3DIVA

Crystal structure of laccase from cerrena maxima at 1.76a resolution
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
499
structure length
497
Chain Sequence
AVGPVADNTITDAATSPDGFSRQAVVVNGVTPGPLVAGNIGDRFQLNVIDNLTNHTMLKTTSVHWHGFFQQGTNWADGPAFINQCPISPGHSFLYDFQVPNQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASRYDVDNDDTVITLADWYHTAAKLGPRFPAGADATLINGKGRAPSDTSAELSVIKVTKGKRRFRLVSLSCDPNFTFSIDGHNLTIIEVDSSNSQPLSVDSIQIFAAQRYSFVLNANQAVDNYWIRANPNFGNVGFNGGINSAILRYDGAPAVEPTTNQTTSVKPLNEVNLHPLVSTPVPGSPSSGGVDKAINMAFNFNGSNFFINGASFVPPSVPVLLQILSGAQTAQDLLPSGSVVLPSNASIEISFPATAAAPGAPHPFHLHGHTFAVVRSAGSTVYNYSNPIFRDVVSTGTPAAGDNVTIRFLTNNPGPWFLHCHIDFHLEGGFAVVQAEDVPDVKATNPVPQAWSDLCPTYDANAPSDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of laccase from Cerrena maxima at 1.76A resolution.
rcsb
molecule tags Oxidoreductase
molecule keywords LACCASE
total genus 139
structure length 497
sequence length 499
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2008-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3divA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3divA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3divA03
2BWDA 1ID2A 2MRYA 1JXDA 3GXUB 3PXLA 5B3SB 1JZHA 2XV2A 1OCZB 1BQRA 2BZCA 4HAKA 3DIVA 1PNCA 4GP8B 1OF0A 3GDCA 3PAUA 1ILSA 4YSPA 3V9CA 2VM3A 5PCYA 2P80A 4N4YB 2JXMA 4AZUA 5LDUA 4HCIA 3X2QB 3FS9A 1AZNA 2IWFA 1ET8A 3UADA 2EINB 4N8UA 3RYMA 2EILB 2I7OA 3AG1B 5I6PA 3S8GB 1AS6A 1J9SA 3AG4B 1L9QA 1M56B 3QJVB 2BP0B 1SNRA 2VW4A 3CVDA 4AX3A 4UF7C 2GIMA 1QNIA 4G7QB 2FWLB 2YXVA 1UATA 2BW5A 3BVDB 1XMEB 2DYRB 1NIFA 2UXFA 4KO7A 3N55A 1AACA 5I5IA 4NAJA 1W6WA 1AQ8A 1NIEA 2CBPA 3PPSA 1XB6A 3ABLB 4BWTA 2FTAA 1ADWA 4YVUA 4P5SA 6PCYA 1TU2A 2W88A 4NB7A 1EZLA 4DP0X 2ZONA 4DP7X 4GXFA 5AKRA 4ENZA 4KNSA 1KDJA 1WAEA 2XXGA 1PF3A 1BAWA 3T6XA 2PPFA 1E67A 5I28A 1L9RA 4W1TA 2X87A 2AFNA 2BHFA 3FQYA 2XLLA 1HFUA 1MZZA 5B1BB 3D12B 3GYRA 1AZUA 3TBCA 5EHFA 2J5WA 1NWOA 2IH8A 1BYOA 2YAMA 3FSAA 4DPBX 3UAEA 3KW7A 4DP6X 3FU8A 5B7EA 2VSMB 1W8EA 2XVBA 5E9NA 1AS7A 4AI7A 4BK5C 3WNIA 4DP1X 2Y69B 5B7FA 1JXGA 1KBWA 2NRDA 3FQ2A 2YXWA 1GS6X 1XB8A 3ASOB 1NIBA 1GS8A 3IBOA 2EIJB 1SFHA 1M9WA 5I6KA 2VW6A 5TK4A 1NINA 4ZK8A 2IAAC 6PAZA 2JFCA 4F7KA 5IY5B 4P5RA 2PLTA 3DTUB 2Q9OA 1M57B 2PCYA 1DYZA 3NJKA 1I53A 3EH3B 2JKWA 4A2DA 1CYWA 2YAHA 2WO3B 3QJSB 4M3HA 1BEXA 8PAZA 1R1CA 1AG6A 4HALA 3FPYA 1ETJA 1GY2A 1TEFA 1KBVA 3IEAA 2J55A 1J9RA 3FSZA 5B1KA 1J5CA 3UAAA 1X9RA 1NICA 1JZEA 3SBRA 1FA4A 4YSOA 5B7MA 3ASNB 1BQKA 4M4RB 1SJMA 1AZBA 3WI9A 1PMYA 1PCSA 2GI0A 1IBZA 3MX0B 2IWEA 4JHVA 3MBWB 1OV8A 2AZUA 1CYXA 3G5WA 3V9EA 4E9VA 3CVCA 3X1FA 1ET5A 4WTQA 1A8ZA 2AVFA 3BQVA 3ZX1A 1JVOA 2QPDB 5I5MA 1KDIA 5D4HA 1KCBA 1TKWA 4YSQA 3UABA 2XV3A 2J57A 2PP9A 5AZUA 4QKTA 3OD3A 2BP8B 3WG7B 2VW7A 2XV0A 4CSPA 1OOWA 1KGYE 3N2JA 2XU9A 3T9WA 2E86A 1MG3C 3QJRB 1L9OA 1SFDA 2FNWA 4G71B 4KOBA 3C75A 2IDFA 3WKPA 4BDVA 4UANA 2Y1AA 2GC4C 2R7EA 2BP0A 3ZBMA 1OE3A 1CC3A 1OCRB 3X1BA 2UXTA 2YAEA 3NJGA 1EHKB 2UX6A 1SHWA 2DY2A 3ZDWA 1B3IA 3PAVA 4HHWA 2VN3A 2WSDA 2BZ7A 3H4HA 1TEGA 4BXSV 4A2GA 1SDDA 2N0MA 3PAZA 3FT0A 3NJHA 4YL4A 3EHBB 1NPJA 4DP5X 1ZPUA 2PPDA 1A65A 2GHZA 5B1JC 1PLBA 1QHQA 2FQDA 9PCYA 2XWZA 2YAPA 1W6LA 3NYKA 3S3CB 5D4JA 4AKPA 1A4BA 3X1EA 4DP9X 2VMJA 2IDTA 4E9YA 3ABGA 3H4FA 1V54B 1AR1B 1NTDA 2RACA 4YSTA 3UACA 3FSVA 3X1GA 3NJMA 1OE2A 3HB3B 1GYCA 1IC0A 1ZDQA 3NP3A 3QJUB 2IDSA 1PNDA 1DZ0A 2DV6A 3TBBA 1OCOB 1JERA 5F7BA 3CDZA 2EIKB 2IWKA 2OJ1A 1BXVA 1AZRA 1BXAA 2GSMB 1JZIA 1A4CA 1MZYA 3FU7B 2HX7A 1KV7A 1GY1A 4GP4B 1ASPA 2ZXWB 3FPXA 3DKHA 3S3DB 2AZAA 2VSKB 4E9WA 4HIPA 3WNJA 1NIDA 1QLEB 4A68A 5PAZA 3EH4B 2CUAA 2PPAA 2AANA 1GR7A 2CAKA 4KNTA 1ASOA 2OCCB 4HZ1A 4AKOA 4X4KA 1IBYA 5FC9A 1AIZA 2GBAA 2QDVA 3NP4A 4K9JA 2QT6A 1A4AA 1AS8A 3FQ1A 4JKNA 1RCYA 4BWUA 1RZPA 4Q89A 3T6WA 4BWWA 2ZOOA 2H3XC 3CVBA 2I85A 3QJQB 2IH9A 2XUWA 2FJSA 1J9QA 3AG2B 2OV0A 2CJ3A 4GYBA 1N70A 2A3TA 1ZDSA 1ZV2A 2BWIA 1JZJA 1BXUA 2ZWNA 3QJTB 3FYIB 5TK2A 3NJJA 4TXVB 5A7EA 2FT7A 1V10A 4DP4X 5AFAA 3L45A 4GP5B 3EH5B 4E9RA 2PP8A 2UXVA 3S3BB 3QPKA 4MFHA 1PY0A 2BO0A 1OCCB 3NJNA 5I26A 5I6OA 5I6LA 1AZCA 1L9TA 1A3ZA 1T5KA 4G7RB 4YSEA 1SDDB 1ZIAA 1J9TA 3CG8A 4CSZA 4E9QA 2H47C 2J56A 3TA4D 5D4IA 2QPEB 1HAWA 3QQXA 3KW8A 2VM4A 4DP2X 1GSKA 1NDTA 2IDQA 3WIAA 2W8CA 3FU9A 4G72B 2XX0A 4RH4A 1PZAA 2BW4A 2HX9A 3S8FB 4BDVB 1IKOP 1E65A 4KNUA 3IN2A 2FT6A 4A66A 4BXVA 2YAQA 1GS7A 2YARA 1SHXA 4PCYA 2TSBA 1KYAA 1JVLA 3JTBA 1MG2C 1N68A 2HRHA 1ZIBA 1AOZA 1PLCA 3NSFA 1MDAA 1PLAA 2PPCA 3CZUB 2IDUA 1F56A 1FWXA 1L9PA 1NZRA 4EF3A 1NIAA 3EF4A 4HHGA 3ERXA 4YVNA 4E9TA 2UXGA 1JOIA 2YAOA 4WKXA 3ABKB 4UAHA 2LLNA 2MTAA 2XYBA 2CALA 3NJIA 5B1AB 3NSYA 4A2FA 2H5UA 2B3IA 2CCWA 1JZGA 4PAZA 4KOCA 4YSCA 1RZQA 1CURA 1KCWA 3PCYA 1WS8A 4JHUA 1SF5A 3SBQA 1URIA 2B08A 3OMIB 1FFTB 2R7EB 5I6NA 1WA0X 2GC7C 1SF3A 3PLYA 2PCFA 4A2HA 1XB3A 3T6ZA 1BQ5A 4L0PB 3U25A 2YAFA 4DPAX 4Q8BA 3UGEA 3AY2A 3ZIYA 4G70B 3OQRA 2UX7A 7PCYA 1X9UA 2I7SA 2DWTA 1JXFA 5F7AA 4F2FA 3FSWA 3OM3B 2PPEA 2FT8A 2XXFA 3WKQA 4A67A 1PAZA 1J5DA 4HCFA 4YSDA 4FAAB 1WS7A 2X88A 4YSRA 5I5JA 2P80D 4W9ZA 4YSSA 3IN0A 3NSCA 2PP7A 2BP8A 3IE9A 1BYPA 1NPNA 2TSAA 4E9SA 1PZCA 3CDZB 4DPCX 1CUOA 7PAZA 1E5ZA 2FQFA 2Q5BA 5I6MA 2QDWA 4A2EA 4FA7B 3TU6A 2DYSB 3AG3B 4GY4A 2WO2B 1PZBA 2HZHA 1GW0A 3AZUA 3SQRA 1YLBB 2HRGA 3NJLA 3NSDA 3T71A 1AANA 3H56A 1ASQA 3X1NA 1IUZA 4E9XA 5ANHA 4F2EA 3HEIB 5B1JA 1AAJA 2HLEB 3SBPA 3T6VA 1E5YA 1HAUA 3ABMB 2EIMB 3TASA 1L9SA 3JT2A 4NERA 4KO6A 4KO5A 4DP8X 4AKQA 1V55B 3NT0A 2FQEA 1ET7A 1NWPA 1RKRA 1VLXA 1WA1X 4YSAA 1WA2X 3OMAB 4G7SB 2HX8A 2XX1A 2YQBA 2FQGA 3OMNB 4YSUA 4QLWA 1JZFA 3FYEB 1E30A 2GB2A 3AW5A 1AG0A 3NJFA 2DWSA 2HXAA 1OE1A 4HCGA 3FU7A 1ILUA 4KO9A
