3DJFA

Crystal structure of schistosoma mansoni purine nucleoside phosphorylase in a complex with bcx-34
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
283
structure length
280
Chain Sequence
VTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for selective inhibition of purine nucleoside phosphorylase from Schistosoma mansoni: kinetic and structural studies.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
molecule keywords Purine-nucleoside phosphorylase
total genus 86
structure length 280
sequence length 283
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3djfA00
5ETJA 1QE5A 4LDNA 1YQQA 4H1TA 1A69A 1V45E 1Q1GA 4GLFA 4L5YA 1JDSA 3KUKA 5F7JA 1WTAA 1ECPA 4L5CA 4G41A 1OU4A 1PR1A 2AI3A 4QEZA 4DA6A 1Z5PA 4D8XA 5F7XA 1A9OA 4JOSA 3DDOA 1T8SA 1Y1QA 3OCCA 1TGYA 4TS3A 1RYZA 2AC7A 2HRDA 4KN5A 3OZEA 4MCIA 1RXYA 4QATA 1PR5A 1OTYA 1ULAA 1T8WA 5IU6A 2GUWA 4WKPA 3T94A 3P0FA 1YRYE 3GGSA 5K1ZA 3DF9A 1ODIA 1YQUA 1C3XA 4MARA 3BGSA 1A9RA 1JYSA 3NBQA 4DAOA 3UT6A 4EARA 2A0WA 2I8AA 1A9TA 4TTIA 1OTXA 3OZDA 1Y1SA 2AI1A 4PNPA 3P0EA 4X24A 2I4TA 1Z33A 1I80A 4DARA 3FOWA 4YJKA 3MB8A 4I2VA 1PF7E 3TL6A 4K6OA 3EEIA 1JPVA 4MCHA 5CCEA 1PR2A 1PR4A 1B8NA 3E9RA 3SCZA 3LGSA 4YMLA 4JWTA 3INYA 1Z35A 2OECA 1U1DA 2H8GA 3NM5A 2QSUA 2Q7OE 2B94A 3PNPA 4M1EA 3DPSA 3ODGA 1T8RA 1B8OA 5B7QA 4OGKA 5EPUA 1T8YA 3O4VA 4QFBA 5EFOA 1PWYE 4P54A 1PKEA 1K27A 1JE0A 3UAZA 4M3NA 1VHJA 1OV6A 4BMXA 2QTGA 4TTAA 2PGAA 1RR6A 3EUEA 1SJ9A 4DANA 1U1GA 4TXNA 4YO8A 5EUBA 1FXUA 4LNAA 3ENZA 4GMHA 4EB8A 1TD1A 1VMKA 4NY1A 4RJ2A 3OZBA 1RCTE 4OGLA 1JDUA 3UAVA 4JP5A 1K3FA 3OZCA 1V41E 2OXFA 3ONVA 5KB3A 4QARA 4QASA 2P4SA 2QPLA 4PR3A 1Y6RA 3NM6B 4TTJA 5F77A 1Y1TA 5F73A 3OOEA 5FAKA 4G8JA 3E0QA 1A9SA 1Z38A 1PR6A 4TS9A 2BSXA 1A9QA 1TGVA 4LZWA 1Z5NA 3BJEA 1PK9A 1V4NA 1JDZA 1OUMA 5CYFA 4LNHA 3KVYA 4D8YA 2RJ3A 