3DJFA

Crystal structure of schistosoma mansoni purine nucleoside phosphorylase in a complex with bcx-34
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
283
structure length
280
Chain Sequence
VTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine-nucleoside phosphorylase
publication title Structural basis for selective inhibition of purine nucleoside phosphorylase from Schistosoma mansoni: kinetic and structural studies.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
total genus 86
structure length 280
sequence length 283
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3djfA00
5JPCA 2PGAA 4EARA 4TS9A 4P54A 1ZL2A 4QASA 1B8OA 1A9TA 3DPSA 5FAKA 1Z5OA 1ODIA 4YMLA 1JE0A 4G8JA 1V2HE 4G89A 3QPBA 3O6VA 4G41A 4BMYA 2AI3A 3EMVA 3TL6A 3IOMA 4FFSA 3UAWA 3OZEA 1OUMA 4LNHA 3GGSA 2P4SA 1A9QA 1U1EA 4TXLA 1ODLA 4F2WA 2H8GA 4ECEA 2Q7OE 1SD2A 1TGYA 1JDUA 1Z36A 3PNSA 1LX7A 1PR2A 4TXNA 3BSFA 1JDZA 1PW7A 2IQ5A 4NY1A 3SCZA 4DAEA 1PR4A 4MARA 3T94A 4JWTA 5CXSA 1TCUA 4D98A 4H1TA 1PR5A 1LVUA 2HRDA 5I3CA 1OTYA 1PR1A 1JDTA 1Z5NA 4K6OA 3ODGA 4DAOA 1V45E 4DA7A 4QEZA 3KUKA 2B94A 3MB8A 1K9SA 2QSUA 4LKRA 1JDSA 1Y1RA 3KHSA 1RSZA 4DANA 1RR6A 2OECA 1PBNA 1K3FA 4MCIA 1XE3A 1RXYA 5F7ZA 4QARA 1V3QE 1M73E 4D8XA 3UAYA 3DJFA 4X24A 4L5AA 1VHJA 1Z35A 2A0WA 1PKEA 1QE5A 4RJ2A 3UAVA 3E9RA 1YRYE 1Z37A 1RXUA 5CXQA 1Z38A 1Y1QA 1Z33A 3OCCA 3P0FA 1Z5PA 4YO8A 4DA8A 5CYGA 1TD1A 4BN0A 4WKBA 4PNPA 2I8AA 2HN9A 5K1ZA 4TS3A 2RJ3A 4TYMA 4JOSA 1Y6RA 5CCEA 1U1CA 4QFBA 1Y1SA 2OC4A 4E1VA 1OV6A 5EPUA 5F7JA 4R31A 3IEXA 4TTIA 3UAXA 3F8WA 4DA0A 1PK9A 1RYZA 1RT9A 4DABA 1A9OA 4OEHA 3PHBE 1T8SA 3KVVA 1T8WA 5ETJA 3C74A 4WKOA 1CB0A 1U1GA 1YR3A 3BJEA 5EFOA 4M7WA 4R2XA 4EB8A 1YQQA 4WKNA 1RCTE 3FUCA 4GLFA 3D1VA 4WKCA 4BMXA 1YQUA 3LBAA 4OGKA 1TCVA 2HWUA 3OOHA 3PHCA 1V4NA 4U2KA 3K8OE 4GLJA 4F3CA 3FAZA 3FWPA 1N3IA 4R2WA 2OXFA 3KVYA 1Z34A 2QPLA 1VFNA 1SQ6A 2GUWA 2QDKA 1I80A 4YJKA 4F1WA 4JP5A 3LGSA 5CCDA 1NC1A 5F73A 1K27A 2ON6A 1Q1GA 5KB3A 1OVGA 4DARA 1T8YA 3O4VA 4TXHA 1FXUA 1Y1TA 3INYA 3OZCA 1A9SA 3E0QA 4F2PA 1A9RA 2AI2A 1JP7A 5IFKA 1WTAA 1VHWA 1T8RA 2QTGA 4QATA 1V41E 2QTTA 3DDOA 4GMHA 1RXCA 3DP9A 3EEIA 4F3KA 4OY3A 3GB9A 1ECPA 4L5CA 2I4TA 3KVRA 1RXSA 3EUFA 4D8YA 4DA6A 1PWYE 3OZDA 1ODKA 4LZWA 1JPVA 1OTXA 4L5YA 4KN5A 5B7GA 4TTJA 2A8YA 1G2OA 4TXJA 4MCHA 4D8VA 3FB1A 5F7XA 1YBFA 1PR0A 1JDVA 4OGLA 1T0UA 1B8NA 2AI1A 4NSNA 2XRFA 4QAQA 4OF4A 1OU4A 1SD1A 1C3XA 4BMZA 3U40A 1V48A 3ENZA 4GKAA 4M3NA 2A0XA 1SJ9A 3NM5A 1PK7A 1Y6QA 4I2VA 5EUBA 4D9HA 2A0YA 1PR6A 4LDNA 3FOWA 1CG6A 5IU6A 4OJTA 5F7OA 2OC9A 3OF3A 3FNQA 1A9PA 4YNBA 3EUEA 2AC7A 1JE1A 4L6IA 5F76A 1ULAA 2BSXA 1VMKA 3NM4A 4WKPA 1U1FA 1PF7E 3E9ZA 3BGSA 3P0EA 5B7NA 3LA8A 3NBQA 5B7PA 1A69A 4PR3A 3KU4A 3MMSA 4LNAA 5CYFA 4M1EA 5F77A 3UT6A 4IP0A 4NS1A 3NM6B 1NW4A 1NC3A 5DK6A 3UAZA 3OOEA 4TXMA 3OPVA 1TGVA 3PNPA 5F78A 3ONVA 4TTAA 4L0MA 1LV8A 1ZOSA 1JYSA 1ULBA 3DF9A 1ODJA 4UC0A 2ISCA 3BL6A 1RFGE 1U1DA 1Z39A 3OZBA 5C80A 2HSWA 5B7QA 3K8QA
chains in the Genus database with same CATH superfamily
4AYXA 2NUAA 1FSFA 3KEOA 3Q10A 1E8MA 4KDCA 3B53X 1GV1A 3NIWA 4TS9A 2X8JA 5HS6A 4P54A 3SYLA 1DEKA 1QVVA 4D7AA 1L7QA 2GERA 4KO3S 1AY0A 4R1MA 3BA6A 4BEBA 2XQKA 2V6JA 3U2QA 1NSTA 2XRYA 2D0OB 4G5GA 5ALTA 3SJBA 3A1FA 4D4LA 3R3YA 3QK7A 4UW9A 5BXYA 1JG6A 1Q5PA 2JFQA 2V8OA 2NUTA 3ONEA 3ZCXA 1QP4A 3TW8B 1QWSA 4FGZA 4G4SO 3WGQA 3NT5A 2QTHA 4IW3B 3W0LB 1DEAA 1OAAA 4Y2YA 3I32A 4LDRA 1WNTA 4N8EA 1K08A 1TK3A 4JNCA 4CBVA 4E2FA 5B12A 2UYQA 1I2MA 2EWMA 4TRJA 5GOTA 5A9SA 1G21B 2XIJA 2Q5FA 4IV8A 2WJ4A 5F5NA 3UJNA 2RI0A 3EXFB 1H4SA 1JWBB 1Z08A 4Q1EA 3UWPA 3C41J 3KAJA 4R6WA 2GK7A 2OEPA 3U9SA 4CM8A 2C1EA 4YIHA 1G19A 3PYMA 4YJ2A 2VCEA 2O2ZA 1CEXA 3Q7QA 1JR3E 4UMFA 4ENWA 1THMA 3DMHA 4QKQA 1WZCA 1NXPA 1RWMA 2JIMA 5AHOA 3NZEA 3BDAA 2BN4A 5LXTA 3I2JA 3RJZA 2XDYA 4CLRB 4QLBA 1CFZA 1U7TA 3SJAA 4V39A 2A1UA 4RULA 3BUSA 3MRXA 1Z12A 4OJQA 4HPXB 3TOSA 3OIYA 1K0UA 3GO4A 5J58A 2I3BA 2FFJA 4KLNA 5D3ZA 3K9WA 4AJEA 4F2WA 1WULS 3F8SA 5EMMA 2DLNA 4GOOD 2O5RA 3LUAA 4U0KA 1A96A 4MR8A 1HE1C 2J87A 2C83A 3GFPA 4EPXA 1V39A 2RHOA 1PNRA 1TGYA 1ZK0A 4GKKB 1Q0QA 2BMJA 1K1EA 1RRGA 1Q11A 3AOEA 3JD4A 5BMVA 3L5KA 1GSIA 1KI2A 2CHFA 1C7RA 2DUWA 2QUAA 4YA6A 2QN6A 5IJAA 3VHLB 2J0EA 4B79A 4ZZ1A 3ORYA 2ICAA 2WLSA 4DKXA 4D4IA 2FG7C 3ZI7A 1WMBA 3BMQB 1RI3A 1H85A 2IKSA 2Z6QA 2WYOA 5K0NA 5F52A 1E66A 1P7YA 4EITA 1W5AA 3EH1A 4D74A 2CKMA 5LLTA 3G23A 3ER8A 4MUKA 2WD7A 1CY7A 5DOZA 1NNUA 4QIHA 1YI0A 1NJSA 2Q6IA 1SOWA 3CA8A 4NEQA 4OHPA 1DV2A 1VGRA 4ARZB 5LDHA 4HD8A 5CK4A 3IQDB 1W36C 5HP4A 1SC6A 4TM8A 4U2FA 2IYAA 3DWEX 1G7RA 3KTAB 3EVBA 1YONA 3D4IA 2IZZA 1GQRA 1R9JA 2QGNA 4LJYA 3WFJA 2AUNA 4F06A 5T4BA 2HRDA 3D81A 2VDOB 3L7IA 3WYDA 2YNMA 3HMQA 2AK3A 1ZEJA 2BM9A 1PR1A 3DBRA 3FCOA 3JZFA 1J2JA 1UOQA 3KEMA 1PFGA 1ZCBA 3ON5A 4ZQGA 3RRXA 4E5UA 4QU5A 1K8YB 2H1VA 4QJIA 4TKLA 4X1IA 4EUEA 5J23A 4CG0A 3PEUA 4Z7OB 3HM9A 4RVSA 4A36A 1E7QA 1VJRA 4GMKA 3WLEA 1WW3A 4HS4A 5JBQA 4O2AA 4S0XA 2XADA 3IT2A 4HJRA 5I4CA 1RQLA 2WTMA 2A9FA 4DUGA 1AHIA 3EMKA 4IDBA 2G5CA 1GN8A 