chains in the Genus database with same CATH superfamily
3L17A 4NT6B 3QO1A 1X5MA 3TZVC 3GXUB 4RMQA 1ACCA 3ZTEA 2X4SB 1OGAE 1A4JB 4N8VG 1BQRA 3RIFK 3B56A 2BZCA 4ILDA 3IFLH 3QHTC 3SKOA 3GIZL 4E5XB 1R3KB 3DGGB 4OGQC 5H35A 2X1QA 3HBZA 4IRZH 1KULA 2XPZA 3JSSA 4N2FA 4NQXA 4PLOB 4AZUA 1KUMA 5LDUA 4APQD 4OGXH 3D85A 3WSQL 1KPVB 5GRXG 1AC0A 4N8UA 5B39G 4FKHA 3HHRB 3KS0H 3KPSB 1OL0A 4PJHA 4XOBA 3VI4B 4K5OA 1YRKA 4GKSA 4HT1H 4IHOB 3ZL1A 2VZ3A 1CBJA 1NUFA 3LVTA 1JYNA 3QVAA 1WD8A 4GKZB 4N9OB 5CJQL 1M56B 4TPRH 3DSFL 4OZHB 1PS3A 1ZAGA 4NN5B 4XMTA 4WTWA 1TETH 4JFFE 4X4XA 4P5TA 4MXVF 1C1EL 2PW1A 3U7WL 1HILB 3ULVF 3KGUA 4KO7A 5I8OL 4N5EC 2BHZA 3LHAA 3QQ4A 1W6WA 2YPKA 3CPUA 4EI6B 1HHKA 1NIEA 3CCHB 1CTNA 2IQAB 5IWLA 3O6ML 1H15B 2GQHA 5D70L 4IBQA 4YBQD 4H26B 3L5HA 3KPOA 3QULA 3AS3A 3HZYB 1MFEH 2GT9B 1KYUA 3B1TA 4GMTH 1S9KC 1IM3B 2LV4A 4PSPA 3T6XA 1J0ZA 3E80A 4N2LA 5I28A 5BO1L 5AKVA 2G9KA 4DWHA 1E9QA 3TFKC 2B14A 5KYYA 4OD3L 1MIML 4YO0B 1IX2A 4JDEB 1KB9K 5HTSA 3CC5A 3IXTA 4C56D 5HP5A 1K85A 3L16A 3HE7D 1H9DA 1LO4H 4FRWA 3UBGA 4KK8D 3PGCB 3TC9A 3KLAA 4BK5C 3DRQA 2FJGA 4G9DA 1MHEA 5B7FA 2Q3XA 2X4RB 1FVCB 1YEJL 5IP4A 1JK9B 4MAUL 1U8OA 5HGDA 3CFIC 1MCSA 3KLSA 1E4XH 4LVHC 2EH8L 2EIJB 4HLZG 3OXRB 2MOQA 3E8UH 4JRLA 3TYFA 4NM4H 3L3HA 4XTRC 2JFCA 5IY5B 1W8OA 1SOXA 1IIKA 3DTUB 1HH9A 1U8HB 2X2IA 4ICWA 4Q52A 1Q94A 3O2VL 3MMEB 2GT9A 3K81A 3AM8A 3QQ3B 2JMRA 2AV1A 2UZIL 2X6BA 3DTXA 2WIIA 4M3HA 1YUHA 4KXCA 3M7OA 3I50L 4ENED 4HALA 4QNPE 3A67L 5HDBB 4F80A 2RIKA 5KSAD 2XWJB 2AJVH 3FQWA 4ZOEA 2FH8A 5E2UH 3QFJA 4PJFE 1MJ7H 1JZEA 4LDEB 4XMVA 3QIBD 1XGUB 4YSOA 3ASNB 1NBYB 5I5RA 5KUKA 1G5GA 3BLKA 4OCXL 4P23B 1EK3A 1OPGL 3F64A 3UX9B 2CM6A 1PCSA 2IWEA 2XPYA 3UAFA 2AJ3A 1HHIA 3VWJD 4P23C 2AZUA 3VXTA 5BS0E 4PJBA 4IBSA 1IL1B 4CAGA 4F7MB 3AS0A 1X4ZA 2FJHA 4NO5A 2V7NA 4OJFL 4ZYKA 5GS0H 2R1XB 2AVFA 1GGBH 3LKPB 4NKMB 2WVSA 3FTYA 2F15A 3BPNB 1V5JA 2ZCKL 4S2SA 4XH2B 4ZFOL 1E8WA 2Y7OA 3WAKA 2WXPA 1VENA 1HESA 1GKEA 2OJZL 4ALAH 3BCFA 4R4BA 3TL5A 3W11D 2MTPA 4FTVA 3LRMA 5F0PB 8FABB 2W0LA 4HG4J 2WLMA 3GQFA 1NM9A 4QAWA 3L8QA 4J39A 3V0VA 4LO9A 5E9AA 1Q9OB 5EO1A 2L4OA 3GBNL 4TVUA 2ZX9A 4L1SA 4RDBA 4QR7A 4RGNB 5TQ2L 2W91A 2GY7B 2EIEA 2Y7MA 4U6VH 1CO1A 1NMCB 3U83A 4HOWA 2NXZB 3A23A 4YK4B 1E6OL 5K9KA 5LG1A 1DE4B 2P7TB 4JZOA 4AV0A 1BBJA 2O61B 2J4WH 4QT5B 4Z77B 3PUCA 2VN3A 4HKJB 1TEGA 4YDIH 1HTYA 5D5MA 3AFLA 4FHBD 1UYWL 1KCUL 4HEMA 5JORB 4GJTB 1HK6A 2FHCA 1AVAA 3WLWD 3P9MB 5DS8B 3EHBB 3QJHA 4UIKL 2PPDA 1B4JH 1JL8A 2HT3D 2B7DT 2ICCA 1O9VA 3O2DA 4KY1L 1XGPB 3MO1B 5LGHL 4JFZH 1C16B 5BXFA 2V9TA 5AVRB 2MQCA 1M1XB 1OTUD 1E5AA 4M5ZH 3S96A 2CO2A 2WIMA 3GB7B 4EEEA 1RZIA 2WGXA 2NNAB 4M6OH 1COBA 1NGZB 1DBKL 3C60B 1S9XA 4HGMA 5D8JL 1LEGB 4OAWB 3VFPA 2PTTB 4M00A 5IEKB 3X1GA 4UTAA 1YVLA 4RRPG 4N2KA 1UJ3B 4LASH 3TYGL 1R24A 4WK4B 5I8EB 4PJDA 4XC3L 4C56B 4QJ5B 1U8KA 3DOHA 1UJ3C 3PWJA 1LHZA 1T7WA 4XMWA 5T8IA 4DW2L 1PKQA 4FQCH 4KPHH 1PYWA 4JO3H 2ZKXA 1P7KA 2YPLD 4M43H 1G7QB 4JHWH 3TEXA 4A7GA 4F3FA 5M95B 2AXWA 4KKRA 4WHYH 4NSKA 4UQ3A 3UDWA 2BOCB 2R2BA 3MLYL 3S4SG 1TITA 4CN6A 2WBXA 2V3FA 2OMYB 2V2TA 1O7DC 4L2YA 4NXSA 1T4KA 1KG0B 4D94A 4R96A 3ZU8A 4AKOA 4XX5A 3MV9E 1EUUA 1D3CA 2YKLH 1RVFL 3MFFA 3NP4A 3L2LA 4WDIB 5EB9A 1E9PB 2DQHL 3FUHA 4PLKC 3ECBA 3ZN6A 2XBDA 5EFIB 3MBED 2VL4A 1MY5A 1GRWA 2ED9A 4J3WA 3G5VA 5IB1A 3OC8A 3T6WA 5J1TC 2L3BA 1XH1A 2VRQA 1N3NB 3DJZA 5IJCC 1NGYB 2FJSA 3OQ3B 2C3VA 4ELME 4BV1A 4KK6D 3ARWA 3VXUA 3DXAD 2QBWA 3W11C 4AXWB 1BJMA 4OJYA 2R59A 5D7IA 5JW5B 2DDQH 4BFIB 1AQHA 4JCLA 1QW8A 4M48L 2E75C 3EXLA 1BYNA 1CZ8L 4RMVA 4TMPA 1QR1A 3HUJB 4QYAA 1T5XA 4FP8H 3I3DA 4PM1A 3CDCA 3Q8AA 2PP8A 1Q0EA 3H3PH 5FM5M 3S3BB 1PY0A 1A2YB 1X5ZA 5GS0C 3KXFB 1G1OA 2Q8AH 4Y1AE 5I26A 3D0AA 4PYGA 4PYHA 3MRDB 4LSRH 5J6HB 5KAQF 2EVHA 3UJTH 2CBQA 4HUWB 5EZOL 3N9GH 4LGPB 3BUYA 4CSZA 3KGRA 4N86A 4HKBB 1SJHB 3HAEB 3QFDB 2M2DA 4IMLB 2YIHA 1YJDC 3QQXA 5L7XH 1W0WB 4ZI8A 1MJUH 2J8HA 3W39B 1IGML 1S9XB 4HUKB 2EDOA 4D9RD 5EC2B 3DK0A 5F6IB 4HS6B 4LCYB 5KYXB 5T5NG 1ITCA 4XP1L 4CNIA 4XO8A 3DO4A 1JPTH 4AT6B 3OLIA 3GSQA 5F6IC 1SHXA 4W6XB 3G5YB 5TQ0H 2R29H 2TSBA 4MA3B 4AG4L 3VB8A 5I1EL 3U4AA 3ZPDA 5D7LA 3ARPA 1OAJA 1YUHB 5ALBL 5F8QC 4JKMA 4Z7QE 3QQ3A 4MA1B 1ECYA 5KVFE 1S4IA 2F5BH 2QQLH 3GZOA 4PWFA 5K1JA 3SDXA 4DCQA 1XZ0A 2DIEA 3L6FB 1CDGA 1ORSB 3IJ9A 3ZKMC 3OGCB 3P3RA 2HTKD 3PWPD 5C0AA 4JJ5B 4P5KB 3REWA 1JGUL 1OKEA 2FZ3B 3SPIA 4PWGA 2AAVA 4HH9B 4X8JA 2AKRA 3T77B 1YNTF 2BVQA 4BUQA 5C0ND 4C56E 2QR0A 3UTPD 3F12A 1CLOL 3GS7A 3S3PA 3RTQD 5BMFH 5IM7A 1XGYL 4LAQL 2X4OB 2WXOA 1WS8A 2GBVA 3FQUA 4LHUB 