4QAQA 1CG6A 1Y6QA 5CXSA 4DABA 3FB1A 1VHWA 3E9ZA 3F8WA 2ON6A 1V3QE 4L0MA 1T0UA 1YBFA 3IEXA 3K8OE 4G89A 1NC3A 5CCDA 5CYGA 4F1WA 1A9PA 1TCUA 3K8QA 3KU4A 5F7ZA 3UAWA 4UC0A 3FUCA 3GB9A 3OPVA 1JP7A 4OY3A 4BN0A 5DK6A 4YNBA 3OOHA 4LKRA 4BMZA 4D98A 1ODKA 1Z39A 4GLJA 4WKOA 3DJFA 4DA7A 4DAEA 3KHSA 1ODLA 3IOMA 1PK7A 4TYMA 1RXUA 3KVRA 4L5AA 3FAZA 1PW7A 1XE3A 4DA0A 4L6IA 5IFKA 5C80A 1LV8A 5F7OA 1PBNA 1VFNA 1SD2A 2QDKA 3EMVA 4OEHA 4R2XA 1YR3A 2XRFA 4WKNA 2HSWA 1N3IA 2A8YA 4D8VA 4M7WA 1ULBA 4F2PA 1RXSA 1CB0A 4NSNA 2OC9A 3FWPA 4WKCA 1SD1A 5JPCA 1RFGE 2ISCA 5B7GA 1Z37A 4GKAA 1OVGA 1V2HE 1SQ6A 1Z5OA 3MMSA 1ODJA 4TXLA 3LBAA 3OF3A 2A0YA 4R31A 4R2WA 2AI2A 1V48A 3EUFA 1NW4A 1ZL2A 1NC1A 4ECEA 5F78A 1K9SA 1Z36A 4F2WA 3LA8A 2HN9A 2A0XA 1U1FA 3U40A 4TXHA 3UAXA 4FFSA 5CXQA 1JDVA 1M73E 3PHCA 1JDTA 1JE1A 3DP9A 1Y1RA 3PHBE 3QPBA 4F3CA 4D9HA 2OC4A 2QTTA 1RT9A 4F3KA 3FNQA 3UAYA 1LX7A 4TXJA 1RXCA 1LVUA 4OF4A 4OJTA 4DA8A 3PNSA 1TCVA 4TXMA 3NM4A 3C74A 1U1CA 3D1VA 1PR0A 4BMYA 1RSZA 5B7PA 1U1EA 4WKBA 1G2OA 3KVVA 4E1VA 5I3CA 1Z34A 5F76A 2HWUA 2IQ5A 5B7NA 3BL6A 3O6VA 3BSFA 4IP0A 4U2KA 1ZOSA 4NS1A
chains in the Genus database with same CATH superfamily
3KL2A 3LP8A 3KJHA 5LVAA 2M2IA 3EGCA 4QG7A 4X94A 4C76A 3LX5A 1UR5A 1ZIXA 1C3VA 4O4LF 1LW7A 4DY6A 3QWAA 4QJ3A 4J90A 5C5DA 2L19A 3FPSA 3MILA 4WZAA 3ER9A 2NVUA 1L8QA 4BMVA 2P67A 4MR8B 4HQOA 2G0TA 2IYOA 1KO5A 1HT2E 4I99A 3WTCA 3AVVA 4B4KA 4CMAA 4Q3OA 4ZT2A 5A03A 2HTFA 2ZYUX 2XNHA 2C2ZA 4Z86A 4E5SA 1IXYA 1U7HA 1NUQA 3DZGA 3GPBA 2HADA 2J46A 5H9WA 3R0VA 3D4OA 1TU3A 2GPBA 3MJ4A 3GT7A 2FCAA 4IMPA 2AI3A 5JH7B 5EXXA 4RH3A 4QJ5A 1N5OX 4DV1B 2D13A 2XUHA 4K9QA 4OSEA 1I4TD 4HXGA 2H3HA 4Q1DA 1TM4E 2ZI5A 4XDHA 5DKFA 2WE7A 1VJTA 1YI0A 1JR3D 2ZWIA 4IY1A 1V9LA 1GQFA 3T1NA 1YT5A 3EGWA 4DA6A 2C8VA 3V4SA 3MWDA 5BSGA 1NFQA 1L1QA 4MV4A 3NRJA 3ZWQA 5E6UA 1LQTA 