3DIVA

Crystal structure of laccase from cerrena maxima at 1.76a resolution
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
499
structure length
497
Chain Sequence
b'AVGPVADNTITDAATSPDGFSRQAVVVNGVTPGPLVAGNIGDRFQLNVIDNLTNHTMLKTTSVHWHGFFQQGTNWADGPAFINQCPISPGHSFLYDFQVPNQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASRYDVDNDDTVITLADWYHTAAKLGPRFPAGADATLINGKGRAPSDTSAELSVIKVTKGKRRFRLVSLSCDPNFTFSIDGHNLTIIEVDSSNSQPLSVDSIQIFAAQRYSFVLNANQAVDNYWIRANPNFGNVGFNGGINSAILRYDGAPAVEPTTNQTTSVKPLNEVNLHPLVSTPVPGSPSSGGVDKAINMAFNFNGSNFFINGASFVPPSVPVLLQILSGAQTAQDLLPSGSVVLPSNASIEISFPATAAAPGAPHPFHLHGHTFAVVRSAGSTVYNYSNPIFRDVVSTGTPAAGDNVTIRFLTNNPGPWFLHCHIDFHLEGGFAVVQAEDVPDVKATNPVPQAWSDLCPTYDANAPSDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LACCASE
publication title Crystal Structure of laccase from Cerrena maxima at 1.76A resolution.
rcsb
molecule tags Oxidoreductase
total genus 139
structure length 497
sequence length 499
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2008-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3divA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3divA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3divA03
2Y69B 3ZIYA 5AFAA 2W8CA 4HALA 3V9CA 2BO0A 1DZ0A 1NWPA 2CBPA 1AZBA 4E9VA 5TK2A 3EHBB 1QLEB 2YXWA 2QDWA 1MZZA 5I6LA 2JKWA 1PY0A 3PPSA 4BDVB 3NJNA 2CCWA 3NJMA 3QJUB 3PCYA 1GSKA 3UGEA 2IH8A 1W8EA 2OCCB 1V55B 4G7SB 2CAKA 3HEIB 3HB3B 3X1GA 3FQYA 3S8GB 1OCCB 1X9RA 2BWIA 2GI0A 2HX9A 3X2QB 1KDJA 4YSSA 1NWOA 2YAEA 2XV3A 1JZFA 4UANA 1GY2A 1ILSA 5I6NA 3NT0A 2AVFA 3PAZA 3KW7A 2GB2A 4KNTA 2I7OA 2H5UA 1NPNA 3OM3B 4HAKA 2EIKB 3NJFA 4JHVA 1AZCA 1IC0A 2BZCA 3QPKA 3X1EA 1AS8A 3EH5B 1SNRA 3S3CB 3FT0A 2X87A 4YL4A 3ASNB 2LLNA 1N68A 1B3IA 3OD3A 3EF4A 3QJRB 4N8UA 3X1NA 3JT2A 1JOIA 1WA1X 2EIMB 1FWXA 1OCRB 2VSMB 3AG3B 3UAEA 4KNUA 3NJKA 3CVCA 2BW5A 4KO6A 2UXFA 3UADA 3CG8A 3FQ2A 3FSVA 3NSFA 1SFHA 4KO9A 3V9EA 2BHFA 4KO7A 8PAZA 1UATA 4TXVB 3N55A 2YARA 1AG0A 5ANHA 2BZ7A 1A65A 3FU7B 5I26A 3ZDWA 4E9TA 4FA7B 1ZDQA 1OE1A 1IKOP 2TSAA 4MFHA 4A66A 2YAHA 3EH3B 4A68A 1AR1B 1L9TA 2DWSA 1KBWA 1AANA 2QT6A 3PAVA 4HHWA 4WKXA 2WO3B 1CYWA 1TEFA 4ZK8A 3UABA 1JZIA 4PAZA 4DP2X 1AG6A 2Y1AA 4E9SA 2IH9A 5D4HA 3NP3A 3SQRA 4A2DA 2BW4A 1MG3C 4GP8B 2ZOOA 2GIMA 1E5ZA 1OE3A 2ZXWB 1ASPA 2PP8A 1E5YA 2UXGA 4YSAA 1NZRA 1JERA 2ZWNA 1NDTA 3C75A 1E67A 4G71B 4GXFA 4YSTA 1A4BA 4CSZA 4KNSA 2IAAC 1BQ5A 2WSDA 2YAOA 4HCIA 4BWWA 4YSDA 3DIVA 2XLLA 2XVBA 1BYPA 2IWKA 1SHXA 4EF3A 1RZPA 3AZUA 4A2HA 1BXVA 1PZCA 1E65A 3H4FA 2OJ1A 3H4HA 2EIJB 3WG7B 1AQ8A 2FT6A 1X9UA 2DYSB 1WS7A 1HAWA 1FFTB 5I5IA 3EH4B 2HZHA 3ASOB 4BDVA 3IN2A 7PAZA 4KOBA 2PLTA 2PCFA 2W88A 2XYBA 3OMNB 3UACA 1JXDA 1GW0A 1IBZA 1MZYA 1WS8A 2R7EB 2XU9A 2VW7A 3CZUB 1QNIA 4A2GA 1AAJA 1PCSA 2IDSA 3D12B 4NERA 6PAZA 2XXFA 1GS8A 5I6PA 4YVNA 1KYAA 3QJSB 2B08A 5I28A 1M56B 2XV0A 2QPEB 4KO5A 3RYMA 5B3SB 1JZJA 3QJVB 3TASA 3GXUB 3ERXA 4DP4X 1NIFA 1PLCA 2PP9A 4HCFA 4W1TA 3ABGA 1J5CA 4UF7C 1XB3A 4M4RB 5IY5B 1M57B 2IWFA 2IDQA 1OOWA 2UX7A 2XXGA 2HX8A 1ETJA 3OQRA 3FYIB 1BQKA 3FSWA 5B7FA 2HLEB 3IN0A 1SDDA 3TBCA 2VMJA 1ILUA 1OCOB 1FA4A 2J57A 2UX6A 2IWEA 2FTAA 2CJ3A 2PPDA 3DKHA 5D4JA 2PPCA 5B1AB 3UAAA 3PAUA 4E9RA 2ZONA 1GR7A 2MRYA 1KDIA 3WI9A 2BP0B 1IUZA 1NIAA 2I7SA 3NJGA 2XV2A 1PLBA 3NP4A 2HRHA 3TA4D 1WA0X 2YAFA 1OF0A 3KW8A 1AZUA 3IBOA 1M9WA 2XUWA 4AKQA 4E9YA 2IDUA 1CC3A 2QPDB 2J55A 2FT7A 1SF3A 1JZHA 1GYCA 1J9TA 1NPJA 3FSZA 1SHWA 5E9NA 3T6ZA 3FU7A 2EILB 4F2FA 4DP8X 4G72B 4HHGA 1AACA 1KV7A 4DPAX 3N2JA 3G5WA 3QJQB 4YSUA 2P80A 1URIA 5A7EA 4BWTA 2IDFA 1A4CA 1GS7A 4G7RB 4GYBA 2GBAA 1IBYA 2YAPA 4P5SA 1R1CA 3NSCA 1ET7A 1JXGA 2CUAA 3FQ1A 5F7BA 3NSDA 2N0MA 2Q9OA 4DPBX 2XX1A 3IE9A 4G70B 1EZLA 2YQBA 4E9XA 2BWDA 2VN3A 3SBPA 2I85A 1N70A 4KOCA 5LDUA 1PNCA 1ET5A 4K9JA 1A3ZA 1CURA 2H47C 2IDTA 4NAJA 3CDZA 4DP5X 3ZX1A 1ZIAA 2TSBA 2FQFA 1J5DA 2A3TA 3WNJA 3ABMB 2VW4A 3NJJA 3U25A 5AKRA 4YSRA 1CUOA 1ZPUA 3FS9A 1E30A 3BQVA 4P5RA 3SBQA 3AY2A 2QDVA 5PCYA 2VM4A 1NINA 2PP7A 1KBVA 2EINB 2AZAA 4YSOA 4DP1X 1ID2A 1AZRA 3S8FB 1J9RA 1F56A 5B1JA 2PCYA 1GY1A 1V54B 4GP5B 3NJIA 3T71A 4BXSV 2MTAA 4HZ1A 4DP9X 2CALA 2PPEA 4DP0X 1W6WA 4CSPA 3T6XA 3FU8A 2XWZA 1TEGA 2AZUA 1SF5A 2R7EA 4L0PB 2BP8B 3JTBA 2GHZA 1MDAA 3WNIA 5TK4A 4HCGA 4YSEA 4Q8BA 1DYZA 1XMEB 3AW5A 1BXAA 3SBRA 2XX0A 3WKPA 4F2EA 3S3BB 4AX3A 3AG2B 1SFDA 3ABKB 3QJTB 2DWTA 5EHFA 1BEXA 1V10A 1J9QA 1W6LA 5F7AA 5FC9A 3CVBA 5I6MA 4AI7A 2J56A 3FSAA 2YXVA 3L45A 2FWLB 2FJSA 1L9RA 1BQRA 4BWUA 1PAZA 5PAZA 3FYEB 1NICA 2DY2A 2RACA 3WIAA 4AKOA 1PZBA 2OV0A 1PZAA 1ET8A 3X1BA 4QLWA 4HIPA 1I53A 1L9QA 4F7KA 1AZNA 1BAWA 2P80D 3FU9A 4A67A 3PXLA 3NYKA 2Q5BA 1AIZA 2B3IA 2UXTA 4E9WA 1L9PA 1JVOA 1A4AA 2BP0A 2GC4C 2PPAA 3NSYA 3OMIB 4JKNA 3X1FA 2J5WA 1ZIBA 2E86A 1HFUA 1OE2A 1HAUA 1VLXA 2VW6A 4AZUA 1RZQA 1OCZB 2VSKB 3PLYA 4UAHA 2FNWA 3S3DB 2DV6A 4E9QA 1MG2C 1WA2X 3H56A 2VM3A 3QQXA 4N4YB 5B7MA 1PNDA 1EHKB 1T5KA 1SDDB 4A2FA 1BXUA 2JXMA 2JFCA 1BYOA 1AS7A 2WO2B 4GP4B 4DP7X 6PCYA 1AS6A 1XB8A 2FQDA 1YLBB 5D4IA 2AANA 3DTUB 2YAMA 3WKQA 4M3HA 3BVDB 3T6WA 1RCYA 1ADWA 5B7EA 1CYXA 4ENZA 1QHQA 4DPCX 4YSQA 5B1JC 2HRGA 1A8ZA 1JVLA 1XB6A 2X88A 2HX7A 1TKWA 1OV8A 1L9SA 1GS6X 1NIBA 2DYRB 7PCYA 3MBWB 9PCYA 1JZGA 4YSPA 1PF3A 3GDCA 3FPYA 3NJLA 2GSMB 3OMAB 4G7QB 2HXAA 5B1KA 5I5JA 3T9WA 1ASOA 3AG4B 4QKTA 4YVUA 3T6VA 4GY4A 1PMYA 1ZV2A 2AFNA 1NIDA 2FT8A 1JXFA 1PLAA 5I6OA 4A2EA 4BXVA 2H3XC 4YSCA 1SJMA 4JHUA 1KGYE 3TU6A 1TU2A 2UXVA 3NJHA 2GC7C 1J9SA 4NB7A 4Q89A 4BK5C 4X4KA 4AKPA 1AOZA 3TBBA 4FAAB 2FQGA 1NTDA 3ZBMA 3CDZB 1ZDSA 5I6KA 1JZEA 2NRDA 3FPXA 4W9ZA 5I5MA 2FQEA 2PPFA 3IEAA 3ABLB 3GYRA 5AZUA 2BP8A 4RH4A 1RKRA 1WAEA 1NIEA 4WTQA 4PCYA 2YAQA 3AG1B 1L9OA 3MX0B 4DP6X 1KCBA 5B1BB 1KCWA 3CVDA 1ASQA