3BUPA 3CU7A 2W0FB 3QDGE 1E6JH 4N22A 1A3RH 1TCRA 4R4BB 4RZKA 2R7EB 3KH4A 5JIIA 3OKLA 4IRJA 5HHPB 3WKNA 5ILTL 1BAFH 4F92B 3ARDB 3EW3B 3IGUA 3TZVD 2VQ4A 3ZHFA 3ULUL 1G7MB 2VWEC 4XN4A 4A6YB 4XOAA 1JDAA 3AY2A 2NXYD 1V7NH 3T0AA 1UZ8A 4JFXA 4LPUA 1S5HB 2F5AL 2IV8A 3CXDL 1SXSA 2XZQL 5F7WC 4TUJB 5CJXC 5EUOE 4BH7B 3CFJB 2F68X 1LE5B 4JG1L 1HHIB 4EIZC 3FO1A 4UTBH 3LEXB 5IFJA 5IHWA 4KHXL 2F7RA 4AQOA 4DN4H 1CE6B 3KAAA 4GG6B 4OB5L 4FAAB 4HCFA 4GUOA 3WNKA 3K6FA 1N59B 2RH0A 4PV9B 3EOAB 5DO8A 2F58H 1RSFA 2FYYA 3U2SA 4CC0A 3BP7B 3IE9A 2FAUA 2TSAA 1SEBA 3N5AA 1ZEAL 2VDPB 2ID5A 5ISZD 1OQXA 1II4E 3Q3GB 2ZUXA 7PAZA 4AJYV 1ACZA 1VFBB 2MIZA 4JPKH 5HDLA 5SV3A 3VXMA 1NSNH 4Q6YA 5TDPB 4JCMA 1MH5A 1R5VB 4IEFA 1FZKB 2GAZA 5DO2D 4U0RB 5KOVC 1S7VA 1CG9B 3VMNA 2HRPL 4RMSA 1OCWL 1DCLA 2HRGA 4MZ3A 3DVNB 3NJLA 1U33A 3CK0H 2NYYD 3KXFE 4LPYA 3N43F 3N91A 4QCIB 5FGBA 4ORZC 4BFIA 1TYEB 1TQUA 5IEHA 2JXMB 5A6IA 1D2OA 2UV3A 1OPGH 5FW7A 1A6UL 3GT6A 5LWYL 2P5WB 3L3JB 1NEUA 4K0OA 5J57B 2A1WL 2EKSB 1KTDB 5FYJD 4YS4A 5C97A 4FFYA 2CKBA 3IPFA 2VGLM 2OW6A 3LN5A 2ATPB 1NEZG 3MTRA 3E6FA 3QNZA 1VLXA 1RKRA 2C3HA 2K6WA 2XBTA 4JHZA 3H42L 1S7WA 2ZCLL 4U1LB 4DZBA 1YY9C 2WXMA 4FX5A 5DC4B 4RQQA 4PTTB 3OMNB 3B9KD 5C7XL 4LLDA 4NC1E 4YMPA 5DJZB 4OI7A 4A39A 5C92A 2F1AA 3OHMB 4WFEE 1YN6A 2YXFA 3D4CA 1XR8A 3BAIA 4C47A 3QBTB 5EUKB 2MRYA 3HG1E 4IRSB 1N7MH 4FMVA 4WUUE 4QRBA 1T6BX 3RWIA 3BEVA 2R1YA 3IGKA 1RUKH 3KWVA 5CHNA 3OAZH 1P4BL 1U0QA 2V4LA 3QUXC 5HYSA 2CD0A 4OR1A 2NW2B 4I18A 3D5OF 3V9CA 3NIGF 3MACL 3NIFB 3RUGF 5A2FA 1N6UA 1MAJA 3F04A 1JNNH 1SPDA 2CUIA 4GAJH 1ZLVK 5I8CA 3PDDA 3TVMA 5B3NA 1FVDA 3LDBC 4WK2B 1DN2A 1GGBL 1HXYA 5LNEA 3VTMA 2EILB 2I7OA 3VNYA 4LESA 5LGJB 4ZPTB 4MAYB 5F1IB 2APBA 3MLSL 1J1XL 4M1DH 3US9A 4YHOH 1YPZA 1W15A 3K7UA 3FTGB 1X7SA 2BNQB 2G60H 2O5YL 2CHNA 3LPOA 5AUMB 5I1CL 2Q7YA 4WO0A 1NIFA 5GRJL 3N41B 2A9CA 4PGBA 1VFAA 3U9WA 3IXAA 4QJ3B 5HYJD 1WICA 2XWRA 1DJXA 5T5FH 2GUOB 4BZ1H 4G6KL 4FFVD 3K2IA 5LXGH 4PJIB 4YHNA 1P9MC 3TESA 3I6GB 5IHUL 3QCUH 1P84K 4OQ1A 3WY3A 5F9JB 3HFFA 4C55A 1ZANH 4V1DD 3S35L 1KXVC 4ZTOH 4H1LH 2MPVA 4N68A 1E67A 2F53E 1BZQK 1F86A 4QHKJ 5E8NB 3E9UA 4CW1A 2ZX6A 5LVEA 1Z3GH 3WHXB 3SGDH 1CT8A 4AUUA 4R84A 2DTSA 2A9NL 3QG7L 5GPRA 4CBPA 1LMIA 3ARFC 2HFTA 1KIRB 4F8PA 1NWOA 4PRBB 2B16A 3UTSD 5JQIB 3HKFA 2PWGA 1KPRA 5IBUB 5GRUL 1TZIA 2HJLB 5DRWB 2BPBA 5EEXA 2CUMA 5D2NC 2WXKA 1T7XA 2YXWA 3MNWA 4NIYE 2VUOA 1DR9A 3UPRA 3PP4H 2F54E 3BAXA 1MELA 2GBTA 4C83B 3H0TB 3IBOA 1KCRL 1W16A 4GRWB 2X4QA 1T5WB 5DC0A 5DYOA 4YN3A 1Z5LB 5ABAA 5I6KA 4ZK8A 4HJUA 5ISZE 5CLZA 4LRNH 5FPIA 4HCRA 4P5RA 5EZJA 1PSKH 4GSDH 4OLVH 5I71C 4ATTA 3KLKA 1IFRA 3FN0H 3TVMC 4L23A 1URLA 2DIBA 4HWZA 2F7PA 5J8OA 4U7MA 3O6MH 3ZO0A 3CLWA 4EI5B 1AR1D 3EBAA 1G9HA 3KXFD 2IGFL 3L1OL 1F3JB 5KS9E 5TGBB 3VX1A 3FCUB 3VD0A 2SODB 5D6CA 4LEOA 1HSBB 1WIOA 1D5ZB 2L7EA 1TUPA 2VJ8A 2W59A 1AGEB 2D3VA 5DHDA 3RWFB 1XF4A 3L9YA 4ZW8A 3MZGB 3CFDB 4XI5C 1HH9B 5ADOL 5C6WH 2CRZA 4YNYA 5E5MB 1XSKA 2HLAA 3WXVH 3B5HA 3UMNA 4AMWA 5AB2A 4OFDA 3V9EA 4QHLA 1NOLA 3RJOA 4OKVA 1QFUH 3OXRA 4PJXE 3TNNA 3AMLA 4GAGH 1VFUA 3VVWA 5L2JA 4S1SL 4X8CA 1IM9A 4GI6A 4M61A 5JMOC 2YC1B 1JVOA 2CLVA 5CJ5A 1S7UA 1TYJA 5DRZB 2IAMC 2NUPA 4Y4HB 2J5LC 3S0PA 4LL9A 5JXEC 2FX7L 2KKQA 4XP6L 5IW3A 1YMMA 3FH8A 5CU9A 4HC1H 3I02B 2NY5L 3HI1B 1GGIL 3CUPB 3ROLB 2YBRB 3P9WB 1R75A 3D30A 5I0YA 3C75A 2Z1PA 2FEDD 3KWWB 3OX8B 2EE3A 4FYQA 1O5DT 3WNOA 4F9PA 1F02I 2LLLA 1UURA 1U8MB 3DJSA 3P54A 2OYPA 1Z3RA 1P1VA 4CN4A 2WLLB 1MVFA 3D18A 3U46A 4OH2A 2XC8A 2QQQA 3F85A 3DX1A 4X5QA 1FFOA 1RQ5A 3F58L 3MCKA 4YHKH 4I3SH 4LSQH 3QJFB 2X89D 3BUIA 4P4KC 2OSYA 4TULL 4IKJA 5C2BH 3HC4L 1FFQA 3CFCL 2X7LB 3RFZA 2PWFA 3GLZA 5D93C 2JJUA 4NNPH 3SY0A 1NPJA 1T6VN 2GHZA 2P46B 5B1JC 3WS3A 1RZJH 3B3IB 1GCFA 4LSDA 1CD8A 4ZQKB 2IANA 1W6LA 2IFFH 2WTRA 5D4JA 3AXIA 5T1LB 1WQVT 4WU5A 1QLEL 1FUNA 3AITA 5LN8A 3RZCA 2I60L 5T1JA 4FTVD 1N19A 4K5PA 5F9OH 4E9YA 3WFHB 1UHVA 4UDUB 1J0JA 1D5RA 1AR1B 4AE1A 5G4MA 2OXHB 2UWEA 1ZDQA 4LPTA 2GY5A 3QXAA 5ESAA 4FLRA 3QZBA 2MSPA 4GFTB 2CBMA 2WY3B 2HJLA 3MNZB 1T7ZA 3HLKA 3NQKA 3L08A 3HVNA 3ZMNA 4LFHG 4LNVA 1JZ2A 2ICEB 3QIUB 3PHAA 4OIIL 3V5KB 3K6OA 4GW4A 5H37A 2VL5A 3ZZ1A 4HIPA 4OF7A 4KUCD 4ZSOB 5PAZA 3QT2A 1UENA 4NAQA 2NX5E 3BUTA 5DTFA 1EEYA 3FONA 2WTPA 4F33A 5DZJA 3FL7A 2QDVA 4L9LA 1PQZB 4Q2ZB 4QJ4B 4JMXA 1J1PL 1LO5A 2WCPA 4A04A 2YHGA 5GRVK 1X7QA 1PX4A 2P3YA 3RUGA 2YD8A 2J44A 3IETB 4HH8A 1P5VB 3CAFA 2XUWA 3AG2B 5EZIH 1ORSA 4DEPC 4J2XA 5DMIL 2W80C 5FFLA 1ORQB 4G8FB 3QJTB 3MCG1 4XXDB 1CS6A 4FDWA 1U8JA 1OM3H 3VW3L 2BNQA 4FGMA 3VGDA 1MNNA 4KXZI 2RHEA 5JW4Q 2EAEA 4KXAA 1QYGL 3IRCA 4CC1A 4J3OC 4QXGL 1CFNB 1H5BB 4MMZA 3AY4A 3BCDA 3O81A 1S9VB 3OV6A 4OZ4B 3VI4E 4GNKB 1BBDH 1HX0A 4MNHA 4U1HB 5BOZG 4Y2DB 1ZLWK 2JI3A 2OMWB 2WB1A 4ODXB 3VFVB 2V2WA 1QBLH 4MQ7B 4YE4L 4HKZA 1WE5A 1JXJA 3CG8A 3QARA 1WUZA 1P6WA 2J56A 3HRZB 4JRXE 3TA4D 2QPEB 3DETD 3ROLA 1J7VR 4IOIB 4NQDA 5C0DA 3RWIB 3CE1A 4GPVA 3K1KC 4BE5A 1EBPA 4G42B 1E65A 5F93C 2ZOUA 1AIFA 1YNLH 4ZO6A 5F21B 3ARBA 4W68A 3P0VL 4K5MA 1CLZH 2YA0A 1MG2C 1WG3A 3CZEA 1JYVA 4XN8A 4HFUH 1CLZL 3Q2VA 1XTMA 4U33A 2EE9A 2NY6D 3ZSTA 1SMAA 5EORL 