB 1LK3H 5GZNC 2B9BA 2CDFB 2DWDA 1NFDF 4EDWL 3CFEB 1G7IA 5E1AB 4F7MA 1HJCA 3UBXI 3NZ8B 1NKRA 3IGAA 1H3PH 4ZMLA 2CG9X 3ZZLA 3C6EA 4PGBB 3ZDZF 2NNAB 1QTPA 1K2DA 3DX9A 5JOFA 4UTAL 2J5LB 5J1AA 5DFWH 4PREB 1FNEB 4NKDB 4P05A 3MU3A 3GZQA 1N3NB 4OUUA 3CN3A 4U1JA 4PRIA 4D9QD 3H9SE 2HRLA 2WUCH 5C0BA 3MSPA 3KPNB 2APFA 1CF8H 4JQVC 4XNQB 1RURH 5I5JA 3BYYA 4Z0BH 3BKCH 1H8NA 2ZX5A 3CN2A 1A7OH 3GO1H 4P2RD 1NM4A 2AZAA 2WMPA 1BQHG 2NUPA 1C12B 3MBWA 1B0GB 3I3DA 1O6TA 3CFUA 1T1ZA 1YEIH 3CZFA 3WNKA 4CC0A 1QRND 4Z7QB 3S3BB 4KRLB 4XN2A 3I2CH 2IQAB 5FUZL 4QYAA 2A77H 2P8LB 3TBWA 3ULVC 3S5LA 4UQ2A 5ISZB 3MHZA 4N0YH 4OM0H 4XBEH 2BVPA 3DX8A 4XNXH 4XP6H 1Q9KB 3BLKA 1NGQL 1E6OH 2Q2LA 4H20L 3N41B 3A6BL 2FO4A 4P2OD 3SY0A 2J6EH 1L7TH 1IL1B 1LE9A 5IV2B 5FK9B 1QRKA 2Y2WA 3DUSB 2FQGA 4PRIE 5AVRB 3RDTB 4NQVA 5A3IC 3BSZH 5DRWB 4BHUI 5J1AB 1HEHC 4LPUA 4M6OH 2ZONA 4AQ1B 4NKDA 4XH2B 4L3CB 1UXMA 1TZIA 2K3TA 3CVIL 3QXTA 1T80A 2APSA 5ACLA 2XUWA 2I27N 1Q1JH 3VE0A 3HLAA 1WITA 2VLRB 2AQSA 2RALA 2OW6A 4JFVA 4Z7VA 5I2IB 3TBCA 1F6AA 3P0VH 5DD1L 5JZ7C 2N0MA 4LIQH 5HI5D 4F57L 4YFDB 1IGML 3I50H 3BW9B 5F7WC 5KVDL 4I2XE 2E46A 3IJHA 2MNWA 1O5PA 4AJVA 5DQJA 5AW8B 2F1AA 5K9JH 1F4XL 5C0BD 4DGYH 3SPVA 4LPVA 1Q0XH 5EUOB 4XWGH 3GJEA 4OB5H 3P9MB 2XN0A 4MD0A 1G7QB 2GI0A 3QXAB 3NN8B 1F8TL 1ZDQA 4GI9A 4KNSA 3CBJB 4GMSH 2FUQA 4OD3L 5J4MA 1ZXKA 3MA9L 3US9A 4DVRL 2DM7A 2NNAA 3LZFH 1R6VA 2ZWKA 3C09B 3EYQD 4M8VA 1YYCA 4M03A 1NCTA 3SY0B 4MXQC 4WQOA 5CEXA 3MN8A 3QFDA 4P23B 3IM1A 1XL4A 1ZEAH 2KMWA 5FUOH 2XTJC 3KW8A 3VFUB 3ASWA 4OT1L 2V4LA 4MXQD 3ZOAA 5KSVA 3U7WH 1GGTA 3QUML 4HT1H 5I28A 3LSOB 4Q8BA 1NC4A 1C1EL 4J3OC 3OKEA 1MZYA 2PYEB 4FFZA 4YSEA 2EIBA 1QFWM 3V5DA 4QRRE 4GG6E 1QW8A 32C2A 4M1CC 5D7LB 4BJLA 1N6UA 2A4ZA 4ODSH 1BOYA 5EA0L 2G2NA 4OAWB 4BFNA 3BISA 3GIZH 4QY8A 1OAUL 3AADB 4DOHB 4GSDH 4YSAA 2NXYC 5JDSA 5I1GL 2FWLB 4XO4A 3AJ7A 5IJKC 2GBAA 3UBXG 1F90L 3OKOB 3BVXA 4G82A 1EEYA 1ZVSB 1N18A 3T71A 5TGBA 4IOSD 1ZLWH 4KITB 4G8FA 4AYEC 5DJ0A 4ZUTA 2VLKA 4HUWA 4F80A 4ZTPH 2Y72A 4TM9A 3DJSA 2ALWA 1G7PB 1O6VA 3ALPA 2Z6FA 1AYRA 1PSKH 2QVIA 2C9VA 3N44F 4JMXA 2F1EA 4W4OA 5I30H 5KJRL 3TEWA 1ZHNA 5KSAC 3PWPA 1CGYA 1WA0X 2A2QT 2WOBA 2X9YA 4GAFB 5DJ2B 1QEXA 3KLKA 4F7CB 5HHXL 2QT6A 5DLMH 3QORA 4U3CA 1AY1L 4IMKC 2ZYSA 4J6IA 2H6OA 4UNIA 4QRPD 5EZPA 1CU4H 4AEIL 5DD1H 3NVQA 1A4CA 1B3JA 3NPSC 1A4BA 3B2UD 3QWOB 2VXTH 4FAAB 2NDGA 4Y16C 4U0RB 4CL7A 3JWOH 3SHSA 4DP8X 5EIQA 2HLEB 4LSTL 1SBBA 4PJAF 4MZRA 1DJYA 2BSEA 3QFGA 4WTZG 1GGCL 5GJSH 3F8UB 4D3CH 4FFYA 1SZNA 4AJWA 4ZD3L 5IVZB 5HD8D 5D9SA 1NMCC 5E00A 1BYOA 2XKNA 3E9UA 4JRXB 3UROR 2DWDB 4CADA 1HHHB 3BQUB 4XVJL 4BQ9A 3RNQB 4XVSL 4L4JA 1QPPA 2HX9A 3BEVA 2A77L 1NTDA 2ARWA 3KBEA 3NSYA 1RIUL 1F02I 3WTWA 1W6WA 5D5MA 2APXA 4ANXA 2Z35B 3IFOA 4KI5C 3L9YA 1WO2A 4FQ2L 4RMTA 1DFXA 1KV7A 1VGKB 3THML 1PGRB 2G2PA 3DXAD 2DD8H 3GZPA 3LYRA 3F65A 1KB5B 4K8RD 5I1EL 1RPKA 1C08B 1G87A 2E7DA 3C6LC 1XSJA 3QQ4A 3QWNA 2LW3A 5EOTA 2VZ1A 3QQDB 4K3GA 4A7GF 3WNIA 5KBLA 1L9TA 4IM8A 1A1NA 4XMTA 3N2JA 5DUMH 1SDAB 4N1CA 3FZUC 5B8CB 1JGIA 4PJ9D 1T7ZA 5KBKA 2HP4A 3EYOA 2V5SA 3C5SB 4LHJB 1QSVA 1EIBA 4WLCA 4NUMA 1U8PA 1ZV2A 3FUNA 5BO1H 3ILQC 1WCBA 3ZE1F 1XAKA 2B7DT 4JG0L 3BZDA 4TL4A 1ORQA 5EH1A 5AQ0A 1IGFL 4IJTA 4X6DE 1AP2B 1CB4A 1QFOA 4LSUH 5DURD 2ED9A 1JHLL 4Y5YB 5T1LB 5CEZE 4JRXA 4FLSA 3V6BR 2XETA 4HEME 2A0LD 2QPSA 1MJJB 5LNEA 3WIHH 3CFDB 4PJDA 5L9DL 2R0ZL 3NJIA 1MFBL 5TE7H 2J88H 3FKUS 3PFUA 3IJYB 3KPQB 3QO1A 4NBYB 2VH5H 4XMLL 4Q9QH 4L29A 1ZWIB 1W8EA 4Z23A 2FX7L 3DV4A 2UVFA 1YYLH 1L7TL 3QIUA 2WQVA 4MAUH 1KEMH 1MFEH 1KDIA 4YHLH 2V9UA 