chains in the Genus database with same CATH superfamily
3Q1SH 3ZIYA 4PUBH 1G7IA 2W8CA 1NC4A 3DJTA 4QO1A 4UQEA 1UD8A 1WC7A 4MNQB 4P2RD 2IPTH 3TBYB 7FABL 1T5WA 2IPKB 1T4WA 2JSFA 3UEQA 1MZZA 1GKEA 3ZDZE 3DHUA 5EBMB 5IVXF 4BKLA 1QBMH 3PPSA 4X2UA 4F37F 1NOLA 2O5YL 3GJFA 3KYMB 3QC6X 1B2WL 2ZIDA 1KBPA 4GXUN 4X7TB 1FNSH 1YEJL 2UVFA 4OF0A 5D1ZI 5HXMA 1MJ8L 2FEJA 5JQ6H 1PZ3A 4I0PD 2IDCA 3BWAA 2WCPA 1NCUA 3PE9A 4PGEA 2COVD 2WIIB 3VWKA 2BRRH 4ODXA 3F84A 3EDDA 3BP7B 3FCGA 4G6KH 1A0QL 4N3TA 3EXLA 4GRMA 4NM4H 3QUKB 4D9QD 2AVFA 4WW1B 5DJAB 4QOKA 4LCIL 5ABZA 1U91A 4TQIA 4ONGL 1TT6A 1GGCL 4FJYA 2CLRA 3ZHKA 2W80C 5L8JB 5C0GB 5E70A 1ED3A 2P43B 3Q1EA 5I1EL 2IV9A 1OKEA 3FCSA 1YEWA 4L0ZA 3BVUA 1EDHA 2BZCA 5C0CB 1S78C 3QPKA 4TRPH 4KV5E 5CKAA 4JZOB 3EJQA 1R3LB 2J25A 2YUZA 5DT1H 3K8LA 1JK8B 5F9JA 1Z5LA 1O6SB 5DJ2B 5AOMA 1HI6B 2E7BA 2P8LB 1M05B 3QJRB 5DZNA 4J4PA 4P2QB 1N5YL 1M1XB 3JT2A 2BSSB 4UM8B 4IM8A 2HFFB 3HUJA 4ZI8A 5ES4B 4KVPA 4UQCA 4CN1A 4JK0D 4WV1A 2HKFH 3W56A 1SJHB 2Q8BH 4HWNA 4KO6A 2VWEC 2ZCKL 5KYNA 2VH5H 3OG6B 1I8UA 1LWHA 4R96A 1DBKL 2B59B 4MJ5B 1DBAL 1ZLVH 3UGUA 1CFSA 3U48A 1UATA 3U1QA 4HOXA 2XZQH 4WJKB 3CFDB 3O6LL 5CS7A 4G5AA 5KSAD 4F2MA 3AU1B 3IGUA 3I75A 4PREA 2BXZA 2VQ1A 3S34H 4ADGA 2GY5A 3FU7B 4Z7WB 5GGRB 2PCPA 5E8NB 1ZY9A 2CLVB 2RIKA 3VXRA 1U3HA 1AMYA 2WNXA 3KVDD 1TJGH 1HHKB 1NBCA 3G9AB 3ZHNA 1BM3L 1RP8A 2NY3B 3L4WA 5D1QA 2PN5A 3SDAA 3QZPA 4MA7L 4PJCA 4HLZG 3BIAX 1ZA6B 3D08A 5GJSH 4OJAA 1ZHLB 4MBOA 4GKOA 4Y5XB 5F9WB 5KSVA 4EI6A 4IIQA 2B77A 3E1ZA 3R0NA 4TSCL 3JT0A 3HG3A 4JE4B 5HDWA 4AH2A 4FFYA 1ZTXL 4NQSB 4MMZA 5ACZB 3ZTEA 1NKRA 2CKNA 5CEZE 4UINL 3GPSA 1MRFH 3K91A 4JKPL 3S5YA 3VWKC 2D7TH 2VLKD 1KJ3H 3CPUA 4YUEH 1S3KL 1DVXA 4DKFH 2XTSA 3UYOD 2K45A 2BDNH 3EFFA 1KTCA 4PQXA 2EICA 4DKAA 1GJUA 1BYPA 3KH4A 1P0SE 3W11D 3I6LE 5J57B 5LN8A 5I0WA 3I6GA 4CNIB 1RJLA 4X5PA 1SXSA 4HMDA 2VITB 1K8DB 5F7YC 3S5ZA 2NLJB 1YPZA 3D2UB 1E9PB 1CF1A 3HC0B 3HZYB 1OTSC 3OMNB 4PVLA 1I1FB 3K1DA 4AJYV 3MV8D 5I1CH 4J4PC 4V1DD 3TWCH 2OJZH 1R5VB 4K7PX 1VFBA 4OAWB 3ZHFA 3HE7D 1QO3B 3BPNB 4FTVE 4WV1C 3C6SB 4WEMB 4NRYB 3BUDA 1U8OB 4NZFA 2Q7YB 1KEGH 2EYTB 4P46B 3QJSB 3VM7A 4DZBA 2XV0A 4ZS7L 2BCKB 4KO5A 3RPKA 1KCKA 2R9HC 3CZFB 4N0CD 3A4DA 4P99A 4NFDA 2P8MA 3WU1A 5I16B 2BOCB 1HEZA 1S9XB 2DKMA 1YEKL 1XL4A 3A21A 1ZT4A 4KROB 4OF7A 3QDJA 4HLZH 3FO2B 1EHAA 1FHNA 1E9OA 5IW1A 2HT2D 1DFBL 3R4RA 1A1MA 5GXBB 3FO9B 4G42A 4JY5H 3MUZ1 2BVPB 5B1CA 4WWKD 1URZA 3R8QA 5AD0B 1J9CT 4YDKH 3L3IB 4MLSA 1FN4A 3NQIA 5DJZA 4DN4L 5D1QC 3NFPB 2YN5A 4HD9A 3JV6A 4YK4B 3SDAC 3DKHA 3VSVA 1TENA 3US0A 5F0PB 5GSVA 2YD2A 3MLXL 3RX9A 3KM2A 4HBCL 2A73B 3QISA 4GQRA 4L8BA 1JYNA 2YEQA 1I7UA 1CXHA 4IIQC 3NRPA 3ZN6A 1OF0A 1I8IB 2C1PA 4WY7H 4XNBA 3P54A 2SEBB 4QNPF 1QLRB 5JDSA 4J28A 4LKCB 2EKSB 3FO0L 3FQRB 5DZVA 4MMZC 1JZHA 2AV7A 3F2LA 4YC2C 3HN8A 1J05A 4YR6A 2XPGA 2R69A 3VW3H 1T03L 5T5NF 3FH7A 4NPJA 1U93A 1NDGB 3H0TA 3QQ4B 3ZE1E 1P5UA 2NY0D 3LKNA 3RUGB 1JNNL 4P59H 2I9LB 2J1KA 2AEQL 4ZW8A 1KB5B 3SE4C 1XH3A 3BEWB 1EO8L 1Q9KB 4Y0GA 1QA9B 2YD9A 5DMGD 2ZYSA 3D0VB 2Y06L 1JXGA 4G9DA 1NKGA 1OSPH 3D33A 4B0MB 5AQ0A 3CDCA 4QYAA 3T08A 1LHZA 3ROLB 4HJGB 4RFEA 1HINL 3REWA 3WFHA 5I30H 4WCYH 4MNQD 1D5MA 4IKKA 4G1EA 1YSOA 5F71A 1P7QB 2AJYH 1PNCA 3QZBA 3BESR 2EDLA 5E8OA 4RNRA 2HT3D 3IMWA 4NAJA 3GIZH 5ESVB 1ZRUA 4JFHE 3BISA 4DK6A 4AYEC 5KVFH 1M3IA 2Z6FA 2VXSH 4GKSA 4MXWH 3EOTH 3BUYA 4XGZB 5AENA 4YLBA 1ZPUA 2GPZA 3GSWB 5D1XE 1MNNA 1FJ1B 3HI6H 3IXTB 1FBIL 2EEDA 3PJNA 4JUSA 3H85A 5PCYA 2OXHA 4YSOA 3C09B 2DLIA 4BUHA 4TNWK 3MR9B 2X0UA 1U8JA 3CFNA 1F56A 3TJPA 2X41A 4W9IC 2NXZB 4NJ9L 2HFEA 5F93C 1TVDA 4K2UL 5JHDE 5ERWB 4PJ9A 1MXGA 1DANU 1RJZA 4KRPB 4PWKA 5FUCE 3EYUH 2WMPB 3M88A 5AWNL 5C0CD 3K0WA 2VC2B 3FT1A 1SYVA 3O9WB 1R3IL 1HXYA 4XVSL 1CIUA 2CNZA 2XI9A 4P2QD 4FQ1H 2XVGA 4TV3A 3MLVH 4EZLA 5B39B 4R5XA 5AVUB 4ETYA 5H4ZA 5FCUL 5EZJA 2AQ1A 3M46A 4I18B 5AVYB 1CBVL 3FFDA 4NENB 4PD4K 2HJFA 2JK5A 3DUUB 1Q1JH 1OZUA 1KEMH 5F9DC 2C3XA 3Q06A 4X7DC 2TRYA 3TEYA 2WWMD 5E6RB 5JXAL 2F54E 1TVHB 2A4EA 1QZNA 2VXVL 4FQCH 2KI6A 2FJSA 4AVKA 4QHMA 2G30A 1T0NB 5HHOE 4O2CB 5C0BE 3B43A 1TXKA 3MRHA 4IBZA 4LSVH 5E8PB 4F7MB 3IRCA 2J88L 1KXHA 1P5UC 4LBEB 2EDRA 5DD5L 3SB3A 1CFTB 2OMXA 2ICWB 2AABL 5IW3A 4LCWE 3DUHA 4QXWA 1E2VA 1JUFA 1XF4B 5DEGA 3CFQA 2V17L 1NDMA 3B2UC 3F5WB 2WLMA 5CGBA 3EYQC 8FABA 4IK6A 2P80D 1YNLH 2DBLH 4KJPC 4UTBL 4DO6A 2B3IA 3VTMA 3WD5L 2IANE 4JKNA 2NY3D 2QMJA 4P2YA 5A7BA 3ASWA 3DIFB 2UZIH 3SODB 3X1FA 1PG7H 5LGKA 2OZ4A 1CD1A 1QI4A 1BAGA 2ZWLT 5D7LB 2ATKA 3KNBA 5FOBA 1XTLA 2FH8A 3BN9D 