1WIWA 4M8KA 3JAKA 3K9WA 2DOKA 4RQUA 5IC4A 1Y1QA 2CZQA 2QRKA 5DF1A 5HOQA 2VLBA 5KYXB 3E22B 2RHCA 3A6FA 1LWNA 3W79A 4MYTA 2UZ4A 4R54A 3KPJA 1RXYA 2AOTB 1XPRA 2O2XA 3ESCA 4BGDA 1SZPA 1B6SA 4LJSA 2CHVA 5KTKA 1J99A 1EGQA 4TMVA 1TQDA 1ULAA 2D0OB 2BKXA 4RAOA 4UHFA 1KQOA 2YUIA 4R8SA 3KYJB 2PWBA 2FFRA 3SXUB 4FKZA 3KQPA 7ADHA 2GA8A 5B6IA 5IAKA 5GGYA 1GU0A 1IBRA 3OFNA 3BE6A 4AS2A 4KQ9A 3A37A 3KYCA 4MUNA 3LY8A 2PJZA 5IC6A 1VPWA 3K0CA 5JNWA 3FMIA 2NSYA 1XX6A 3CA8A 1ZCBA 2H6EA 3QVOA 5AW3A 4KIWA 3CPEA 3WLOA 3C6BA 3LT4A 1G5PA 2XCIA 3WLJA 4BNUA 3H2YA 3M1YA 4LCEA 5DBOA 5DNAA 3BHNA 4HGOA 3FUUA 4KZKA 5COQA 1GYPA 2DBVO 4XX1A 4X64B 2XOKA 1L5HA 4DM4A 1GT6A 1WF6A 4D3FA 2ZB3A 3N8HA 4W6ZA 1FXSA 4B32A 4HN9A 4P83A 4C0SA 1T34A 4FYWA 3D31A 4JC0A 3TW4A 3PCXA 3RM3A 3AHDA 3CLHA 3GN1A 4FHFA 1T8UA 1WCIA 2CBXA 3WX0A 2V45A 4JBXA 1QYRA 5CLGA 3O03A 2ZUBA 3PP8A 3KHKA 1U0NA 4W1RA 4TTIA 3WIOA 2WJYA 1OPXA 2XDAA 4GT1A 1OJLA 1K5DA 2ILTA 3Q40A 2E87A 4GWKA 4RHFA 3SJBA 1QFZA 2Q0HA 1BA3A 4ZI7A 4ZQFA 3SZ3A 3HM2A 4R8LA 1WQ4A 3OIUA 4TKUA 4FMDB 3ULKA 4F4FA 4YUYA 5KU7A 1E99A 5JJKA 2BW0A 4S1PA 2GAIA 1BH6A 1X1QA 1YACA 2C84A 2OD7A 2FSUA 2P6MA 2HREA 2QP4A 2ZFUA 2QJRA 3DXXA 3GQBA 3N5CA 3DFFA 1OFVA 4QOSA 3BUSA 1YMUA 4JJIA 4YJFA 2WIFA 3VPSA 5ALDA 4PNHA 4BATA 4DHWA 3ZZUA 2QY9A 2XUQA 5AIAA 1ZCFA 3JVUA 3HJCA 3Q7IA 2IU0A 2KE5A 4XEUA 1ID8A 3RUCA 5BSFA 1RLOA 1YCDA 2PZAA 3PYLA 1QF9A 2DR2A 3CH4B 3EA0A 5ALOA 3FPHA 4ETIA 5B5SA 1WW2A 3ETNA 5IRCD 1HBJA 1PF7E 3TJRA 3DXFA 4Y3UA 5K8CA 1NQXA 2IEIA 3P52A 1ZIOA 4MCHA 4CMEA 3OQ6A 4CEJA 3DOEA 1SXIA 2V8OA 4AJIA 3X1ZA 2C2OA 3MN1A 3E9RA 4AZSA 2NXJA 2GJ8A 1YNSA 3O3NB 2AYXA 1M2OA 2O50A 3LQ4A 5AKIA 1JA0A 4CUKA 2NUAB 4XWKA 3PJRA 5GQSA 2PUBA 1YGYA 5AJZA 5AI4A 2MJLA 1U8YA 4NE2A 4HMPA 1H2HA 1YAJA 1OC4A 5IULC 1BA2A 4DPKA 2CVQA 2WYIA 1UQUA 1ZM9A 5B4VA 1A97A 3ICEA 3TCNA 4HGYA 2W2MA 