3MV7A 4NRXB 4FYRA 3RY6C 4D8OA 2C3HA 1IM9A 4NP4L 1ASOA 2PXYB 3BVDB 4ZUVB 5GRYA 1VADA 1SLWA 3KL3A 4HS6B 4RMRA 1TFPA 3RU8L 4IDJL 4XBPB 2IPTL 1AIFA 3GMQA 4KJWD 5K9OB 1AKPA 2ODHA 2QTVA 4ZSOE 4MXVE 3GMOA 1LO3L 2FLRT 2R1YA 4X98B 2WHVA 1D6EA 1MHHB 2OX5A 5GPRA 1TJIH 2HT4D 2MJWA 2DEYX 4G8GB 4EZLA 2V7HA 1CLCA 3SKNB 4YSRA 1OK0A 2FEDC 1IGJA 3ZKQD 2W95A 4XCYA 5T3ZD 2DMBA 1J9QA 1MDAA 4RDBA 5IQNA 2FD6L 2BCMA 5HI3C 3LNIA 3PQYB 4V2CB 1SOSA 4UIKL 3BPCB 1UACL 4MJJA 4L8CA 3VXME 5LQBH 3D0LA 1IAOB 2X9WA 2OMUB 3QAZC 1CYWA 1PLAA 1Y0LB 1H19A 1LLAA 4YBQD 4X7CC 1OB0A 3KNBB 1RZFL 4ZOEA 5DEFB 4E9VA 1UXWA 4NUQA 1CG9A 5EV7A 4WRLA 3QNZB 2YAPA 3GJFH 3FUKA 4Y88A 1AMYA 4G7QB 5I6KA 4G83A 2AKRA 2JJVA 2QHLA 2IFGA 1XGQB 4GP4B 2WQSA 3SYQA 1CDCA 4PP2A 1G0DA 3MV9D 9PCYA 2HTLC 1PFCA 1TJGL 3UYRH 2D7OA 1F58L 1QYGH 2QGCA 1IM3B 5DZVA 3L54A 4NQEE 4KY1L 4K8RC 3UOAB 4HUUA 3MRJB 1CLYL 4QXTB 4D3CL 3B7YA 4MCMA 5LAPA 4GG8B 5D1QC 1IGJB 4E41E 3WIHA 1IAIL 4IGBB 4C8XA 3PGDB 2MPAH 3QJTB 2JJTC 4MFHA 3VUAA 3MV8D 4O2EB 2N56A 5EOQH 1F3JB 5HJGA 5JDJA 2DQTL 3NMEA 4Z0XB 1M2VA 4KJYA 1HNYA 3QHFH 4DERA 4YLQT 4XWOD 3IPFA 3QORB 3QARA 4GBXA 3D0LB 3NCFB 4HIEB 4KKBC 5GISL 4AZUA 3MX0B 3RKDD 1VADB 3F00A 3QJRB 2HFEA 3AGVA 3NT0A 1E27A 3NCMA 1SLVA 5IQ9B 1V10A 4MD4A 2EH8H 1IVLA 3HE6A 4YPGB 1DVZA 2ZSVA 3EBHA 3UAFA 2IWKA 1K8DB 4TQPA 2YSSB 2WVTA 4NO5B 3U0TB 3TPKA 4NJ9L 1BQLL 3P3YA 2A6DA 2X4SB 3MLTB 1SFDA 2EXWD 4YSCA 4FD0A 1TTFA 4JG1H 1ICTA 4GKZB 2X2IA 4CKVX 1YEJL 3QJFA 4NENB 3N1FC 4XXCC 4G3YH 3VGGA 3FS9A 1F4HA 1WBYA 3MLUH 2F8XC 4KK5D 2V8MA 3GXFA 4JB9L 2FH6A 1EH9A 4YSTA 3FMGH 5JOEA 3RB7A 4C56A 3UTPE 3I9IA 4X9YA 4ABWA 1ORSA 3T6XA 1MREH 3OC8A 3F6JA 1JNHB 3VGFA 4KNTA 4BD4A 2QSCL 3VXSA 3FAWA 2COQA 3GMLB 5I15H 4NQTA 1AXTH 1EEQA 2GJJA 4I18A 2BNRB 2HFEB 2X6UA 2YHGA 2AW2A 3NJFA 4FOMA 1ZT1A 4X9GA 1ZRUA 4JFYA 1JNLH 3WI9A 2XG5B 3MROA 2OFQA 4N86A 4BH8B 5E5RB 3JTBA 3QUYB 2GY5A 2WGNB 4PM1A 4PWKA 5GSVB 3PYCA 3T3ME 3TN0B 4EN2A 3SQOL 2B9AA 5CBAA 4GH7B 3ZJAA 4ZPVA 5GS2H 4KZDH 3MV8E 2AXGA 1CQKA 5I73B 1TETL 1F2XK 1I31A 3FQWA 3B2VL 2QQLL 3ZX1A 3L1OH 5JLZA 2QVFB 4F1SA 2F5BH 2LT9A 3LEYL 1DBJL 5D2NE 5IESL 1OZTG 5BMFL 3QIWC 4XMVA 1Z3GH 4ENZA 3ULSB 3ZL2A 3US1A 2W60A 4L3EE 3UACA 3N44B 2PWGA 2FQFA 4NZTH 4DF9A 5LNGA 1KIUB 3TVMD 5IW1A 1EQWA 1E6JH 4L0PB 4PU2A 5BRZB 2VDLH 1WBZA 1XR9B 1S5IL 3GSNA 2J12B 4OFDA 5AB0A 4NRZA 3QNXB 5TJWK 5GGRB 1MVUA 4MCZA 4PJBE 3SPCA 4WWNA 5HVHC 2EUXA 2X6MA 3CN1A 1Z5HA 4MVBC 5K1JA 2RD0A 1RULH 3JUYA 4MRCA 3NQKA 3WGVB 3LNGA 3QPKA 2G3XA 3BJLA 3QUXD 2G5BB 5K9OA 5I74C 3MBED 2CMRH 4Y4KB 1DLHA 3L5XH 1O9ZA 2EDNA 4LBAA 3WUWG 4WSJA 3BESR 4PJEF 4ANWA 2GJPA 3DBXA 3ZQXA 1NGWB 3HC0A 5H94A 1NCNA 3MLUL 4EOWL 2DD8L 1J5CA 3H9HA 3N6YA 4LCVA 4GQRA 5AYTA 4H1LG 1DQKA 1S7XB 2XCMC 4FQHB 4P5TC 4PVLA 4HD5A 3S34H 2GSIA 1NBZA 3L7FB 5J56B 3I9GH 4RSVA 1FYTD 3GXPA 2OMTB 3MODH 4RSYA 1JF6A 1P2CA 1PEWA 2A38A 4I77L 4G8AC 4Q58C 3BO8A 4W1TA 3D34A 4OCRH 1A1MB 4M3HA 5CZKA 3UO1L 1VCBC 3OM3B 4HK3N 1OHQA 1AGEA 3SODB 5HSFA 4XMXA 4TQ8A 4NO3B 2DJMA 4M1DL 3NSCA 1WV7T 2P5EA 5FAAA 1I8MA 1EHLH 3KM2A 1PCSA 2EO9A 3MCLL 3KM1A 4IMKA 3NFSL 5D7JC 5DUBA 4F2MB 1JZ8A 1TEYA 4ELKA 4U1LA 2PABA 1ZHBA 2PCYA 4G8IA 4BWWA 4RESB 5EUOF 3HI6L 5E99H 3WIHL 2P24B 3ARVA 2F7RA 4UDTA 1TENA 5DS8A 4HWBA 3P4NA 1T1WB 2ZOUA 4PJHB 2GJ6D 2XZAH 4AH2A 1BAWA 1B4JL 2FIRT 4XX5A 3HE7B 1L9RA 1COBA 4OZGB 2BY3A 3FQXB 4KUCF 3U30B 2Q5BA 1CFTB 4N2HA 5DHYA 1ROWA 1WLHA 1QAWA 1QVOA 1IE4A 3MRFA 1PKQB 5IBLD 3WEMA 4P2QB 4E9LA 5EIIA 3BP6B 1CLZL 2WXLA 5D7SL 4BIKA 1BQLH 3SB3A 1E4KA 3LD8C 4EIUA 3QCTH 4PJ8B 3STBA 4MMYB 2QVKA 2DTMH 2RFXA 1NBVL 1R19A 