3L8QA 7FABH 4KXBA 3CCHB 4CSTA 1DJWA 3Q2LA 4JZNA 4YHOL 1E3XA 4X0KA 5CN3A 2JXMA 2O5YH 2AJ3B 2R39A 4AQAA 1G9EA 4GP4B 3DUSB 3I02A 1VDGA 1B2WH 2E4FA 1WVZA 4YFEA 5E95B 3TH4T 4PI2A 1MJ8H 2Z31A 4N9GB 2FUTA 4RA0C 5JYLA 1IBHA 2CCVA 2R2BA 3B37A 2XRAL 2XWCA 1HOCB 4OLZL 4PWIA 1QACA 4ZUTA 1JGDA 5IBUG 1A0QH 3BZ4B 3TXAA 2G2NA 2R8SL 3AJ7A 4LCUB 4LCIH 1KB5L 3R7RA 4JQIA 4ONGH 1GGCH 1MFNA 4PJ9C 1L3NA 1GS6X 4HEME 1NIBA 4LFHG 5I1EH 8CGTA 3D2UD 1MVUA 5CP7B 1C16A 5IZ7A 4LCYB 1OLLA 4J3VA 4WK0B 2DQFB 4PLJC 3ABZA 5BQ7B 4QKTA 1Q90A 4RGNC 3MRNA 3ARUA 1KXTB 1PMYA 3H6JA 5A6LA 5JHBA 2WOBA 2K7PA 4OZIE 2M83A 3C12A 1N5YH 4ZOAA 3U83A 2Y25A 4BSWB 4NNXB 1KB9J 1P4LA 1A2YA 3OXSB 3QEGL 3Q9QA 2H3NB 3LNDA 3MRRA 3N1PC 2WBJB 5IB5B 1UB6B 4OZGF 1D9KA 2ZCKH 4PJIE 4Z3TA 5L8LB 3OXRB 3UBGA 1DBKH 1YJDC 4KROD 1LK3L 1DBAH 2YZ1A 1F45A 2YOCA 4LL4A 3O6LH 4G6ML 3EOAA 4LKXA 3DBXB 1PZ2A 1D7DA 4J8RA 3T0VA 4G82A 2W07A 5AUMA 2D3LA 3KL3A 5KUKA 1E0OB 5H94A 4NBXB 1JRHL 4XTRD 5J9PB 1FHGA 1NGPL 2VAAB 4A2MA 1YAZA 1NH6A 1BM3H 3ZRFC 3GSXB 2VC2L 2G5UA 4MA7H 4PJFE 1MFMA 2CBPA 3HG1E 1AZBA 2BNQE 3FFCB 3QYMA 2YXMA 3FCTB 3VD2A 1O0VA 3KYNA 4EVNB 4BDVB 4N0UB 3VGFA 1KIPB 1GSKA 1N8ZB 4MDJB 4W9FC 1A6WL 4TSCH 3SDXF 1RD6A 3H9SD 1XF5B 5K59E 1ZTXH 2ZOLB 1JZ6A 1NAMA 4A7TA 2Z31C 3BKML 4UINH 5K39B 2GI0A 3PWVA 4JKPH 1NBVL 1LO5B 4FC3E 1FNLA 2NY6C 3OG4B 3CTTA 2X4RA 3K4DA 2ZSWB 1S3KH 1HILB 5T3ZE 3IGAB 1AXIB 4KTDL 3VD5A 1FUNA 5D7JB 3H2QA 3KWWB 1JGEA 2I60L 4XN2A 3TNNA 2NZ1A 3DV6B 4PPTA 4MA8L 1CK0L 3CFTA 1K5WA 3VI3B 3E3QC 1JCKA 4ZUVA 4LSRL 4HX1B 4WSGA 1M7DA 5H37G 1SJXA 3P9LB 4WFED 2KQMA 1IC0A 2GTQA 3MZTA 3X1EA 4MKMA 2MIZA 1AS8A 2VAJA 3EH5B 3GSVB 2DF3A 3PWNB 4O51B 1IE4A 3ULUF 2G0LA 3MOQA 3GIVB 4JFFA 3EBGA 1Z3RA 2UZYA 1KGWA 3ATDA 2KUTA 4DOHE 3EOYG 3U1SL 4F5CA 4GBXA 2NSMA 4ZAKB 4JRYE 1GOGA 4QEGA 2BSEA 3DA0A 5KBNC 4LPUA 2VJXA 4HGMA 1D9KC 1FYTB 4O02L 4ZS7H 2YXFA 4LSSL 2R0WL 3UADA 1GYVA 2O4EA 3FQ2A 2R0KL 1DN0B 2KKQA 4FG6D 4P5TC 3TF7C 2CM6A 1XSOA 4QRPE 1DUZA 3NSFA 1SFHA 4NO2A 2X4NB 2H3KA 1CU4L 1YEKH 1IT9L 4Z7QE 3VD0A 3VXTA 1SLXA 2BC4A 2NXZD 1I9JL 5JMRA 1BM7A 2YMXL 3DSFL 3ENEA 5HGGS 1DFBH 2HJLB 3ZK0A 3H7LA 2OSWA 4G9FB 4KRPD 5HDRA 3OHMB 4FQXA 4MS6A 4QY8A 3O9WD 5C08E 3BVVA 2DWSA 2IIJA 3FQNB 3MA7A 4KK5D 4DN4H 2V2WA 2Y24A 5D2NB 1ZHNB 3QWOB 2H1XA 4J1UB 1KTKE 3AC0A 1ID5I 3BP4A 3NZ8B 3RVUD 2BVYA 3VFNA 5BOPA 3TS8A 1FNEA 3MLXH 4ZMNA 1NFAA 4HBCH 3L3OA 5IESL 2OL3B 2ICWJ 5JIHA 1QMUA 3ALXA 2NY2C 4X6CF 1DLHA 4CKVX 3Q48A 4EQ2A 3FO0H 3JWNG 1N2RA 3G04B 5T5FA 3VQ2C 2ZXWB 5LG6A 1EAOA 4DJMA 4YSAA 4U31A 5EORL 5H37H 2OSXA 4AK2A 1T03H 5I74B 2FZ3A 4GXFA 4Y4FB 3OL2A 1PLGL 4KNSA 4K3DL 1M71A 1TUPA 2Y5QA 3HNTL 1JNNH 1A7PL 3RDTA 2YAOA 2AEQH 4AUYA 4X5RA 5BZXA 1EO8H 4ZDHA 4AW7A 3KLHC 1CR9L 1RUAL 2AEOA 1I7RA 2C3VA 2Y06H 3NN8A 4CJ0A 1HL8A 2J71A 4C56A 1AP2B 3H4FA 4ODUB 1KPRA 1TJMA 3KL5A 2DJUA 1HINH 3QDMD 3TPKA 5D7LD 1D6VL 5JR1L 4JG5A 5CCHE 4HJUA 3TN0A 2JQAA 1BQLL 2YPKA 5E9DA 4AIEA 2Z8WC 1S7XB 1GW0A 3OR6A 1IRAY 1DHKA 1IBZA 3DECA 3RWCA 3DRQA 1X5JA 4PU2A 4GBXC 1WFIA 4Z7UE 3N42B 3Q8EA 4JHZA 1YN6A 3CBRA 1JTPA 1M56B 3X13B 5ECJE 3VFRB 3HZ3A 4E5XB 3OKNA 4QHNB 1FG2A 3O2WL 4MD4B 4AENA 1S2EA 1FBIH 1X7TA 2CG9X 4PJ7A 5I1IL 4HCFA 2X4UB 1W72B 3PWJA 3ZL1A 2YMTA 5K69A 4LLUB 1DQQA 4F7PB 3GS4A 3D05A 3T65B 2UX7A 3O4LE 2OYKA 4DCQA 1AGDA 2CIIB 4NJ9H 4U1KB 3PXJA 3NBNA 1I7ZA 3S6CA 4K2UH 4HJ1A 4FQXC 3BAWA 1QUNB 2BPBA 2X1QA 1CL7L 1TOXA 2P5WE 3VGBA 3JWNH 1BX2B 5AWNH 2J57A 4ES9A 1KIQA 1XGQB 1R3IH 4QGYA 3HRZB 1CFVL 4XVSH 2J8OA 5LBSA 5FGCE 3MN8A 3C9NB 3E6HB 1KDIA 4ENED 1P2CA 5D6CA 1CWVA 2VXUL 1A6VL 3L3OC 3ZQWA 2OW6A 5FCUH 5FF6B 3IJHB 1CBVH 5EB9A 1U36A 3PFQA 2X89A 2WBJD 1MFBL 3HFFA 4QJ3B 3MCLL 2I26N 2G5RA 1SF3A 4FD0A 3V4PA 1I8AA 5JXAH 1MY5A 2OKMA 4HS3A 4QWWC 4Q6YA 2VXVH 4WJ5B 4HIJB 1WIUA 2P1YA 2PABA 2DZEA 5I8EB 3IGLA 2AKRA 3ZKNC 4PJXE 3FUDA 4A2LA 1KPVB 4DP8X 4IMLA 1EAJA 2J88H 5IJDC 5DD5H 4YPJA 4U1SA 2PW2B 2VZ3A 2AABH 3RDTC 4QHUA 3RVXD 3EJRA 3FHEA 3GPEA 4OV6F 2XWTA 4HF5L 2CHDA 2V17H 5SWSA 2BVTA 2FEDD 3G08B 2KZBA 2NYYD 5IOPA 4Z7OF 4POZC 3EHBC 4UTBH 3KLLA 4NQVB 4Y9BA 5F7FA 3WD5H 4NC2B 3ME0A 3RWFB 1WBXA 3ZR5A 1TKWB 3FFCD 3RHWK 4PGZA 3TN0C 3UP1A 1X3DA 5C0RL 1XXDC 1Y6KR 3MCKB 1CBJA 4R6UA 4B9KC 2R1WB 1LTXA 2MQGA 4NM8L 5CSZA 2TSBA 3BD4A 2ZJSL 4YHOH 2CDFB 5CAYB 4UIMB 4QI3A 2OL3L 3WDHA 2RJMA 4HIIA 4YSRA 1CUOA 2BIHA 3VDAA 1WG3A 1BVLA 3FZUC 1UJ3A 3GMQA 2NPLX 3THML 1UZ8B 4MB3A 3FONA 2D31A 3DDGA 1OD9A 2XRAH 1KC5L 3G5YA 1KNOA 1RZJL 4OLZH 1JCVA 5I15L 3ESNA 1MHEB 1A7OL 4P4RA 3UTQA 5D7JD 4P3CL 5KG9A 2PCYA 1JNLL 3KD4A 3NJIA 3X12B 2ITFA 5B39G 2R8SH 3HG4A 4K5MA 1KB5H 2CALA 4DP0X 4XPFL 1KTJA 5D5ME 3RL1A 1E6JL 4ZUWA 5HHVL 2NYKA 1X5AA 3IDIA 3TM6A 2EXWD 1HE8A 2CHNA 1Z2KA 4WW2F 3OZKA 4JFEA 5EA0L 3UZVB 3TIDB 2WLZA 4XCEA 4QD2E 4HUXA 5HJGA 4HXBL 2EE2A 5EV7A 4WTWA 1DYZA 4X4MA 4BH8B 4K3GA 2HG5B 3I3EA 1C08B 1OAXL 4M7LL 5E99L 1IC5L 3DIDA 3WKPA 3IJYB 4PRIE 2DEWX 1G7IB 3ABKB 3I74A 4ZAKD 4CMHC 1NC4B 2D7NA 2W38A 2D2OA 1WC7B 4IKJA 4OZ4A 3QEGH 1FYTD 2ZWKA 3OJMB 1E4WL 4X0NA 5GRXG 3T2QA 3II3A 4AI7A 3K71A 1XTMA 4BKLB 1ORSA 1OGPA 3VA6A 3EOBA 3PXHA 1LK3H 1Z9SA 4XB3A 1U41A 4PRPA 4F9LA 3RGBA 3SDDA 3RWGA 3MJ8A 1PEZA 1MLCB 