2AXGA 4KTDL 4R90L 4QDGA 3WN5A 2F54D 4Y1TA 1UB6B 5J11C 3BFOA 1ZVHA 4X42A 1UWEL 2P26A 1E2WA 4KZCA 1AC6A 3WDIA 2F0CA 3RVVC 1SVBA 2ZXAA 1EX0A 4N25A 1AJ7H 1F45A 2MNWA 3NACH 3S3SA 4XO4A 5FO2A 5L6YH 3VO0A 3RWGA 5FS5A 4JR9H 5HHME 4PJBF 3IAGC 3DLQR 4YE4H 5DUML 4AQ8C 3DVNA 1IBHA 2CCWA 1XXDC 3MC0A 2APXA 2ITFA 3H2PA 5CO1A 1F58H 2H6OA 2R4RL 4POYA 3GUTB 2FSEB 2K3TA 4OD2B 1T4KB 4HUNB 3U9PH 1YEHL 2EXSA 1MCQA 4ZUWB 1OY3B 5IOPA 5KBKA 5C07E 2ALAA 5CN2A 3FNKA 4HIHA 3ZIMA 2QV2A 4B0MB 1A47A 3PLYA 1ZPLA 1U6AL 4L8DA 4FFYL 3LZRA 3AACA 4DAGH 4XGZB 3PRZA 4JS7A 4KROC 4QOKE 5GGVY 43CAA 3X11A 1MWAH 3ZHLA 1IE5A 1IEBA 1D5XB 1IC5H 5FF6A 4X9YA 5HGHA 3DX7A 3NEOA 3LPGA 4HWBH 1MCWM 4X6CA 5EOCL 3ETSA 3VD5A 3UJIL 3L4VA 2NDFA 1QLRB 3LDBB 1WS7A 3MA7A 4JAMB 1KIRA 4UU9A 5ANMB 4D9LH 5I5JA 4Z95L 2P80D 4LCWE 2DWYA 3TPUB 3HZMB 4KZEL 5FR3A 3FUNA 3QEQA 4GSUA 5T1DH 2WMPB 3LRSB 3CDZB 2Z93B 1B88A 2Y2TA 1EGJH 2X4PB 4IGBD 4QOKA 2B39A 5DUBA 4FEIA 5I6MA 1TMCB 4NM8H 4PJGE 1O0VA 5DVKA 5DGQA 3H0TA 5D2LB 1C08A 3O4OC 3IETA 4Y5YC 4GXUN 5ICXB 5SWZE 3Q5YA 4M1CC 1H8LA 1T3FB 3BGMA 1M7DA 1IUZA 1KN2L 4TVPL 3TJEL 2FO4B 4U6HB 3N43B 3NFNA 4K07A 5B1JA 4WI5A 5FB8A 2X0WA 4QRTB 2QLYA 4FQ2H 1HKLH 1FCCA 1T7YA 1XZ0B 1WK0A 3L6FA 2C1PB 4S1QL 3RIAK 3TIEA 1DQQA 4XNYH 3D0LA 4M5SA 3U0TA 3QQNA 3V5KA 3ALPA 1WA2X 4XP4L 1A9BB 1KBGL 5EBWA 4M8QB 1X9QA 2XN9B 1TTFA 3O9WA 3G6AB 4DGVH 3I6GA 4ZZFA 3FFCA 5D7JB 3FU7A 1ILUA 1JF5A 1IGIH 1UA7A 1CXIA 2J6WA 1YEJH 3OZ9L 5L0QC 1ZTXL 4M7KH 5IVZA 3PXLA 2NY4C 5F7MC 5DLMH 3L13A 1MI5A 1PZ5B 4TULH 5C2BL 1DDTA 1TPXB 1C8PA 1JNJA 5KBLA 4OIAA 1PD0A 4I3SL 4F91B 5E6SB 2ZZUT 4YR6B 5FECB 2OL3A 1HHHA 1F11B 2CHWA 3GSOA 1QACA 4JM2A 5DK2B 1HXMA 5GHWH 5ITFA 4W4NA 5BO1H 1AHWB 5IJDC 3ULUC 4HCIA 3A0OA 2DZEA 1GA2A 5D1QE 3UADA 2XA8L 1ODAA 1GKOA 4J27A 5LJYH 3FCTB 3QEQE 1RURH 2PO6C 4GIAA 4PJIF 1QUNA 3ILPB 4GQ9L 4GH7B 5BS0A 3S8GB 3O6FC 1KXQA 1EHNA 4ZFGL 5F7HA 4RGOH 4DZBB 3RWGB 2BP0B 2CPCA 1N5AA 3AU1A 3ZT6A 2HVBA 2FWLB 1Z9NA 5IT2L 5D1ZD 5DVLA 2XZCL 4P46D 1DSYA 1ZGLP 5DMGD 5FHAH 5HI5D 4IOSA 3BUDA 1E43A 1PZDA 4ZO7A 4AYFB 3QUYB 3B9EA 1P4UA 3EFOB 4Z7QF 4AITA 3D08A 5KVDL 1AQ8A 1WHPA 1BQHA 1BLNB 2FBJL 3S6CA 2ZXGA 3M17B 1OB1B 4KKBC 5DK0A 3QHFH 5HHMD 3RHWF 5MERA 3H9SD 3DO7A 1U92B 1P4LB 1KXHA 5EOQL 1MJJA 2WGNB 3UTSB 4WENB 4NBZB 4M03A 1QSED 1CG9A 4OV5B 1KDJA 1FYTB 1UADC 3EJZD 5T3ZH 1O7DE 1KN4L 1ND0B 1BZ9B 4LCWB 1KY7A 5AVXB 1CD0A 1FNFA 3IFNL 1BQLL 1RUPH 4IOIA 4R9HA 3SQBA 1E4KC 1RPQA 1G7PB 3DYPA 3CHPA 4B50A 3ZUCA 4HEPA 3VWJA 4G7VL 4JO2L 4JY4A 2FL5A 3L3JA 3WMQA 3GYRA 2J5WA 3K71B 3GXIA 3M1BA 4YO0A 3RA7L 5GS2H 2CCVA 1AQKH 1RFDL 1T21B 2E9GA 3WNIA 3L7FB 5F9AC 1ZRUA 3RWJA 3SDCD 2RQ8A 4H20H 4MJ6B 5IBLC 4A38A 4DEWA 1XO8A 3PDOA 1XB8A 5EZLB 3VMPA 3ATDA 5CLTA 3LNGA 1I82A 2C3WA 2LLGA 3UBXB 5HYFA 4OI8A 2EXYC 4LDCA 2P5WD 3BAKA 3B43A 2I60H 3TX4A 4AQAB 3PWVB 2OSLA 1TQBB 3ZYZA 3CNKA 3MRPA 5CIPH 3P69A 3EGXB 2Q0ZX 3L3IB 3QAZB 4Y5XA 3D33A 1X5LA 4PUBH 2AW2A 2DD8L 2QVIA 4K3JH 3VXNA 2WOBA 4HWUA 1DSFL 2VIRA 1F1DA 1GGIH 1CLCA 3FB6B 1AI1H 5SWZD 2FVNA 1UUNA 3KNBB 4X6FB 5KSUB 3SQBB 1OANA 1NGPH 3DA0A 1HWGB 1A1OB 2BSRB 3C2AL 3CX5J 4EKJA 5BW7A 1GYAA 5E4IA 3KPSD 5F3FA 4J3UA 5F88B 4L9DA 2LU5A 4B9PA 2DKMA 4LCCC 3VGAC 5J13C 2Z8VC 5I82A 4LHUD 3C6LA 3T0EE 4KBPA 2BIHA 1INDH 4DNLA 1HN1A 2EXWD 3QB7C 4YHYB 4GG6F 2BVUA 5C0RL 3LH2L 5BZWA 3GINA 4D8PA 3V4VL 3DI3B 3EDFA 1QZNA 3G5WA 5IW1A 2EIZA 3HZMA 4BSJA 3KMDA 2IAMD 2VN4A 5KVMC 1M7UA 4NQSA 3MA7B 4JAMA 2VLRD 3T8XA 4YDJA 4JZJC 4OCSL 5TDNA 3W82A 3GMQB 4YDLB 2I9TB 3RHWK 4WF7A 5I5MA 3RX5A 1J86A 2HUEA 2J6EA 3PHSA 4KV5E 2ESVB 5IBUG 5K9JL 4N1EA 4NZJA 4H40A 1J1OH 2XQYK 5CSZB 4RBPK 3RIAF 3VH8G 2F74A 4EI0A 2DQIH 2Z34A 1CJYA 3UTTD 3QORC 4WI6A 1PEZA 4WNQA 4MXWH 4QRFA 2WQUA 3QR2A 4N2HA 1A3LL 4OFIA 4NS0A 4BFJA 3F7YA 4V2CB 2P4AB 4NO2A 4G42A 4OLWL 3PWVA 1RIHH 2Y24A 4JY6A 2Y1AA 3UG5A 5KSVA 2GC4C 2HKFH 1Q0XL 1ZHKB 3VCLA 2BOCA 2DOCA 3QPQD 1E90A 5I15L 4UNTA 1CXFA 2NYKA 3SGDI 4G5AA 4IBWA 3L1OH 4B9FA 2JLLA 5DD1L 4WJG3 1NBVH 4MJIA 1AYRA 1BQSA 2QZ5A 1MIEL 1EFQA 5DQDH 4L05A 4NUJA 4KKAC 2JKXA 1HXYB 4FXLA 3UZEC 3ZHDA 4OZIB 3O9WB 3C9NA 3QUXB 4GEIA 2VXSL 5LCVH 5EBWB 2NNCA 1ZHBA 5DD3L 2N59A 3D2UA 4UINH 5J6SA 4HK3J 4BK4A 3CU1A 2BSCA 3RURA 2Q2LA 4XMXA 1D6VL 4YSTA 5BW7C 2QFRA 4YR6A 1T5XB 4EOWL 3OF6A 3QJUB 1OAXH 1D7BA 4JE4B 1I9RH 3TBBA 3ZKXB 3DURB 1YQVL 1U8LB 1TQCB 4J5VA 3GSUA 5MENB 5DMJB 1THCA 2WN3A 2HMIC 1MZYA 1OSEA 4FN0A 4MZRA 4UIMB 5DHVB 5EIQA 3U79A 2A9NH 3IDUA 3C8KB 2RJMA 1OWRM 1FVEA 1ASPA 2VUKA 1AE6H 1J05B 5I19H 4DO4A 3HIZA 4HWNA 2DM4A 3UIYA 1EHLH 1XZWA 1DBML 4LOEA 1GR7A 2Y7NA 1HEHC 4FQXA 5IVXA 3VG0H 1RUQL 4G43A 2C8NA 3D69A 3MJ9H 1S9YA 4O02A 5IJVB 1OGPA 3M86A 1AIZA 4JX0A 2HPTA 3E9TA 4Q9RH 1RUQH 3FB8B 4KROB 4CMMA 1S3KH 4O2FA 4ZDHA 2P49B 3S36H 5B4MD 1SJEB 4BWUA 1JGDB 1RZPA 3RGHA 3NAAL 2OMVA 4I5BB 4JG1H 5T33L 4I9XA 2G5BA 2I85A 1UOLA 5GRJH 2JIXA 3VFTB 2R8SL 5D2LA 1DO5A 3C60D 5I1CH 5LB1A 1GYVA 2A3TA 2YLHA 4J23A 5DDHB 5I23A 1BXUA 3ZE2E 2VLJB 4YGVA 3NH7L 3WV0A 1KYDA 3ZDZF 5CD3B 1BZ7A 4N90E 4G5ZL 1IGCH 3EYQD 3TT1H 3VDAA 3Q8FA 5JXAH 3BHBA 1RY7B 2H9GB 2EUZA 1U93A 3HZKB 1KENH 5CZRA 4UM9B 3EH5B 2OXGA 3LMJH 4X0KB 3KPRA 2O61A 2E7MA 