1KGCE 1X6NA 2IAND 3RNKA 3H0TB 2XT1B 1BX2A 4M6MH 4RGND 4UT6L 5KOVC 3QPQC 2G3NA 3S5LB 3UG3A 3GNMH 4JFOA 2AXJA 2P5EE 4W6YB 3ZZQA 2XWJA 1HI6A 1T66C 3RX9A 4Q52A 5FHBL 4GKSA 3ZYIA 2QHRL 1DVSA 1INDL 3S7GA 5L7XH 5MHSE 2NY5H 4RMQA 2XICA 4X6DA 1ANUA 1GMIA 1IC0A 3OHXC 4F2MA 2VN4A 2A9NH 2R0LL 4JM2A 4R8WH 1S5HB 4AQ1A 4M8QA 4CNIB 2IF7A 3C9NB 3L5XL 2WINB 4NAJA 3S96B 1C5BH 2XIDA 5IHZB 3MV8B 1OT4A 4RWYH 4I0PB 1JYWA 2D0FA 4G1EB 3ZE2F 2P5WD 4CKQA 4RVBA 1NBQA 2IBGA 3H9SA 2SEBA 3TFKD 1QI4A 3IDUA 5J13B 3OKDB 1LEKA 1HN1A 3VFSB 1D9KC 3PIQB 4J8RA 4CC4C 2R39A 2DQGL 2N01B 3QFJB 4JMNA 1HINH 2XBDA 4TUUA 5IMMB 1T83A 1CGXA 3HNSH 3TL5A 1XH1A 4OCMC 1ZY9A 3UP6A 1NFIA 4O02H 1A6AA 3OR7B 3QUKA 4GNKB 5CWSB 4L0ZA 5D7HA 3NJJA 1ZT4B 2G3ZA 1U9KA 1I9IH 4K7FB 4QOKE 3VGDA 4TUKH 1NCCL 5DC9B 3WO3B 3ZTJG 4QXGH 2X0VA 4WWID 1KGXA 4NQSB 5EEUA 5IESH 1P4IL 1RZIA 2KZKA 1A6PA 3B7TA 4ZO7A 4L3EA 3TH4T 3FRPB 3IS0X 3S9DB 4OFKA 3H56A 4PBXA 2O6PA 1BFOA 1A6UH 5DO2D 3OKYA 3QORD 2Z4TA 1HJBC 5CMAA 5C0GA 4BXSV 3F58H 4A55A 1Q8MA 2YS4A 3C9NA 1EEUA 2V5TA 3CSTA 4AH2B 5IVXE 1BLIA 2VAJA 1RUPH 5GRUH 2GK0A 2JTYA 3SPJA 4Q6IC 2DQTH 2WBXA 4PJCA 3OZKA 1DQML 3P11H 4XBMA 1DVQA 2YOCA 2JI2A 2OJEA 2XPYA 1OM3H 3WY1A 4HDIB 3ULUE 1PEZA 3P02A 2BS71 1WICA 1N8ZB 5FYJE 1H3UA 2H4EA 3CZFB 2DQJL 2X2UA 3MRNA 4K5MA 4PCSA 5I82A 2H47C 1SMOA 1OP4A 1J8HA 5GIRB 5D2LF 3GQFA 2PW2A 1FFRA 1T0PB 2JIXA 2DQ6A 2OL3A 1E65A 3UAJC 2LLGA 1NOAA 1UKTA 4GRLC 1G0XA 4D0CA 1QPXA 3HMWL 3PWJA 4PREA 2EE0A 2IDQA 2FZ3B 4BSJA 4ANUA 5EPMA 4XTRC 4PRIB 2X88A 4W6XB 3HW7A 3K4ZA 3STLA 1UWGH 1VJSA 1A6WH 5E8PB 4NQDB 1KC5H 4HC1A 4NN6C 6FABH 4U7MA 1KENL 3DVIA 2Q8BH 2B77A 4UT9A 3CZGA 4WI9A 1A21A 2F54E 4KWUA 3KH4A 3N50A 4KK9C 2ILLA 4HKBA 4OQTA 1UYWH 3EJQA 4MGXA 5IOPB 2DH3A 3SKJL 4AKQA 3SDYH 4Y2DD 1DZ0A 3I6SA 1ZSHA 2CUIA 1MFAL 3II2A 4BM7A 5DMKB 3HMXA 2O61B 1FO0B 4XCNA 1HH6B 4MJ6B 5JIDA 1JNLL 1OTSD 1WCQA 5HHMB 2VQ4A 3GTNA 3QHZH 4NUPA 3UTZA 2EDWA 2VLKD 3KPOA 2EDRA 35C8L 4QXTA 4H25B 1TU2A 3UTQB 2B0SH 4BQCA 1T0NA 1AHWA 1T4KB 3P4OA 1BD2B 4XXWC 5F89B 1K3ZA 4G9FA 3BYTA 4P2CG 4R7NA 1TSRA 4IHOB 4U1MB 4X6CB 2LTQB 2ED8A 5E0FA 4KJPD 4DP5X 2F8VA 1GAFH 5AVXB 4I48A 5EC1B 2D2OA 5JHLL 1UCBL 1EHKB 4GBXB 4HIEA 5JUEH 1YN6A 4RGNC 5FLUA 2IWEA 3DMMB 4QPEA 3SJVA 3VFMB 5JOPE 5I6XB 3DARA 2BP8B 4QRRB 4GG6B 2AZUA 3BDYH 4GIOA 4KRPC 3SD5A 2UWEB 5BQ7A 2IEPA 3MRFB 2ZOOA 1ZT7B 2NDFA 5DHVB 1K9TA 1S5IH 1CGTA 3HOGA 5E94A 1PY9A 5I6XC 2GG1A 2H3KA 3O3AA 4MWFA 2VMJA 2XTJB 3HC4L 4HG4K 4ODHH 2IH1A 2CBMA 3COOA 4NC1E 3DOHA 3TVMB 3K6SA 2X1XR 3I9PA 4PWGA 5F88B 1V54B 4JO5A 1N6QH 1PBYA 2ICWB 3FTGB 3SE9H 3CN4A 2EUWA 5FGCB 4QTIL 5BS0A 1OT1A 2Z64C 4UV4H 2AF2A 5EWIH 2EDFA 4YEFA 5AB1A 1P84J 1W16A 2PYFA 4GRWH 3X17A 1KPVA 4I18C 1URZA 2Y07L 3DUUA 3PGCB 1OT2A 2DPKA 2YXFA 4X99B 5ICZB 5BZXA 3CSPA 4WO0A 4ZUVA 2ZXEB 1MG2C 5T8IA 2UVEA 2VDPB 5CN1A 2IALA 4WF7A 4HJEA 3B9DA 3PP4L 3QAQA 4M6NL 2EIDA 4R5VA 2YA2A 4NPYB 1JWSA 3LS4H 3SCMC 5IY5B 3D39B 3CFBA 2J73A 1R17A 3BJ91 3V7MA 3E8UH 5CJXA 1J1XH 1OAYL 1ZTXE 2LVCA 5GS1B 1CF8L 3DIFB 4OI7A 1U8HB 2V7HB 4Y2OB 1MJ7H 5E2UL 4BZ1H 5IG7A 3HFML 1IFGA 3IU3B 3LNHA 1RUAH 3DIVA 4A6YL 2XPGA 5LGHH 4L4TE 3WD5H 1E2VA 1YPZF 1UXSA 4X7SL 2CWRA 3IFNL 1AGFA 4YHNA 4CJ1A 1TIUA 3O3BA 2X4QA 4NSKB 3VTTA 1FFNA 2IDCA 5JA8B 3RWGB 4YNYB 3V0VA 4CU6A 1JPSL 3UJTL 4WCYL 3KCWA 4L8CB 4D8PB 3HNTL 2FX9H 3SPHA 4OZHF 2YK1L 1E9QB 3C2AL 1XF3B 3HMWH 1T1XA 3K8KA 4NDMA 2E4TA 4WFED 4X4ZA 2YRLA 5DHVA 4DKEL 4TNFA 5ENWA 4FL4B 5IF0B 3QDJE 1XXFC 4WY7L 5A2IH 2HVJB 4J3OH 2N4IA 3FCSA 1LO5A 5KANI 3GSWA 2F54A 4XXDA 3U0WL 5I1IL 4YUEL 1SHSA 5GS1A 4DTGH 2MQGA 2OR9H 