3AM4A 3LPLA 1Y5RA 4S24A 4B8ZA 4LK3A 2AOVA 1L5NA 1MVOA 1FP2A 3BCHA 4D9GA 5IKMA 1CUSA 1YONA 4J3JA 4DILA 1CY2A 3ZNOA 4DDWA 2BJWA 2PIAA 4XDGA 2OCLA 2WR8A 3CLVA 1QKKA 4BLSA 4YCMA 1U3FA 2Q1TA 1CQPA 2HSJA 2OCDA 1US8A 3BAZA 1FBTA 2X4GA 2PTHA 2XUZA 1F0YA 2ZIXA 4EF4A 4ENTA 1UBFA 3E5RA 1BXRA 5AI6A 3GWZA 4M7PA 5LZ4A 2FNAA 3PK0A 1QDUA 1U2SA 1C8KA 3AY3A 3QWFA 5BQXA 5THXA 1RQ7A 2C92A 2JIZA 3MLEA 1RHKA 2WWTA 2YXPX 2XGMA 3ROMA 4OBWA 5C1DA 4YDSA 1JWLA 3ZZ1A 3BFXA 3O4RA 1VHJA 4CMHA 1KEUA 4J16A 2C5EA 4PHGA 4ZOBA 3P4YA 2NX2A 2XRMA 4J75A 3UCXA 2QUKA 3COZA 1L4FA 3SYTA 2GN2A 4AG6A 1G20B 3DDNA 4GM4A 2YDXA 5D8DA 5IZ4A 1PSZA 3VAYA 1J0CA 4W5JA 4W5TA 3S40A 1FMFA 1IPFA 3M9WA 4Y98A 3K5WA 4KGZA 2JKVA 3VH2A 2IYPA 2K4MA 1OROA 4PM4A 3H0KA 4JL5A 3LS2A 3T3HA 4QSHA 1IN6A 4A27A 1XK6A 5C8ZA 4X41A 3O83A 1JEEA 3IRUA 5HQ3A 4BQRA 1KIFA 3RYFB 2VJPA 5IDWA 4LZPA 2GCGA 1Q3TA 1U2DA 1T9GR 3BYZA 3HN6A 3I09A 3VNRA 3Q3IA 4DIOA 3WISA 4KMRA 4AMYA 4UARA 4U4AA 3R6DA 4QASA 4ZO7A 4KWTA 1T5DX 3ZG6A 1QIJA 8LDHA 4CIVA 4R05A 1TM5E 2PXXA 3PZBA 4YT2A 5GZ3A 5DWDA 2FN4A 5EJ6A 5FR2A 1PS8A 4R9NA 1Z4MA 1SCJA 2QE7D 2VK2A 4UHBA 1QP4A 2WVHA 1R9MA 1FMTA 1PO7A 2J5QA 2N75A 3V9PA 4BNWA 4CIWA 2Q3BA 1YB5A 4BRZA 1R9GA 2HA6A 4LRYA 4O2BB 1CRZA 3FMPB 4DLVA 4ZCRA 2PMBA 1FYVA 4D8TA 3C7TA 4RUKA 3HXTA 5EJIA 2VCEA 3QIVA 2Y1OA 1VKNA 3ZE6A 1J9GA 4X8MA 1YDFA 3LOQA 4Z3KA 1EFRD 1FFXB 4KO3S 4MS3A 4RZIA 4ARZB 4D9NA 3RYCA 4P38A 4FYYA 1FLAA 2CNKA 2CMDA 3DWFA 4Y0NA 5EKDA 3SJCA 1BE6A 3CRZA 4CMEC 1GPH1 3QENA 4MOWA 1OUMA 3X1JA 4X7BA 2Q0SA 3TIGA 2RMKA 4UAUA 5C53B 1ONPA 2XUAA 2GA9A 3K70D 1A72A 3BTVA 4UHCA 2BUAA 1V96A 3ANSA 3EIUA 2QOEA 3SDBA 3PX2A 2RJ3A 2PFGA 4CL0A 4TL8A 4RBNA 4UTZA 1ND6A 1ZDMA 1FTYA 1LA2A 2BEWB 3MSXA 4UU1A 4ZA2A 1W5FA 1B14A 2GHIA 3L0OA 1R3DA 1X7GA 2IPXA 2OESA 1UDBA 2ON6A 1CF2O 1E2LA 2ZJ4A 2QUAA 3B9QA 1P5ZB 4LG1A 3CRMA 5EINA 