3ZXYA 2I6QA 5HIAA 4YMVA 2Q2QA 1YRAA 2APJA 2H63A 3DBLB 3BCSA 5LLSA 1FU4A 3QU5A 4ZQCB 3AHEA 4G97A 4KXMA 3VR2D 3X2EA 2IYZA 3PQEA 4EL5A 1OFIA 1TF7A 2GEUA 2V5AA 1K0FA 1MTZA 1OBCA 2YL2A 1MNQA 1Y33E 4MS1B 4U7TB 4AS2A 3UMFA 4JIMA 4L78A 5DHUA 2QMOA 3OPMA 4E88A 4ZVKA 3WGTA 3HDQA 1Y7PA 3LXRA 1SBTA 4P35A 2G6BA 1NNI1 4P3OA 2CLLB 1ZCAA 4ISBA 1HE8B 3MMXA 4LG1A 4NBVA 1U2TA 1A2QA 3BXFA 2X0KA 3RIHA 2OXTA 2HC9A 3WZ2A 2IHYA 2DWOA 3CLUC 3ESBA 4S1TA 4HWKA 5A7FA 3VHQA 2B8NA 1T0PA 1GZ7A 5EJFA 4OYHA 4DCMA 5L53A 1NJ1A 1PVOA 4QFMA 5T5QA 1RWVA 4RTSA 1WPQA 2XMQA 4GI1A 3BCHA 4HK4A 3K1YA 3NYIA 4JELA 4Q1CA 3TF5A 5IKXA 4CEIA 3NETA 3A6KA 4MIKA 5C18A 4UJ5A 4J0QA 5KQLA 4A82A 2D3TA 5BQPA 3PP8A 2GPJA 2PT5A 1H05A 4B85A 3W3AD 3TQHA 1MQAA 3UHPA 4O4JA 2WJHA 5EMLA 3WRVA 5GQSA 4C3OB 1LBQA 1RVDA 1EEHA 1WCIA 4JVLA 2X2EA 1URPA 2AV6A 3GJ7A 1T3SA 4LZPA 1BH2A 4PM4A 3OCZA 1IN1A 4AY3A 4EG0A 4UBJA 4BV9A 5C8XA 1JLKA 4MUAA 4TQ9A 2I1VB 2D3WA 3HYSA 4N76A 4PS1A 3VR3A 2YIJA 1TA4A 2VAXA 3CS3A 3NAZA 4DVGA 1IK4A 1K5PA 2Y1XA 1K4YA 2JVKA 3BORA 3PTLA 4URUR 3SS8A 4NTZA 3TVYA 3SHOA 3UMJA 3ZNNA 2C5SA 1J2YA 4J7XA 3D8TA 4NJMB 3RR2A 3ZWMA 1VCOA 2ZJ6A 1P4AA 5TF4A 2F8MA 2QRNA 4BYMA 1AOXA 4UTOA 3W78A 1UANA 5FOSA 4ZHSA 3R9XB 1L5HB 2G80A 4UD6A 3QG1A 1NW7A 2A9OA 1NW5A 1QCCA 1ESDA 2EW2A 2ZPUA 3TJMA 1KJQA 1K3UB 3ZXUB 2WILA 1I5OA 1KVRA 2ODAA 3HBNA 3EDQA 5EWLA 3RYHA 4DJDC 1JLSA 4ITUA 4B0OA 1NNEA 2QBYB 2ZSAA 4RZ3A 4ETIA 4Q93A 4FX2A 3EN0A 5EGSA 1O6BA 1ICEA 1T9GS 1HO3A 3AH8A 4OI4A 2P77A 2BSAA 3Q3HA 1V5WA 3USES 4CMIA 4J0CA 1N6LA 5DI9A 3WMRA 4G8DA 4ITVA 1G3RA 2RAFA 1LBEA 3GJZA 4KRGA 1BU8A 2O2DA 3FM9A 4K88A 4WY5A 3RSOA 4OXQA 5AOBA 3SEQA 1BXGB 4FIZA 2ORIA 3DOJA 4L76A 5G3YA 4RGVA 4YT8A 1USGA 5K0ZA 2FW6A 2Q6OA 3G9UA 1LI4A 1MVLA 1ODTC 2HQ1A 3FVQA 3LH5A 1YB1A 1MG0A 4R7ZA 2V54A 1WU7A 1RLTA 2D0DA 4C43A 5EIXA 2EBFX 5TQVA 1OE0A 4ZVSA 2J8ZA 3D5QA 4B6RA 1H8EA 3P9NA 4HX5A 1N2EA 2NU9B 2OHFA 3FIUA 5DASA 3QX9A 2IU0A 2W98A 4DLNA 3AR7A 4IIGA 3RPEA 3HC7A 2CDAA 2CFOA 2GT1A 1WCYA 3EZXA 4JXJA 1VOTA 4U5QA 3GPBA 1ZM3A 2Y9MB 1K98A 1QMGA 5CDFE 3ZWDA 2G5PA 4I4NA 4OK6A 1E7RA 2XOKA 2XZTA 4BO3A 1UDXA 2REQA 5DGTA 3PB3A 2ZYHA 2HDOA 3K8YA 421PA 3L02A 4Z8XA 4C4RA 3JAWB 4EZEA 4LF4B 5LXTF 1NN5A 2VHTA 3UZUA 4AUKA 1MRNA 1B1CA 1NQXA 3U7IA 4OLBA 1N3IA 3GLVA 3F6YA 3PR2B 2AG8A 4MWZA 4OVKA 4Y6OA 3QKRA 2IHJA 3LLVA 2Z8YM 4HY3A 1VFNA 4C21A 4CKCB 2QDKA 2W2KA 4YJKA 5LA6F 5TJHA 2ZM6B 1A5TA 1OBVA 2I6XA 3KBOA 3OZ7A 2WHYA 3QV2A 3WNDA 1L7AA 4L5JA 5FUMA 3QSYA 3U7GA 4XA8A 4KAAA 1ZD8A 2PYDA 4IO1A 1OZGA 4RPCA 5EGNA 3WGOA 5DSXA 5CG1A 4MUIA 4JROA 4O33A 1W35A 2QLMA 1TCBA 4JUCA 1Q1GA 1JTVA 2WV7A 2PKWA 5F35A 4C0JA 3UJBA 2P7HA 4EKNB 2FN3A 5ER6A 4ZVVA 5KYXB 2OBMA 5ALVA 1F14A 5FOTA 1UPCA 5DNWA 4DLVA 3MT7A 3A1DA 4W5QA 4O25A 2PLAA 3OZCA 3CKYA 2H1WA 4QEDA 5FOXA 3RD5A 3TAHA 2Z95A 3VZCA 4D8TA 3WADA 5AW0A 5DHAA 4F97A 1W59A 1YRWA 3E5HA 3H1GA 3SVTA 1RKQA 1GYRA 1NKSA 3EXG2 1CR4A 4MGHA 1WEKA 4EL0A 4Z54A 5AK5A 1V6SA 1WS6A 2P2YA 1QP0A 1MO6A 8MHTA 4ZQFA 4EVIA 3TECE 3AVTA 4H1UA 1D1SA 4ID3A 4YRFA 3GLGE 3QBEA 5CJPA 2JLBA 2F1KA 2W43A 1ZISA 2WJVA 3CPEA 2QK4A 4YPVA 3RNLA 5LM3A 2IYEA 3OP4A 1TW2A 2JG3A 1X15A 1XKTA 3HCNA 3KYBA 1I24A 4KQCA 2HGZA 1O08A 3NOVA 3JYPA 4PFJA 1FW6A 4R3UC 1BYUA 2DPLA 1O03A 5L6LB 4P53A 2EF0A 3U3JA 4IZHA 4ZODA 1JILA 3O8RA 5FJJA 1I1HA 3C4VA 3KSMA 3CZQA 4EAAA 1K6EA 1N2BA 5EWMA 1ZCFA 3WIEA 5CBPB 1RRCA 3COZA 1SB9A 4O2AF 4N0DA 5TMBA 3EY9A 1QC5B 2HUPA 3IPRA 3UK7A 4DWOA 1FLNA 4EY3A 1H5NA 1X7XA 2C9YA 4K28A 2XVXA 3NALA 3AHGA 3WX0A 3JVUA 1ZUWA 4H9GA 4EYKA 4UPEA 2OHXA 5IH7A 3KJQA 4MV6A 3QKSB 3GPDG 4D8VA 2JLRA 4TVOA 2CNOA 2P69A 4QTTB 1S96A 1EFHA 2GFHA 3FPLA 3FTPA 2A58A 1R6TA 2HADA 3FR8A 3OCJA 5F64A 3ZGZA 4IQ0A 5JZOA 2JFYA 4FE7A 1NXVA 4FYXA 1M76A 4JLDA 5M7EA 2QTNA 3L7BA 1YU6A 3AUKA 1KKMA 2AI1A 1DBVO 4C2AA 4TV9A 1PWXA 1EBFA 1DEXA 1KP3A 4HPJB 4L6AA 2ESRA 5E7IA 3FAKA 3M4NA 5F1KA 1C3XA 1BDIA 3EG9B 4LHSA 4ZK2A 1DFIA 5DP2A 1OR8A 5AJHA 1V48A 4GM0A 1J1IA 2IHVA 3WBKA 5K0BA 1UMKA 2POQX 5EIAA 4F38A 3LCJA 1KDVA 1DEHA 1FJ2A 4LOHA 1LI5A 1BJKA 1RVV1 4CPDA 3A3PA 5IKOA 4HG2A 4XVHA 2H7CA 5I3ZA 2RK4A 4QHTA 1X8KA 1G3IA 1L6RA 4QU9A 5B4VA 4ICIA 3ICOA 3F6CA 3ESYA 3SM9A 2JLSA 3LLCA 3HZZA 1KZ7B 3RVSA 1KPIA 4OJTA 5F7OA 1CDDA 3IXQA 2JKYA 5ALDA 3UOAB 4Z3KA 2I65A 2CB9A 4MAMA 4R1NA 4HDRA 3NEYA 4O4JF 3BEOA 4Y2HA 2NVWA 2AR9A 2V03A 3OJXA 3ZE9A 1NJ8A 3DR3A 4JGBA 4REQB 4UTZA 5IKEA 3O8BA 3SPXA 4LPSA 2Z3WA 4LYHA 4ZXPA 3L04A 1QUFA 1LLCA 4MRMB 3MF4A 2HNAA 3GA0A 3WMXA 3RKRA 5LNK6 2M6LA 1KQ3A 4DR1B 1ULSA 2ONCA 1KDPA 1VXRA 1O54A 3C1OA 4OP3A 3EXHB 5HMMA 3H04A 4DCUA 4YUYA 1YOBA 1ZZGA 3PJEA 4GOKA 4PTZA 1USVA 2C07A 2FZCA 3HA7A 4YLGA 3WLJA 4ZHQA 1H6DA 4GVXA 3B7PA 2PIAA 2YUTA 3FYCA 4RBNA 5THQA 1QSGA 4HOYA 5A71A 3VU9A 4UTXA 4I1PA 3TFQA 1MN6A 4KRXA 3GRVA 1OX5A 1QH8B 2X1VA 4RHYA 1NBEA 5KMGA 2RHWA 2B3DA 3HKDA 3HO1A 3OOJA 1J24A 2ZBQA 3QJ5A 2HMVA 4GR9A 2ZI5A 1UBLS 3HN6A 5AM0A 2VYVD 5C7LO 1F2UA 5ALGA 3W9YA 5IULC 4TYNA 4H7KA 1UFRA 1EA7A 4MW1A 4S04A 4IP0A 3V42A 1MX3A 3IDZA 1YVUA 1DWQA 2R3SA 1BDBA 4LXYA 2G8NA 2D5IA 2GEJA 3NDPA 4BVAA 1ZMBA 1KY5A 