3P3TA 5L4MA 4J8RB 4NJAL 3ZDXF 4OD2A 5CJOH 2R23B 4HKXB 2YPLB 2DJUA 5I6LA 5CUSL 3KL5A 2ALWA 3NOIA 4PY7A 1JRHL 3HC3H 2X7LA 5HDOA 4DO6A 3OXSA 4K2UL 5D1ZI 1O75A 3V4UL 3MLVL 4CBZA 3HI5H 1P4BH 5D4IA 3HMXA 1U4FA 3JVGA 1XGPA 5EPMB 4DKFH 2QGEA 4YHPA 5DJDB 2W8CA 2ZG1A 4Q9CA 5I1HL 1J8HE 3Q8CA 4IM8A 3OZKA 1GZPB 5F96H 3TH4T 4FJYA 1WEJL 2FT6A 2LGNA 1K9TA 1B4TA 3V0JA 3D39A 2EC8A 3JTBA 1XF3B 5F0JB 2Q6WB 3SKJH 1WAAA 1YEKH 1YEIH 1L7TH 2V17H 2OP4H 4OCRL 4L3CB 5I76B 2APWA 3IAQA 5KSUA 2FIKB 3ULVE 3QEQB 3UTPE 2E7CA 3TPUA 3ERXA 1JPSL 3PGCA 5D96B 4H8WC 2K3HA 1EANA 2ICEA 4Q97A 3ETBF 4XVUC 4QO1B 3VFNB 2NY0B 4UZGA 4FQHB 1BJ8A 4NENA 2FJFB 4O4YH 4QRUA 4YHMH 4JO2H 4HOMA 4X80L 3ULSA 5DK3A 5EZOH 4MSWA 3MBWA 1SM3H 4JN1H 5CEYB 4UT6H 5A6LA 1JZGA 4UQ9A 1EQWA 2HRPH 2YD2A 5KAQG 5AVQB 2IPKB 1KPUA 1V7NL 3NCYP 1VA9A 2C7UA 1BVKB 3AS1A 2QSTA 4NO0B 3OMIB 4C4KT 3H2WA 3BWZA 1Q90A 3IWVA 5IHBA 1HCZA 2ZX7A 3BP4A 3TBSB 4C8XA 4HSCX 1ML0A 4D0DA 2AP2A 2H4EA 4HJGA 1DTUA 3T0VA 4AYGA 5ICZA 1XB3A 2IWGA 2K7QA 3N50A 4P23A 1A3RL 2BC4A 2FJFA 3LNIA 3HI6L 2QJDA 1XGYH 4Y9CA 4M62L 3N6YA 3VTTA 3EYSL 2WZ6A 3DVFA 7PCYA 4MXQD 3HJEA 4N8VB 1FBIH 4BELD 5EZJB 3NBNA 4PRIA 3QFJE 2DWTA 4PJFA 4PS8A 5SWSA 2XZQH 1SY6H 4Y2DA 1BVKA 2RFXB 1J5DA 3C87A 4HK0B 4XNZB 1VHPA 4ZXBD 5KS9B 2CRMA 5BJTB 5C0NC 3CZNA 4XN1A 4MDJB 43C9A 2VDLB 1SY6L 5FW8A 3A6CL 4DPCX 2FQFA 5E99L 4G11A 4Z1PA 5HHXH 3QAQA 2CXKA 4PB0H 2XRAL 2YS4A 2WUCH 3T0EB 4F8OA 5CEZL 3T0ED 4ADIA 4G6FD 4EDWH 1H3TA 3KBHE 3QIUA 3WEAA 4YFLI 5HYEA 1CLOH 4RISL 4M7LH 3VM5A 3ME0A 4BRJA 1ZLDA 4H8UA 4WTZA 4KDTC 2NY3B 2VQUA 2J6EH 3Q1SH 2J73A 1SBBA 4EXPX 2Z91A 2N1TE 1KG0A 1DL7L 3NIDE 5L2JB 4WI0B 4BQ9A 3B7UX 1XAKA 5CJXA 1JNLH 1WZAA 2EIMB 5KTEH 1R3JA 4ZSOE 5FYKD 2V2TB 1F0LA 1TJHL 4R7NA 4KO6A 2R15A 3W38A 1DN0B 1V55B 2WAQA 5IB2A 1A1NB 2WXLA 4TNVK 3CSFA 3ARRA 1TJHH 4GW4B 3GMRB 4QLWA 2PR4L 4F2MA 2AV7B 2VISA 4JPWH 4XMLH 4XMKL 3TO2A 1Q72H 3T3MF 2VR7A 3LEXA 5AVVB 5E99H 4ONGH 4HDIA 4P9ML 5JPMC 3V6FB 1KCUH 5DZPA 1HHKB 1JGLH 2XV2A 1UJ3A 2W65B 3BKML 4N0YH 1BXXA 1QFWI 5IMKB 2CK0L 4GT7A 5D1XB 3D18B 3U46B 1PNCA 1S9YB 3HE6C 5AW1B 3ZDXB 1CF1A 5INCB 1OT1A 1NGZA 1AKJB 3GDCA 4PRAB 2W60B 1CT8B 1VRSA 3N9GL 3NK4A 4FQXB 3ZOAA 5GGUB 4ZMXA 1MREL 3OKLB 3ZE0E 5I8CB 3MODL 2FIKA 2BNRB 1E7VA 2OLDA 1CL7I 1GJUA 2IWFA 2JQMA 4I0PD 3CFKB 3DSNB 3U1SL 1JP5A 5CMAB 4G2AA 5IFHL 3S88L 5DA4A 3THMH 1I3UA 4GBXC 1E5UI 2ZKHL 1WISA 3MGOB 4OSUL 3VXSA 1N8OE 2NY1B 3Q0HA 3X3GH 3CZGA 3WDHA 4J3OF 5I1JH 4JREB 4DK6A 3IDGA 4N9GB 5TF1H 2K45A 2QSQA 5DS2A 5CM1A 6FABH 4FQPA 2PR4H 2Y06H 4OZGF 3MREB 3IDXH 4M61B 3AAZB 5C07B 2L04A 1J8HA 2UXFA 4ODUA 1I7ZA 4R7VA 2WAHA 4DKEH 1PZUB 3O8XC 1CGWA 1MCHA 2JCCF 2VDOH 3Q5OA 4WZ9A 2Y23A 4NKOA 4MNGA 4X7TB 2FTAA 1TTCA 4NQVA 2EE2A 5I16B 2YPLA 5K1NA 4N2BA 1OP9A 1KGXA 1ANUA 2WANA 3QUXA 4NB7A 3RWEB 4DP0X 2CO1A 8FABA 4GXFA 2DQGL 5CP3A 3AT8A 4XPGL 3BAWA 3CIAA 3MROA 1AGEA 2AEIT 2RB8A 4JFEA 1PF3A 5BOPA 5D6CB 2ZF9A 3Q6FB 1J8RA 3F5WB 1UH2A 4RFEB 2X3BA 4KK5C 2Y6SD 2DLGA 4M8VA 4QGYA 5E70A 4AYID 5AOIA 4DTGL 3STBA 3G5XB 4JFTA 5TFSL 4EN3C 4DVBB 2EO9A 2AJXL 1AZUA 1R5WA 5LGHH 3K46A 3EAKA 4M6ML 4GG6E 1BVZA 4HUWA 2IF7A 1PLGL 3ESNA 4RAUB 5FWRA 2VTFA 3IMVA 2GSIB 4L4VA 4LQFH 3SD2A 4LU5H 3TF4A 4R26H 5DHMC 5AAPA 3FQ2A 4UTBA 4NNXA 4RDQF 4XO5A 4XWOC 2XICA 4ZPTA 5DYOB 3ML8A 1HWWA 4RWYH 2V3DA 3PL6C 4NN6B 4FJZA 4Y9EA 3HG1A 1OP5K 4MMXA 5LUMA 2XQBH 1IARB 3ULSB 2F54B 2ZNWA 4GI8A 1S9WA 1YQVH 2QMKA 1E0OB 4KZEH 4MLIA 2X2HA 1L7IL 4H88H 1BWWA 2CDGA 4RA3A 3R7QA 4UQIM 1X5XA 3CQFA 5CZVH 4AV5A 3C6EA 3PE9A 1FRGL 3U0PB 3QDJD 5FDYA 3VG9B 2YGVA 5HI3D 2VZSA 1AXSA 4OLZH 2VLRB 3L7EA 5D7KE 1HYSC 5AWNH 2XZAH 4P59H 1NICA 5HY9B 3K5SA 1NGWB 1Z9SB 3LHPH 1GMEA 1NJ9A 1WWCA 4HUCA 3F12B 4KKCC 4RGNE 3ZRSA 3SDCA 2UVEA 4GINA 2GI0A 5CP7A 3WBDA 3V5DA 1ZT1B 3S36L 4HD9A 5D7JD 4KJPC 1JPFB 2CBOA 4JPQA 1KPRB 4Q9RL 4OCXH 4KMTH 2NXYB 1T66C 1UM4L 2N4IA 3B4NA 2P5WA 3L81A 4N0UE 1S7RA 3SOTA 1DBBH 5JYLA 4AQEA 3LXCA 2OJZH 3NZUA 4ALAL 2AERT 4FI7A 5DQ9A 3OXSB 3EGXA 3K0YA 5BRQA 4D0DB 4FXGB 4R7DB 1KV3A 3UH8A 3RJDA 1KLGA 1YEIL 2G3MA 2K9UA 3QIBC 1LP9B 3BKCH 5L6YL 5BVPH 1MFAH 3RPKA 2NLJA 3I50H 5GS0L 3RVXD 3U2IA 5F9JA 3EOYG 1AGFB 2XPGB 2XN2A 3FXIC 1YYLH 4JRXD 5E2TH 5GGVH 1WFTA 3JWDH 4QEGA 3B2DC 1G7MA 5HHQB 1MUJB 4PLJD 3GB7A 3MRKB 3QZWA 3T65B 3JUZA 4FCHA 4B97A 3IM1A 1VGEL 5IVOA 4NM4L 2RTTA 2YAEA 3SODB 2PW1B 3M46A 5IMMA 1FIEA 1SHWA 3HI5L 1QHPA 3M1BB 4X4XB 3UTQA 1IC7L 4JY4B 1ZVYA 4TSAL 1JG9A 1KLUA 1FZJB 3PL6A 3NSJA 4ACTA 2DLFH 1EEUA 1N2RA 1NAKH 1LD9A 1TZIB 1QLFB 1M9SA 1XGRB 2VM9A 3SGJA 4L0ZA 4PIRF 3EFDL 2P8PA 1A6TA 3MSPA 3X12A 4X7FC 5JXED 3TO4C 2XVKA 4BFKA 4TNEA 4HPYL 5F6HJ 9PCYA 3VQMA 3S2CA 3RTQB 5K33A 2COVD 1MPAH 3VACA 5EU4B 1P6FA 4I9WD 2C9QA 2OI9B 2V0AA 2YFOA 2IDTA 4HJJH 4WUKL 1FG2A 5DD1H 5C1MB 2H2SD 5BOJA 4MKMA 5LCVL 3UTTA 2WVTA 2RACA 4F37F 3F62A 3SKOB 4P2OB 1LEIB 5T33H 5IKCB 1TJGH 3WFZA 3BZ5A 1MCFA 1IRAY 4FFWC 1A1OA 2BSRA 1PNDA 3LXAA 4KTYA 4QD2E 2NZ9C 5FLUA 1RU9L 3RDTB 3QXAB 3WCYA 4K9EH 1OM3L 3SDAA 3P0YH 2DMCA 3V0IA 3TNMB 2K1MA 4ICXA 2P5PA 3OGCA 3RX7A 1HSAB 1CQYA 4D0BA 2D9QB 3V10A 3QUKA 1P9MA 3WNMA 1UEMA 5BZDA 1J0KA 1GGYA 5E1QA 4X4ZA 3A6BH 2KUTA 3D2UB 1NIDA 3TV3L 