2JCCE 1W72L 1AH1A 1S8DA 4P9HL 4G6MH 3T09A 4G9FD 3BWAB 4ZQKA 3GSOA 3KCPA 4PV1C 3VWKB 4F7KA 5I71C 3QJXA 5DD1L 2Y9RT 2E46A 1IFHH 2Z4QA 4G8IA 2X9WA 5CLTA 3V5HA 4Q9CA 1THAA 5CD5D 1UWXH 3U30C 1JRHH 4GRMB 5LLIC 2LOEA 1NGPH 3N5AA 1E43A 1U91B 3GXIA 3NIGE 2WXQA 2CLRB 2Z0BA 2VC2H 2VSKB 3FQTB 1G7MA 1AXSB 1ED3B 4UOW1 3FCSB 2I5YL 5EF3A 3NUKA 4AGOA 3E2HC 2GHWB 3GXFA 5HI5D 4F8QA 4AG4L 3BKCL 4LASL 5EN3A 1WCBA 3ZT7A 5FB8A 1NSNL 3NCWA 1Z5LB 1A6WH 3WTVA 4AL8C 4WSKA 4LPTA 3NFSL 2YAMA 2KL6A 2CSPA 3BKMH 3HUJB 2NW2A 2C4FT 3EDJA 1RCYA 2CMRL 4WV1B 3HN5A 1NBVH 2EDNA 3ZE0E 1MRCL 2OXGA 3RPBA 1ADQA 4TVPL 4PWFA 4OZGB 4IYKA 3PQYE 4IOSA 4DPCX 1NLBL 5BRQA 4R96B 5GISL 4R83A 1ETZB 3LKRA 1NQBA 3LRGA 2I60H 3QFDA 2YSTA 1R5IA 4HJEA 4MA8H 3K6FA 1CFSB 1CK0H 4HUMB 3WUWA 2MPAL 4LSRH 4F2MB 4PREB 3I75B 2JKNA 4KKLD 2VQ1B 1JZGA 3FH8A 1PF3A 3NJLA 1ROWA 2ITDB 2PCPB 3TNMA 4DZ8A 4L8DA 5DRZB 5HD8D 1I3GH 5IMOA 1YQVL 3VXRB 1EK3A 2G4GA 1SZNA 4CVXA 1NIDA 2GQHA 4JG0L 5D55A 5D1QB 4Y4KA 5KBKA 3SDAB 2J8UA 4A2EA 3U1SH 3FXIC 4NQEA 1S9WA 3GBDA 1KN4L 3LY6A 4JM2F 2EE3A 5KW9L 1H3XA 2D9CA 4NB7A 4HS8L 2BIOA 4O02H 5KSVB 4LSSH 4EI6B 2R0WH 4IIQB 2R0KH 4ICXA 3B9EA 2FQGA 4AH2B 2H32A 4F9LC 3SDDC 1CU4H 2MCAA 1IT9H 4NI6A 4MMZB 1EZSA 3TBSA 3LKPB 1BZ7A 2X1OA 5B22A 3Q5OA 1R24A 3FRPA 4YC2B 1I9JH 3MO1A 2YMXH 1FP5A 3DSFH 4WTQA 2XN0A 2MH4A 1XGRB 5E8DL 4U4IA 5HGDB 2LAGB 2WVTA 5F9OL 4XMZA 3EFFB 1JF5A 5B1BB 4G1MA 3CVDA 4PH8A 3ZOAA 4IU3A 3GLAA 4OFQA 2Y2YA 2AAVA 4HALA 2BO0A 1KCVL 3CX5K 3I6GB 3MTRA 1E8ZA 2QDWA 4KJYA 4G6AC 5CBAA 4RMSA 1B4RA 1YPZB 2KDYA 2EEFA 2UWEE 4R8WL 5IESH 3QXWA 3ZSTA 3PL6A 4P4KA 3P2BA 5DK3A 2Z7WA 5IEHA 4WUKL 2YPLE 1AFVL 2R29A 4FJ6A 1NL0L 1X9QA 1B0RA 1VFBB 3FQYA 4PM1A 5EORH 5E7FA 4Q6IC 2D03L 3BQUA 5EN2A 5C0EA 1JV2A 3HZMB 3NFNA 1PLGH 2OSLA 3NZSA 4K3DH 1KCUL 3HNTH 4JQVA 1A7PH 2GUYA 1GY2A 2ZUWA 3NT0A 5LXVA 3O8XA 3VX0A 2N3JA 1TLMA 1CR9H 1HEZB 4KFZC 1ZT4B 4ZYKA 3QDJB 4OH2A 5FGRA 2H5UA 4P49A 5KS9A 1E9OB 4FL4C 3MXWL 5IW1B 2OMWA 3P2DA 3MLTA 3GMLA 4XBGA 3W0WB 3LRKA 3CDFA 3N41B 1FAIL 4LLYA 4G42B 1C7SA 5C7XL 1D6VH 5JR1H 2CIKB 4GAJH 2WWNA 5KWYC 3FFOA 1WPCA 4I8DA 4JO5A 3MRJA 1FN4B 3X11A 1FZOB 1S78D 3NIDB 2BIIA 1TVBA 3KHOA 4Y4KC 3JV6B 4JHAL 4J8QA 4L05A 5GSVB 4X9YA 2WVVA 4XHJC 2OLDA 2UY7A 5E08L 3DO4A 4L8BB 2BW5A 1I7UB 1CICA 2AQSA 5IVNA 5HY9A 2C1PB 3O2WH 3ZKMC 4LNVA 3NIFE 3Q44A 4AQ8A 5I1IH 5JDSB 3IWVA 3VQLA 1LJMA 4TXVB 4JNXA 4JFTA 2X6VA 2AV7B 1ZV9A 3HBGA 3VFOA 1J05B 3QB7C 2I32A 4YR6B 1EJ8A 1JNHB 1PFOA 2XPGB 4KX8A 5A2AA 3IVKB 2F53E 5T8IA 2BOLA 2C4XA 1P5UB 2EJ1A 3VYNA 1JL8A 3VXMA 5SWZA 3OLEA 2XWJA 1CL7H 5LGJA 3UYPA 1BMWA 1XH3B 5FO9B 1CFVH 2R15A 3F6LA 4CVWA 4G9DB 3WY2A 1IKNA 2CUIA 4B97A 5IK3A 1JI2A 4RFEB 1RXLA 3MUY1 3WFHB 3QP3A 2VN5A 2VXUH 1A6VH 4BFKA 2QVMA 4MDRA 1D5MB 3PL6C 4G1EB 4P4KC 5GRVL 1MFBH 2BW4A 3MCLH 4L1HA 5E8OB 4C57C 4OD1L 4OUOA 4RNRB 5I17A 4KUCF 3U2JA 1E5ZA 1XT5A 3F64A 2LU5A 3LSOA 5DHDA 3UAJA 2XJKA 4A55A 3DOHA 3IRPX 1OGSA 3BQUC 3FQWA 5CN1A 2F5BL 3MLRH 5AL0A 2WLNA 3BUYB 5FXCH 3SO5A 4JQVC 5FYKU 3FUHA 3POCA 3P3UA 4FFYL 4Y5YA 3VWKD 3O8XC 2EECA 2EIZA 4HF5H 3ML9A 5HP5A 4AJVA 4MBRA 2OXHB 2AJVL 3CFBA 1NCIA 4R4BA 1UJTA 2ZWSA 3OKDB 4R7DA 4P3WA 1QQDA 2FJUB 3EUUA 4X98A 2NDGA 1D5IL 2VM9A 2HFEB 2HZHA 4OQ1A 4E5XG 4QTFA 4ACTA 1JZ3A 5LVEA 3BX7C 1X5GA 4PJ9B 5D2LF 5C0RH 5DGRA 1ZS8A 1P1VA 3L5HA 4TPRL 4QTIL 3KYOA 4Y19E 1BF8A 1AZZC 3CZUB 3O6ML 1DSFL 1HXYB 1YQ2A 4NM8H 4AC4A 4ALAC 2ZJSH 2ZQKA 4ELME 2EVHA 4TUKL 5L2JA 4BFGA 1UXSA 4J4PD 5F21B 5C6TH 2OL3H 4KKRA 4RGNB 4CU6A 4GUCA 4LP4A 3KPSD 1CICC 5B3SB 5LXGL 5EZJB 2FJGB 1EAPB 3EJSA 4M62L 5C0ND 2CQVA 3FFDB 2OTUA 3THMH 4B9CA 1F4WL 2C8NA 2JK5B 3RIAK 4AQ8C 1BZOA 4FHJA 1KC5H 2ZKWA 1RZJH 5DZOA 5I15H 1XIWA 2R9HD 2YS4A 3BVWA 4TOYL 3K6DA 4F1SA 4P3CH 1M57B 4XHQA 1TTUA 1JNLH 4QHMB 3MRHB 3DJSA 4N2AA 3IJEA 4R97C 2Y1ZA 5TF0A 3VNZA 4JGNA 2OMXB 4XPFH 4AYID 4MA1C 1E6JH 4NPYA 4ZODA 5HHVH 5EG6C 1AYOA 1JUFB 2FGWL 1L4IA 5DEGB 5EA0H 2ITCA 2XKSA 8FABB 1XZ0A 2FTAA 3VXRD 4LVHC 5CKGA 4U1IA 3VMNA 3MACL 4HXBH 1IKNC 4Z7OB 1TYJA 2ZONA 2EUZA 4KC3B 5D1QD 3GBML 4M7LH 4GKNA 1OAXH 5E99H 4UTAA 1IC5H 3NP4A 3SDAD 4Z3GA 1CD1B 1OQXA 4PJBA 1WA0X 4JRXA 3TV8A 2FCBA 2ATKB 2GJJA 5EWIL 4YZWA 4LO9A 2C34A 1O7SA 4BEIA 2MOQA 1E4WH 2Z7UA 3FF8A 3FUJA 2EYSB 3CDGB 4JZNB 1SHWA 5E9NA 3IGKA 4X0KB 1OHZA 4MMXA 2PW1A 4AQAB 2V4LA 1SVCP 3I02B 1IM3D 5I0YA 3U4EA 5I1GL 4Y5YC 4EN3A 1W72H 2Z31B 5DI8B 4P9HH 4HQQL 2R2BB 4KI1A 1BYNA 2R69L 2P5EE 3TONA 5DD1H 3JSSA 1JGDB 4G8GA 2DQMA 4IMKA 2VZ1A 5DMIL 4NKMA 5C0JB 3BOVA 5C09A 1KJ2A 1V7ML 4YDJA 3VXSE 3BFOA 1QATA 2YJQA 5LDUA 5E8EB 2XWDA 2FHFA 3DHMA 1ET5A 1JZ2A 5IB2A 3KZ8A 2I5YH 1MVUB 1KGUA 1C16B 3GWJA 3ULUD 2JMRA 4A6YA 3WAKA 2CWRA 4AG4H 3ZDXE 5TF1L 2WYIA 1YEFL 3BKCH 4BK8A 4LASH 2WXOA 2VW4A 1NSNH 4F1ZA 3GKZA 2YQ2A 3UL4A 3NFSH 1DQJB 2ZXAA 1B9KA 2WINA 4KZEL 1NC2B 2FX7L 1P4LB 4RESB 4JO3L 3BLKA 3QORA 2CMRH 2WYTA 2J1XA 3MRRB 4YZFE 4Z7AA 1MRCH 1XIWC 3EGSA 4K0OA 4QLRA 4TVPH 5EIVA 3TP4A 1B0WA 3HE6B 1HJBC 1NLBH 5JYMA 1E7VA 5GISH 4P5TB 3F12A 4FYSA 5AVXB 3CSBA 3QDJD 3QBTB 1MW2A 1WHPA 3MODL 4LDOB 1BPLB 4WQOA 4WU7A 3W0WD 2JKSA 3BZFA 2MPAH 43CAA 3LXCA 2N7BA 3EOAB 4PGJA 1QSFA 3Q2VA 4I9XA 3ZU8A 4WSJA 4J8RB 