3MMPA 1IVSA 3SXUB 3BD6A 1Y5RA 4NBLA 2P0EA 3SK0A 3ZHUA 1WMSA 1NJGA 4TXMA 3AI7A 4DRZA 4CIAA 2WWGA 3K0BA 3AVYA 3LXUX 3T1OA 2FWIA 1HQCA 3ZQKA 4O4HF 1HV8A 3G2LA 4JI2B 1JHRA 2A4KA 3T7SA 4CTJA 2AFHE 5GV7A 1XTJA 2WIDA 4IRXA 3QXXA 3OKAA 4HUQA 5TQ2B 1YTUA 2NM0A 4C0AC 3TOCA 1PZEA 4NOLA 2AVNA 4ZA2A 5H82A 4Q39A 3V8EA 4AYWA 2YVKA 4HI0E 4BFTA 4D9MA 3ZWKA 1H3NA 1AS0A 2FGKA 5IAGA 1AF4A 1JEQA 2FN8A 3PJGA 1G2IA 3QPWA 4H4EA 4ZJZA 3DKIA 1YE8A 1DAFA 2R1TB 3AFOA 3GGCA 2I6FA 1Y42X 2X0NA 3Q7RA 3PFIA 1A8UA 4CM5A 4HDKB 4GYWA 2WPDA 3KFLA 2NXJA 4WNCA 1TQ6A 1A0OA 1E60A 2G0AA 2RHLA 3LUCA 5DIFA 4BU1A 1ZN8A 4NXNB 2G04A 1T1SA 4DLXA 3C5CA 4OATA 5IJ9B 2HEGA 4ND5A 3O4RA 4B3FX 3L0DA 3PPXA 1K2WA 1JI3A 3EFBA 4DCTA 1CRWG 4ZKEA 3UCFA 3CQ9A 2XMGA 1OLUB 2XT6A 1YJAA 3E70C 4TSKA 4KN9S 4ZQIA 2G9NA 4F9FA 1ZIYA 2C4VA 4JIGA 4IUCS 5G0UA 3FYSA 4FUTA 3SFZA 3WJ2A 1ZJ4A 2WA1A 4UAJA 1VL1A 3GUUA 4P0TA 1GZVA 1KOLA 4JBHA 4PYKA 1TLTA 5K0TA 1ZAYA 4ZQEA 3QHPA 1FTNA 4JUIA 1GPH1 3HZHA 1E6EA 3UUEA 4BQNA 4Y2UA 5DLDA 4AS3A 4YCMA 1W36B 2ZYGA 1KJYA 3DYBA 4E15A 1YRHA 3T5DA 4AKTA 3C4QA 2G3YA 3LWBA 4ZCSA 1XEWY 5FUVA 2ET6A 4YP5A 2YY6A 1IPEA 5DHPA 5GADl 3MT9A 1MZPA 2JFWA 4IXNA 4D96A 4D0LB 4CI9A 4X84A 2IUFA 1T5OA 4IIJF 1M67A 4ABTA 2Z83A 2C99A 2AI3A 2VHJA 1VB3A 4FWIB 4R8MA 1QRUA 4PPGA 2C0QA 4L07A 1G8AA 4GMXA 3LPAA 3VGPA 5HWSA 1O0BA 3FCAA 5F9FA 1T0JB 3WKCA 2IPMA 2H1LA 4FFSA 4WMLA 3N0RA 2BFMA 1KI8A 2SBTA 2EJWA 2QTVA 2VFAA 3S44A 2EKDA 4ZAYA 1W1IA 1JKFA 3D3NA 3WB2A 4KX3A 3MWJA 4G23A 1XMPA 5CRIA 1HLFA 1N2CA 1XGKA 1DC3A 3FZGA 1VBNA 3HLKA 4CZ2A 5A4AA 1AURA 4XVRA 2O6HA 3QENA 2YR0A 4G24A 3T9CA 1QE3A 2ERCA 2HCTA 5CDUA 4PCUA 2OILA 1DQRA 2GZDA 1U1EA 3I83A 1QFSA 3A1EA 2H0RA 2JH8A 3ETEA 3ECCA 4V0RA 3ZJUA 4AF8A 4C0HA 1KSFX 1MGOA 1T4CA 1I0LA 2G1KA 2Q7OE 2EKPA 1XZHA 3EXEA 4YP7A 1HFEL 3AXSA 4TUYF 5EAIA 1S2DA 3LQ4A 3QVTA 3R44A 4M98A 4R2KA 1FYFA 1GR1A 1YGPA 4PYOA 8ADHA 3LBFA 2TMYA 1ZUHA 4DSAA 3LNTA 1KI7A 3DF7A 3OESA 4TXNA 4ER5A 4IZOA 3V2HA 1IOVA 4AMBA 1JG7A 4Y2QA 3SBOA 3NTOA 3PGXA 1AQ6A 1N0WA 2QM3A 1CY4A 3KB8A 3ROKA 2HL6A 4JK3A 5AT1A 2ZU0C 2B4YA 1SRQA 1O8CA 4G9EA 4RDCA 4S12A 4LF6B 1JWLA 2XR1A 3AVQA 4RKQA 5C1BA 4KXXA 3SF8A 5DK4A 4JWTA 5THKA 4AROA 1LW6E 5ELMA 1W0KD 4BNIA 2CYCA 4N9QA 2JCXA 3FOCA 1YZQA 4MW6A 5EL0A 1F9EA 1OYVA 1CQXA 1SKYB 1BMFA 5IXJA 3I58A 1SD5A 3WLRA 4U6SA 1BYIA 1RMTA 3FPBA 3EPLA 3NTVA 5H83A 3K9BA 2JLQA 1S2LA 1WZ2A 3WHKA 2OZEA 3ZDRA 2NT3A 4DBZA 5IM4A 4ZYVA 3WGLA 1WAMA 4PGFA 1OZAA 2QRJA 4RD4A 3S3TA 3V8RA 4R40A 3NIGB 3N07A 1Y3DE 5HZGA 1UBHS 4GVPA 4RM3A 2F48A 4ND1A 1F1BA 3LT2A 2VJOA 4DANA 2E89A 1SZDA 3H84A 1XELA 2Q1WA 3B9RA 2PY6A 4F4DA 3D6TB 1ISJA 1CXZA 2ZIFA 3ITDA 1ZIDA 1FUYB 2ZRPA 4HWPA 5C53B 1H8HA 1X1AA 2WUGA 1KL7A 4QARA 3Q6NA 2VBIA 3O4JA 5AKIA 2YWFA 2ZWVA 5JS7A 1TZBA 4XAQA 1EU1A 1U28A 5EEGA 4IDFA 2QTLA 2INGX 1M34B 4GXRA 4Z86A 1QBKC 5A5FA 1EK1A 4YC7A 1YS9A 4V3BA 2CXUA 5FUBA 1ZZEA 2O0HA 4HATA 3I6BA 3UAVA 5KBYA 3M3DA 4CIWA 1KSHA 2H4XA 2JVIA 1W36D 1D1QA 4RJLA 2D7JA 3NBAA 1JEOA 3I4FA 3B6EA 4DY6A 5CM8B 3E9QA 1JKJA 1NN1A 3B85A 1SUEA 3OU6A 2Q2VA 3PPWA 2DHEA 1G6HA 1ORWA 2FOLA 2Q0XA 2HF7A 5GONA 2UVDA 4PSVA 2BKLA 1BZYA 1Q95A 2G9VA 2L17A 2PS3A 3OCCA 1Z6ZA 4MI9A 2ATCA 4OQFA 5EYPB 1BX3A 4RLHA 1T3ZA 2EQBA 4IEEA 5A7HA 4A8HA 2ZRGA 2IHNA 4HZGA 5L3ZA 5AVJA 1FNSA 3VO2A 821PA 1ZGHA 4A1OA 4Q7KA 3EEBA 4HAUA 4PR0A 1RBYA 4AG5A 2X0EA 3B1FA 4Y1RA 3UV3A 2VUUA 1EAYA 3OM1A 2NV6A 1MMFB 2JFNA 1Q44A 4F21A 2ZXUA 1Z16A 3IAM1 1SU6A 4IF4A 3ZE8A 4KCGA 1DELA 2V0CA 2WAOA 2FZWA 2Z1NA 2DVMA 1JYEA 3WGIA 4CVNA 3UYLA 1EFVB 2ZPTX 3OBBA 1N3BA 1VBMA 5CCEA 5CVJA 4IFBA 4IQ8A 4QGBA 1I94B 3K2EA 4BLVA 3LHSA 1TTHA 2JJQA 5BN4A 4PHGA 5KOYA 4DE5A 1IQRA 1DXOA 3GEIA 1I3CA 3VSCA 1M8PA 5GM1A 1ISRA 7YASA 1GLNA 3RSZA 4TTIA 3CLUD 3G79A 3OLWA 4R2IA 4XRRA 1QQ5A 3DJYA 5TNXA 1LPBB 1JFRA 1A72A 1NW3A 1WZUA 2VQ3A 3QWFA 3EC7A 1C7IA 3N53A 4LE1A 4O1MA 3X2FA 3KP1A 5COAA 5DSZA 3LUPA 2WSSA 4BO0A 2FDCA 2PLRA 1XQYA 3QF4B 5IMSA 4HN9A 4B2IA 1P5HA 2ZB2A 3KKNA 4JJ8A 4L9AA 1Y4SA 3ZZ1A 4AWXA 2H51A 4C2BA 3LKDA 4IM7A 3TK1A 1E7YA 2ECQA 2ERYA 3KTOA 3UO8B 4IINA 3FDIA 2UZ1B 1LB1B 1EFDN 3M1LA 2AOXA 2EGGA 4MVJP 4RK1A 4WA7A 1ULZA 2OBLA 1L8AA 1Z29A 4TL6A 4FMPA 1YR3A 1EG2A 3IBFA 3QPVA 1BWPA 3O21A 3SZGA 5ABPA 5JTTA 3IIEA 1QIEA 2FE4A 4M8IA 2VDJA 2P90A 1M2OA 3Q40A 1DIRA 3VPXA 1TZMA 4B5KA 2IXDA 4BZXA 4DNPA 1VI5A 1XEAA 2GK3A 4MS4B 4A73A 2QIOA 4ETNA 3Q88A 1PYOA 4RVNA 1TF5A 3HVKA 1E62A 3L8EA 3PNLA 5K0LA 3SE0A 3W8EA 4BNKA 1XXLA 1E4EB 2RH9B 2BGKA 1OXMA 2ADFA 1CRQA 3R5XA 1QVAA 5ED0A 4YBZA 4XW2A 1TKCA 5TX7A 1XZAA 3A27A 2GUGA 2VTDA 3ADPA 1SRRA 2WAYA 1I1QB 3ZKWA 2CZGA 1TYAE 2IIPA 5E38A 1HNXB 5D2CA 1D07A 1EDEA 1U0SY 2D1TA 1YR7A 4LMPA 2C9BA 3WC4A 1NMXA 2VYNA 3RS3A 4F3CA 2C94A 4JT9A 4WINA 2A4MA 1JNXX 4LZAA 2J5QA 1Z6TA 3LP5A 3R5HA 4X7PA 2J0VA 5BRAA 3RC1A 5C32A 4XIIA 3LX8A 5AW4A 2GFQA 5EXEA 4JP5A 1KA9H 1JJBA 3ETGA 5CFMA 5BVHB 1FE8A 2ZTUA 3MTAA 4TMVA 5TXGA 1FNDA 3R74A 3D3JA 3LGAA 2GVZC 4IJMA 1ZQ1A 3UEOA 4D4MA 1BS9A 4Q3BA 4EGJA 3IV7A 4FNOA 3TMAA 3IQWA 3DEAA 3HU2A 3NBFA 4Z9FA 3O26A 3EVZA 4HAYA 3ONWA 5EHZA 5K8TA 5CLQA 4WBSA 3ZS8A 