1U8PB 4ZX5A 1QSFE 2IAMC 1ZTXH 2J3SA 3A5VA 3FTGA 2WNGA 3H42H 1WEJL 2XWCA 1S8DA 3PJLA 1S3KL 3Q9PA 1AKJA 1J0KA 1CWVA 3TCLB 3Q2NA 2BWIA 3K2UL 1WT5A 4D0DA 2VL4A 3HC3L 1UB6A 1RURL 1I3GH 3DJTA 1A6TB 2Q86A 4OJCA 3T2NH 4NNXB 1IGCL 3FFCB 1KB5A 5C3TA 4R5XA 3HA0A 4IQHA 1TYJA 5ICZA 1E9QA 3WNOA 1Z66A 2YUXA 4AUYA 1N10A 5F3BA 5H2BA 1UJ3C 4KPHH 3DYPA 3EHBC 3FB7A 3HG1E 3MR9A 3ABGA 5GZOD 1IBFA 2NX5A 4IK7A 2EIJB 1NCCH 3I02B 3BFOA 3L4CA 2X3AA 4JG5A 3BZ4B 1UWYA 4G71B 5B8CA 4KGLA 4PG9A 3F12B 3TZVD 1QBMH 2OZNA 3UJJL 4UOQA 1SBSL 1X5XA 2H1PH 3BAXA 2W9DH 4G7VL 5GZOC 3QCVL 2OTWB 4MTMA 3VXTA 1P6WA 2VZOA 4XXDB 5HJBA 2AQQA 1P5UA 3QC6X 3FT4A 4XNUH 4A7GA 3BOVA 1NC2D 3I3EA 2MCG1 5I8OH 2F8OA 4S0TD 1BAGA 5JW4N 3MRBA 1X5KA 1BD2D 2NTSP 2CALA 2C4FT 4AG4L 4EI5D 3D85B 3HS0C 2AJZB 2Y2TA 4X83A 1BOGB 4X2UA 3K3QA 3QUYD 5CD3B 4YGVA 4H0GA 3N1MC 1Y6NR 3N85H 3C6LA 3MPCA 4M1CD 3WFEH 3G04A 1AXSA 2KPNA 3SJVB 5IMLA 4PJ9C 5E8OA 4LFHD 2Y9RT 3QYMA 2Y7QB 1NDGA 2X2JA 1DQTA 2NX5B 3H4FA 2RIKA 1OP3H 2QQQA 2ITDA 1M71A 4IRSB 3R8BB 4BH8A 3PUCA 4XOCA 3DSFH 3QIBD 3ZKNC 3KS0H 2VR9A 4HS3B 3U0PA 5FR3A 1D9KA 3RQ3A 4LKCA 4NPJA 5LUMA 3VFPB 2XSKA 3VI3E 4PP2B 1K85A 1ZTXL 1SJMA 4JG9A 2DV6A 4U1KA 2VSKB 1P0SE 3FT4B 2QDVA 3C8KB 1LEKB 3H9YA 3OKDA 5DFVC 5FXCH 5LCVL 4YHYB 3CC5B 5I71C 5KSUB 1FGVH 1N4XL 4APXB 4F33B 1OTUC 3BPOB 2VN3A 5DJDA 1ES0A 2VISB 4EDWH 4N6RA 1J11A 3PWNB 4O2FA 1D7DA 3TN0C 3FO2A 4NN7C 4PJCF 4QRBA 1KUMA 2W0KA 2PYFB 4NCC1 1YPZB 4C4BA 5F3BB 3K1KC 3ZUNC 2QSTA 3FBQA 2VZTA 5DEFA 5F9WB 5BW7C 4OCYH 5EU6D 3L13A 2ZCLL 3QG6B 1DYZA 3WLBB 4H2AA 2LAGB 3FONA 5D71L 5E5UB 3RWFB 1QG3A 3MRKB 1RP8A 5I16B 5IKCB 4NI3A 3HNTH 1YMME 5JXEC 2EE9A 3SO3B 2XHNA 3PWLA 1VFBB 4PQXA 3QZNA 1PD0A 2AQ3A 3IDJB 1ETA1 4WHTA 4JRYA 1U3HB 1B4TA 3FH8A 5B21A 2NUTA 2AV7B 4KC3B 5GS0C 2Y1AA 1S7UB 5T1MB 1OTTD 3G5ZA 3DXAB 4P2OC 1DQQB 3AM8C 2C5DC 2CR6A 3G6JA 1J1XL 1KWGA 5PAZA 1QW9A 4NZFA 1K4DA 5CZVL 4OM0L 3S35X 3NFNB 3F62A 1AH1A 3Q1SL 5ALBH 1QO3A 1FF5A 3VFGH 4UZGA 3IETA 2DMHA 1XGUB 4ONGL 2JWYA 3H42L 4QNPE 5K9JL 4Y4KD 1YNTB 4KK8C 3QIWB 5TFSH 1A8JH 4PS4H 4DUWA 2R0KH 3QE5A 2DQDL 4MJ4A 4PW4A 3W82A 3F6LA 4S0SD 2IAMD 5D6CB 3MRCA 4OQTH 2GITB 2FLBT 4X4KA 4LU5L 1QR1B 2CKNA 2GSGB 4XP4H 3GSOA 4R4FL 4PD4J 2FATH 4HKJA 2Y23A 2X2YA 4YK4C 2H32B 4DEPC 3OSKA 1AIFB 2JKLA 3CIQA 3SDDB 3S88L 3U25A 4ZMTA 1EHAA 5CU5A 1NKGA 5DQDL 3QQ3A 1LMKA 4GW1B 1WGVA 1G9NH 5CZXD 4HJUA 2KZBA 3K5SA 1II4E 4KJPC 2XQ0A 1JTOA 1DBML 3BC9A 4P9ML 1FQ9C 4N8CH 4LCCC 4GAAA 4GRMB 1NDTA 2EIZA 1O6SA 3JTTA 4PJCE 1S7VB 2ZKMX 3T8MA 4NOFA 3L5JA 1V7NH 2NY4B 3VFOB 2J20A 3F3HA 3B9KB 3GIZL 1JPTL 4L8DA 1L6PA 3QEGL 3JXAA 4TULH 5ES4B 5INDA 3VH8A 2KLSA 3U9PL 4AV5A 4Z8FL 4FC3E 3FK3A 2IOIA 4WJKB 1WK0A 3GSNB 3VSVA 1A0QH 1X4YA 1FG9C 4Q74A 1PY0A 2R51A 2Z31A 4O5LH 3SE4A 4M8QB 3FUFA 5C9JB 2WK2A 4MBOA 4ODWA 3FL7A 4KXZH 2G5BA 1RLWA 1ZA3B 3L5WA 3VXRD 4AM0Q 4FXTA 3KLAA 1RLBA 1UD2A 5FOBB 2YAEA 2LFGA 3GHEL 3MBWB 4PJEE 5A16B 2GJ6B 1MG3C 4Y16D 3SE3A 4I1PA 4JFWA 4OKVB 1MHEB 3BKJH 4S1QL 1T5XA 3I75A 3O3AB 3VFGL 3NJGA 3ZE0F 4Z76B 1XTMA 3E38A 4C47A 4JO3L 5IMKB 1S7VA 3X1NA 1TQWA 1DVUA 1UZGA 4X7TA 4UQ2B 3EJSA 6TAAA 2VDML 1F58H 2A6JA 3RZCC 1RZIB 3UTTE 1J0ZA 3VW3H 2CGYA 4G2AA 3C08H 2VLJE 2EDYA 2DWTA 1G9ML 4FI8A 3J07A 4MS6A 5SWQA 3RGVA 4D9QE 4P4KD 43C9B 1MFUA 4ODTL 4L3FA 2A4CA 4L3CA 1KCUL 3MRRB 2YD2A 2VABB 1JNNH 4ADGA 1FLRL 2NYYD 1G9NL 1RSYA 2J1KA 2LLLA 1AJ7H 2FNBA 4P2QD 5M7QA 4APQB 2CJUH 3Q8AA 5CCJA 4HV8B 5AKVA 3D4ZA 1JK8A 2Y6SC 5CJXC 4YE4H 2HUEA 3MZTA 4NN5C 1UOKA 2MOVA 4HA1A 5DHYB 2FD6H 1K5WA 1N67A 2MQCA 3ZL1A 4LLVB 4ZD3H 4ERSL 5KBNC 4FFYL 4J12A 1OSYA 1O6SB 