2ZYTX 3DDCA 3U80A 1U2DC 4C0WA 2Z6UA 2Q9AA 4ESOA 4YDHB 1AE1A 1RM5A 2RBEA 2Y0PA 3VR6D 3H86A 1CS4C 4FVTA 4LXIA 4QHTA 2DRIA 4FDMA 4OQDA 3TUJC 3QW4B 1CZNA 4CTKA 4GL4A 4XARA 3HBMA 3NTRA 2B1IA 2FYTA 3P9XA 4LXHA 3TR6A 1L5FA 1V8FA 2HQRA 2CSXA 2G3YA 1GL7A 3KAQA 3NVAA 4B6QA 1K7FB 2XMSA 1TZMA 5CK4A 5ALRA 3LF2A 4UW9A 2TMKA 3H11A 4A8HA 3C41J 2G72A 1AHHA 1WA5A 1X8LA 5IEJA 2HQ1A 3ZC3A 3BQMB 2XB6A 4KE8A 2IV3A 4NCBA 2X8JA 1DDOA 3CLRC 2O05A 3PL1A 4HYYA 5I4KA 3IIMA 4P4NA 4UM7A 1HDYA 4BHTA 3K8YA 1NQVA 2DWUA 2P68A 3EG5A 3JQ9A 5DK6A 2HNKA 1LLDA 3HKBB 3RWOA 3D6VA 2E89A 1EVYA 4HH4A 1X87A 3ZV6A 3F6BX 1L7MA 5AKHA 1ORIA 3SQNA 3I73A 3O31A 5IPFA 3IT3A 4RGVA 4QUGA 3ICPA 4IICA 4BWYA 2VDWB 3TRJA 1AB6A 1UKEA 2CL0X 4LOLA 2HA2A 1O95D 4KFRA 2WQ6A 1N33B 4WASA 4P7FA 3SC4A 2ZZNA 2GBFA 4FYPA 3IQHX 2UZ0A 3DKVA 4DIKA 1WRBA 3IUJA 4EQ6A 1X2EA 1CEYA 3PQ6A 3M8KA 1QSGA 3TLBA 3WK7A 3WS7A 2X9GA 1DCFA 3K3PA 2H0AA 3TRFA 2UUBB 4L0QA 2J3JA 1M83A 1PSDA 1RYEA 3HU1A 5BSHA 3LKBA 5G02A 2O06A 3D5QA 5F3DA 5AWFC 4EG1A 1CZRA 1KFEB 3KC2A 3SEFA 3CB4A 1AK1A 1W30A 4G9EA 1N2ZA 5I4IA 4HAUA 4DRXB 4NXMB 3QOFA 5EQJB 3LMKA 1N2CA 3N7UA 3QVTA 4YWHA 4CQMD 3TGPA 2QGFA 4RVFA 3Q7QA 3GUUA 4XQEA 3UJNA 2J9ZB 3PQCA 3T3MB 2ZIFA 4DR1B 5IFLA 1SH7A 2I87A 1IBCA 1CYEA 1KBOA 3QF4B 3G7NA 4FFMA 2ILVA 5FD8A 1QP0A 3QLUC 2UUAB 2MDTA 3DFUA 3E9YA 2I2WA 3OJWA 1OWPA 1JIIA 4R2XA 1UXJA 1PVOA 2EF1A 5BV2P 1TPYA 2QLJA 1DKLA 2D62A 3HB1A 2W8ZA 3OT1A 2FK7A 3QYPA 5BR8B 4ZT7A 1I13A 3CLTD 3OLYA 3ICQB 4PFKA 3OCVA 1IJKA 1QVVA 3LF1A 5FBRB 4QYIA 1QMGA 4KG7A 4Q9IA 1U1IA 1E9SA 2QVZX 5E4JA 3WNCA 4BWVA 1NVMB 2WU0A 2QNIA 2DTEA 4D3ZA 2G80A 4QWWA 1Z75A 2GPYA 4H1HA 4Q6BA 1JR3A 3FTPA 3SGLA 2RGNA 4UU8A 3K35A 2QMOA 1F2TA 3SJAA 4CFYA 1D2NA 1NJFA 1TUEA 2Q7XA 2DY0A 9ATCA 2M6KA 3ROFA 4P4GA 4KDFA 3ZW8A 3GEMA 1AZSC 5TEWA 3HVKA 3QEBZ 3LFUA 3EA4A 2PA0A 3EISA 4NWIA 2QL5A 2NU8B 