1T8YA 1D0SA 3LC2O 5JNWA 3HZRA 4XQGA 1W4BA 4B40A 2B4KA 2FZLA 3QJGA 1X9HA 4HYEA 4WZAE 1YASA 5CG2A 1XT6A 3UA3A 2AL7A 5IDWA 4DR5B 1JG4A 2EQ5A 4YCSA 3EH2A 2F43A 5T67A 5IHXA 1QV6A 3MWKA 2Z5LA 4MPPA 4J4BA 1IG3A 3LAWA 2AOTA 2NPFA 4FOLA 1KS9A 1EAMA 2W2LD 4PLPA 5J5CA 3AZOA 2QNRA 4KPGA 1ECCA 3PUXA 1X80B 1ZBQA 4CLHA 2Q5QA 2ZCJA 2JI6A 3NASA 2X7XA 1FL9A 5AXAA 4ALJA 4M1WA 3IL2A 1H65A 1TM4E 4CJXA 1GNLA 3UAOA 4OPMA 4C4PA 4Q34A 4UAGA 4QECA 1X2BA 1W29A 3AJEA 3MOIA 1BVRA 3AETB 4FGSA 1Z2NX 1PS0A 1R0ZA 2CFIA 4KGXA 4CDNA 4GQAA 5COBA 2PPVA 4JJKA 4RW0A 1CNEA 2YX1A 2Z98A 3LC0A 4QDXA 2WWVD 2QRGA 2C84A 4D0RA 1ODKA 4UVDA 5ITSA 2OK8A 1VL6A 2Z5VA 4R69A 1VI2A 3ENVA 2IH2A 4YWJA 3U4MA 4DQUA 3ITEA 1PSZA 4ZQBA 3B3JA 3H05A 4XUDA 4LMAA 4YQFA 2XT0A 1ADFA 1U0JA 5HHTA 4YJHB 4OK3A 4AZ3B 2WYUA 2ZSKA 1SIUA 3CNQS 1A3CA 2XOXA 4J03A 5CB0A 2H16A 4WECA 1MJ5A 1HLPA 1W5BA 1ZSVA 3FH0A 1IC6A 3GEDA 1TCAA 3OQIB 4PVCA 3TFWA 3PQ2A 2NWQA 3ZIUA 4J49A 5EQFA 4WK4B 3E5RA 1GFSA 5JASA 4ZAVA 1E1KA 4GECA 2A6PA 2WIGA 1OYWA 3BN3A 3GCWA 1T0UA 4EG6A 4HVTA 4KIJA 1B8NA 1QH1A 4QAQA 1AQYA 1V95A 4PZLA 2HREA 2VXCA 2PRJA 1V5IA 4BMZA 1G20E 2Y6VA 4JKOA 1MFZA 3EUAA 4NABA 3OP1A 2HK9A 2FXVA 2JFOA 3ER6A 4R51A 2DKNA 1MHPA 3R75A 4GKAA 4QDTA 4LJ8A 1HT0A 5IP5A 5LP6B 5K8UA 3ZE2B 3EEOA 1IN7A 1PZXA 4XD7A 1QQAA 3OZWA 2PWBA 4O4LA 3OOYA 4I2VA 3EC1A 3ROQA 1R8JA 1ACLA 1A9ZA 1I5RA 1RC8A 3NAQA 2MU1A 2Z0MA 1KAEA 3LVFO 3ROGA 3LW7A 1H3FA 2J4DA 5LMCA 1J8YF 3KEFA 1X7WB 4WW0A 1D9XA 1X9IA 1RWNA 2M6KA 1BMTA 5ARCA 4EK9A 3SZUA 2IBTA 4XM1A 3AW8A 4MCJA 1PQUA 3JQBC 1GZ4A 1B26A 4AJ9A 1NZFA 4X8MA 4WOCA 3UIEA 1EVZA 3C1AA 2YVUA 3QFTA 2JVJA 5JWOA 1CU1A 3A1WA 1QVZA 4JDUA 2LIPA 1YVEI 1XVVA 3STHA 4OHCA 3OIDA 3OCYA 5FWYB 3ZGNA 1Z4MA 4EKGA 4UDXX 2P9BA 3T99A 1SFRA 3R7NA 3UAGA 1ZGCA 3MFYA 3NB0A 4MKRA 5HUHA 4ZMSA 2FDXA 4JEIA 3LDGA 4PHTA 2CJPA 2E5LB 1KBOA 3FDJA 3GCZA 3IP5A 1TK9A 4G8BA 4G5SA 4C4ZA 2PMKA 1SUDA 1HEUA 1GGVA 4TTSA 1FP7A 3PKIA 3QU2A 2ZEJA 4BN5A 4DNFA 4QJ5A 1BX1A 3KFXA 4A4DA 1P9LA 4RA9B 1CJSA 4XQ0A 3WBJA 2FMHA 2FOXA 2JIBA 3EVGA 3W4KA 1KI4A 1GADO 2NU8A 1UC5B 2PT6A 4JQYA 2JKVA 3AFIA 3KU4A 3QIAA 4MV8A 5D1NA 3QIVA 3CR3C 3RRYA 3NORA 1C7FA 3PRJA 3JXEA 2IKQA 4N18A 4NR0A 4CR8A 3ISVA 3WK7A 3B1KA 4FFBB 4ND4A 2FEAA 1YV9A 4UAVA 3KPWA 1RI4A 1VYHA 4HNQA 1QQ6A 1L4UA 1O5TA 2H5EA 4P98A 2PX2A 5CP8A 2PVCA 3FGOA 5ECYA 5IG2A 2D2FA 3E2IA 3L41A 3CM0A 3GMIA 4QPNA 3MAAC 4IKPA 1SKAA 2O3QA 3S99A 1TDJA 3BSSA 2LR0A 1M0SA 3L43A 4WV3A 5KVQA 1X8LA 2BGGA 3WGMA 3T1QA 3S8EA 2DUMA 1MCZA 1D0VA 5BWCA 2O8EB 1QF6A 4CV3A 5CURA 2HMYB 2Y2VA 3IR5A 5L3SB 3H5OA 3RTEA 5AVKA 4NENA 1M74A 1CRPA 1D09A 1YQDA 5BOSA 1AQLA 3L8GA 2GPSA 4REOA 5YASA 2QGFA 1UJ6A 1R88A 3FUXA 4HQOA 4CCYB 4QVGA 4GC9A 5FBHA 1L3BA 4YECA 2CVHA 1PO7A 1L5GB 2JC3A 1VE6A 1U1DA 5C4GB 1SXHA 1M6WA 1GV0A 1DOAA 2GF2A 3P8ZA 4MQUA 1ZA2A 2ZK7A 4XSVA 2YWGA 4HLCA 4M87A 2IEYA 2Z57A 3RREA 1UMDB 1Z0IA 2A5GA 2OE2A 4N12A 1P3Y1 1UXIA 3BMCA 2NXNA 3DP7A 1PLKA 2QLTA 4OBEA 1HQYE 3RVLA 3QPDA 3D4OA 2BCEA 4RMHA 1YAJA 4YCJA 2PLNA 4P4SA 5JVDA 1H42A 4QDJA 2OD2A 2XMZA 1R0YA 1B8OA 1GSAA 4FHCA 1PFUA 1JA0A 5C80A 3V4LA 4IIBA 3A1NA 4AT1A 1KHHA 4TQAA 2ZFUA 2XZPA 4HN2A 4JB8A 1DJNA 5DTEA 4V0KA 1YMVA 1VHLA 3E1SA 1ZJ6A 4DTIA 1LF0A 4PLGA 2QTMA 3CJTA 4G8JA 1V2HE 3TLEA 2G1PA 1BHJA 1NR7A 3AF5A 3JQ9A 4AF6A 3R5SA 4FNMA 4R8KA 1AXEA 4L08A 2WQ7A 3HY3A 1ZOLA 4BTVA 4F56A 5TSDA 3V7FA 4OMCA 3PDJA 4B3XA 3ZZNA 3T52A 1VBKA 1BW9B 2C2GA 4U2BA 4X63A 2EF1A 2JI7A 3BTUA 3R20A 4BIMA 3RVPA 3GEGA 1I4DD 1U3WA 1J5EB 2J48A 2OORA 4TWIA 2MR5A 2RHRA 3DR5A 3EIHA 1O5OA 1OGJA 3IQGX 3MK31 2OXRA 4QQNA 1YCGA 1ZD4A 4K40A 4FZ3A 3ZWVA 5JD5A 4JJAA 2XF2A 2VF5X 2HSZA 2VRBA 1OUMA 3KJZA 3OF5A 5EOVA 5F2EA 5CA1B 1TYZA 2C58A 2GCGA 2XAAA 1DDIA 3GD5A 5DM2A 1VRVA 1XRSB 1J4AA 1JHXA 3UJ7A 4GOMD 1Y82A 2WTUA 4D9JA 1WZEA 2A3RA 3ETHA 4X1YA 2P7IA 4I6JA 2JHAA 3VKVA 5JFTA 4ZAWA 5JCOC 2UZ0A 4TXLA 4AJIA 4O0LA 1TT5A 1X7YA 2I87A 1C9NA 2EW8A 2JIPA 3UGJA 5FORA 2NTJA 1SXJC 4DMUB 1P5FA 2YN0A 3H1BA 1JHZA 4P7GA 1CUFA 3RNOA 4XB2A 2HJSA 2X4GA 4N54A 5BUQA 5IPFA 3IA7A 3PFWO 1W52X 1KBQA 3NNNA 4R1PA 4Q18A 2OV4A 1ZKMA 2ZI9A 4WVFA 2JI8A 1FS4A 3ZJYA 1PJSA 3KSDO 2D59A 3UH0A 3QE2A 1HTTA 1UT8A 2VQEB 4ZT5A 4E2ZA 1SXQA 4K9OA 4Z0PA 3OQOA 3JQ7A 5TQJA 4AO6A 4DG9A 1FFCA 3W5HA 4DDKA 3THXA 2L2QA 2R6R1 2BKVA 4EB0A 1M8JA 3IDAA 3KU1A 3PNQA 5CDTA 3QY0A 5ITWA 3W79A 4BY9E 1YFKA 3H1PA 4Z3DA 4GBGA 2YJ6A 3M8KA 4WLVA 4AJ4A 4C2TA 2GD1O 2AOWA 2Q5LA 2G4CA 4IGAA 4Y7DA 4RF5A 2M9MA 3I92A 3ZBPA 4BEVA 2HSJA 3ZTWA 3CUEF 3MRVA 3DD5A 2B61A 3P9YA 3RVMA 2YW9A 3EQZA 5D3QA 2Z2YA 4ND2A 3WMWA 2PA0A 3PZRA 5HPYB 3MAGA 4HEA6 3GV0A 1Q0TA 1M5TA 1I01A 3HB4X 3L7DA 2ZGVA 3L4EA 5KNDH 5LU8A 3CF0A 1I2CA 1PVVA 2FUCA 2C3YA 1ZJ5A 3BFXA 2XSZD 1BS1A 4LKRA 1E6MA 3EG5A 3OTWA 3OX2A 3BWCA 3PYLA 1QGAA 1V7PC 1WUTA 4NYJQ 4UMDA 2CUNA 2R48A 1ZN7A 2DUUA 4HYQA 4KI7A 2GVDC 2QU8A 1Z7BA 3EZFA 3G6KA 3U7JA 4QSHA 2J3IA 2YZKA 1RPJA 3D2AA 5D87A 1UBFA 1O96A 1DINA 5DBFA 2DSTA 2A1TS 3DWFA 5KC9A 4LF8B 2H31A 4PX3A 2I1QA 2Q9AA 3R6LA 4GYKA 1QR2A 1SUFA 1WD7A 5C7IO 1JDNA 3GDHA 4TLLB 1QHHB 3ZK9A 2CWWA 1JIJA 3BE4A 4IDDA 4JENA 