3HE7A 3EH4B 1I1CA 4RA0C 1V8HA 3BPOB 2BJMH 5GSVA 3QPXH 3UBFA 3FT3B 1AQKL 4LPXA 4XP5H 4JHBA 1GTNA 3GNMH 1DLFH 1VJSA 3DBSA 3MRLA 5JUEH 1R3HA 2JB5H 4NQQA 4QKXB 1BX2A 4ABUA 2NY4B 4XNQA 1BEYL 3QDHA 1ACYH 3AT0A 3U4EA 3MBEB 2QT6A 4FTVE 2IOOA 3GXPA 4O2FB 3K1DA 4M93C 3N3EA 4YK4C 3RGVD 2DPKA 4G83A 3VXUB 2IH9A 3JZ7A 3QUYD 1UZ8B 4JFXB 4PHXA 4HKBA 3IRZA 5IHLB 1G7PA 2JJTC 4A6YA 2F19L 5JW4R 2VR8A 3OX8A 5A7EA 4PGZA 1XEDA 3I3EA 1NC4B 1WH0A 4PLNC 1YMHA 4K8RH 1KYOK 4MDRA 3V5HA 1TVBA 2C7FA 4L3ED 3QUKB 3EOAA 3U2SB 3VE0B 3ARTA 1BDYA 3LNEA 4WW1B 4R0LB 3S2AA 3TZVB 1B0WA 2Y5TB 1T2QH 3SGEI 2WVVB 1DO6A 4FZEL 4LCWD 4MMYB 5D1XC 4YQXL 2E76C 1A3ZA 4EE2A 1KBKA 1XGQB 4G1MA 3DYMA 2IFFL 2BY3A 5I0DA 2JLPA 4UQ3B 3O2WH 1FJ1B 1HAWA 4MBRA 2XTSA 3ROOB 3VYOA 1C08B 2QV4A 1OO2A 3VI3F 2Z3FA 1E9QB 4Z7WE 3WIAA 1B6DA 2Z7WA 2B1OA 5I1IH 1AOHA 4KDWA 5BZWB 2CDFA 2FATL 4QHPA 3HC4H 1ZHBB 4BJLA 2CNZA 5EO1B 1IM3A 1VCAA 2YAQA 1JVKA 2NY0D 4HUVA 3VFUB 2APVA 5GZOC 2WQSA 3HN5A 1INQA 5F3BA 4UTAH 2WCGA 3WS6C 3O3EA 3BWSA 4PBWD 1TJXA 2GVYA 5H4ZA 1I1AA 2PCPB 4BK8A 1LK3H 2F53A 4NQCD 1P7QA 3MRJA 4AEEA 1WCQA 3SQOH 5EU6E 4XC1L 4N2CA 1LD9B 3PHQB 1DANU 3AQYA 3FFCE 3DROA 4YVNA 5ECJE 4U1IA 1PZSA 4S2SB 2BY1A 4MVBC 3EGSA 1IAKB 1RHFA 2C9UA 2X28A 3CPLB 3MO1A 4BQ6A 2MTAA 4CMHB 4GG6A 2F1BA 5HDBE 4X5RA 2VXTL 3EIFA 5B1AB 2AC0A 1FFPA 2PETA 1FSKC 2CM5A 4PG2C 1ZJBA 3LEYH 2FBJH 2H5UA 2WD0A 2SEBA 3MJ7A 4AK2A 1QVOB 1NMBL 3MKKA 4TSCH 1A2YA 2YQ2A 2RCSH 3EG9A 3EYFA 3NK3A 4F2ME 1LP9A 3BQUC 1FFTB 1S46A 1KN2H 2H32H 4ORGA 1F6AB 2QKIB 1NUNB 3WXVL 2WLHA 2IG2H 2QEJA 4FXGA 4R7DA 4I8DA 4H13C 4RGOL 5C0BB 4ZX3A 4OZFG 4IOFD 3CFEB 2WNXA 5AW4B 5FHAL 4F7TB 2ITDB 3CMGA 2Q8BH 5E9DB 5C8JA 4HJIA 4N0FB 3B9KC 1TQSA 1KGJA 5ICYB 5MHSD 4Y1AB 1TLKA 3K91A 3PV6B 4WFHE 2ZUVA 4NRYA 3CDGA 2VXQH 3S5LG 3IDIB 5J89A 2DWXA 4YHOL 4BH8A 5TE4H 3EG9B 1JZDC 3EYFB 4PV8A 2VZTA 5FKPA 2VLKB 1DE4A 4YSSA 3NSCA 4L18A 1PD6A 2BP8A 3S5ZA 3TS8A 1MFAL 1CCZA 1A8JH 4P07A 2SEBB 3MV9B 1TTAA 1N2RB 1OB1A 4HWBL 3QO0A 2VC2H 2HA1A 1H3PH 3MACH 2C4FU 4F7TA 4R3SB 1VZHA 3GJEA 3AG3B 2AXFA 2PTVA 5B1CA 5ACLA 3RVXC 3O6FD 4ODVL 4M8UA 3IYLW 3NPSC 3IFNH 1B0RA 1U58A 1LEKB 5EBMA 1MFVA 4U1SA 1ASQA 1YMME 1F3DJ 5EO9B 1Z66A 4AGMA 1TFHA 2XBZA 2VR3A 2JH2A 4IU3B 3V0WL 4FQ1H 4CU6A 5EO0A 3NIDB 5KZCD 3IKKA 3DUHA 3SZ6A 4U6TA 4PBXA 3TJPA 4L9LC 1FYTD 2NW2A 1M05B 4IIQA 1UXWA 4NO0D 1WBZB 4WI8A 3KPQA 3CFNA 2YPVH 3S96B 4YSUA 3SGKA 2XVGA 2I07B 4U6YB 3C5JB 3ROOA 2FWOA 1S3RA 3G04B 3MA9L 3KPSE 5FOBB 1T0OA 1EZUA 3B6SA 3OLGA 5JW4N 4NWTH 4YXHL 4LLUB 3SDAC 3TWCH 3MYJB 1BZ9A 3A4DA 1A6AB 3VJ6B 3ZTCC 5KVEH 4QY8B 4GQ9H 2XQYA 1MW0A 4JFQB 4TSAH 2MKWA 1OCWH 1H5BA 2VNCA 3DIVA 3HE6B 3FTSA 3OKDB 1LEGA 4OAWA 1VGEH 1ILSA 3HNVH 5GISL 2N3JA 5CZXC 2P43B 3RDTA 5EFIA 1LO2H 2BIIA 1H19A 3QSKB 3PIQA 1KT2B 2GW5A 4N6RA 5EWIL 3ZLQC 5IR1A 1NQBA 5E03A 2Y3AA 3V52H 4FERA 5E2WL 4F1ZA 3FTUA 5J9PA 2BNUA 1ZSDB 3WLBA 4AVIA 1V3LA 4TQPA 2MJWA 4XHJD 1N10A 4MDIB 3Q01A 3CIQA 1CGVA 4PVNA 2F54A 4J3SA 3L54A 3H9SE 1QBLL 3TEWA 3BPNC 1QFOA 3ZT7A 1BFSA 1A7OL 1CK0H 3GRWH 1XMEB 4HKJA 1YC8A 2P28B 4EKXA 1BBJB 5AKTA 1G84A 4XP4H 2DQGH 5HYJB 5E00B 3V0AC 5FLVA 1J18A 4F7MA 4D9RE 3LIUA 3SDDD 2HH0L 4GUPA 1GSMA 4QRSB 3DHMA 4B9JA 1ONQA 5CGBA 3CLEL 3DX8A 3PWUA 1IGYB 2DYPA 4QHMA 2N7SA 3H7BB 4LL1A 5INCA 3L3DA 3CZFB 1EO8L 5AKRA 1T0NB 3WFDH 3TJEH 4K7FA 2ZKYA 3QXUA 4MMZC 4LAQH 4KQ4L 4PW3A 1MI5B 1PZ5A 3FCSB 1SYSA 1QWHA 5D1QD 1LE5A 4KNQA 1YEDA 4BZ1A 2VRKA 2AFNA 3D9AL 2LR4A 1P1ZB 4G6JH 4P2OA 2HTLD 4U3SA 1CI3M 2E27L 4OVUA 4WEUD 1JWUB 2AV1B 4X7EC 2VSMB 4NQVB 1IGYA 3VNZA 3D0LB 5MHSE 4LOUC 2VERA 3SOBL 4JPIB 5GZOA 3FQUB 2ZUUA 4K3DH 2A83B 4D0BB 5AAMC 1CXEA 3CN0A 3T2OA 1T0PB 1QASA 4M93B 3H6JA 1HNGA 4IDJH 2VABA 4X9IA 2CK0H 3QDGD 2BNQD 4PLKD 2CG9X 1VCBC 4F8NA 4ZUUA 1FDLL 3BEWB 4LQFL 4DGWC 5T1LD 3RDTC 3BH8A 3UTQB 1FFNA 3UGUA 4L5FH 5F7NC 4DEUA 3DHPA 1I85C 3MNVB 1R1CA 3TT3H 3D2TA 4JKLA 3TNNB 1QYGH 5EU5B 4J3BA 1I8MA 2G3XA 1F4YH 3EBIA 3AQDA 4PU2A 4NN7B 2BNRA 1T89C 2WYHA 3VGFA 3LHPL 1S2EA 2OI9C 4XMPL 5L2KE 3MV11 3STZA 1Q0YH 3LPWA 1WCBB 3MRNB 4WFFE 4QXGH 1F18A 5B7MA 2MWCA 3P9LA 3RQ3A 1PMYA 3DBXB 3QORB 1WBYB 1S9WB 2FWSA 1JK8B 4MJJA 5HJBA 4BBWA 1J1PH 2IH1B 3TH2T 3BN9C 4BE6A 3S5LA 4ETQB 3O9WD 4EI6A 5FYJU 2Q76B 1DANT 2R56L 5AOMA 5E1AB 1EHXA 3B9KA 5DFAA 3L5XL 4U1GB 1YNKH 2Z35B 4UQ2A 3NTCH 1U8IB 4WWPA 5KUMA 1F90L 2NT1A 1Q9WB 2DTML 3CHRA 3FO9A 2X41A 1CGYA 1R6VA 4CSPA 4O51B 2X4QB 2H0JA 1DJSA 3FDWA 4IHOA 4C83A 1L9OA 3CTTA 2FNWA 1F4AA 2Z1KA 4KOBA 4HC1L 2QQLL 4RFOH 4TVPE 1VADB 2J72A 3MODH 1SOSA 1DQDL 2VQTA 4AQ1B 3PV7A 3OKNB 4FC3E 2EABA 3WFBH 3PAVA 4R5XA 1EHAA 1HQ4A 1KCVH 5LN4A 4Q14A 2C4XA 3TH3T 4TNWF 4IS6B 4OBSA 4Z0BH 4FLOA 4NRXA 1QLEH 4A2GA 1VB9A 1SDDA 1CL7L 2VLLA 5TDOA 2E6JA 1PY4A 4IOSD 1IB5A 1U2CA 5E0QA 3HHSB 1NH6A 2KL6A 3DETC 2IGLA 3QK0A 1A9EB 4Q4IA 3LXUX 2DICA 2R9HD 4XP9L 4QHLB 2BRRL 5F9OL 3BH8B 1Q9WA 2BSTB 4XPHL 3EJQA 4OZFB 1GZPA 2VMJA 1NC2B 3ABGA 4KKPA 1MFDH 4Y89A 5EZIL 4G7YH 4KFZC 2ADYA 1NTDA 3N04A 2YMOA 1RZJC 5K1VA 3RY6C 4UOZA 1H3PL 2VUYA 5FUOL 1CVSC 3F7VB 2P1YA 4NHUA 4X5WA 1FC2D 1RP9A 2OCJA 3OAZK 4FNLH 2I24N 4I2XE 1M3JA 3GEFA 4WO4A 4LRNL 4CRPA 1FNEB 5B38G 1EZVY 1JZIA 5ISZB 