5F8QC 1UEMA 1ZVYA 2W07B 2Z35B 4FQ2L 1YQVH 4ZTPL 5AUMB 3PHAA 5H94B 3PWPE 3TFKC 2WZ5A 3FT2A 2XX0A 3RNKA 5BS0A 4HSQA 5JDJA 4JG0H 1SGKA 5JORA 2J8UF 5FIEA 1IARB 4OFIA 1V10A 3EO9L 2C9AA 5KW9H 2JJVA 4NBYB 4HS8H 3KYNB 2H4EA 2FBRA 3T1FA 2OX5B 4MMXC 2XETA 4U05A 4IBUA 2RACA 1A7NL 4EN3C 1NAMB 2BCMA 3X1BA 4F8LA 1EUTA 2FO4A 1XV8A 4ICWA 3FTXA 3RX7A 5DHXB 2X4RB 1YJDL 2IH3A 5CCJA 5E8DH 4IMKC 5F9OH 3CC5A 4X6DF 4D9QE 4N2CA 5DC4B 1JGEB 3TNNB 4Q4IA 1D2PA 1NCCH 3CFEA 4KJPD 1KIRA 4PRBB 1EMTL 1KCVH 3O11B 4ZUVB 1Q72L 2VLRA 4FMFA 3GLZA 4N4YB 4QRSA 1XH0A 5F1KC 2OMBA 4A37A 1ACZA 1M7DB 4HG4J 5HGHA 2E74C 4AC2A 2W91A 3D4CA 4ZQTA 4R8WH 4TLUA 2OZ4L 5C07E 3BD3A 2JFCA 3GBEA 3J07A 2FDBP 2WO2B 3LRSA 2Q86A 4GRWF 5CEYB 5JIKA 4JFFB 4WUKH 1AFVH 1NL0H 2UZYB 2DQUL 3IDUA 3PP3H 5I1DA 2HFGL 4LSUL 4GBXB 2VZTA 5B7EA 3QORC 1TSRA 2D03H 4JFYA 4RLDA 4HPYL 4PMFA 1BAFL 3GJFH 5CILL 1KCUH 4OR1A 4C59B 3IDMA 5DHYA 2BFVL 3UJTL 4JM4L 1DUZB 1DP0A 3ET9F 4NO2B 2AJZA 4S11A 4FG0A 2E59A 1OF2A 3NQKA 4A7QA 1HEHC 1S5HB 3DMMA 3VXTB 1X5ZA 2BC4B 3I9IA 3MXWH 2ZF8A 1MW3A 4ZUSA 1FAIH 2KZWA 3NVQA 4PJ9D 2CGZA 2LE9A 3KDMA 1AQMA 5C7XH 1IEHA 1MCIA 3FRUA 4HW6A 2DD8L 4FQXB 4ZNCD 1TZGL 3CSYA 4QY8B 4JQIL 2X44D 3AWFA 3MA7B 5F70A 3PDOA 4NX0A 2V2WB 5I6OA 3H2PA 4PB9L 4JHAH 4WEUD 2GK0B 3UP6A 3BP4B 3B7YA 3VFNB 1FNEB 4FZEL 4PTTA 5E08H 1F97A 1ZVNA 3DOSA 3N3EA 4JY4B 2GCYA 4U1NA 3LZQA 3L3OB 4NUJA 2ZXBA 4PN6A 4I89A 3AWEA 3LKOA 5D7IA 3DHJA 1OP4A 3CN0A 1DLHB 4L9LA 5KYXA 5I6KA 2G9HA 3K2KA 3QQNA 1N2RB 4P2AA 4RX4A 4G11A 2YJLA 2YR3A 4ZUUA 3CZJA 5MEPA 2Y22A 1ONQA 4IOFC 4YEFA 1OALA 1IGCL 2FZ3B 2VLKE 4KK9C 2BX5A 3GMRA 1O7VA 1KCBA 4YDLC 4XE5B 3AVEA 3RDTB 2FLMA 1ASQA 3MREA 2DAVA 4HHAA 4XMXA 5IR1A 1KLUA 2AXJA 1KACB 3GZKA 4L4VA 1EH9A 1NEZA 1J0KA 1TTGA 2C3VB 1EEZA 3NN8B 1DZ0A 5F1IA 4C56B 1BQSA 3EHBB 4RDQG 4K3JL 1A21A 1KPRB 3FQUA 2JKWA 3KVPA 2X3CA 3L5JA 3QH3A 4ZMLA 4EIZC 3TN0B 2DH3A 4PRNB 5A3IC 1E4HA 4AYMC 3G6JE 1RLWA 3OR6B 2GT9B 3RWCB 4AJ0A 3QXAB 3MBEA 4OD1H 4H44C 3TEXA 2CUHA 3HEIB 3DRQB 3WHE0 4LOFA 2BVQA 3HHSA 1RUQL 3X2QB 1XSKA 3G3LA 1EXHA 2F5BH 1YN6B 1YNKL 3AY4A 1XFPA 4L8SB 3EFDL 3JWDC 1WBYB 2FVNA 4NZDA 5HHME 1QFHA 4FFYH 4AENB 3FB6A 5A43C 4FEIA 3MUGA 4PJ7B 1NAML 3QCUL 5EFIA 1OAUL 3PWJB 3VTAA 2JF1A 2EVJA 3RGHA 1FAKT 2AJVH 2NSQA 3DMMC 4FQHA 4OFPA 4P06A 1DQQB 4PJHA 1JRHI 2EDEA 4DCQB 1D5IH 4NT6A 4WWPA 5TQ2L 5JW4Q 1AQHA 2RTTA 4R4FL 1I7ZB 4C8XA 3P02A 2MFNA 5M95B 3EH1A 1QFWM 4TPRH 1BREA 2VR8A 4QTIH 4TS6A 1KIQB 4L2YA 4J5VA 1NMAL 3O6MH 4UQ2A 1DSFH 3MLUL 4TYUA 2Y3AA 3WDIA 2YD7A 3T0ED 3A67L 2IC2A 4TUKH 1EPFA 3TYGL 3L5IA 5D6CB 2VUYA 4JCWA 1NC2D 4PJ5A 4KBPA 3IK2A 5LXGH 4CMHB 1JNJA 4M62H 2P9RA 2ZCHL 4BFOA 1F4WH 2WIMA 1OCWL 3N0AA 4L9LC 3VFGL 1HYSD 3HE6D 4FABL 1T22B 4P5TD 1G1CA 1KTDA 1VGKA 1G9NL 4HS3B 4QKXB 4TOYH 4M1CC 1WFTA 2AKRB 5H35A 4IMLB 2DPKA 3PY9A 3ZQXA 4JCLA 5IBTL 3TX4A 1GGYA 4MS8C 4M5ZL 4U1SB 4A66A 1KFAL 3HRPA 3PP3K 4L4TD 3WE6A 2XWTB 2F58L 2FGWH 1B0IA 1ZD6A 5SWSB 1DJHA 3BHBB 1JSYA 3ARQA 5I71B 5IOPB 3MACH 5EF1A 2EO1A 2KLRA 3SQBA 3K8MA 3U30B 3GBMH 3ME0B 4HAFA 1FFPA 4MNQE 1FDLL 3PDDA 2EQDA 2VN7A 4A2DA 5EWIH 2Y23A 3PV7A 4FXTA 3WTXA 3Q5TA 3MBEC 2VZUA 3RY5A 2EXTA 2VE6A 4TLKA 1ASPA 3LXUX 2WLIA 3E2HB 3L7EA 5CSZB 3VQMA 2XTJE 5HYJA 4G71B 3AY4C 4Q2ZA 3TA3A 1QLFA 2ZZUT 4HIIB 5I1GH 1BVLB 1GGTA 3GMQB 2RMNA 1YEDB 4BWWA 1FORL 5T5FL 4WWOA 2DM3A 4HQQH 4YSDA 2D31B 5JPNA 3NCJL 4PLOB 5F97E 3GSUA 3EJYC 3S3PA 5DZJA 3G5YB 1KNOB 1I8KA 1TETL 2R69H 1AQ8A 3OF6A 1I31A 4P4RB 3UTQB 5KG9B 1X9UA 3Q8AA 4LCVA 3KLHD 3FTSA 1I9IH 5DMIH 2ALWA 2VABA 5LCVA 1TCRB 1V7MH 1BA9A 2BFGA 1I9RL 1ZK9A 5F2FA 9CGTA 5FUZL 4ZUWB 4Q7DA 2V5YA 3IDIB 1O7DC 5C0CE 1E3ZA 4JFEB 3UOAB 2VW7A 3BDBA 4HUXB 1H8OA 5TF1H 4FX5A 1YEFH 4JFFD 3PABA 1R75A 1JS4A 1Y1DA 2W9EL 1KYAA 5DRWA 1IILE 5A16A 1OXYA 3C5XA 4KKCD 5E23A 4Q9RL 1JZJA 4GBXD 3GXUB 1HT6A 2L4OA 3MGTA 3KXFA 3OAWA 2BSED 3GB7A 4OZ4B 5C3TA 4KZEH 1FO0A 2FX7H 5EBGA 4DP4X 4Z7NF 4JO3H 3VG9C 5B38A 3W3BA 4ZS6C 5C2UB 4AGLA 2K8MA 3K71B 2NOYA 5IFJA 1QPXA 4DKEL 2YGOA 4I77L 4R9HA 1UXWA 4YJZL 4NQQA 1ETJA 4HK3J 3EOBB 1Z9SB 3RWEB 2A83A 4RZKA 4PRPB 3DK2A 5GIRA 3SO3C 3MODH 3SDDB 3LZNA 3MJ8B 5C0DA 5GGRY 1MAJA 2ADIA 1PKQB 5KSBE 1FA4A 4H0HB 2K6YA 5D4JA 3GSOB 3KCPB 3PHOA 4FQXD 4FCAA 1E27B 3PAUA 4E9RA 2ED8A 1RK1A 2Z4QB 4G8IB 1MDTA 4FQ2H 4XR8C 4ZTPH 3V5HB 4N20A 1LMIA 5EIQA 5ITFA 4HJTA 5HHPA 4Y16B 3ULVC 2YAFA 3TEUA 1AZUA 1Y1UA 4WFHD 3ZDYB 1G7MB 5E03A 5LB1A 4OCWL 1Z6JT 2IVFC 3EO9H 5DUJA 5LBSL 3OVUB 5ANMA 3HJ0A 3N44F 5GQBA 2X1XR 1TTRA 3L4ZA 3S2CA 1WCBB 5FB8B 3TA3C 4QWWD 3A3YB 1HH6B 4GAYA 4N3UA 1A7NH 1GGUA 3K46A 3TLRA 2NW2B 3V4PL 5JPNC 3ARZA 2JIXA 4Q6IB 4XAWL 3L17A 2OXGB 3NSDA 2VDOL 2QVIA 3AUWB 3RDTD 2VMDA 2X53A 1YJDH 3Q2NA 5INDA 3T77A 2HMIC 4YUEL 1OWRM 2YQ3A 4FQIL 1GC1C 3P69A 1CL7I 3LKRB 3U0WL 3QFDB 4C56D 4MRCA 1R5IB 3EHBD 2KC0A 1EMTH 3HR6A 4K9JA 4U6HA 1Q72H 1UYWL 4FL4B 3ILDA 2K8QA 4PJAA 3B3IA 3LS5L 5ITBL 3TN0D 2EVFA 3TNMB 4GAGL 5G4MA 4L8DB 2GFBB 2OZ4H 1JWUA 1F90L 4F33A 1MVFA 3QEHA 4OD2A 3CD4A 4CVXB 1N0XL 1Z66A 4Y4KB 3LAFA 2DQUH 3NCEB 2J8UB 2HFGH 3L3KB 1S9WB 4LSUH 2QDVA 4NQEB 4ZO6A 4I85A 4AEFA 3I2CL 25C8L 5F7HA 4HPYH 4M9PA 4UILL 3FZUD 4QXUL 4JUTA 5CILH 1G87A 4RAVA 