1ZMTA 9LDTA 3GOQA 1RHUA 2OV1A 3PQ8A 5L3SB 4Q4CA 1KU6A 1JVNA 2HLHA 3FWHA 4EO4A 2Q4OA 2QIPA 3O4JA 1IUPA 4U2EA 1W94A 2YMPA 5CJ2A 3W4IA 1Z82A 1NW4A 3GEGA 4RFVA 1NYLA 4BVHA 4J29A 4KYIB 2BFBB 4L8GA 4IGAA 2P5UA 4KR9A 3L6EA 3NHBA 3NWEA 4OK6A 3SPXA 3THOA 4X92A 3TEJA 3LA8A 1T5BA 2PLRA 2HIGA 4X1YB 2VC2B 3UK1A 4FFSA 2F8TA 2L18A 2W8BB 4GWGA 2EHDA 3LHKA 4NEGA 4HWTA 4Q9AA 2NU9A 5FRDA 4BGVA 1BN6A 3NEJA 4JQYA 1J1ZA 2W48A 4MVJD 4NF2A 2G1PA 4R7GA 2R6AA 2WQZA 5C1PA 3CVOA 1W93A 1YMQA 3MT9A 1PHPA 2D8AA 3PTLA 3SAJA 4UQOA 3V4PB 2FR1A 3UJDA 4Y2TA 3ZWBA 3KJFA 2YW2A 4HGQA 3W8EA 5FNVF 5KSPA 3ZTTA 4BB5A 5AKJA 1JPUA 3A2LA 3PENA 4EBFA 2ZS7A 3DTVD 3DE7X 2PMKA 3D6AA 4LMPA 5MFZA 3HCFA 1UT5A 2GAJA 3GG2A 2YNMD 2ZAYA 1DXQA 2B8JA 4FLFA 5GMOA 4X66B 3DL2A 1TD9A 5I7SA 4LHZA 2I4NA 2WP0A 3GFOA 3GMSA 3MEQA 3O4HA 4K05A 1JI3A 4O08A 4ZJZA 4BXOB 1Z7WA 4LJLA 3NKLA 1GPDG 3H9UA 1II8A 1KDOA 3A1VA 5B4UA 1Z5GA 2A7QA 2ZAMA 2B8NA 2VF8A 1KAQA 1C4KA 2ZCVA 2ZG6A 3H1EA 2BF4A 5J9FA 4AU1A 2ZJAA 3EBPA 1JFRA 5KOHB 2EW2A 1QZ3A 2CLSA 4WECA 1QYVA 1LW6E 2CNWA 3R6LA 3U4MA 3LLSA 2G7MC 2F59A 1K3UB 1XGKA 2M1ZA 3K9CA 3AVQA 4J07A 3T3EA 3VR5H 1NZDA 1GNQA 1I32A 4P35A 1UC9A 2Q99A 3OZVA 1TUBB 2VA9A 2OUIA 2CB0A 3Q6NA 4GZMA 4LXXA 4ENSA 4MKFA 5JEDA 4NMLA 2ASVA 2I1VB 3DZKA 5CXXA 1EUZA 2V7UA 1DMRA 1OF1A 2GEUA 4BLPA 3QVUA 3AIMA 3IAEA 4P86A 4X93A 2BTEA 2IWHA 5G1PA 4JXJA 4CG3A 4V24A 1EXDA 5FB3A 5HMLA 4N0PA 1JALA 1E7YA 1VPDA 2BH9A 2HSGA 2Q3FA 1HF3A 2J3KA 3HCAA 4F93B 1XRLA 4KB5A 4B6RA 1T9CA 2HO4A 3RSGA 2BM0A 4GX2A 1H4VB 1GLNA 1N7JA 2GKOA 2ZITA 3FTDA 4S1OA 4YP7A 4CI0B 1P75A 4LHWA 4RPLA 3NOOA 5FBWB 4V0SA 1SVLA 2JIBA 3L8EA 5BQPA 2IBMA 2YJNA 3CONA 2I8LA 2QQGA 2XX3A 3MSCA 4G4IA 4C5AA 1L1EA 3I6QA 5K01A 4P7KA 3HKEA 4H1TA 1N0WA 4WHMA 2XDQB 1NNEA 2I4LA 4WLEA 3X2EA 3E0XA 3BE5A 1XP5A 3PEUA 4HMOA 2J0UA 3RRMA 5HZGA 5JNVA 1E4VA 1E60A 1I2MA 