4KK9D 1FL3A 2AEQH 2ZOKA 2CO7B 2OP4L 4LBEB 4PBDA 2G4EA 3BP5A 3VRJA 5DJXA 4ZO8A 4PI2A 1UT9A 5IB4B 2ICES 3VRIB 4UAOB 1JUFB 2EDRA 1HCVA 1KJMA 5DUPH 2XFXB 4OFYD 1F6LL 2WZAA 4BZ2L 1NCWH 3FQNB 4A7SA 1DVYA 2PPAA 3D1MC 2HJKB 5BXFB 4KNTA 1UKSA 1ZLSH 2AEOA 4AYEC 1G9EA 4FXKA 3VRLE 4QHMB 3SY0B 2VT0A 4K9JA 3GSXA 4XNAA 4KXDA 5HGGS 2R2EB 3RFZB 3O4LB 4N0CD 5EC1B 5D5MB 4PP1D 4YE0A 4ZDHB 2F19H 4BWWA 2CO4A 3HCVB 4M56A 1P7QB 1YAZA 4EN3B 3NCCB 3STZB 1PVHA 5CJOL 4UI2A 3IDJA 1NCDL 5B39B 1CD1A 5FGBC 3RE0A 4RFNB 3H9YA 3DPBA 3W0WB 1XGTA 2FT7A 5E8NA 5J06A 1V10A 2WXIA 4PJIE 3DMMD 4WKZB 4DP4X 2D2CC 3SBWA 3KYKL 4RZCA 5HHNB 3QUZC 4JQIA 4O4YL 5IV2A 3FCGA 3V6ZA 3HPJB 1ETA1 1FE8L 4TNWK 4YXKL 1AQDA 3ISYA 2R8SH 1JTTA 4U0RC 4URTB 2F2HA 4OCYL 3FTWA 1UKTA 5I0WA 1KWGA 1YEKL 1B3JA 3D09A 1DJHA 1R4XA 5DJCB 2ZSWA 2OZ4H 1T03H 2GJ6D 1F4XH 2N01B 1R5VA 2VMDA 3MUGA 2XX0A 4RH4A 3DXAE 4HSAC 2XG4B 4PG9B 4ZOCA 4BZ2A 1NBQA 1IKOP 1E3ZA 3II2A 3PNWB 1TR7A 4WV1C 3M88A 1MW1A 4OZHE 2B1AH 4KRNA 4PRID 5C0BE 5SWSD 2J8OA 4MA7L 1N68A 3JV4B 3GGWA 1E4XL 1JGDA 3EZJB 4CVXB 1MPAL 1WEJH 1CI5A 5FKAB 3AU0A 1NZRA 5CCHE 2VZVA 4Y2LA 1DJGA 1DJWA 2AV7A 2VISB 5E6YA 3UZVB 5HVHC 4GW1A 2CJSA 4NFCA 3WLBB 3V79C 3LCYA 4S1DC 3APDA 1GYWA 2BXZA 1T89A 2VWEE 2WKLA 4FXKC 4G6KH 3VXUD 5HYIA 1F2XK 4DESA 1YEFH 1N0LA 3RWDB 2H32B 1YN6B 5CUSH 5DJ0B 3TN0D 3TONA 4Z76B 1TQBC 3N41F 3SYPA 3APMA 4QXWA 5E8DH 4Z78A 2NR6D 1B0IA 3PGDB 3T3PE 2Z91B 3FUJA 4ZMQA 3QQDB 4UT6L 1WUNT 3EZ8A 4NEHB 3HS0A 3L3OC 3MGAA 4D8OA 1G43A 5DZAA 4MCYB 2Z92B 4TQIA 2CJUL 5C0IB 3AXLB 5HD8C 3CFTA 4D7PA 1S3KL 1U3NA 4OUUB 2JB5L 3VXPB 2A6KA 2NX5D 1DLFL 5FOBA 2H3NA 3V0DA 2ORBH 1NFIA 4L4TE 1J9CT 3VWKC 1QQDA 4YIQA 2EIZB 2YD1A 4YNYB 1M6OA 5E5MA 1TCMA 3BPCA 4JO5A 5IK3A 3O3DB 3D51A 1J1XH 4FFWD 3C9NB 1M2OA 3LXBA 4CUCA 4MXWL 2WYIA 5A2IH 4U3SB 4XB3A 4P2CG 1T04A 3UBXI 1MVUA 3WENA 2VAAA 3H9HA 1XX9C 2EDQA 4M7ZC 5C0BA 3O3AB 5JNYA 2ZCZA 3O4LA 1HL9A 2YEQA 2JF1A 3NRQA 2DLHA 2HT4D 3GZPA 3QG7H 2DYSB 4XNXH 1SZNA 3WIFA 4ZX6A 2AK4B 3LNFA 4L4JA 1NAMA 2FGZA 2EDYA 1H6EA 5SWQB 5FYLH 4WI4A 1FAIL 1JRHH 4MZIA 4PGDB 3FT1A 4W6YB 4Y4FC 3LY6A 1FGNL 2G3NA 1BAGA 2JB6A 1LK2A 3S35H 3VFOB 3X1NA 2ARJB 4MD0A 4YBLB 1S5HA 1KPUB 4Q0XH 1DJZA 1CN4A 2OZ4L 4X5XB 5HYJA 1WWWX 5AW9B 4DZ8B 3OAWA 4UNVA 1EA9C 3Q43A 2R83A 1F1AA 2DM3A 4WNJA 4TL5A 3WKYA 5TE7L 3WIHH 1YN7A 3MDJA 5DD3H 1HL5A 1SJEA 4RMTA 5D5MF 3QEQD 1FV1A 4P57A 1MCOH 4PFEA 2EE0A 2YQBA 3GJFK 4I4WA 2JTYA 5KBMA 3VGGA 5LXVA 2GJRA 2WNWA 3L9RB 5FO7B 5C6TL 2AJSH 6PCYA 1ZGLM 4FEMA 4ISVB 4P3DB 3ARGA 4RFNC 4NJ9L 5DZ9A 3LB6C 4FULA 1OW0A 2O5XH 3LKRA 5GGVL 1A3LH 3QXWA 2F58L 1G4MA 1S7QB 4GKNB 2NPLX 3QJOA 1G9NC 5ESQB 5EIIG 2PWHA 1JNNL 4ZD3L 3QNXA 3GMPA 2QADC 1AXSB 4XAKE 4D2NA 4QYOB 3MR9A 3TA3D 5FEBA 1BLNA 2GITA 4UT9A 5DC9B 1YZZA 5CJQH 5D1XE 4AXWA 1MFBL 4LP4A 1AGBB 4B9IA 4KMTL 1T1WB 4J6RL 2BVTA 2YSSB 2AJYH 3RY4A 3CFEA 5AVYB 1LE9A 1CLYL 5BRZD 1OHQA 5BV7H 1UFGA 1JWSB 1TVBB 1LWJA 4G3YH 4TNFA 1DVSA 4IIQB 1BAFL 2HLFC 4ELDA 5JPNA 4LB8A 5IQOA 1IAMA 1TTBA 3MYZA 3DV6B 1GL4B 5INDA 4PJDB 1NCAH 2DYRB 3ATEA 1UTDA 4NQDD 5C0GB 2G75B 1AACA 5I5IA 2AEQL 2GI7A 3X14B 3LS5H 2LW3A 3LKQB 1RIVH 4M48H 3GLEA 4YVUA 3TBWB 1B0RB 3EO1A 3VH8A 2QVTA 1DSFH 5IMOA 4L3EB 3RILA 3MGTA 2Q7AA 3ZKNC 2CR3A 1FL5B 3QDJB 1MNUL 1JTOA 4AIOA 3QEGH 3FO1B 3GO1H 1MREH 4PCKA 5EUKA 3FQYA 3FU5A 1T22B 4LLMB 4ABWA 5K9QI 1SEQH 3QWRA 4P2QB 3QORA 1IFHL 2G3ZA 2G75A 4LVEA 1MZZA 1ZT7A 2BRQA 3D12B 1HXKA 2CUHA 3GRWA 1WO2A 3KHOA 5D1ZA 3HNTH 2IH8A 1S7QA 4UZSA 2HKFL 3RL2A 2ZTBA 4HLJA 3KW7A 3L95B 1DJIA 4OLWH 4JDTL 1CBVH 4ELKA 2H0PA 1RIUH 4G8IB 2WXQA 2AQNA 2E7DA 2EVJA 1OW0C 3C5ZA 4TQEH 5GHWL 5EF1A 1TXKA 1KLFB 5EOTB 4N0UB 4OB5H 4G7YL 2EEXA 4GUQA 4M3JA 5TQ0L 4AG4H 1UOWA 5LGYA 3F65A 5I75B 3VXQA 5J1SC 3NCWA 3Q2CA 2E3VA 1MAKA 3L1GA 2AKRB 3T77A 5I74B 2WVVA 4MMYA 1RD6A 4X0NA 2ZYSA 4PRIE 4XCYB 5SWSE 2DQEH 3EH3B 3KPRD 1ZTXH 3MUZ1 4FQLL 1FL5A 3REWB 3UGXA 2XNAA 4D7BA 2YAHA 4TLSA 3KEDA 2VLKA 4AEHH 2X89A 3BYTA 5K9KB 3E8VA 3KJ4B 3RNKB 2YRPA 4N2AA 4K7PY 2YUXA 2XN9E 4AJVA 1QO3B 1BQLH 1RUPL 4JPIA 3FT4B 1KB5L 2Z7YA 2ZICA 3CFUA 4MB1A 4RSVA 4XXCA 3F7YB 1S78D 4P3WA 3KPPA 2EJ1A 4RISH 4XCEB 1MFCH 2FD6H 1FYHB 3KR3H 4G80B 3SEPA 1U8QA 1X9RA 4M4RA 4PCTA 4E0RA 3OJVC 2DLEA 3R4RA 2YGPA 6FABL 1XF2A 5CSZA 4ZPVA 2NY1D 4IKIA 2YOCA 3ZTJG 1LNUA 4FTDA 1PJ9A 2NXZD 1HEZB 6CGTA 4X6CF 1LEKA 5JW3H 1OXYA 3DX7B 2LQRA 1RZIB 5BV7C 1UYWH 2NZIA 1E9OB 1RVFH 2DN7A 3BN3B 1R3HB 2I9TA 4Y19E 3ZDYF 5IFHH 5JO5A 1B4RA 1KEGH 1HVXA 1K5NB 4MMXC 1Q9KB 4IHBA 1IAOA 5GXBB 4NZTL 2NNFA 1SDAB 1T4WA 1HE7A 1V3JA 4KXBA 5B8CA 3T0DA 3GBNH 3OVUB 1WZ1L 4J28A 4QRSA 2BP8B 5DQ9B 3L5XH 5KG9A 1R9FA 3BIKB 4Y4HC 4JFSA 3NGBC 4GB9A 5DHXB 5AVTB 3RNKA 3UJJH 2XU9A 2E86A 4NRZB 3BKMH 3TA3B 4L5FL 5AENA 1D9KB 4G71B 3KVDD 4GXUM 5CP3H 5DI8A 1JGEA 3U6XA 4AVJA 4XOEA 4AUJA 3ULAB 3GSNL 4KU1A 3H8NA 2FB4L 4HJ0C 3ZBMA 2BS8A 1PFOA 1HL4A 2ZYRA 3TZVA 1Q0YL 2ATKB 2VE6A 1UJTA 4WIQA 3IXTB 2I26N 4Y88A 3OKNA 2VLRA 3L7EB 5EOCJ 3WN5C 5DLML 2BSDA 2IANE 2Y25A 3FBQA 5CINL 4M8RA 4I9WE 1YN7B 2GG1A 5DK0B 1Y18A 2VITA 1RUAL 4YL4A 3S36X 4WDIA 1HKLL 2HAZA 5E51A 43C9B 1G9NL 4E41A 5EEWA 1UUSA 3APNA 1XAUA 3I6KB 4UNUA 5HJ3B 1MCNA 2EYRB 