3B48A 3OZRA 4JEMA 3WBFA 1AS3A 4DB4A 2ZUTA 4R71A 2FUEA 5AI9A 1N2HA 3M33A 4U4AA 1TU0A 4OXNA 4TVKA 4CEHA 3ICEA 4EB6A 2JHPA 2B7CA 2QX6A 4CT0A 5EWJB 3MD9A 3V8BA 2AXPA 1U0OC 1BQ3A 1RABA 3LDHA 5TGZA 1XO1A 1NI3A 2VN8A 3T1TA 1SH7A 5HYVA 3G5AA 2I4NA 1P7VA 2WIBA 3FIJA 3FNHA 4R2HA 2V55B 2OCLA 3H2YA 3QNUA 4XWOA 4I8DA 1NVUQ 1I3LA 4IDQA 4FONA 3DL0A 2GGSA 3ASVA 4LF9B 1QAQA 3QBJA 3U56A 3GYGA 2SKCA 1SULA 3C5VA 2OMKA 4PE5B 2XUGA 2ZJZA 3ZCVA 1WHTA 4XWTA 5CUQA 3ST7A 1ZK1A 2LXNA 3LO8A 3UKDA 4D9FA 5KNLA 3SYTA 3LQQA 5CB6A 2YHUA 1G5TA 4UNPA 4FI3F 1L5VA 1G4UR 5LU9A 1BRTA 1L5FA 3VKWA 4N48A 4PLYA 1LNSA 2YINC 3BE6A 3GGOA 3U17A 3UK6A 4DLRA 1CQZA 3WA7A 4CEJB 2FJPA 1TEZA 4OHVA 4MQ4A 2DERA 4EHIA 1AGYA 2B35A 3AR3A 3DZFA 2O19A 1BS2A 4HB2A 4KHZA 4XE5A 3AUYA 2PFSA 4G67A 1PD1A 1Y6RA 2B37A 2BFEA 3MQFA 4UCFA 1XZPA 4I55B 5EMKA 4JBLA 5AVOA 3U3MA 2GZ2A 5AJXA 1E1NA 4LQLA 1UR5A 2HJVA 5CT9A 1RRVA 1UQUA 4MA4A 2ZTLA 3TSZA 3TG8A 2WWIA 3KB6A 1Y1PA 3OQ6A 4JXZA 3GROA 3U7QA 4YUXA 2VTBA 3GVPA 4ZV7A 3I1IA 3K6JA 4PLWA 2ZUSA 4ZYWA 2H3EA 2H57A 2OZLA 2WP0A 3EXIA 1JV2B 4PGHA 3M4ZA 4AO7A 3SXJA 3WIVA 4CODB 3BIOA 1Z4OA 5J3JA 3SBXA 1U3GA 3KQLA 2CHEA 1CVRA 2AJCA 2REOA 2ZRLA 4DABA 2RHTA 1WCWA 3GNTA 4HEJA 5BORA 4EYOA 1JIXA 3FF4A 2PKEA 4CF4A 2CUZA 1WCV1 1XX6A 2QKYA 2R8ZA 2WYVA 4AJ2A 1W30A 2MINB 4KB5A 4PCVA 3VVBA 5ADHA 3BZWA 3IERA 1C3OB 4TZTA 2PXXA 3ZWYA 4ZAGA 3I9JA 4C29A 2ZSJA 3H9UA 1NVTA 2HUNA 4HJXA 4RV5A 5HX7A 2CWDA 2QSYA 3E2PA 2ZRJA 3LZDA 3MGAA 4KO1S 4RY9A 4Q1BA 3DLBA 1R8SA 3OAAA 4Q3KA 3ZDCA 4EB8A 2PX3A 3UUFA 3KJGA 2WNIA 4ZVLA 5M04A 3KOMA 4TMKA 3SNHA 1Q7EA 2BAGA 3KLBA 3RYCB 2DLCX 4KXLA 2WG1A 3W8RA 4K9MA 3GLRA 4GOXA 4DZRA 3PC4A 3ITNA 2BP7A 3NUGA 1R8XA 5EQJB 5F4ZA 2Y9PB 5FI5A 2C04A 3U61B 2GI4A 3FVVA 1OFGA 2OXEA 2FW1A 2OZKA 3AR2A 4RHXA 4ZD6A 2QI9C 2JBAB 3OICA 2RGNA 2HO4A 4PAWA 3I04A 5IKMA 3SQMA 1FTQA 3T3IA 3QITA 5KYYB 1IBKB 1W9HA 1NJ5A 4HPWA 1ZY2A 1O4VA 1F8XA 1SUWA 1Z13A 2DFVA 3F3YA 4GLJA 4MV3A 4Q48A 2FLVA 2P9JA 1WQ1R 3VAZA 2IXAA 2D0IA 4P2BA 4ECAA 4DEYA 2OXFA 4WXHA 1SY7A 2VPIA 1N0VC 2YASA 3FZYA 4NCHA 1MFPA 2GUWA 4GVLA 4XDZA 1N5RA 1R6BX 1SG0A 2FMKA 2IP2A 3P4YA 2RG7A 3RO7A 4Z6KA 1H6AA 1UWLA 1XZEA 3GRYA 1Y8QA 4TN5A 4A8JC 3VKHA 2WU0A 3N2EA 2DTXA 3LGSA 3MJVA 2H4WA 1GG2A 2W90A 4A2PA 4ML3A 1NVBA 4RESA 2C42A 2R6GA 2J1LA 3DL7A 2VLBA 4FQ7A 1MX1A 1S2MA 1UJ2A 4UCQA 3RAGA 1XMQB 3CXRA 4CIXA 1VKHA 1B2LA 3EVEA 3LA6A 4MWOA 4WXYB 5EMJA 1O6ZA 4G56A 4QOFA 4TMFA 1JMYA 2BIFA 3FPEA 3NHAA 2PM8A 2PUJA 3I53A 3PGJA 4EUHA 1YA6A 4B6SA 3PNVA 1INLA 1Y7IA 2FPXA 3DZBA 2ORED 3GDGA 1WTAA 2C7VA 3CUYA 1A4UA 5LKAA 2GJ8A 3M9LA 4CF3A 1HG1A 2NUPA 2X2FA 3ZDXB 1HNZB 1GHTA 2DPGA 2V7WA 2E9SA 5KJ1A 3I5YA 2Z30A 4MQFA 3VR5D 2EJCA 3P2MA 1QCYA 2QW8A 4PC7A 2C4TA 4TKUA 3NIDB 2OYRA 1A4RA 2BTQA 6REQA 3CTMA 3KVRA 2EAUA 3BZBA 4CT4B 1PLLA 4O5AA 2WVHA 1W4RA 4PLVA 2Z2ZA 3DWGA 3WVNA 1O9HA 3SFTA 4TKMA 2DCUA 3HXKA 4DSTA 3M6WA 1ZM7A 2FFRA 4QLAA 2HIHA 2YMPA 3UMGA 5I9LA 1NATA 3JRNA 2HMWA 4EF4A 2ZBRA 2ZKLA 2Z5GA 9LDTA 5JZMA 1V16B 3QYFA 4NP6A 1SCQA 3LNCA 2YVLA 5DGCA 1WVGA 4OLFA 4WCFC 5ENDA 3WGKA 1F4PA 3EFOA 5HR5A 3OX4A 4UUPA 3P0RA 2MDTA 3PC2A 2RC5A 2V7VA 4H60A 5JG7A 1KZ9A 3DKKA 1YR6A 5FWXA 3U16A 3BFVA 4X45A 4LJ5A 3QOFA 1E94E 4E7PA 4TV8B 4J90A 1WMFA 3N70A 4UBMA 3LC7O 4IEFB 4IKOA 4E46A 3LQYA 1C4WA 3K5PA 3U4IA 4FP9A 1MZVA 4LEIA 3TRHA 1SC9A 3KXDA 4OF4A 2PL9A 3ZXXA 3IAAA 5BQOA 4ZICA 4DSUA 4P0PB 3H5TA 3PTAA 3N8NA 4YJFB 3TVTA 4ZFNA 4B3MB 3SLKA 4G63A 3I1FA 3EVDA 5BY2A 4C7OA 3B1YA 2J7PA 2QRKA 4HQFA 2VSQA 2YXNA 2R7LA 3PDUA 5IAEA 1QORA 2GKGA 2JFFA 2QAGA 3CPHA 3I01M 4Q9IA 5B3AA 1CQIA 2IYTA 2CXHA 2J3KA 3ECAA 1XWIA 3H6KA 3OE7D 4BP3A 3TPFA 4MVJD 5MFPA 2VBCA 1WWKA 4GXTA 2HTFA 2CNDA 4MYCA 1CG6A 3L1IA 1EBBA 3NLLA 4WWHA 4EHBA 1P75A 2XQIA 3BTSA 3QXJA 4R8LA 3AJ9A 2VT6A 2GD2A 2BOVA 3PQ6A 4FXPA 3D9QX 4AYTA 5ALQA 4DEXA 1JIIA 3FUVA 4CKWA 4M8LA 2IIBA 5J9FA 1DBPA 1GEGA 1EPUA 1WHSA 2GA9A 3KZKA 1B74A 3TLJA 1JH8A 3RBAA 2C8KA 4B71A 1B3BA 4G4GA 4Q03A 1NY6A 2HSDA 4ZC8A 4LSWA 3N7TA 5CLLA 2H18A 5K0JA 2OPBA 5ENZA 5HFNA 3GLIA 3NHWA 5C5IA 4CETA 4LV6A 2BSXA 1QHGA 1II9A 4KFSA 1X7GA 3C70A 5EN4A 1VCIA 3BQNB 1BA2A 5EIHA 4IHJA 3V2UA 3KEQA 1JUDA 3MAJA 3WNQA 3VX3A 3PFHA 4GX5A 2BEVB 4N7MA 4HBGA 5KNCD 5GWXA 4Q9HA 1ZL0A 1Z4KA 4N3CA 2PMEA 4MYDA 3UJDA 4QUBA 3ANXA 2QU7A 2J3MA 3EW9A 3CCBA 3LA8A 4JYCA 2XBMA 4S1PA 4YV2A 4CL0A 2EEPA 2HQSA 3KD3A 5FDFA 5A1JA 1Z26A 3QFCA 4HNVA 1PW5A 3GT4A 2ZZMA 4LRYA 1T9BA 2P2DA 3E4DA 3TTYA 1UMCB 3DBOB 3L7MA 1C1DA 2XA9A 2W7TA 3I9FA 3DLCA 4KR9A 5EINA 3CR8A 1K92A 1T9ZA 3R7WB 5HW0A 1ZINA 2DPMA 4QDKA 3WBBA 5A4FS 4P3NA 2OV1A 4ZVUA 5JV5A 2IS1A 4OHMA 5LMUB 2BZ1A 3DMTC 3LYAA 3PXCX 2EZUA 4YUVA 1PQ4A 2XUQA 4OQQA 3W2TA 3WV4A 5E4FA 4BYGA 3OA0A 3E9YA 4EFDA 3D3WA 4HMQA 4D41A 2O8FA 1IONA 1M2EA 5ALUA 1ZI9A 1T35A 2LTAA 3GI1A 4UPDA 2O8DB 3C6XA 3D7SA 4A9AA 3B1ZA 3HNOA 2BGJA 3NU1A 3OOSA 4UULA 1NVKA 4Z0NA 1ZJWA 4XWAA 1X8XA 2QN3A 3ONVA 5AFSA 1QK3A 3LRPA 3Q15C 3AGQA 4D9BA 1NKVA 1VP9A 3ANNA 2YJTD 3JWIA 4LZNA 2PKXA 3S55A 2VHCA 2I3GA 4A6PA 4C0XA 1QS0A 2ZJOA 4R2JA 2AEEA 2KI5A 2ZBPA 4KNWA 4KZPA 3LF1A 2OLEA 4CUJA 4UFPA 