5CSBA 5B1JA 3QZOA 4AL8L 2JI3A 3GMNB 3X3FL 2BFVH 1T89A 4JM4H 3UJTH 4PFEA 3SHSA 1I3VA 2PPEA 4GPVA 3VXUA 2P8PB 2CDGA 1KTLA 4M6ML 4OSUL 3TBSB 3T1WA 1BZ7B 3HJEA 1R24B 3FRPB 3T8MA 3MO1B 4WGVB 1AGEB 4PR5A 2MCMA 3D07A 2XQBL 2K0RA 3MRFB 4ZMWA 2DD8H 2W65A 4X6DB 1HK6A 1TZGH 3EAKA 1J7VR 4G1MB 4JQIH 4ZMOA 1YEIL 4AX3A 2EDHA 4B5ZA 1SXBA 3MUUA 5AG9A 4IU3B 3ZTNL 5CCGE 1AD0A 3KLAA 4PB9H 5EUOA 1BEXA 1UH2A 1N3NA 1J9QA 1QRNB 4FZEH 4KJYB 1WZLA 4Z23A 4EZJA 2VDQB 4UV4L 1SHMA 2CE6A 3CSFA 2W0FB 4GRWB 3PL6B 1UEYA 4P4KB 3VSUA 4A7GA 1CTNA 5IEHB 2MMXA 3H9SE 3EYSL 5F44A 1VZHA 3ZO0A 3OWEA 3W81A 4AKOA 2A9CA 1T1WA 1B0RB 1ET8A 2FIKA 3FDWA 4JJ5A 1SPDA 3BQUB 4OIBA 5EN2B 3RUGE 4ABUA 1BIHA 1IGCH 5C0EB 1C8QA 1JV2B 1XZWA 2OR9L 3NYKA 3NFNB 2JJWA 2C9SA 1AIZA 1ZV5A 2M2DA 2OSLB 2UXTA 1G9HA 3DJRA 3KLDA 1ZHKA 3MQIA 2F8XC 2W9DL 3JWOC 3O8XB 2ESVB 3JTSA 1VLXA 3BGFC 3PLYA 4ZYKB 1QR1A 1QSVA 3STZA 1RK0A 5BZZA 4TM9A 2OMWB 5EO0A 3MLTB 4JFDB 3GMLB 4K3JH 4XBGB 4WFEE 4LLYB 3D3VB 1BXUA 2DLFL 1FLTX 1MN4A 4GSXA 2Y2TA 3DRTA 4RSYA 2RBLA 4LOUD 1AS6A 1ZGLB 3C6LA 3S37X 1F3DJ 3MRJB 2QLYA 2VR4A 4JO1L 3X11B 3UZQA 1TVBB 2LU7A 4JFPA 4P5MB 4ZMPA 3FO1A 3JUZA 4IBTA 2AV1A 2AEIT 1RUQH 1QHQA 2WVVB 4MAYA 4WGKA 4LVEA 1YNKH 2A9AA 2B0SH 5DVKA 1MVYA 5D93C 5B1JC 1X5FA 3EFDH 1R3HA 4GB9A 1CICB 3GLDA 5HY9B 1G84A 1JHLL 3HG0A 4JBSA 1T89C 1MCFA 2APXA 1XL6A 1JE6A 1NAMH 1NKOA 2CO4A 3QCUH 3TURA 1OAUH 1UC6A 2ZT9C 3C5SA 3S35X 1ADQL 3S3SA 3FW6A 2WNGA 3GI9L 2ENYA 4KWUA 4G7VL 1EERB 5DFVD 5TQ2H 1SM3L 4R4FH 4R97B 3VG0H 2JB6A 3U1PA 2X5PA 3IFPA 2ADYA 4JFED 3BE1L 4MA1B 5SWZB 2XWJB 4FG2A 1B0GA 5LGJB 3UYPB 2FT8A 3LEVL 3RBSA 5BQDA 3OLGA 1D5BA 1NMAH 1SJMA 3PU7A 3MLUH 4LVHB 5D7KE 1K3ZA 3JUYA 1O9ZA 1WTLA 4FQQA 4Z18A 3A67H 2P44B 1IGFL 3QJHA 5IK3B 3CHXA 3TYGH 2WBKA 1DEEA 3SCMA 1KTRL 3VCLA 2XN9D 1G1YA 5AAWC 3HMWL 2ZCHH 3AXIA 4XO4A 1OCWH 3VFGH 4UM9B 5JHLA 5I17B 3JQOB 5ISZA 2UY6B 4FABH 1I1CA 1M6OA 3LSOB 1G9NH 2EDQA 4M7LT 1KJVA 4RH4A 1YO4A 1JGUL 3FN0L 1ZAGA 3FQWB 4LLQA 1ZLSL 3SDDD 3C60C 1XD0A 2B3RA 4YHIB 3PHQA 2EXSA 5FO2A 3BAXA 4B6ZA 3D39A 5IBTH 2A0LD 2M26A 4M5ZH 1KFAH 4Y5YB 3T5WA 5DJDA 5J1TC 2F58H 2EIZB 1XGYL 4FDWA 3KG5A 4DK5A 2J72A 1T6VN 4F8NA 3AMLA 3SE8L 5CMAA 4R4BB 2CDEA 4Y16D 1NFDF 2XA3A 1QQDB 2EO7A 1NGQL 2FGZA 4Y5VA 4X98B 2FJFA 3QDME 1FZJA 5D7LE 1XO8A 1FDLH 1ES0B 1UHVA 2C9XA 2D73A 1W8EA 2EDFA 3C6LC 4U0QB 2X1WL 4MQ7A 1V55B 2RR3A 3JVFC 3KYOB 2CAKA 2FR4A 4ELDA 3GJEA 4QHLA 2V2XB 2HT4C 1UM5L 3F7QA 4L29A 4YHNA 3ZGHA 2XNAA 3QULA 4MAYC 5L2JB 4YSSA 1F58L 1TJIL 5EU4A 3WLWC 2V9TA 1O5DT 5I6NA 5KANG 2MKWA 2R29L 2F8IA 1MQ8A 1FORH 3DGGA 4HH9A 4OZHF 5T5FH 2Q6WA 3TOPA 1IAKA 2MOGA 3NCJH 2C1OA 2V33A 1LXMA 1WLHA 1FI8C 1TETH 1XIWB 3MRGA 3VD3A 1IBGL 1CDCA 1UUSA 3RJQB 1JPGB 4DGYL 2H0EA 3U6XS 2AS5M 2X4PA 3IJEB 4HISA 2EUWA 2DRUA 3ASNB 3BO8B 1I9RH 2AK4A 3OD3A 5FUZH 4NPYB 1WAAE 3BW9A 5AW9B 1G7JA 1KBKA 4Z76B 1ROCA 5BUPA 2UZXA 4TSBL 4F8PA 2ITCB 1WA1X 1XZ0B 3C8DA 4U1IB 1J1OL 1UZ6E 1GPOL 4MXQC 3WFZA 2SODB 1JG9A 4GKLA 5F89A 2W9EH 4Y4KD 3RA7L 4GKNB 1HVXA 5FWRA 3L7FA 2XXMB 3SCMC 4PJBB 4RVBA 5IMMA 4Q9RH 5F8RC 4IKNA 3DO3A 4JRXB 4IDLA 4NCC1 4P3DB 4XHJD 4WI9A 4PP1C 4NNYA 4LP5A 1LP9A 3A6OA 5IVXE 2ICES 4ALAL 1U8IB 3LQZA 3CZKA 2VR6A 4XP4L 4I77H 1AG0A 3ZKMD 5FYKL 5E5LA 1DLFL 2GY7B 4DTGL 5I26A 4MMXB 4E9TA 3APFA 2PW1B 1OE1A 2JKRM 1C9SA 1IKOP 4IK7A 4RGOL 1X5YA 5DRNA 5I23A 2ADFL 1QFOA 2YHGA 3B9KA 4WKXA 4EN3B 2H2PC 1JBJA 5E6ID 4FEMA 1GXEA 1Z1WA 3U9UA 4K7FA 5MEQA 4YH6A 4ZMAT 4G8GB 1TZ8A 5JIPA 4Y5VC 4U0RB 1COBA 4NKMB 3P4MA 5C09B 4BE6A 1KJ2B 3OPZL 4N85A 4XMLL 4U1JA 1IEBB 1XGPA 1QRND 3B9AA 4TNEA 3NP3A 3S8WA 1CGWA 5K1NA 4OCWH 5IB2B 2UUDK 3P77A 2KH2B 4LEBA 3RVTC 2J2ZA 4CGTA 3FCUB 5LBSH 4F91B 5C92A 5B3JF 4ZNEE 2H0JA 2CHWA 1H3TA 4Z0BL 1NDTA 4X50A 2RA1A 2IO5A 4RQQA 2WLJA 4AV0A 4NGHL 1ZOXA 2Y4SA 3QARA 1LYQA 1NCGA 4MNGE 3BQUD 3C08L 2WINB 4ZMYA 3Q13A 3V4PH 3AMKA 3QORB 2HPOA 5JIDA 4XAWH 1E40A 5J7CC 2BM3A 3QFGA 1PZCA 2VDOH 3HZVA 4J6IA 1BVOA 2GITA 3O8XD 1RK7A 1IC4L 1GL4B 2GIXA 2ESVD 3I6KA 2H6PA 3CFJA 3M1BA 4FQIH 3F12B 1Y07A 4GW1A 3U0WH 1R34A 4KOBA 1CDUA 3L9YA 3APMA 2WB1A 4BBWA 1U58A 5BCAA 4WU7B 1N26A 1XD1A 2DJSA 2ZG1A 3OLDA 1JXDA 3BZFB 4JFDD 43CAB 1UYWH 1H3WM 3D3VD 3V0VA 5FLUA 4PJAF 1QNIA 3LS5H 2VDPB 5ITBH 1S4IA 3K1KC 3CHOA 4X9IA 1H8SA 4GAGH 4GRLA 1LD9B 3R7QA 4URKA 1HZLA 1F90H 1RZGA 3P30L 4UZGA 5BS0B 1JTTA 2OMUA 1Q94A 3HNVL 3TVMA 1N0XH 1N8OE 2CU9A 2YSSA 2WC7A 4X9HA 3DX8A 4UOQA 3KL0A 5FYKD 1FYTE 3AREA 3CSTA 3I2CH 25C8H 1PVHA 4UILH 5KVGE 5D7HA 3QZWA 4QXUH 3T1FB 2FO8A 1HXMA 3MCYA 4JVWA 4YGAB 4AL8H 4K94L 1G0DA 5JW4N 1SMDA 3OQRA 4D94A 2YD1A 2AEWA 4AK1A 2X38A 2Z7YA 4M6MH 4OSUH 1TQSA 1N5AA 3B9KC 1AYRA 4AIZB 1JYXA 2FO4B 1NGYB 2A5UA 2CJ3A 1V7NL 1N6UA 3DX7A 3GGWA 1JN6A 2XQBH 4IHOB 3SD2A 4XMKL 3TESA 4B7LA 1DVTA 5D2NE 3CC5B 3V52L 4ODBD 5T1LD 1PLBA 2I25N 1YEIH 4HKBA 3RBGA 2FYVA 2IALB 1MY7A 3ZTNH 2ARJB 3CFEB 3U9PL 1KIRB 4CC0A 3IDXL 5KTEL 3D30A 5IHZA 4XN1A 2VLRB 4L9DA 5F7WC 1UOWA 2FT7A 3W39A 2VMEA 5F6HJ 1UM4L 1XBRA 4B95C 1KT2B 5HGHB 3WFCL 4UV4H 4UM9D 4UTAL 3W38A 3LRSB 4JJOA 4A7GF 1AACA 1KV7A 2Q86B 2WXNA 2A6KA 5E1IA 2QQKL 3EYSH 3WUWG 1A4CA 1GS7A 4POUB 5EOTA 1KJMA 1YMHA 3LHAA 5I1DB 2QSVA 