4IBWA 4OKVA 1OIOA 3EGSA 1N8ZA 4FFZH 2IGFL 4ZFOB 1FVCA 4DO4A 2I07B 3UJIL 3TV8A 2ADGB 2IMNA 2BINA 3OAYK 5DRZB 5AW2B 4DZBA 4R3SA 2N7AA 5AYUH 5J89A 2B2XL 1CJYA 5E9DA 1JNJA 3APDA 5TQ2H 1WD8A 2DBJA 4OLXL 3CH1B 2Y5TB 2X4UA 3OLDA 1J8SA 1IAIM 4MNGE 4E9WA 1I1YB 1G4MA 4NQEA 2EZ0C 4HWBH 2HH0L 3CZJA 4KDTA 4P2RB 2Y4SA 4RX4A 3BPLB 2EICA 2NUTB 2F7PA 4GAJH 3FSAA 4XNQA 4X4YA 1QVOB 1RMFL 4PWFA 1I1FA 1CTMA 1YN7B 3O4LB 4HK0A 3WFHB 4BCZA 1HSBB 1ZSDA 2JCCF 2YMOA 5IOPA 1IAKB 5I18H 5IROA 1U3ZA 1KYDA 3K2IA 4R26L 1UACH 1AOZA 2N7SA 1NGZA 1AGDB 3WXWL 4YSDA 1CGSH 1Y07A 2VLJD 2VR3A 1QKZH 1SUJA 3B6SA 3DDFA 1FVCB 3PXJA 1CLOH 4JFED 1G7IB 1HI6B 3Q2WA 4PRHD 2F5AH 2C1PB 3WS3A 1PIFA 2EDKA 5CP7A 2YMXL 4OLWL 2KZ1B 2HG5B 4QHLB 2BOLA 1YQ2A 4PP1D 4I9WD 5D1XD 5GZOA 4WTQA 3RHWF 3UZQB 3OKNB 5E1GA 1J88A 1R3IH 2I5YH 3R7QA 4B7IA 2YN3A 2YQ2A 2V2XB 1JNNL 3KPPB 1TVBA 2Z91B 3MVSA 4JG1L 5I1AB 1J05A 2OXGB 4X9FA 2YD9A 1QX1A 4GLRH 5C0CD 5DDHB 5C0JA 2VAAB 1L0PA 1YNKL 1IMHC 3CFJB 1A2YB 2H0FA 4GW1A 1U4FA 3NEEA 4GXVL 4N90D 3AXHA 4QI3A 4R0LC 3HI1B 4UAOC 5JPMC 4IBUA 1JOIA 4HQQH 2K6YA 4LVOC 5EU5B 1LM8V 1IKFL 3BX7C 4L23A 1HSBA 1ZSDB 5H4YA 3WAKA 3TYFA 1HHKB 3TN0D 3VFWB 2H2PC 4K0OA 4P5KB 1JPEA 2NY2B 2NXYB 3G9VA 2OJZH 2NY4D 4HW6A 5TPWH 4YLBA 5GSRA 4M7KL 4AQ8A 1MAJA 1E30A 5IB5B 5F7UA 3L3OB 4OZIA 2EDHA 5E00B 2OMNA 5DJXB 3WLWD 3KJ4B 4JFHE 5D1XB 5GS1C 3O3EA 1RU9L 1H3TA 5LXVA 4LCUB 4XVTH 2FHBA 4KHXH 3I3BA 4K8RH 3AG3B 4M6AA 4FEIA 1I3VA 1A4JB 3G3LA 3MLRH 4MCYA 4OGYH 5GRJH 5JIHA 2BWQA 3NP4A 4GXFA 2UX6A 1OL0A 4G8IB 1I8KB 2EP6A 5EEYA 3QPXL 4E9QA 4PHXA 4Z77B 3Q1SH 4HAKA 4M7ZB 1M1XA 5I6OA 4XP1L 4HU8A 1A22B 4RMUA 1UOLA 3MA7B 4X6FB 5LN8A 5DR5H 3QH3A 2Y6SD 2Z7ZA 3SQRA 1F45A 4L3AA 3Q48A 4P2AA 4KO6A 5BUPA 1BA9A 3ZW3A 2JTDA 1GSKA 3VQ1C 4J4PC 3IDXH 4NB7A 3C5SA 4QXUH 2ZCKL 4FZ8L 1XMWA 5E24E 2H9GA 3RWCA 2XTJE 1CDJA 4KO7A 4DVRH 1H15A 2PWDA 3BWUF 4FHJA 1A8ZA 4HBCH 5E1IA 2J8UE 1YRKA 4JO3H 4Y1AE 4M43L 3HE7D 2FBRA 2A1WH 2FB4H 4X8XA 1QHPA 1G1CA 1U3HD 1MW0A 2XQYG 1DJZA 3NSXA 3FH5A 1NEZB 2BSRA 4HUXA 5E2TL 4HETA 4YZWA 4OT1H 3VI3B 4UTAA 3E7JA 1NCDL 4N2MA 4Y5XB 3LH9A 4UMSA 2Y0SA 1XIWB 1A4KA 4S10A 1VLXA 3SGDH 3CHRA 1MLCB 2KI6A 3QZWB 1UD8A 3DA0A 2VR8A 4M8RA 2AV1B 5KSBE 1ASPA 4I0PC 3VD0A 4PGCA 4A66A 1FG2B 1MEXL 3LEXB 2RBLA 5BPPA 2QELA 3HAEH 5TPWL 1Z3GL 4OV6F 1CFVL 1YYMH 2C7UA 4PRAA 5GJTL 2IANA 4KK6D 3MTRA 1GS8A 5JORB 3IDJA 2P43B 4S2SB 5T3ZL 4LOFA 2X4TA 4OB5L 3AVEA 3EYFB 4XNZB 5CCHE 3TCTA 4GMSL 4OD3H 3HEIB 3OZ9L 3RDJA 4Z7UF 3SKNA 2JB5L 2ED6A 4RRPM 2X6CA 2W0PA 3IJSB 4TVUA 2VL5A 4Y9FA 2LR4A 1DQDH 4XX1E 2FNWA 3B2UC 3I2CL 4PRDA 3H2QA 5DZJA 1H3VA 2GT9A 3DK2A 4R4ND 5GS0H 1JDDA 4TL5A 1MFVA 3BAJA 1KGJA 4X50A 3ZHKA 4ANVA 1GHFH 5F9OL 4QT5A 4R97B 4PVBA 5E70A 2V2TA 2ZSWA 4M1GL 4NZTL 1TZIB 1XF5A 1GR7A 3EJRA 5D7IE 5HYFA 3O4LD 2HUHA 1JWUB 1N59A 2AEPH 3W2DL 1LO4H 3D85D 1RPQA 1MAML 3DVNA 4HISA 4N0UE 3NABH 4NQCE 1A3LL 1NIEA 2MQ0A 4MWFB 1GGCH 5GJSL 1QFWL 1JZIA 1UJTA 4GRLB 1G9MH 4OZFB 4J2XA 5F44A 4ALAC 3N5AA 1PU0A 4WEMB 1INDH 5L7XL 1TQCC 2B39A 3GSUA 1ZIBA 2ZKHL 5BCAA 1UASA 1ORQB 1TTGA 3QR1A 2ICWA 3SYPA 5T3ZE 2VL5B 4BQ6A 4KK8D 3EH1A 4L8SC 4KKZA 2F74B 4FULA 3CGTA 3NACL 4MQ7A 5TQ0L 3NIFB 4JR9L 1SHXA 3N43B 3WO4C 3RWDA 2AV1A 4MMXC 3EJYC 3MLRL 3MX0A 2KLTA 3OX8A 3QDJB 4MJIB 2WO2B 4OGYL 5GRJL 3S35L 4FNRA 5AAMC 1S9VB 3KVQA 3NJLA 1T5WA 4K3JH 2NY6C 1MXDA 3I85A 3TJPA 3CAFA 2YMTA 3MMEA 4X0NA 2NSQA 3UTSD 1WA1X 1ODUA 2WSPA 3FB5A 1T2JA 3GRWL 2BIPA 3MFGB 2AABH 3WENA 3TYFB 4ADJA 4Z3IA 3OKKA 1U8OB 5DEGB 3T0DA 2QVTA 4UT7L 2FHFA 5JYMA 2CK0H 3DYMA 1T2XA 3HZMB 3IGFA 3WDJA 5D2NA 1MI5A 4XNYH 1U21A 