2YAPA 2ERJB 1H0DB 4PJFB 4LOUD 5C09A 2WV3A 4HFWB 4ODSH 4M5ZL 4H5SB 2AHIA 1B90A 1TMQA 3QQDA 3ISWA 3L4WA 3FSVA 1EFXA 3F7LA 1B4JL 4PJEB 2Q1EA 3QYCA 3LAFA 4YWGL 3AABA 3H9SB 3EF7A 2X05A 1C5DB 4DUVA 3JV0A 3O2VH 4E41E 5HJDA 4FLQA 1AZRA 2NY1C 1MAMH 2GJJA 3ULUE 5F7UA 5DFWH 3LN9A 1JNHA 4GRMA 3ZE2B 2XPGA 1YPZE 4RDQG 5SX5K 4JO8A 1KV7A 1X5IA 3OSKA 4KX7A 2CA4A 2J4WL 3B7SA 3HZYA 3HHMA 4G6JL 1S78C 4N90D 4GP4B 2KZ1B 1RV6X 1BOGB 4JB9L 4LSUL 2AZAA 4PI0A 3WIHA 1P4LA 5TQ2H 4HP5A 3WNJA 1UD6A 3B7RL 1XCQB 3QXVA 2CUAA 2R56H 1JWSA 5CAYB 3D52A 2QZQA 2ZCKH 1GYUA 3OJMB 4WY7L 3BWAA 2B4CC 4L1TA 5C0CD 1CXLA 1IBYA 2X12A 3KBEA 1JV5B 4F9LA 4G6AC 4YDKL 2A73B 2ATKA 3K2UL 3UBXG 4AIXA 3CHSA 5MEPA 3L3KA 2HG5A 3OKYA 5H8DA 1W2KT 2GK2A 4BUHA 3DI2B 4XB7A 3BZEB 3U6RB 1LO0L 1AZVA 1Z9PA 3NZ8B 4EI5D 2EXTA 1XR9B 4HISA 5B22A 4WSGA 1HH6A 4XCFH 5FA4B 2CJ3A 4V2BA 2NTFA 4R7XA 4YDVA 5CFAA 1ZMYA 3NAAH 4WHYG 4X8GA 4C4KO 1AFVL 1REIA 4TUUA 5AZ2L 4NRYB 1F4YL 3WHE0 4N2IA 4I2XB 1B2WH 2IAND 3MX0A 3PABA 3V4LA 4JFDB 4HBCH 1M1SA 3FQ4A 2NY7H 5F3HB 4WW2C 1WBXB 5IV2B 4CDGC 4DT2A 1ADQH 4UT9L 2CE6A 3O41A 4PGJA 4Y16C 3FUDA 3VI3E 2QSCL 2FBOJ 1T5KA 2WZPA 4AW7A 3M1OA 4KITB 2QKIA 3WEXB 1I8IB 1SRDA 1J9TA 1JGIA 1TENA 4PVLA 5HPMB 2IFGA 3FO0L 3BISA 3X12B 2XN9A 2V5SA 4HHAB 4JG5A 4CU7A 2VJ0A 4X50A 1MSPA 5GSVB 1KXTA 3C60A 3VFPB 4PJDE 1YNLL 2DI8A 1IQWL 2AJ3B 4KNUA 3IN2A 2FRGP 4J1UB 2BY0A 5FAAA 3GXFA 4GUPB 5IB5B 1LJMA 2BVOA 1J8HB 1NGQL 4AGPA 3UJIH 2YPVL 2HRHA 2JELH 1A3QA 2Y2YA 2YD5A 4R4ND 4IRJD 2PNDA 2QHRH 1E7UA 4KDTA 4BFOA 2E6PA 4AJWA 1H6TA 2JKIS 2Y6SC 3VUAA 4PRNB 1V27A 3RNQA 4L3EE 4TVSa 5D72H 4UT6A 4A2LA 1USZA 3R06A 1R3LA 4L29A 3D48R 3KL0A 3BP5B 3MUJA 4D3CL 5JOFA 2PCXA 4PJAB 1FL3B 3CVHL 3BVXA 4LLVB 3UJJL 1A7NL 1VFOA 3ARSA 2KLRA 4JY5L 4U3HA 4LVNC 3X17A 2NUTB 2OMZB 2KLTA 5I6XB 4X4MA 4PAZA 3WU1A 4MCMA 3U9PL 4LVNB 1NCUA 5CN3A 1RZQA 4QRTA 3IU4L 3RI5F 4MNQB 2VDMB 4PY8J 3WY4A 5J12B 2P42B 2W65A 2DI9A 2Y7SA 4EVNB 3QWQB 1XIWA 1ZTXE 3GHEH 1RAMA 2LAGB 4PWIA 2EDHA 3RAJL 1URZA 4FMKA 5DQJA 2CWRA 2UZIH 1JGVH 3BESR 3E6HB 3MN8A 2APSA 4GBXD 5IGXL 4ONOA 3I9GL 5CMAA 3C5JA 4Z7UE 2YZ8A 5FO9B 1LO2L 3ZE1F 5EORH 2NYZA 2VDRH 3A21A 3P77A 4OM1L 5TPWL 1JCVA 3R0NA 3V0EA 1YMHB 2VDLH 4HMDA 4HOXA 1UZGA 4HUXA 3SJVE 4QWWD 1EVUA 3CZJA 3WKQA 1NLBH 3G6DL 5KVGE 1PAZA 5IHZA 3VSUA 4ODHH 3IVKB 3U4KA 1MFUA 1R3IH 2ITCB 1HSBA 3IN0A 1ETZA 1GOFA 1KLGB 4JQXC 4NUMA 3KPMA 4AQ1A 3MRBB 1MCWW 4X6DA 1NGXB 1C5BL 1NUDA 1Z2KA 2G5RA 2H1PL 2Q5BA 2ZSVA 3I6LD 1K8DA 2V2XA 2HT4C 4Y19A 4Y16B 2R2HB 2WUBL 4L3AA 1WCBA 1GGTA 3BQUA 1ZOXA 4Z7WA 4YHIB 1MIMH 1U42A 1B0GA 1WDAA 3GIZH 4NP9A 1IT9L 3GJEB 5LCVA 3PNWA 4WGVB 4AMKL 3W56A 5LGKA 5B4MC 2WWKT 1AR1C 4JY6B 5JIKA 2XG4A 4H7VA 4PJGF 1LTXA 5IROA 4PJ9B 4FQQA 1QRNA 5L8KB 3IPBA 1T6WA 4EIBA 5SX4H 4ANVA 1AAJA 2ENJA 4OTXH 5DMYA 1H6FA 2FSEA 3SBPA 7CGTA 4PJDF 2G2NA 3T08A 2JIXD 1T1ZB 1GIGL 3JT2A 1Y1UA 3R0MA 4NO3B 4TRPL 4YZFE 1FVCA 3TO4A 1DQMH 5EIVA 1NOFA 3EYVA 3EO0A 4G9DB 2GCYB 2XWBB 5D7SH 3T4AB 1LXMA 4G7SB 5CXPA 4N0FA 3B2UC 2EH7L 1JZFA 2O1AA 4UM8B 1E30A 2GB2A 1OAZH 4JHAH 2MFNA 4KY2A 4U4IA 1RIHL 4KO9A 3UTTB 2ZCHH 1CU4L 4OLVL 4HAFA 1G94A 1RH8A 3C8HA 1XGTB 3MUHL 5IQNA 2A74A 5IVXF 4APQC 2OCFD 1UKQA 5EV7A 4BGDA 3QDAA 5I66B 1FN4A 4HT1L 5DJ2A 4GAFB 4G59C 4CJ0A 4QRRD 5LNDA 3ZQWA 1T0MB 4UOW1 1J11A 4GP8B 3PAUA 2X4UB 2F8XC 1X5KA 3HCVA 3KWUA 4LVHB 1T83A 4MD0B 4LLYB 2Q2EB 3K72B 4NQEE 5CWSA 1KN4H 1CFMA 4QRQA 4OT1H 1ORQA 4G8FA 3VDCA 3EO9L 3VMOA 4QOKD 2W0PA 4ZW7A 3AWGA 4X98B 4UDUA 1MFBH 2HN7B 5MI0C 2ADIA 3QJZA 1MHPL 4YXLH 4KJQC 1R3JB 2BW5A 3NABH 3I9GH 3MLZH 1HINL 3O3EB 1TYRA 4OIFA 3LKSA 3ARGD 4NAJA 4I5BA 5IHUH 4X7TA 2F9BT 3APFA 3SSGA 2DMHA 5AZEL 3ABLB 4BWTA 4NIKB 1DLHA 3ILQC 2VL5B 1ADWA 3P11L 2Y9RT 5EU5A 4XN7A 1I8MB 3MV8D 1MCLA 5C6TH 5HYSB 3O3UN 3NCXA 4P2RA 3WL9B 3FN9A 2PPFA 1CGTA 3SQOL 2ZOTA 4B9GA 1KJVA 2XWCA 3WNLA 4KI5C 5TE7H 3FN3A 4JO1H 3WIHL 4XHQA 4DVRH 5CD5C 3OKDA 5FYJE 1TQWA 3ARED 2WP3O 3PPEA 1ZGLA 4IDLA 4ZAKB 4M4PA 2RFXA 4FYSA 5LLIC 32C2A 3HC2A 4FL4C 5LBSH 5IQLA 3QUZD 1FGNH 2PABA 1U3HD 3B7YA 4PQXA 5GGUA 2NUPB 4AMXA 1KTLA 3E38A 2X9ZA 4KRPC 2A74C 3T3PB 3UPAA 4HZLA 4J3VA 5EPMA 3EFOA 1NLBL 4IGBB 3MRCB 3KZ8A 2LT9A 3PP4L 4PMEA 3ZMRA 5TK4A 3WO3B 4XOCA 4B60A 3CFMA 1AGCA 1Z5YD 4XNYL 3VXOB 3JYCA 3P4NB 3ZE0B 5JZ7C 1CGXA 5L2KD 1X3DA 3SE9H 5GJTL 1WWBX 3TBVB 3RFRA 4B9KC 5F0LB 4BFRA 3D69B 1R0AH 2KPWA 3PWUB 1U8MA 3WDJA 5LXGL 3ET9F 2A9ML 5GRYA 1EJOL 3DIDA 4ZMZA 4C4UA 1OTTD 3VGAB 5J13B 2DH3A 4BQ8A 4L3FA 2A4CA 5G5DA 1ZANL 5KEZA 4JFFA 3IBEA 4QO1A 1QSEE 4K9EC 3VFNA 4BFBD 4Y8AA 4YJZL 3FU3A 1ZXKA 2AS5M 1BQKA 5DJ6B 1SJMA 4OD1H 3WI9A 3G5XA 3S5LB 4ETQA 2PUQT 3QR0A 4PP1C 5DHEA 3WGUB 1WBYA 4RFEA 1ZLVH 2Z31C 4NKQB 4TUJA 1UM6L 1UWYA 1T5WA 1RURL 4PTUB 2D7PA 3NIFE 1NCNA 5FFGA 4OKVB 4RGMC 1CPUA 1MCRA 2IADB 1S8DA 1VGKA 1TKWA 3ZDXE 2XTLA 3IU3B 1MLCA 2D7QA 2DQCL 4G9FD 3KS0J 1IGTB 1SMOA 1WHOA 2JELL 2XV0A 5HGBB 1DBBL 2QELA 5E9DA 4NGHL 3EH2A 4YAQA 3WTTA 3FQXB 3AGWA 2J71A 5J11B 3QQ9C 2WXRA 2CGYA 1A6TB 2YD4A 4K9EL 1SGKA 3NFNB 4TQ8A 4LLUA 2VDNH 4CW1B 1S5IL 4PJ6A 4UANA 5F9WC 3V4PH 1CFSA 5CBAB 3EUDA 1YAIA 4Z7OB 3NJGA 1XF3A 1HU8A 3FO0H 5BRPA 1B3IA 5E24E 4PJ9A 2WKGA 2XIBA 1WP6A