4BFRA 5HSFA 3U36A 1CFMA 5LKNA 3ULSA 5AVRB 5A2LH 2Q9OA 1F13A 2BSTA 2OR9H 2WXRA 5AAPA 1ZXKA 4PG9A 1FVCA 3WAJA 5HGBB 2LT9A 3DROB 2W9DH 4EN2A 5DHYB 2E7MA 2WXFA 3OB0K 4HA1A 4U6XA 3IMUA 4WUUE 2N7SA 1MFEL 2AJZB 1OF2B 4BFJA 1ITBB 3DMMB 4QUOA 3MGAA 3B7SA 3LVTA 4XVJL 1GOFA 4ZXBA 2BP5M 4ZUSB 2G2RA 1Z9LA 1JP5A 2DQDL 1J5DA 4GW5A 1WJ3A 2QL1A 3KDMB 2DLFH 4GRLC 3FOMA 3FRUB 4HJJL 1KJ2L 3VSTA 3CSYB 3BN3B 1VGEL 5AB1A 4JO1H 3PDOB 1SDYA 3FS9A 1MOEA 3BQVA 3TVMC 5LNDA 4P5RA 3FRPG 4JEGB 3SBQA 1SBBA 32C2A 4H7VA 1FGNL 3I9AA 4A6YL 3GUTA 3QG7L 4PTTB 4PP2A 4M8RA 3ZJAA 4OLEA 4GLRH 3DOSB 2BS9A 1J9RA 5AAMA 4GUQA 2BHZA 1NLDL 4U1NB 4QNPE 1QSZA 3LRLA 2CR0A 4NUJB 3KLSA 1JHLH 1QFWI 3LKOB 5D7IB 3QJFA 4L37A 2BSDA 2F2HA 4L9LB 2CBQA 4EUPB 2VSDA 5K1JA 5E5RB 3IETA 1A3LL 4K7PL 1VERA 3QDGE 3O3EA 1LGVA 3NGBC 4JPSA 4ZUUB 1QUPA 2ZWYA 1ADQH 1JGLL 2CK2A 3E8VA 4JFXA 1ONQB 3GI9H 4KQ4L 3D50A 5IB4B 4G7VH 2X4SA 1SM3H 3K2UL 4KZCA 1A5FL 1DVSA 3GMRB 1BXAA 3BE1H 3MREB 2Q3XA 4OGQC 1EVTC 1LMKA 3A4FA 4N0YL 3LEVH 2NW3B 4L4VB 1NEZB 1CFQB 5F1IB 3TFKD 1EEZB 2WGNB 2KPNA 2GJ6A 2VDPL 4X4XB 3RWDB 3RWIA 1E3FA 2NYZA 3TV3L 1IGFH 3FQUB 3IPEA 5ELIA 3CN3A 4JRXD 5INCA 1H15B 2LR4A 4CVZA 2F7QA 3QH3B 4YDNA 3HMWH 1IL1A 3QIUA 1NICA 2VISA 4XB7A 3L2MA 3MBEB 3DVGA 5F7EL 1N18A 4FTVA 1BBJA 1XVSA 3FTYA 3DYMA 5GS2D 1C12A 3CHRA 1JGUH 3FN0H 1ZLSH 1BAWA 2GW5A 4HUKB 1X5MA 3A6BL 4KMQA 4EN3D 3KBPA 3CMOL 1Q0EA 3QVAA 4BINA 2H32H 3FB6B 4Q56A 4YHZL 1M6UA 3MUGB 1S7VA 2VW6A 4AMWA 5EFIB 2VN4A 1IGML 4XWOC 2E76C 4FQHB 3ETBJ 3SE8H 3QQXA 1WA2X 3T4AA 4ZXBC 4CMMA 5C09D 4UBDC 3VFSA 4BQ9A 4QJ5B 1NGQH 4F93B 2COQA 3BAIA 4NT6B 4X80L 2A2QT 1A9BA 1T6WA 5JHAA 1OANA 5D1ZD 2J8HA 4NQCD 3DK0A 1KPUA 4UQ2B 1U0QA 5ICZA 4NKIL 1UM5H 3DNKA 4XAKD 1DJZA 2WXJA 3RB5A 1F58H 1TJIH 2VCOA 4GRWH 5AAMC 3LPGA 3JVGA 5L7XH 1JVLA 4FXKA 4OM1L 1S9VA 2X88A 2R29H 5FV1L 4MCYA 3CQFA 5DWPA 3Q2CA 3VG9B 3K81A 4HLJA 5AVQB 5DWUL 4XOCA 1KTDB 1VGKB 3ZQ9A 4Y2OA 1NFKA 2E9BA 1IBGH 4OW6A 4TNWF 3TH2T 4WFFD 3FPYA 3JWDL 5H35B 4DGYH 2G0KA 4KI5F 3Q43A 4ZFQA 3ZYOA 1ASOA 3EGXA 4YVUA 4UYPA 3SO3B 1JZ7A 1EFQA 1NGWB 2OJEA 4TSBH 1XBDA 2OYMA 1J1OH 4NJAL 4LPXA 1S7TA 3VUAA 1E5BA 1GPOH 3ZXAC 3O4OC 2XWRA 3SQBB 3LTVA 4JO4L 3RA7H 4ZW5A 1FFPB 2EDJA 2LLLA 3O2DA 3CLWA 4L1BA 2OR8A 4AKPA 4UB0L 1PIFA 3KCWA 1F18A 4WENB 3FBKA 3VRJA 3WV0A 4ALAH 2VE6B 3P1VA 4QCIA 2CPUA 3KGTA 5CR8A 2WLIB 4XP4H 2XG5B 3L7EB 4FMVA 2EIEA 3ATAA 3MRIA 1LQSR 5FYKH 4JHBA 3WIHL 5HYJB 1DLFH 3UJIL 4DTGH 4PRHE 4B60A 3TA3B 3AQDA 3FF7A 1QLFB 4RGOH 5D1XA 4NLHA 2OSYA 2ADFH 3LNFA 4PG2A 2MKLC 4IOFD 4UNVA 3QZLA 4KK9D 5JPNB 1G0XA 4R5VA 2L7EA 2P4AB 3GSUB 2XIDA 2IOIA 4NFCA 2X4OB 1I8KB 3LDBB 1TO5A 1JZ5A 3T4AC 3VRLF 4FNTA 3LV3A 4TNFA 2CJTA 1G7PA 3DX6A 3RG1C 4X7CC 2EC9U 3OPZH 4XMLH 2P24A 1ZANL 4JX0A 4OTXL 1YUHA 1EZVY 4EOWL 1X9RA 5B4MC 2BVOA 5A3ID 3QG6B 3BIBX 1GZQA 1F0LA 3PABB 3E8UL 5TDNB 2EIBA 1FLRL 5A16B 5DRWB 1A47A 4NGHH 3S9DB 3JVGC 1IAMA 1JZFA 3KPSE 4FXKC 5DRXA 3T4YA 2BY3A 3MGTB 4XCYA 1A3QA 3KXFB 3GB7B 1UB5A 5DK2B 4F37K 1FO0B 3HKFA 4OZGE 1NOAA 3QNYA 4M5YL 2F54A 4MJ6A 4NAMA 3SYCA 5IFJB 4GW4A 4PHXA 2EIKB 3QJZA 5IHUL 1BFOA 5HHOA 5C0BA 4C58B 1IC4H 4CW1A 3IF1A 4MB4A 1UXWB 4Z5RA 1EBPA 2A83B 2JKLA 2X87A 3FT0A 4FYTA 4LCWA 5EC1A 5KJ7E 3BRDA 2IH1A 3IMRA 3LH2H 5GIRB 4OCXL 3VI4F 4EDWH 3U79A 3WCYA 5C0DB 1KXQE 4YLCA 3EIFA 3X1NA 1UG9A 4RBPH 1JDAA 1JOIA 2F7PA 5CEXA 4W9HC 3PHOB 1V27A 4G3YL 5EBLA 2A74A 2IANA 5A2BA 1RK1B 3POHA 4HXAL 5ITFB 1I4FA 1KYOJ 3OMZA 1EDYA 5AW0B 5HPOA 3H3BC 4MB1A 5HHPB 2A6DA 3P30H 3S5LA 2Y6TE 2VGLM 4LL9A 3HNVH 1HWWA 3G5ZA 5CD3A 4AT6B 4U6VL 3V0EA 1FZKA 1K3IA 1WZKA 5ANMB 5ANHA 2AVGA 3RZCD 1FZMA 3SDXE 3AS0A 1WRFA 3N40P 3E38A 4K94H 1WGVA 3KGSA 1G7HB 2DIEA 2Y5TA 5D1XC 3ZT5A 5IJBC 3R4DA 4GAYB 4PG2C 2WQSA 1TQUA 4HHWA 2DJMA 3ECVA 2JIXB 1LDSA 1V7NH 3UABA 3AM8A 1H6TA 5DO8A 4E0RA 5INDB 3T77B 1WFOA 3OKYA 4XMKH 2EYRB 5J4MA 4L4VD 3V52H 4CADA 4IRJA 3H3PL 1XCWA 3H54A 3HKZA 1I3UA 2Y7OA 4HEMA 3BGFB 5TTRA 4XZUA 3U9PH 3IDXH 5KTEH 4U6HB 5FK9A 3EW3B 3D9AL 2X2IA 3AGWA 3ARXA 3FT9A 4PJAB 3B3IB 1OTTC 3QFJE 2YRPA 1UM4H 2PP8A 5DVLA 3ULUE 1VKXB 1NZRA 3VE0A 1DJYA 4UT7L 2H6UA 2H2SC 5AVTB 3WFCH 2PNDA 2PR9A 1SXNA 4UOJA 4UTAH 3ULVL 3MBED 1JWUB 4PV8A 1VESA 3ML8A 2H9GA 4OZIA 5IF0A 1J8HA 1JPTL 4OD2B 2QQKH 2DQEL 2WJ7A 1U3YA 4R90L 1MCCA 2YA2A 5KVEL 1IJNA 2R1XA 4U3HA 4PJEF 1U6AL 1GCFA 4PJIA 4TULL 5D93B 3BYYA 4H0GA 4RAVB 4G5ZL 4WI6A 5M94B 5FFGA 3LQAC 2YD6A 4M8QB 2ADJA 3SPHA 3QWQB 3QDJE 4M6AA 1OK0A 5CU9A 1MFEH 2X09A 3N85L 3SE6A 3VXUB 3P0GB 4FE9A 2CDGB 1KTLB 3W0WE 1CJYA 4PV9B 3F7RA 5EEUA 1PY9A 4XVJH 1BEYL 2N01B 3WEBA 2DQDH 2EDWA 4PR5B 1X6LA 5K93A 1GC1L 2A74C 4LHQB 5E24E 5LCVL 4HJJH 1KJ2H 4NSKA 3T3MF 3AT0A 4WKZA 3QEQE 1HNYA 1VGEH 3Q3GA 4PJFA 1I9EA 1AD0B 3EO1A 3HG1A 3BAEL 4LNRA 2BNQA 4QTHA 1YMMB 5KVDE 5EUOB 4ANVA 1FGNH 1F6AA 1N3NB 1WIOA 3HFML 3QG7H 4A6YH 2V7HA 5EPMA 2Y5EA 5I66B 3DHPA 2ZKHL 2AEPH 1NLDH 4X6CE 5CLYA 1NBQA 2Z4TA 5SV4A 1RHFA 4FLSA 1WE5A 4FCHA 3G6AA 4ZS6D 2B1AL 1BD2E 4DKDC 2ENSA 3V7AG 2DLHA 3M1CA 4M00A 1VEOA 2Z91A 1FO0L 4K07A 4YDMA 5ENWA 5J3HC 3ARSA 2Y72A 1A3LH 1ZKAA 3A47A 4K7PH 1CGVA 2FIKB 1BJ1J 5GHWH 3UMTA 5KYYA 1E2ZA 1JGLH 5IHBA 2F5AL 2GUOA 5BOJA 4KQ4H 3C60B 