1AQKH 1NL0L 1NGQH 5FO8A 3KPOB 4NZJA 4Y8AA 2AI0H 2IIJA 3V6OE 1Y1UA 3UERA 4YSUA 2MKWA 2D3LA 2JKJA 1S7QB 1CLZH 2LV4A 4L4TB 3T0EC 2FO1A 4MAZA 2DDQH 2Y7SA 2K78A 3IDYC 4KTEL 5GGVH 4X8CA 4ZUWB 4K94L 4W9KC 1J7VR 1E28B 1YPZA 1XV8A 4GXUN 2R4SH 3FTYA 3HAEG 4MHHG 5H35A 3T8XA 3T3PB 2FWUA 3DTXB 3HNSL 5E9DD 3D87B 2W1NA 1LO0H 3WHE0 1OGTA 2YMXH 2FEEI 4YXKH 5KJ4A 3WEBA 1CFQB 3EOAA 2EDMA 1JDAA 3T4AA 3RPIA 2P8PA 3LZPA 3WUWA 2OBGA 4W9LC 4HS8L 1ML0A 4JANA 2J71A 4JFEB 1L0YA 2WQ8A 5E9AA 4D0BB 5DJAA 2H9GB 4RMWA 3O6LL 4Z7WA 5HI4C 1XT5A 3FTXA 3VXUB 3D06A 2VZSA 4HXBH 1MJUL 3DGGB 2A74C 3DX0A 2BJML 4HUNB 4WIQA 4RFNB 4ZBJA 1R3HA 1G7HA 5GHWL 1KYAA 4BE5A 1N12A 1QO3B 5ECJE 2CGRL 5IIEA 2BXYA 1QSED 3ZL4L 5D5MB 2KYIA 4QAWA 4Z3TA 2G5UA 2A9MH 4XMKH 1DBAH 4DZBB 1BXVA 3KNBA 5FYJD 1D5MB 4HIJA 5IHLB 2W5PA 4QXGL 3CHOA 4QAMB 2C1OA 1KYOJ 1TQUA 1C5BL 1WFOA 2EDXA 2VN6A 3IXTB 4HLZH 3QQDA 4WSKA 3TEXA 4YAQA 2UZXA 4Y9BA 1UB5B 4K07A 5BRQA 2ENYA 2K7PA 5TDPA 4M1GH 2O1AA 1C5DA 1M7DB 4QRSB 4WO4A 3BH9B 5DUJA 3WJLC 1A14L 4NRYA 5JORA 3CFBB 3EXLA 1HZLA 2Y07H 2DQEL 5FO7A 1JN6B 1TMCB 3HZYB 2DEXX 5HGDB 4XN7A 5IK3A 2J72A 1UA7A 1A3LH 2P3YA 3KLHC 4U6XB 4HEMA 3BRFA 4HCRH 3BXNA 1YECL 3O2DL 1A7RL 2CD0A 3L2NA 2BVOA 4C58B 4JAMB 1AVAA 5HYSG 4XHQA 5AVVB 4C57C 4DK3A 5JPNA 5C0IB 3GB7B 1AGDA 3VDCA 4OF0A 3GMNA 4F7EB 4J39A 4MDJA 1NIDA 3DTDA 4EAEA 4JDTH 3GPSA 2C3XA 2DMGA 1BMZA 2D03H 2XVBA 3KW7A 4JY5H 1ZD6A 5FA4B 2EVHA 2R1WB 5D7IB 1JZGA 3M7OA 3TTSA 3TIEA 2OA9A 3FTZA 2W88A 2XPZA 1IGTB 3KXFA 1W80A 2Q3ZA 4BFEA 5DK3A 4M3JA 4X0KB 3EJCA 1GS6X 5CILH 3CDFA 2H32H 5DK0A 3FTUA 3O6MH 4LEXH 1AMXA 32C2B 5E23A 4FTVB 2APTA 1DQLL 5I0WA 4OAWA 1KBPA 1HAWA 1R3JB 4QWWC 2VC2B 1U3HC 2CRZA 5EBWB 5EU5A 4R96A 3SO3C 5ESVB 1KLUB 4PCTA 3ZR6A 4KKAD 3ARDC 1BZQK 1NSNH 4FG0A 4RCAA 4UUJB 4WENB 5TGBB 4M93C 1L0QA 4NC2B 3IJ8A 5ABAA 5DHDA 5DA0B 3IYLW 2EYTA 3IKCA 3WCYA 2CJ3A 5HP5A 1J86A 2O93L 1OD9A 4KQ4H 2IPUK 1N6VA 3C6SA 4E9TA 4PGDA 3QIUD 1ZXQA 5BRZA 2YRZA 2IWGA 4NN7B 3DX7A 3BKCL 4NO2B 3DX9B 4ZAKD 1UJ3B 5JOFB 1IX2A 2EH8L 3TPUA 3QZPA 5DZ9A 1QI3A 4YDNA 1UOVA 2XWRA 5D6CA 2F18A 3HKFA 3I84A 4RFOH 4E42A 3ILQD 4FLRA 5F6HJ 5CJ5A 2UY7B 4WW2B 3OAUL 4DZ8B 1B88A 1XB6A 4Y4HA 3RE0A 4NO0D 3EO1A 4JPSA 3VFVA 4RFEA 2GTWB 5EB9A 4OBRA 4UOW0 4KVNL 1MLBA 2K7QA 3KHQA 4KKLD 4PRHA 3NUKA 3JYCA 3CWGA 3QHTC 2FQDA 3WE6B 5KVGH 2NUPB 1JHLH 3D7PA 4OZIE 4JPIA 3F7RA 4DP2X 4UV4L 2AS5M 1FP5A 1NLBL 2ZKXA 5ISZE 5IW6B 1U41A 1KCRL 2YBGA 4HJIA 2R69L 1KELH 3LRKA 3NESA 4PJ9B 4RWHA 3A67H 4KY1H 1DHKA 1HWGB 5JW3H 3NAAH 1FFOA 1H0DB 4NKOA 1VZHA 4P06A 1RZQA 1P2CB 1RK1A 1R5VA 1G1KA 1J8HD 5EORL 3ZDZB 2JJWA 1DSFH 1TQBC 4OCXL 1GAFL 2JQMA 4PJHF 5E9DB 2PR4H 2C26A 2KDYA 2NY7H 5IV2A 4ABVA 5I8KH 1QD0A 1NUDA 3L9BA 2D2CC 2Y3NA 4MMXB 4ODXA 5IB4B 1EZVY 1ZHBB 4WTWA 3WO4B 5J6GA 5BS0E 1RVFL 2IAAC 2P45B 2ETWA 3SSGA 4Y4HB 1FH5L 3IRPX 4L1BA 1YEDA 4H8UA 4TLKA 4UOZA 4TSCL 2RAMA 5F1IA 4AQAA 3O4LA 4G7SB 2X0UA 1HESA 3B2PA 2JJTA 1HH9B 1SMAA 1HHIB 4U1GC 2LE9A 3DHPA 4C83A 2QZQA 1IBBA 4QRUB 5KZCB 2HLAA 3TA4D 3KDPB 4A67A 5K59F 3EHBB 4YBLC 1G7QA 4K23L 4HALA 1M53A 3ZE1E 3LIZA 1IILE 2AEQH 3MNZB 2O6EA 5DA4A 4EZKA 5DI8A 2H8PB 4F9LA 1RUAL 1Z7JA 3HI5H 3NDZE 1LNUA 1VPOL 2KT6A 3RWFA 2AJYL 1F56A 5EZOH 4AITA 1LDPH 4ODWB 4NC0B 1N2RB 4WWKC 2GI7A 4XWOC 2M8XA 4GP8B 3GBNH 4U1JB 4HCGA 4ZS7L 2DW5A 3LB6D 2MEJB 5B22A 4JE0A 2DS4A 2WW8A 3C2AH 3TN0A 3MV8A 4BUQA 1X44A 3MGAA 1NBYA 3X3FH 5FHAH 3OKMB 4JFEE 1SQ2N 2GQHA 4JQIL 3ORJA 4APQA 1JWMB 5D96B 3FCGA 3O11B 3BP6A 3QI9A 1QA9A 3V9EA 1NMBL 5L4JA 1U8MB 4XP9H 4AM0B 3QJHB 3NEXA 2EYSB 1BEYL 4NQUA 3IFNH 3AREC 4NIKB 2H1XA 1E5YA 3HRPA 