4Z9AA 3K7EA 4PGGA 3AERB 3C3MA 2IXGA 1PJCA 1AKEA 2DG2A 2IFTA 1ODJA 3ADOA 3FRIA 2R60A 4LVOA 4ZOLB 5JSHA 5BWNA 2ZREA 5JCPA 3HK2A 5JATA 2O8VA 1WZIA 1SXJB 3F6SA 1WUHS 1O89A 4NH4A 4V0OA 5DYWA 4UMEA 1J8DA 1XZCA 3H5AA 5MFZA 3AO0B 3F7MA 4W9RA 4LZJA 3WIDA 3R6GA 4LYDA 1Q84A 4MIEA 3L93A 3K8QA 1S3FA 3ND9A 1AGRA 5CNMA 3L0SA 4CMCA 4CQLB 4BNYA 3FPHA 3P2OA 2H1HA 4RIFA 2KMLA 3DB1A 4GD3Q 2FG6C 2H52A 4ZOBA 2ZJAA 3HCDA 4W7HA 4ZVTA 6ADHA 1M7BA 2BI7A 2C0PA 1CR2A 2ZI4A 3TTTA 2FR0A 1P1IA 4H1HA 3WMGA 5FBRB 2JAWA 2Z6UA 3GAMA 3H97A 2HF9A 2N46A 1RZRD 1JSRA 4NYMR 1Z5OA 3BTOA 1X6VA 2X8WA 4CKBB 4N0MA 3GJ5A 4OP2A 5DGHA 2CDBA 4XIJA 3RVNA 1HT3A 3V6LA 3TRIA 1FYEA 1E1MA 5IBRA 3GFBA 2NQ2C 3EF3A 3KYCA 3OCUA 4IL5A 4JZKA 4MJ7A 5ISMA 4QL3A 3U3OA 2CV2A 1KEZA 5DBEX 4JL5A 4ZCPA 3SJ7A 4G0WA 4G0VA 3NHLA 4MNTA 3FNIA 1FXWF 1HDYA 1R3DA 2A59A 4HDNA 1TFRA 3V8MA 4B46A 4DQKA 1EXWA 2OGTA 4MS3B 3ABZA 3U4DA 3MBOA 3D7NA 3ZIAA 2FQYA 2BT4A 3KKLA 4FW8A 3AV3A 3NKVA 4GPIB 1R15A 4I2NA 3TAUA 1L5SA 4D3XA 2RGGA 1AV6A 4MLPA 4ZIRA 1IDOA 3B6KA 1HK7A 1P0IA 5JFOA 3LJKA 1Q7TA 2X9NA 1VBFA 3V1YA 1B15A 3EF0A 4JY7A 1N2GA 4NWIA 4RPKA 4P4NA 4U02A 3V1NA 3EX7C 4DV2B 1U2GC 1JFFA 4BJ6A 2AEMA 2AXQA 3PL1A 3W8FA 2O1WA 4MRPA 1IJBA 3GAFA 2P9TA 1XUOA 2D8AA 1QX3A 4ON9A 1Z6YA 3E3MA 2OFWA 2VSOA 4YXWD 4QXPA 2C96A 5FBQB 1NI4B 1KEPA 4OFXA 2GAOA 5AOCA 2RGEA 3VZSA 2D00A 4E6EA 4M55A 4D44A 4F6RA 2W83A 1SWWA 4HDSA 1P91A 1DRUA 3NVKI 1SKBA 3QVSA 2YFHA 4H7FA 1JXMA 4LHEA 4B83A 2E21A 4NS4A 3KEGA 4M54A 5C0OE 5AYVA 5LQKA 5JS1A 3SCZA 1KRWA 4MI3A 2PRIA 2RIPA 3RUDA 3TL3A 3LPCA 3EEFA 4LECA 1A5SB 1U81A 2A0FA 3OIGA 2IEIA 4QYIB 4GICA 1UQRA 1SUPA 5G1PA 5T6MA 1U63A 2E6UX 1U80A 3AEKB 3HA3A 4Q82A 2IYPA 4CTOA 1A8QA 4F5ZA 4W5WA 1QB8A 2YICA 4KBFA 3M5PA 1VLQA 4ZMRA 1FK8A 1TJYA 1EWRA 2AGVA 3PXEA 1LVUA 1G8JA 1CUCA 4QULA 4Y1FA 2ZULA 1BG6A 1RW4A 5CT4A 3ZD7A 1GQ2A 3EQ2A 3D8UA 3ZCTA 4ZVPA 1GDHA 1IY9A 1U8AA 3WA6A 2AYXA 3W2IA 4UREA 4KQIA 1KRXA 3GMDA 4DA7A 1GA6A 5CLHA 4US2R 1DJMA 2C7RA 2E49A 3HDGA 1RYBA 2YHIA 4FGLA 1E2NA 4BC1A 4DVJA 2HIGA 1M9NA 2IDMA 1BSVA 1XXHA 4V38A 1SXJD 2DB3A 2HGSA 3DYVA 4MGEA 1HZJA 4B5LA 2LGJA 3GLUA 3QA9A 3CIFA 4UFNA 2HX1A 2R44A 2TYSB 3NIBA 4C4XA 2B6HA 1ND6A 3QG5A 3R3WA 2AXEA 4Y2TA 3PEVA 4DNXA 2CLSA 1NUUA 3LPMA 3WO0A 3KSRA 2E1RA 3TEFA 4ZZ2A 1L7DA 1Z8HA 5DP1A 4EMUA 1JNYA 2FW7A 2XPCA 3MXTA 5C3UA 1CB7A 4B3GA 3JWGA 3EPHA 2PJUA 1G291 1VMEA 3DJFA 3LTNC 3GLFE 4QYSA 3TNJA 3WSWA 3RUEA 4DLBA 3M4YA 1DC5A 3LBYA 4M1SA 2GHTA 1QE5A 4F3TA 1RAGA 2UYGA 4M6WB 5BUCA 3G0OA 4WX2B 2WLTA 2ZYIA 3STVA 3UUGA 3M6VA 1TJ4A 1G8FA 2PFGA 3NUZA 2BMAA 3QXHA 1XRJA 1C7ZA 4EHHA 4FS8A 4PQFA 1RKVA 1XZFA 5LWHA 3AEUA 3NATA 3RUAA 1DZIA 1V43A 3DEJA 3D8RA 3QKUA 5IX8A 4UEKA 1GAXA 3LY8A 1EJ0A 3DMPA 1JTFA 3G0HA 2VYFA 2F8SA 3IJRA 3CRQA 3WISA 4CDRA 1DJOA 4EUSA 4JHLA 3VDXA 4YH1A 3URMA 4M1KA 3MRSA 1TD1A 2Y77A 1UC9A 1YB6A 1E2PA 1RZUA 2FWNA 3TOZA 1MO2A 3T3HA 3U1VA 4FCCA 1IPFA 4B2YA 4ALMA 1QHNA 2VZ8A 1NVFA 4LBVA 1KZGB 1W8DA 2VJMA 4RD1A 4XI9A 1SCBA 3FXAA 4L4ZA 4P81A 5CA0B 4X44A 3EPKA 2B8JA 3FTEA 2HEIA 1COWA 2NSLA 3Q87B 4KUHA 4NE7A 3V4FA 5CU7A 1U3TA 3R3HA 3NHBA 3QUTA 3TXYA 2O2JA 2XZOA 3MXOA 1H1TA 1K7CA 3MWLA 3U39A 3UOWA 1G41A 1U3DA 2JJ2A 2P68A 4I36A 4JOSA 2Q0QA 1E99A 4EW2A 3TGLA 3QUQA 4I5FA 3QBTA 1YRLA 4NMMA 4QFBA 1H5QA 2XCLA 4P7KA 2J9FB 5EQDA 3PHIA 4XGQA 4DY4A 5LP1A 4R9RA 2AD1A 2ST1A 4RHFA 1ZIXA 1VIVA 3NV7A 1VI6A 4A8JB 3ELDA 4AKSA 1TEXA 1WKCA 4LYAA 3HNPA 1P1KA 4ENPA 4C87A 4HNRA 4EO4A 1IVYA 2R62A 1NBME 4QRHA 4HKTA 1H22A 3EBPA 3F8WA 1XD2B 3N2KA 1OLOA 4L02A 5JE8A 5K7SA 3M1IA 2ZW9A 3CONA 3PUHA 1PQWA 3V55A 1C30A 1KSGA 3TLXA 4D92A 2EWWA 3DVQX 5HCNA 4WK0B 3IB3A 5AW6A 5AK3A 1PJTA 1XOIA 1P5ZB 3CUTA 3JZDA 3LT5A 3LIIA 3LG2A 3CLRC 5EI5A 2XA1A 5JS2A 3ZX4A 5I7VA 5JAZA 2BKAA 4GRDA 1G42A 3O1IC 3KD2A 2E4WA 2R96A 2ZR7A 1R0RE 1TTPB 2VSNA 3KQNA 5M3BA 2ZUDA 3DUFA 1JLLB 3BA1A 3G2PA 2DPXA 2GESA 3KAPA 3L3BA 1GAEO 2BZSA 1F0NA 1C9MA 3BJEA 5HILA 3V9PA 4LZLA 4WNIA 3PUVA 2PR7A 4JP8A 2BEKA 3R0XA 3BXEA 4JH0A 4TT3D 1OCEA 2NVUB 4CM3A 3G82C 4LJSA 3K96A 4HO1X 4DC0A 3MTBA 2L69A 1SBIA 2PUWA 2J33A 1VLHA 4ZT2A 3SD7A 1ULHA 5PNTA 4LISA 1WMDA 1ZW6A 1CUIA 4FEGA 4R1SA 3E7XA 1F8YA 1GA4A 3U31A 1KO4A 3DFMA 1E3WB 2CHUA 3I3OA 3FI0A 3QEOA 1MC4A 1QP8A 3X2SA 1GVNB 4AJHA 4BO9A 4WFJA 3A1CA 5FLKA 4GNKA 1I1NA 3DQZA 4L4UA 2UXBB 1TCVA 2ZS9A 3PCTA 4K87A 2ECOA 1A2OA 2FKNA 5CHEA 3SFVA 3MWEB 3NP9A 5JALA 1QIKA 1P1HA 5I7UA 4D3ZA 1EWYA 1RTTA 1NKTA 3CJRA 3MUEA 3O90A 4RU1A 3VYUB 5C9ZA 5HKBA 3A2MA 4WCFB 3OFNA 2NU6A 4UHBA 3T5GA 3TR5A 4EG7A 4HNUA 1K6MA 3KVYA 4NK5A 5JQGA 3SWWA 3PDIA 1EXDA 4RA6B 1LBSA 16PKA 1I80A 1M2WA 1MEOA 1XBTA 4C4TA 4Z1MA 4BQEA 2C78A 1E5XA 2ARKA 1OX6A 2VPYA 2XDWA 3D0RA 3IBYA 4OKNA 1LWOA 4PYIA 5EJ9A 3S8YA 5K3CA 1GKIA 3QTTA 2W37A 5AM3A 2ZT8A 1DRVA 5IJ0B 1K5HA 1N1MA 2A9KA 2HZ7A 3CLKA 4LXHA 1JHVA 3U4GA 5LIRA 1MP0A 1K27A 3CV3A 3U7HB 1G63A 4Y9SA 2D0PB 1J39A 5KB3A 4EHKA 5LOVF 3TRFA 4F11A 1ZUIA 4H27A 3O84A 1HEYA 4K05A 3ZGVA 5FPKA 4JI7B 4GL2A 3E0QA 1HLDA 2CBXA 1I7DA 2IJGX 2AI2A 4QNNA 5K6AA 5KSZA 1EYZA 1US8B 3C6ZA 4DR3B 1RJEA 2CJYA 1ZXLA 1VKOA 1T8RA 2QTGA 