3AM8C 3NRQA 4I3SL 2PR4L 4FA8A 3K2UH 3L1GA 4NO3A 1A5FH 4FN0A 3PJSB 4JRWA 1FH5L 3BVNA 1ZHKB 3HC2A 3LIZA 4Z78B 4FKEA 5EF2A 3KYAA 5LJYH 2H26A 2ZOKB 4IRJC 2WV3A 4N0YH 4Z95H 5CP3A 3JTSB 2X6UA 4E9YA 3T3PF 4DH2A 2CJUL 5BZDA 5L9DH 1QR1B 4EI5A 2J55A 3STZB 1RK0B 2VDPH 1PQZA 4XO3A 5EO0B 2V9UA 3TV3H 3U2SA 5ACLA 4Y4HB 1GYCA 3ULVD 5EZIL 2WLHA 3TJHC 1WZ1L 2CO1A 1QBAA 3FSZA 4MXVF 4RETB 5DO2C 3DRTB 4N6RA 3G9VA 1MCHA 4RGMB 1W2KT 3UZQB 4JFPB 5FYJD 5F7EH 3FTWA 4BQCA 5HYJD 4UCFA 2EZ0D 3LMJL 4GYBA 4H13C 5L4FA 3FO1B 1JAEA 3PAYA 3TA3D 2AV1B 1NANH 4MAYB 2N0MA 3A6BH 2K3HA 2QHRL 1EZLA 4PGBA 1R3HB 2EAEA 4QRPA 5IMLA 1PIGA 4H26B 4OB5L 4AIOA 4YHZH 2O61A 3OF6D 3HLAA 1U8HA 1FNFA 1IGMH 2HMID 3TBVB 2WNKA 3C5SB 1B4JL 5AEAA 2QKIA 3CDZA 3U6RA 3WE1A 1T3FA 5HYQA 3L9RA 4X80H 5TGBA 5DJ8A 3L48A 5A2IH 3JWOL 2JB6B 5KANI 3IFPB 5C08A 3F7LA 4LPYA 5IP4A 3GSNA 2APVA 3BAYA 3GRWA 3QXVA 4XN4A 1D5BB 2CZNA 5C6PB 3W5NA 4FQQB 1NINA 1T2QL 4NKIH 4NCDA 3QJHB 3AACA 4ZOEA 3WL9A 1E8YA 3GLEA 3P4NA 2QV4A 1DEEB 1LNUA 3RTLA 3SCMB 3VCLB 1PY4A 4OM1H 4GT7A 1TZAA 4H2AA 2C3GA 3LPFA 2F7IA 4PS4L 1NEZG 1X9LA 4NPKA 3T6XA 2JELL 4L5FL 1FVDB 1M6OB 2NMSA 3KH3A 3MROA 4PBVC 5DWUH 1MSPA 3MKKA 3OKMA 1SJVA 3NPSC 1CDHA 2GHZA 2Q76A 3JWDH 2G2PA 3PHQB 4HOWA 1XMEB 2QTVA 4CILA 5B21A 1P9MA 3ZE2F 3UBFA 1VFAB 4HS6A 4Z7OE 2WUCL 2XWXA 3IPFA 4F7EA 5I1AA 2VOTA 3RRQA 4EI5C 1U8MA 4NJAH 4ODWA 3T0AA 5CMAB 4BKTC 3PDGA 1ZGLP 4N8VA 1S9KC 4Y5VB 2FJFB 2JJTA 4JO4H 1G5GA 1FZJB 2FWLB 5D7SL 4EJ1C 2E47A 4JFQA 4PJGF 2ZP0T 3MGOA 4UB0H 3DPDA 5T1KA 5GRZA 3AS3A 4MQ7B 5B8CA 4WI0A 3ZIMA 1GKOA 3GJEB 1PZAA 4LLWA 4QHLB 4Z7UA 1FFRA 4HIPA 2NXYC 2PF6A 4L29B 4YHNB 2RH0A 2XNAB 3QULB 3UJIH 2NZ9C 4N87A 4LIQE 4NUMA 1XF2B 1HHIA 4MCNA 3QWRD 5EU4B 1KTBA 5DK0A 3OMIB 1A4AA 5D6DA 2J5WA 1KULA 2LFEA 1U8QA 2JLPA 3WKMH 4HH9B 3DGGB 5GZOD 2HJKA 2Q6WB 1IAKB 5DYFA 3D52A 2C1OB 2CK0L 3ESVF 5TE7L 2N56A 3BIKA 5C0AE 4QAWA 2QKIC 1KENL 3O4LA 4BJLA 4MWFA 2QBWA 2QGBA 4KDTA 5AVZB 1FG9C 2CRZA 2YUWA 2X4PB 5C1MB 2P5WA 1AS7A 1CQYA 1ZANH 2AK4B 2FB4L 4MVBD 4OTXH 4AZ8A 3BW9B 1G7JB 3RHWF 2PXYA 2UZXB 4X4ZA 1YCSA 4EOWH 2BOBA 4QRUA 5FKPA 2A1WL 5BZWB 1HL4A 3T0EE 4BZ1A 2CM5A 3UTZA 4RAHA 4JDEB 3E8UH 3NRFA 1KV3A 1NUNB 1FLRH 4Y1SA 1KGXA 4PBWD 5F89B 4X4YA 2AJUL 3L7FB 2ZF9A 3B5GA 5IMMB 3EG9B 2ZXGA 3MBXL 4QRQA 1VZGA 2O1AA 1HJCA 3QUMA 1EJOL 3LQZB 4M3KB 3HN3A 4M5YH 7PCYA 1OEZW 2D9QB 1U8CB 5IHUH 4CAGA 3PPEA 2RALA 2VR7A 4PJXA 3VXUD 1TQBC 4XWGL 3N06B 2ZTBA 5DRNB 2OZNA 1P9MC 4OCXH 2HTKC 4LLVA 1U8PA 3TEWA 3B9KB 2AFNA 4L4TE 4EKJA 1EXGA 2YEZA 4KK8C 5HDBB 1GGIL 4NUPA 3W9DA 1E2WA 4JHUA 5FW7A 2ATAA 4G3YH 2VDNB 3U9UB 4K7FB 4ZFOA 1R47A 4XNXL 3F7PC 1MCNA 4RWYL 2K6WA 2MNUA 1BZEA 1PZ5B 1LWRA 4HXAH 4LT7A 3RZWA 1TNNA 2JJTC 4O00A 1XGTA 3CXDL 1N67A 1K2DA 3P4MB 1YMMD 1EEUA 4U1JB 4JAMA 3CHQA 3JXAA 3ARFA 2WQAA 4FFWC 4I0KA 2WQVA 4U6VH 4AV4A 5B8CC 3P77B 2J2ZB 2WBWB 3ZYZA 4GLRI 4Z7WF 3Q2WA 5BPPA 5HPMA 1OTUD 4PCYA 5EOCL 3UMNA 2W94A 5D6DC 4MB5A 3NCBB 1KBGL 1NJ9A 3DYPA 5JHLL 3V6FB 1QR4A 3C60D 3FU0A 1MIMH 4RMVA 2OMZA 5I8CA 5EF0A 3GBLA 4BHUA 1G7QB 5IQ7L 3Q5YA 1M42A 3LRMA 5LGHL 1J8KA 3HZVB 1MCSA 3EYVA 5IMKA 2OYPA 2GITB 3I6KB 2H6PB 3CFJB 4KDTC 4LLAA 3S4SA 3O3AA 4GW1B 1MHHA 5D5MA 4M1DL 4XE0A 3H3PH 5DHEA 3VFUA 4N90D 1U58B 1RU9L 5MEND 1AOHA 4Y4HD 4PCSA 5FFOA 5B38G 6CGTA 1PL3A 3CUPA 2PXYC 5IQ9A 3D9AH 3V0VB 5CR1A 3PWUA 3S8GB 3U0TB 2F68X 4DWHA 3AWGA 4UT7H 4B9JA 4GRLB 1YEHL 1NWOA 3ULVH 4PRIA 3L16A 1HL5A 5LNGA 1RZGB 4F5CE 1JPTH 5HDLA 3CX2A 3QUYA 1Q94B 2VLJD 2DQEH 2O5XL 4PGCB 4R90H 3TVMB 3CJJA 2YSSB 4LSTL 5KVEH 4MAYD 1A4KA 3PAZA 2VNCA 4JHWL 3DX8B 1IB5A 3WLWD 1JFQL 4BRVA 1U6AH 4PJIF 4TULH 4JHVA 2YGPA 3QZWB 5EO9A 1AZCA 1JYVA 2ZPKL 4G5ZH 1HXMB 1I8LA 3BLBA 2WNWA 4J6RL 4MJID 1HCZA 3VFMA 1SNRA 3MRQA 4NQDE 3ZVVA 2E27L 1S7QB 3WJLA 3LIUA 1RZ7L 3N85H 1WT5A 2JCCA 1I75A 3LEXB 4J2XA 4IBLT 1BEYH 3NGBB 1FWXA 2OMTA 3DX7B 3GGWB 3OJDA 1GC1H 4JO8A 1JN6B 1E90A 3NOIA 2WTPA 3BPOC 5LCVH 2A6JA 4N1EA 4QRAA 1LE5A 2FWUA 5EU5A 4A1RA 4HKBB 2YOAA 1M2VA 2ZOTA 2WO4A 2Y7SA 3ARFC 4MXQD 4R7LA 12E8L 3BAEH 4KPHL 1OAKL 2XIBA 1K6QL 2AJSL 5IHZB 3HFMH 4JG1L 3W39B 3FAXA 3SCMD 3ZY7A 2P45B 1HS6A 2ZKHH 1TEYA 1A65A 4BE5A 1ZDQA 3WN5A 2B1AH 2DOCA 4E41E 2A6KB 2ZXCA 2N59A 3VM5A 3PUUA 4A68A 1FO0H 2WTRB 5EOTB 3UAFA 4ORGA 1KJMB 1YMHB 2AXGA 1HDMB 4NRZB 2F5AH 1LEGA 3ULSB 3NABH 2F8OA 2FE0A 3PQYA 2BSTB 4I3SH 1XR9A 2PR4H 4I7ZC 4EIUA 3RKPA 3V79C 4PG9B 3MV7D 1FVCB 1FH5H 4NDMA 1PAMA 1R19A 4BFIB 2XG4A 2YPVA 1M9SA 4U6XB 4OKVA 2A38A 3REVB 1KMGA 4K3EL 4I4WA 3S7GA 2CJUH 3WXVL 1FL6A 1NCAL 2XCMC 1KN2L 1Z0MA 2VDNL 4ZXBB 1SJEA 3PP4L 1KGCE 2DLEA 2G2RB 2ZICA 3VFVA 5EZIH 1LILA 1HHHA 1WZ1H 4GW5B 1IGYA 3FOMB 2CCLA 3V6OC 2MEJB 3RVTD 3WEXA 4KRNA 3OC8A 2IGTA 3QUYC 5FHBL 4KXDA 1YRKA 3ZYIA 3LMJH 32C2B 1WCQA 2ZP8A 3MZGB 3GUTB 4K4KA 4MD0B 2CH8A 1QHPA 4PP2B 3RJDA 4A2HA 4D7BA 1CT8A 1IBDA 2QHRH 4TLSA 4U7KA 3MRLA 1J1XL 5FDYA 2BY1A 5BO1L 1F3JA 1CGSL 4YWGL 1OP3K 3QJFB 4L37B 3STBA 3WJLC 3Q6GL 1F42A 5FM5O 1WT5C 4DN3L 5H8DA 3C8KA 2HLAB 3IETB 2QADC 3G5VB 1B4JH 1B90A 4HKJA 1WS8A 1FRGL 1DBBL 2QQNL 4KI5D 5HJDA 3ALPA 3PF2A 1BMZA 2OMYB 1AY1L 2WYZA 4DAGL 2I9TB 3ORJA 2AK4D 3FUEA 1PDKA 1PTZA 2WKOF 2X4SB 1F1AA 3JWOH 3V6BR <