5KSBF 3GMNB 3OR7A 2YD7A 1DSFL 5CWSA 2M1KA 1F13A 2F53E 5F21B 3Q2CA 5JHDB 4GKSB 5BUGA 3IVKA 1F4YH 3DGCR 2K45A 3RTQC 3NFSH 4HOXA 2R29H 2G9KA 2QPDB 3IDIB 3I74A 5C6TL 1VFOA 1UFGA 2E6JA 4FLQA 5AKSA 3QQXA 2ZYIA 3B83A 3EUUA 3BUQA 5GQBA 5IB1A 3LHAA 4BH7A 5FK9A 4Z7OF 1L9MA 1JI1A 1KY7A 2DQFA 2HRPH 1CD8A 5IHZA 3MUUA 3FN0L 3WY4A 1MCLA 4RBPK 1DFBL 1JSYA 1FNAA 5TFSL 4DN3H 2WB1A 2NQDA 5IM7B 3DURA 4C55A 3MXWL 5EU6B 4F2EA 1JHTB 2EQDA 3IMWA 1XCXA 5AB2A 1OCZB 2CHNA 3FPXA 2ZOKB 5FDYA 3S5LG 4R96B 1XO8A 3CFMA 3H2PA 1M56B 4L1HA 1T1ZB 3WNMA 2WCGA 2OSLB 3MCKA 5DEGA 2QDWA 5IEKA 2I7OA 4XPHL 2CXKA 3U1SL 3SYOA 1J5HA 4XZ4A 1NLBH 4BZ1L 1BM3L 2AJVL 4PLNC 3J2PA 3HB3D 2ZP9A 3BE1L 2Q6WA 3EOTH 1E3ZA 1LEIB 2UV3A 1DBMH 2GBUA 3IWVA 3CMGA 3RGVC 3RWHA 3SKOB 2EE2A 1ETJA 1B9KA 3CVCA 1I7TA 4UYPA 4FNUA 1QNZH 4MD4B 2OMYA 4XVUD 3FQNA 3INOA 3VGAB 3GDBA 2CKBA 1KWKA 4XC3L 4YDVB 1F2QA 3L3HB 4K5LA 4K5PA 2VLJB 4A6YA 5I1CH 3NIGB 3NFPA 3P9LB 3TONA 1O7SA 1B0WA 1RP9A 3PWPD 2ZX6A 5FYJH 1I1CA 4UZSA 3ALWA 1H9VA 4MX7B 4ODUA 5I9QB 4B41A 5EF2A 2Q7AA 4JZNA 2ZOLA 3H1ZA 3HCVA 2DQHL 3AABA 3RYMA 2P42B 3S3PA 3T77B 1UD4A 1Z9PA 2QQLH 3DMMD 3ZYOA 1J12A 4HX1A 1MWAA 4KRPB 4FJ6A 3JWNE 2ATKA 1H3WM 1JF5A 1HL5A 2D3NA 5HHOD 3C5JA 1PYWA 2Z9TA 1R33A 3L3OC 4RGOL 4XPGL 3IK2A 2BZDA 3MACH 1FFOB 1JV5A 5DTFB 3DGGA 2FJGA 5L4MA 2C9UA 4PRBA 4ATWA 1DCLA 3RVVC 3OLGA 4HCIA 3QO1B 1Z9OA 4P59L 5IVNA 3HR5B 4Y16B 4JDVB 2KKQA 5AW3B 3IDGA 4Z7QE 1LJMA 4E68A 1HSAA 1OV8A 3JBG7 4WU5A 1D5MA 4O4YH 4APQD 2ZT9C 4ONHB 1BYNA 1A3ZA 1OTSC 1A47A 4KXAA 1FYTE 5I75C 1I53A 2A9NL 2R0LH 1IBGH 4ZPVB 2K9UA 2BFGA 3EF4A 4AL8C 2PYED 4LEEA 3L4ZA 2X6AA 4G6FD 3F5WA 4MNGA 2J5LC 2QFRA 4U3SA 3KD4A 4PJ5A 5HD8C 2PWFA 5K9QI 1F1AA 1JN6A 2XWTA 1URIA 4HKZB 2ROXA 4OGZA 5HGDA 3U9PH 2GIXA 3X13A 2Z93B 4E9YA 5BV7L 3JSSA 4G7YL 4WI2A 3D52A 4MCNA 4I77H 2AERT 1BZDA 3EYVA 2J7LA 1VSCA 3GI9L 1IVTA 4RMBA 3FFDB 1N26A 3SDXA 2XFXA 3QDGB 2EC9T 3FO1B 3QWQB 1FO0H 2CM5A 2VXVH 3DUHA 4R7VA 2LVEA 2ZD0A 4LHQB 1HZKA 2QKIB 4UB0H 4F7CA 1JGUH 1ID5I 1OSPL 5FECA 3BPCA 4JHVA 5DHMC 3WIFB 1ET8A 1NEZA 4N8VG 3RTQB 2CHXA 1MVYA 3VFMA 2OMUA 1PZBA 1Y0LA 1A3QA 1MRDL 1QATA 1B9ZA 3MBXL 1S9VA 5LAXB 2H2PD 4JO1H 1BBDH 3F2LA 3MMEB 2VDKB 3FU5A 4DCQA 4LLDB 3H9HB 3AWFA 1XQ4A 4NAMA 4JDZA 4J1UB 4OQTL 4OY9A 5AVQB 2C7UB 3ILPB 1PYWB 4M93B 3OR6A 4R4FH 2EAEA 4HJGA 2OTUB 1VDGA 1KJ3H 2HG0A 4NKIH 3W0WB 2BFVL 2FLMA 1GGIL 4J6RH 4UM8B 1RJZB 3ARUA 2M83A 3ARGA 1Q1JL 1SUHA 3HAEB 4KKQA 3LD8B 4JFFD 4BFRA 5J12B 1CBVH 1M3JA 4GAGL 3IB4A 4UUJA 3ARSA 3LIZL 3ESOA 3G6DL 1I8LC 1UXSB 1LK3L 2NR6C 3VX0A 4BGDA 1A02N 1RJLB 3OGCA 1NAMH 4ALAH 2H7WA 1FL3B 1BOGA 3GMPB 4YGVB 5LO7A 4Q6IA 5DF0A 4HOMA 3EYUH 1OAQH 3FF7A 3GBDA 1TYEB 3T8XB 4L29B 4Y4HD 5F9JA 5D7JA 3UBXA 3CZNA 4YZFF 2HFGL 2QQKH 4S1QH 1B4LA 1XF5B 4CGUB 1AQHA 3LEXA 2AGJL 1WFNA 3F5WB 1CFQA 2Y1YA 4MA3B 3GI8L 3FQUB 4PTUA 4C4UA 1QFUL 3JWDH 2NR6D 4ZX3A 5ANHA 3LV3A 1T3FB 2XWBB 2DQHH 3FRUA 3GSWB 4GRLA 3CVIH 3GMOB 1A5FL 4O51B 2P26A 4MHHI 4RH4A 3WMPA 4HIIB 3SKJH 5KSUA 4BQBA 4BZ2A 3UDWA 5CAYB 3SE9L 1AS7A 4FQQB 2EECA 2F68X 2Y7LA 3ECBA 3TX4A 3UX9B 3H85A 1G7HB 2NNRA 2R7EA 4Z7VF 1IM3D 4FZEH 1OCCB 2KPWA 3QNYB 4L2LA 3GEWB 5I24A 3VXRE 1A4JA 2NX5E 3UEZA 4OCWL 2TAAA 2ICEC 4ZNEA 1NCOA 4XN5A 3TF4A 3NIFE 2R8SL 4BUHA 4MQSB 3W9DA 4YC2B 3QQ9C 3WLBA 1U95A 4O00A 3M45A 1T0MB 2PCXA 2PYEA 4PMEA 1BIIB 2RB8A 3K81A 4HZ1A 4ETQB 5FF6B 5K9KA 1SNRA 3KWTA 2MTAA 4X8JA 2JNZA 2Q8AH 4XBPA 4Q14A 1L9QA 4WFFD 3B2VH 3SN6N 3FCSB 3N1PC 4QUOA 5DHEA 2GCYA 5E2UH 4AGQA 3MOAL 1R9FA 1IGMH 4OLWH 1E5UI 1QSFA 3QIBB 4M9OA 1JS4A 2X6VA 3MV7D 1FORL 3U7WL 2VDQH 3L4TA 1TFHA 