2VAVA 3OZVA 4R05A 4OI1A 2J6IA 3A4LA 2JHFA 1MJHA 1O8BA 2WM8A 4GMHA 1V2GA 1U2DC 1FQJA 4MW9A 4NE2A 3L18A 4ETWA 4HVCA 4BBZA 5C4IA 1RXCA 2OCAA 4HF7A 4U3JB 4KQGA 3NYWA 2DT8A 2O1SA 1YJ8A 1VL5A 3GJ0A 5DO9A 5JARA 4FT4A 3NDRA 1OKKA 3R0IA 1JFSA 4EO7A 3ZV6A 1ABEA 1TTQB 3IMEA 2RJNA 3DO5A 3SKVA 5FNVF 1S9HA 1WX1A 2GPTA 2I4OA 1SA0A 2MSCB 3AF1A 5ALZA 3T3GA 4BKOA 2ZETA 3HCEA 2Q5IA 1TYDE 4O4IB 4AZVA 2HQOA 2EKLA 1K5DA 1DHRA 1CUBA 4ZV9A 2ASVA 1V11B 2YMQA 4QO8A 3UY4A 3ZY2A 1OTXA 4YMUA 4AI6A 1KZ6A 1ZLXA 2KPOA 4WBNB 2VZLA 4HNAA 3IJ5A 1YQGA 2B69A 4BX3A 3U3DA 3T4XA 3PDHA 3DDWA 5EJ5A 4GX1A 1JR6A 4C7VA 4MVYA 1J90A 1UPTA 1YIOA 5TVKA 4IZ6A 1UK6A 1Q0UA 2H5LA 1BCRA 3K31A 3RYFA 1GL7A 1QCZA 2IIVA 3WKDA 2OOSA 1KEUA 3J7AC 2J5BA 1B8VA 1S4MA 1Q1QA 4P82A 4DGSA 1ODCA 3I6MA 1BFDA 1P3JA 4KEAA 4NPHA 5CYPA 4YN3A 4DMCA 5FX2A 3VA7A 1RXWA 5G40A 1L5NA 3ZOKA 1KEEB 1EHCA 1LX6A 4XFDA 1VKZA 1RHMA 3KK0A 4LZOA 3L7NA 1GIAA 1FMJA 2CKDA 3TG2A 1JI0A 3K0CA 1U7ZA 1L9KA 2NZVG 1ZG3A 1BEUB 3I8XA 3D3QA 3O95A 3OZTA 4UHJA 4KZKA 4M3NA 1YUMA 3BG5A 3S2GA 3RK0A 2G36A 4PFQA 4JASB 4WBXC 3ZLJA 3ERCA 2O0JA 3UF0A 4C20A 3S27A 3CUWA 4D9HA 1EE9A 5A6SA 3FF1A 1CD5A 1NF9A 1SAYA 3FZEA 3R0JA 1C1HA 1GPJA 1J5PA 3U4CA 4A26A 1M1YA 1PK8A 2J9XB 2EP8A 2WA2A 4W1RA 1TM2A 1IVNA 1C0KA 1P0FA 1WUKS 4GOND 4X54A 4CV2A 4DW8A 4EYSA 1Q74A 2JEYA 3DPUA 4RVDA 1KAQA 1NI5A 3CVYA 3PA8A 1B41A 5FT9A 3AWIA 5C46F 1RE0A 1WLSA 4FYJA 2H4FA 3HLYA 5KQGA 2BKUA 3CB4A 1XYYA 3B6JA 3SE7A 4LQ4A 1SU8A 2AZDA 3ZY4A 1L4YA 5FO1A 3MVEA 3QMMA 3EIWA 1NDQA 4OQLA 2P9QA 5DMXA 4IJKA 2HA3A 4FKZA 4CKEA 1G2QA 2VRCD 3ZLUA 1DI0A 1IZ7A 5HE8A 4KR0A 4DLPA 2N1MA 2JJYA 4YRSA 4IDPA 3AFHA 1HDIA 1L5WA 1TXGA 1J70A 1R0WA 2JAOA 2ZIWB 4FPXA 4UM9B 1G16A 5BVGB 1Q7BA 2P0YA 5BR8B 2X9LA 1RQGA 2WSMA 3ZGOA 2YZNA 3F3MA 2QD1A 3BULA 1RP1A 2DY1A 2JFHA 3I2HA 3SQDA 4CKXA 4N03A 1HRKA 3CMCO 5HGXA 2NP7A 4EDHA 1XMIA 2FLKA 3O03A 3WY9A 4L8FA 2F4VB 4P6VF 2EL7A 4K0KB 3B9BA 1H2BA 3IOCA 4I08A 3D7MA 3V7YA 1EZZA 3T7DA 4E0BA 2ZRIA 4Q66C 4JT8A 2ZBFA 2I7VA 5ULLA 4KUEA 2AD5A 2CF5A 5JLAA 4KQEA 1JS1X 2XOEA 4IVRA 3TXXA 5ALLA 3JQGB 4M76B 2QZ9A 1MAAA 2V97A 4M8KA 1CUEA 4RIGA 4BV3A 2O2GA 2GJ9A 3AC0A 4EPYA 3QXGA 3LCVB 3BE5A 4TTAA 4FGWA 2XXBA 1F17A 3HPRA 5ITZB 4D81A 5ARDA 3SJCA 2AXNA 3FPFA 1UC8A 2AQIA 4GM1A 3NYQA 3OZUA 4LGMA 4I50B 4KDRA 4EFNA 3A2LA 3FYDA 2OO7A 4PO9A 2J7KA 4Z9XA 5IABA 3GG2A 1C8VB 3OFJA 5T41A 1LLUA 1OAOA 3T54A 1N5IA 1P1FA 3AHCA 1IZ0A 2VNJA 2ZITA 3OM8A 4QBFA 2IW3A 3UT0A 4GZMA 4D1YA 2ZBUA 3PGLA 1PJQA 5D01A 4KVFA 4KR6A 1VSBA 2DWCA 4UCXA 5I9SA 5J4LA 2X0RA 3T5AA 3CUKA 4QUEA 1W73A 3BOSA 4XEHA 3QVXA 4NECA 2QP9X 5EIEA 3NGLA 1KQPA 1G7SA 5LYYA 4BGVA 4UQLA 2R25B 2ZAIA 1RAEA 1XVTA 1RZVA 1IEQA 1JAHA 1V1RB 2QR5A 2XE8A 3DTTA 3DZKA 4K7JA 3MHPA 5JPCA 3K6SB 5LYJB 3CH4B 4BNLA 1K7EB 4G0UA 2C54A 3MNFA 1ADCA 1E3MA 4M37A 4FN5A 5JLJA 4JC4A 1NURA 1TRHA 5IN4A 4ISCA 2E4VA 3DV9A 3RJ9A 1I30A 4DXHA 4PZZA 1Z06A 2LPMA 4IIUA 1R0LA 3NWPA 1YR2A 3JVDA 1XMVA 3ILXA 3PQCA 3KWMA 1E1CB 1LY1A 3AM3A 2QNIA 4BNHA 1PUIA 5DN9A 3TTSA 1DCMA 2H7YA 1PSWA 2AT1A 5FF9A 2UXCB 3VYVA 1Q92A 2GDJA 3ED5A 1EWQA 3EGIA 4JJZA 1T1GA 1JPJA 4L4YA 2JGEA 5A02A 2WWXA 3HUUA 2GN8A 4URHA 3W05A 5KVCA 1FUUA 2XE6A 1JA9A 2VT3A 4D4GA 2FSVC 3JTMA 5B1IA 2J0SA 1D2CA 3TPZA 5C7OO 5C8VA 1OLXB 2MTBA 2WY2D 3CW8X 2OCPA 4D42A 4UUAA 1JALA 3GFQA 1Y8RA 1SBCA 3BERA 3IAS6 4R8SA 5A62A 2FCRA 3HXLA 1NVVR 3GGSA 2AFIE 2KJQA 4WPGA 4U0JA 1RXEA 3H0KA 2PK3A 5IWCA 2BDEA 2DHQA 2QUHA 4F6CA 5CAEA 4Y2VA 2ZJ2A 4X0EA 4PYLA 3WHPA 3GP5A 2AKYA 4E5MA 1F7UA 1Q6ZA 1LDYA 3A2KA 2QSZA 3O8OB 4HT3B 2PRYA 1V5EA 2YJGA 1LNQA 2O3JA 3MCTA 4GYJA 4NZNA 1BIFA 2PBFA 3GNSA 4GS5A 4C22A 3IQFA 4U9HS 1FVFA 2Q5JA 1D4ZA 4UM9D 4X94A 2R8PA 2H9AA 1K7YA 3KZVA 4N1AA 2CVOA 3NQ41 5D3KA 3ROMA 5IC6A 3F6BX 1Z73A 1I1OA 2Y0BA 4HX9A 4EJ0A 3H7IA 4LC1A 5CCBA 4Q24A 3V00A 4JYAB 5G0VA 1A4IA 1F5SA 1FZTA 3OETA 4OHOA 4PV7A 2WSYB 2CF6A 3ORSA 4Y67A 4AUEA 1FYXA 4WIAA 1KJWA 5AUOB 4BE4A 2I6UA 1DAEA 2Z6VA 1Q83A 3KKOA 1U99A 5IYZA 5HTOA 1TZKA 1FRNA 3UBMA 4K6KA 2QG6A 5REQB 2R86A 4AIRA 2WM3A 1ST2A 1U02A 1XR3A 4GKJB 5TC4A 1M33A 2BR4A 2UZAA 3KXIA 2Q3DA 3LQ1A 1W46A 4UHDA 2JGNA 1U8TA 4EHJA 4IHQA 1RKUA 4RSMA 5I3CA 2O54A 3BWBA 1SXIA 5KAPA 4JCOA 1PTJA 3V3KA 5JNLA 1HFKA 4O8CA 1FBTA 1SXGA 2VDMB 4DYDA 4PTLA 2PUCA 5DYTA 1QFJA 1ZPDA 3FSEA 2NQTA 5JNRA 4H0CA 1ECFA 3MJRA 3EE6A 1G21A 1JQ5A 3H4MA 1C80A 1E2UA 2X5NA 2C82A 1VHDA 4RUKA 2WWWA 6CHYA 2CLIB 2XMDA 3CZ5A 3G8BA 3MJ4A 2C5LA 4DT1A 4WGFA 3CEMA 1CZRA 4ALLA 2V7EA 5K99A 1MORA 1RKBA 3SX4A 1YS4A 1E1QD 5L9AA 1C7QA 5DN6D 3DOFA 4YB8A 4V0MA 3CW2A 1GZUA 4AK9A 3BB3A 2EBWA 1VLMA 3FHLA 4F96A 1TW3A 1M73E 2FXIA 3HU3A 1RM3A 3BWDD 1YO6A 4K03A 3C3AA 1WPRA 1S2OA 3R2JA 5LBIA 5LQCA 2GK6A 1BDHA 5KX5B 2I6SA 4PS0A 5K20A 1AMOA 5GINE 2A0KA 4UU8A 4X3CA 1BDJA 4AY6A 4FHZA 1FTGA 3GPLA 2ZG6A 4N5IX 1T0IA 4UATA 4QT4A 5HUQA 4D5EA 3D2LA 3UB2A 3IUMA 2ZRHA 3FHTA 3MCZA 4FE4A 3SDSA 1X94A 2PYIA 5DFAA 2NP6A 1PJ4A 1WW2A 2KWIA 1TE2A 4H31A 2WFZA 1OREA 2OGZA 4ZI5A 1SBHA 4B3DA 3QM1A 2ZS7A 3C8ZA 4YAJA 1ESCA 3R23A 1KFBB 2Z5FA 3DZIA 3K70C 5BN5A 5JDCC 1EUQA 5G3ZA 1Q20A 1W49A 4C6SA 5KOIA 1THTA 3BMQA 4TPKA 4XCVA 3VKUA 1IY8A 1D2GA 1V6AA 2MR6A 3T1NA 1K86A 3I6YA 2V6GA 2VK8A 4DDHA 3KKZA 2O3RA 5G4LA 1GAQA 4ZEMA 1H1LA 1SIBE 3ZKAA 2Q45A 3A8TA 4WKBA 3ER9A 4M1YA 3LC1O 4ARZA 4RZIA 4HGYA 4IV0A 4UNIA 1VE9A 2FMUA 3B1XA 5INTA 4R3WA 5FTKA 1WMEA 1ISPA 2CK3D 2XLBA 3OECA 5TPWB 2CXXA 3P0IA 5JH7A 4S1NA 4UAUA 2GO7A 2R8EA 1NFFA 5GP1A 4MYHA 3U62A 1VGVA 1LVGA 3SQOA 4BC0A 4OSEA 3H3XA 4LMRA 3WLIA 4WY8A 2V7UA 1KQGA 3FOZA 5IVHA 4HGQA 5EJ2A 1DKRA 3ZU5A 2BHLA 3UXYA 4I55F 1EUDA 3U3RA 4AQYB 1USKA 3G7UA 1Y1SA 4GZLA 4CQLA 4KN8A 1VCMA 3KHKA 4KYUA 5CW2A 2Q99A 3K30A 2I66A 1P1RA 4GSYA 4NATA 4PCLA 3AJRA 3T3NA 1Z5ZA 3HFJA 1XTVA 1E2JA 2HJHA 1Z74A 2GRUA 2P6OA 2QG9A 2GLXA 2DQ4A 4MITA 2VSXA 5F7JA 1GTG1 1JXQA 5DM4A 3W5JA 1ZA1A 2AKAB 2I55A 2YC4C 3CVUA 1FTYA 4CM1A 1DV1A 1N6KA 1DADA 1KNQA 1VIAA 2QUIA 3AOEC 3CO0S 3LU1A 1LK7A 2KBEA 2GD6A 1ZD9A 1RHUA 2R7MA 2WB4A 3A6GA 3CRW1 2PRZA 3LD9A 4I4TB 4X5OA 3RYIB 4BQPA 3DBLA 3RDPA 1D1PA 2O4UX 1K9VF 3F5QA 2FVXA 4OEHA 1M1UA 1OGYA 2P9CA 4P3YA 3VPGA 3NANA 2PZJA 2OTCA 1XTTA 5ESWA 3I6IA 2ZXFA 3G8YA 4XGIA 4BJ3A 3S7ZA 1TQ8A 4G0MA 3CU5A 3TQQA 2C0CA 4JLSA 4DCNA 1ICIA 1RJ9A 1GFWA 3JRWA 1CB0A 4RMJA 2P11A 3CCFA 4G5QA 1FMCA 2JCSA 4OLJA 5FAXA 3HXOA 3IVGA 2EXXA 2PRKA 2OMEA 3PXDA 3O47A 3OC0A 3RKSA 5EHQA 3DC7A 1JEYB 5CXXA 4WKNA 4D3YA 1LS1A 2CSXA 2YNMC 4NI5A 2HT6A 2XGJA 2ZIVB 2HV8A 2Z9BA 1NMSA 5JADA 2D7CA 2IF2A 3H87A 4D99A 1IPHA 3G6WA 1NXXA 2JIZA 3D8NA 5FWNA 1ODFA 1RWPA 1PHPA 4MVJF 4YASA 4WN9A 2V96A 2G83A 3K05A 4FE3A 4JP1A 3PDWA 1L1RA 1O97C 4ARVA 4EA8A 3SIWA 3RCBA 5TGDA 5JR3A 4UVGA 3BMOA 2HWWA 2ZJ1A 5CHYA 4BMVA 2F64A 4UMVA 1RWXA 1R00A 4F2HA 1TUIA 1AMNA 1EK6A 4L57A 1RFLA 4FBLA 3RJMA 2ZT5A 4CFZA 5BWLA 4LX0A 1B1AA 2C5FA 1J7JA 1SQ6A 2CMGA 4FJ1A 4H7EA 3HR8A 4E2YA 2WMYA 3CLRD 4G8CA 2FCAA 4AJKA 2MYPA 2ZAGA 1UODA 3DVRX 3FKSD 4P08A 1FUIA 4QXMA 4ADSG 4Q19A 1KOFA 3ZVLA 4NJMA 1P80A 2PJDA 4YRDA 4CM4B 4J3FA 4WLNA 2G7ZA 1XPRA 1RC1A 5AVYA 5AK6A 1QTNA 3SR3A 3UTDA 5KWVA 1R6UA 5GM2A 3R9XA 3VDMA 2P5TB 3T34A 5B2FA 5KSYA 2ZQYA 5LCXA 4RJTA 1T4DA 3O73A 2YWCA 3O4VA 4TXHA 1IHXA 2VPTA 2G82A 3NW9A 3TD6A 1EDZA 4BWVA 1IZ8A 2Q8NA 3KKPA 1AT1A 3GDOA 4QSMA 4U7HA 2YYYA 3BRSA 3GJ8A 3NCHA 4G3XA 4M0KA 4LVNA 3VR1A 2QBYA 1W47A 1X8JA 1ZKDA 1UDBA 1Q3KA 2O48X 2B4QA 2OQ2A 5BT9A 3H1FA 1Y81A 4JLVA 4MDHA 4BX0A 4FBGA 3M6IA 1YHYA 1P33A 1CY2A 2WF5A 4N5MA 2XT9A 1E7MA 5IXYA 4HQNA 2WFLB 2JFBA 4HXFB 2XNKA 1E1RA 3S4YA 3NC1C 2R6HA 1BXGA 1YGYA 1MOSA 1PJ3A 4I3FA 3W5UA 1T3HA 4NG5A 3NPMA 5FA5A 3TLYA 1L7RA 3DKPA 3IHWA 4J16A 4YRAA 4ZYLA 4RDIA 3LIPA 1I3NA 1QE0A 4TMZA 3SHTA 3GLKA 3DHWC 1UAGA 2CLKB 4G0QA 3FPAA 1EVQA 4HLNA 2Q9BA 4Z7QB 1TD9A 1RXVA 2GNAA 4QVIA 1OLSB 2BZ0A 2CJWA 4DLWA 4KR7A 4LZWA 4RNCA 4GSKA 3VHXB 1CR1A 2YOFA 3L6DA 3ENNA 5CX1B 4YI5A 4NV1A 2X2OA 1OFHA 2GCEA 3EOBI 1NBOA 2A9RA 2F1RA 4M60A 4TTJA 2BEWA 5FLEX 2W6ID 3DXZA 4JI6B 4BQIA 4D2IA 4B7AA 3PUYA 1M6VB 2V6FA 1R9MA 1T9HA 2ALJA 2NTYC 3GLSA 3JAWA 1AKTA 3MBKA 4TV8F 4IUYA 3TZHA 1WXEA 4CW7A 4TKVB 4QAJA 4FFNA 4Z4FA 3TLGA 2G28A 3WGGA 2P6RA 2IUTA 1LNZA 3D6FA 4CKCA 3VTAA 1L1EA 1NTOA 4G0YA 5NULA 4R4JA 3LY5A 3SZLA 2XUOA 3NG1A 2XUPA 2XRFA 1QO0A 1A7JA 2LDXA 2NU7A 2XKJE 4R1QA 2PTHA 3DCYA 1SD1A 3HYTA 2I3DA 3II6X 3D0QA 3KKMA 2ZT7A 4Q3NA 5K8JB 4WZBA 2NO4A 5LQUA 1L5YA 4RABA 3CRRA 3GEBA 2G9RA 1U2QA 1X7ZB 1FJGB 1PL8A 2RH5A 2WIKA 2ZBGA 4MZDA 5EIOA 4I4LA 4CQMB 4YXFA 5JCXA 4X65B 3LT0A 1CS0B 3T7IA 3TLKA 4IY1A 4LFCB 4S1WA 4N8DA 3GNQA 4E21A 2D54A 2PZ8A 5IU6A 2Q3BA 2QR2A 1P9OA 4BKPA 2DTEA 3RSCA 3Q11A 2GZHA 3SBDA 1IN6A 3TZBA 1NY5A 1XZLA 4K9QA 2VYVA 1QQ7A 3FNFA 4GEKA 1FU7A 3U4QB 2V5UA 1DKOA 1T36B 3VH2A 2ILVA 3N7UA 1A8SA 1SNYA 3WAJA 2FR8A 4MUNA 3FD8A 4D6YA 3N0VA 3T0IA 3PUWA 1EFUA 2YCLA 3S70A 1JU3A 1U5BA 1EGHA 3UWDA 5H3HA 3AVVA 3DAOA 1JHPA 2VT7A 4D43A 4JYBA 5BSGA 1NWHA 2WM9B 3WLAA 2XV1A 1DOHA 1UBNA 4IDEA 4RL4A 3F46A 5AI4A 2I1LA 1KDOA 2RK3A 3DFZA 4KXFB 1ZI8A 3A3NA 1YCDA 2HHJA 4RX1A 5DGXA 1VE7A 2HZBA 1JQKA 4E12A 3BGSA 3PNOA 5A5VA 1WQ3A 1Z82A 3HA5A 1YVDA 1EQAA 2Y93A 4TTRA 4XD2A 1QC5A 5C8YF 1DFHA 2C4UA 1FX0B 1L4BA 5GPBA 4MPTA 3PZBA 3OPXA 1B8UA 1DSSG 1C3EA 1N9KA 2QVYX 1V3TA 3UHFA 3ZVMA 3CKMA 1FRVA 2B1QA 4M49A 2PQMA 2WNSA 2XUAA 4IMJB 4ER6A 3W5AA 2RMKA 3LFTA 2ZRAA 2ZYDA 1YIDA 1GGKA 3DHVA 1Q1NA 2LKDA 3N2GB 3RRJA 1IYZA 3NEPX 4L16A 4M9XA 4JLJA 3DW1X 5FTWA 3OZAA 5CR9A 4YYEA 4C88A 5KEIA 4NLLA 1R0BA 2Z1DA 3ZDQA 4WNAA 1CULC 2B4AA 1WXDA 3EG9A 3IPAA 3K1AA 5C7YA 2J0UB 2DOKA 3H3FA 4YCAA 5DNYB 1OU0A 3JQ8B 3NHPA 1WM1A 3RE1A 4EUFA 3AR6A 4Z8YA 4OIFA 2C4HA 1MRSA 4JR2A 1YZGA 1OXSC 1RBZA 1L4HA 3VSEA 3OJLA 5LD2B 3QTLA 4R8RA 4XVUA 2O7NA 5BR7A 3UJCA 4O2RA 4ZJUA 3IAFA 3EHDA 1DQPA 3PWTA 3U44A 1K6JA 1IB6A 2W6MA 3F8TA 3PFBA 5BSMA 5J2TF 3H5LA 1FNMA 3LK6A 3SYMA 5I7OA 5M29A 5CLFA 1P7WA 5JSQA 2XCUA 3KLOA 4UCWA 1E2IA 3AR4A 4NAHA 2JFXA 4FCVA 4K3UA 4FZJA 1MIOB 3V1LA 5ALRA 1Z9BA 3IHLA 3UOGA 4YT2A 1ZR4A 2I7CA 1MB0A 4MRMA 2PGLA 3LOPA 3F0TA 2QM8A 4DIKA 3GLHA 2WUWE 1UK9A 3GEPA 1ZL2A 1NV9A 3A28A 1FFXB 2ZXEA 3CC8A 1FTWA 2FRVA 4MEJA 4QOGA 4E09A 3PV0A 1VL0A 3K8ZA 2D5AA 1UBOS 3EXHA 4MUMA 4FB5A 1AHNA 1MAHA 3Q9NA 4ZP1A 2ZU6A