3L6FB 4HWNA 2E7BA 3BMVA 2AAVA 1IBDA 1DFBH 3TM6A 2YBRA 2OZ4A 1IKOP 1H3XA 4C4KT 3WHXA 3JWOL 4ODHL 1UB6B 2F74A 1PZDA 1UHVA 2WLMA 5DJ6B 4QXUL 4Y2DB 1I8AA 5C0CA 4J3TA 3SDXF 1CFNB 3VTAA 1TZHB 4LO9A 2DIBA 3A24A 3O0RH 1R46A 4BRJA 1WD9A 4P46D 5D7KE 5CIPB 3EFOA 3NJVA 5DYOB 4WU5B 1XIWA 2X28A 4UT6A 4QTIH 3MR9B 3KLHD 4Y19B 5ESAA 2HXAA 4H8WC 2AXWA 1OOAA 4KROB 1HTYA 4M8UA 4GT7A 3AREA 5AYUL 5F8QC 3W5MA 5AZEH 2W9DL 1CF1A 1KT2A 4MNQB 3CMOH 4PEEA 3DJZA 5BZWB 1A5FH 5AVZB 1G7LB 3WKPA 1IBGL 4J3SA 2XWTB 1NMAH 4ZFZB 4XVTL 4Z7VE 5B1BB 2EINB 3V52H 4FFZL 5I1LB 3ULVE 3LQZA 5E9NA 3L6FA 4Z0BL 3C12A 4JO2L 1N68A 3K2UH 2GSIB 4XPAL 4D94A 4OLVL 5CUSH 3A22A 2UUDH 4PJFE 1NJ9B 2Z35A 3VFNA 3VFOA 3HBGA 4U6YA 3GXTA 3BP5A 1DZBA 5EUKB 3RL2B 3D08A 1KPUA 3QFDB 4P23A 3PDGA 2R1XA 4X9IA 1BF2A 3VFUA 1JYNA 1E4XL 4JFXA 4A2FA 1JGDB 5ICYB 2VC2L 1GTNA 1XB8A 3VACA 1ZLVH 3TA3A 2ZCKH 4IHBA 1MFBH 5TE7L 2UY7A 4QO1B 1E50A 2PP8A 4JFZH 2I5YL 4PJBB 5DJCA 5I1GH 1E8ZA 4FQ2H 4P9HL 4JRXD 1AOHA 1CVSC 4FG6D 1AIZA 3ABLB 4YHLL 4I9WE 1E90A 5EDXA 4JPIB 1TQCB 3EBAA 2YAMA 1YNKH 3RWJA 3CV5A 5DHVH 1CLOL 3L2LA 3BUTA 5I6PA 2YD6A 1TTAA 43CAB 2Y7MA 3MV11 2B1HH 5GGQL 5FYKU 3ARFA 1X9UA 5B7MA 4Q6YA 2DY2A 4TV3A 3IGKA 1GKEA 1OGSA 1OAUH 1YY9C 4JG0H 4Z18A 3FFCA 4Z7AA 1EMTL 1DO5A 4N85A 3WEOA 4LPWA 1WTGT 1JDCA 4QYOB 5KYWA 5GGTH 4HUVA 3FOLA 4FHKA 3M1CA 3L48A 4L37A 3V6FB 5K1VA 1FZKA 4M4RB 4B9ZA 3UABA 4NRYB 3IXAA 2YD0A 2KC0A 4HF5L 5DJCB 1NPNA 2ICEB 2R83A 2IOMA 1Z9MA 3TYGL 4JQIA 5D1QE 2OXHB 1X3DA 4HPYL 4JN2B 5LBVA 4WDIB 3ULUD 3N1GC 1FGVL 1N4XH 1KGUA 1M42A 3B9AA 2MTPA 1U8KB 5F88A 1UXLA 2IDSA 2ATAA 3GGWB 3ATAA 2ZKWA 1NJ9A 3GS0A 4PJIB 3OLEA 1D7BA 1QABA 4FNTA 8CGTA 1I7UB 2WSKA 1J0JA 1LDSA 4GO6B 4JJHA 4L8BA 2YN5A 1RERA 3U4BH 1M9SA 2NZ9C 4CN1A 3P2BA 5FFLA 2D3JA 1QSEE 1J8RA 1MH5A 5T1DH 5FYKH 1JJUA 2BP0A 2DLTA 5IQ7H 1IGTA 2V9TA 1M2OA 5T1LD 1MCBA 3NK4A 3W11D 5A7EA 1KY6A 2WLNA 2NYZA 3DJ9A 5AAWC 2V3EA 2WWMC 1NFAA 2IOOA 1BFOB 4PLKD 3P11L 2MPAL 4LKXB 1G0YR 4IGBC 2AJXL 1RFDH 1EO8H 2RH0A 2CUHA 3TO4C 1LK2A 4TQEH 5EBLA 5E7FA 4R2GB 4NEHB 2OL3L 1OP3K 3VQ2C 2D7NA 2OLDA 3ZPDA 1BWMA 3RVXD 2EVIA 4HUMB 3PCYA 2HKFL 4RFEB 1YN7A 4HK0B 4Q7DA 4UM9B 4RAHA 4RGMB 1OE1A 4ZFQA 1BREA 5CINH 4NWUL 2XLLA 4S1RH 3WTTA 3NACH 1Q72H 3TZVC 3LNDA 3QULA 5C0FB 5J12C 3DTUB 5TE6H 2ZF9A 1XCTB 3PAZA 5IW6A 1MCWW 3K91A 2NY6B 2VDKL 4P2RE 4F15B 5CSZB 2BOCB 1TZHA 2E6QA 3CX5J 3QXAA 1ZGLM 3MJ9H 2XN2A 2P4AB 1FN4A 3LN9A 4Y19E 1M7IB 2H26A 2VLME 4LBEA 2X10A 3HE6D 1WWBX 1IGFH 4E0RB 1WFIA 2HN7A 3GRWH 3PNWB 2GAZB 1WFUA 1DLFL 4HIJB 4KPHL 3GMLA 3GINA 2HT3C 5FYKE 4TVPD 4Z5RA 5IB3B 5L4FA 4YHIA 3IE4A 4PRNB 4PJ5D 3QJSB 2NXYD 3OG4B 5E03A 4HJSA 3T4YB 3CDGB 4DZ8A 3STLB 1SN5A 5CKGA 1EGJL 3EO1B 2ICEA 1LK2B 3VFVB 2XWZA 5B4MD 3ZHNA 4KKRA 5C0JB 3KHOA 4WNJA 3HG5A 1U3HA 4DETA 3V8CA 1YYLL 3JTSA 1JPFB 4XPBL 4ZTOL 5IK3B 4JFZL 3QJZA 4NENA 3FJTA 4HPOL 5HHNB 5L2JA 4PLOB 1GYUA 1CZ8L 4J1UA 2DTSA 3QUZD 2JVUA 1MWAL 2VZ3A 5G2NA 3AY4A 3S5ZA 3ES6B 3CSGA 2OMBA 4G5ZL 5D1ZA 4G72B 1JHKL 1TT6A 1IC7L 2ZXQA 3ULSA 3IF1B 3QUKB 4F7MB 3LPWA 5H37G 3PAUA 3WJLA 1KBWA 5D1XE 1MXGA 3Q8FA 1WSST 3Q44A 4GMTH 4JFXB 4URTB 5DHXB 3L81A 2WXHA 2CRIA 4Z7UE 2VDOB 2C9XA 5DYFA 3VXQA 1SYVB 4NM8L 3MROB 3DLQR 5IZ7A 2ENPA 1PDKA 4JZOA 2ZXWB 1MCFA 4IU3A 1NCJA 1OQXA 4P3CL 4PV1C 5B8CC 3ELQA 3QUGA 4YO0A 3RJDA 3PFQA 3VG9B 3K2KA 4URKA 2IXQA 1Z1WA 2N59A 4NI6A 2DDQL 3GK8H 4N2AA 3TBSA 1T21A 3CLEL 5F7EH 2VDKH 4X5LA 1S46A 1O9VA 1A6AB 2Q7NA 5F96L 1OGPA 2MIZA 5T1JA 1YMMD 4FABL 2FJHB 4WUUA 3RX5A 4Z0XA 1L7IL 3W39B 4GQ9L 4GKOA 3CVBA 3FB6B 2F15A 3WN5A 3BPLC 3G04B 5I73C 4KI5D 1AGEB 1IC5H 5MI0B