1HMPA 4GICA 1QQ5A 5EC8A 3VR4D 1WTCA 1XZPA 4I08A 3N2YA 1FYFA 5CFRA 5MGNA 4JX8A 4IEFB 1NJ8A 4CUZA 2ZQYA 1U94A 2VHWA 5A05A 1KVQA 1R5NA 4H7EA 5CIWA 1T3HA 1VECA 3CLTC 3EW7A 2Q4DA 3UJ9A 1BX0A 1QRTA 5AVKA 3JR3A 1ZUNB 4AN1A 4JELA 4N82A 4KL8S 5K3SA 2JFPA 2VLIA 1X70A 2JAOA 3JATA 4L76A 3OH8A 3DMNA 2JIZD 4HRYA 4CQLB 5DWQA 1NRXA 4QOJA 5LBUA 4OUDA 3NVMB 1AS2A 2Q1UA 1RYZA 2D7DA 3TLGA 3TTVA 5CLLA 4RXUA 3I1FA 2HRDA 3DDSA 3T3NA 1G3RA 5L7WA 1H94A 4MCIA 3AP1A 1ULUA 1X8KA 4TRJA 3T9BA 3NI2A 3HM9A 1XXLA 2A3NA 3L0YA 3V4FA 3GLFA 4F92B 3ZV4A 1DCTA 4I14A 4IOMA 3ZDBA 1XZGA 4FYHA 2AG8A 4LYAA 1FFEA 4EMSA 2R6R1 1YO6A 1K7YA 1UXIA 1YE5A 2BZSA 2OWDA 2Y4NA 4Q9KA 3RVPA 3T15A 3OG9A 1SWWA 5AK4A 2WJHA 3B1YA 4DNXA 4EVIA 3IT0A 4OHYA 1ENZA 3KFXA 5ES4B 4OHWA 2GO1A 1GL3A 2VJBA 2O3TA 4WKPA 4ZOAA 3RGGA 1V4VA 2WSBA 4BNXA 3EFOB 4V2IA 6CHYA 4PZDA 4EGQA 5IXYA 2NVOA 5DEIA 1G8YA 2GSWA 3P0FA 1UAGA 1YIDA 3LGAA 3AQ4A 4GOXA 2OCGA 5AESA 5HFAA 3CVYA 4KRFA 2EJWA 2VL7A 4BKOA 4NZ9A 4EHHA 1D03A 3BMXA 2R8YA 4A91A 4CYMA 3U3JA 1EP2B 2Z5FA 1YQUA 1W44A 4MARA 2R8ZA 2MINA 3N0RA 5B58C 1Z5UA 1W59A 2GCPA 2WTEA 3DOCA 4ID3A 1SU4A 2C59A 4FFBA 1M6VA 1A88A 1T9ZA 3DBIA 2ZIXB 4ZYVA 3KYDA 5ANRB 3OWXA 2AOXA 2WSLA 4F4UA 4Y1EA 3EGDB 7YASA 4MJ3A 1OB2A 3BFKA 1EVLA 4OB8A 1JEQA 3TMKA 3W5CA 2W7TA 3SX4A 3QUAA 4P58A 4E5YA 3PS9A 1IRXA 4JK3A 4MUIA 1KZ7B 4KODA 1RZRD 3VJRA 1X3LA 2O5VA 4OQ4A 1RP1A 4HPWA 2AEFA 1OTXA 3BEDA 5CNMA 3VSCA 1DHTA 1WU8A 1Q19A 2QUJA 3D6JA 4RWZA 1FC0A 4ZU1X 3W2TA 4EJ2A 3UAOA 3KT8A 3HXMA 1FFYA 2Z43A 1DJQA 4B40A 4D6YA 2G5CA 4U7GA 2CK3A 3GQVA 3WLRA 2Y4OA 1IATA 3LPMA 2QAGC 1T2FA 3DO5A 3QFHA 1H1DA 4G6ZA 2SKCA 3WYAA 3LC0A 3UTCA 4EVRA 1CR1A 1WS6A 1G18A 1PFUA 3FBGA 3VGJA 3MBKA 1JHRA 2MYPA 3AR6A 3NB0A 5G1OA 1BXGB 1ST2A 1P0MA 2CVPA 3W5IA 2C2MA 3KWMA 4NJMB 3EFHA 3JSXA 4XH9B 1NWHA 1PR2A 2GWRA 4HQRA 1EVKA 3RVJA 2IODA 4NHOA 3RYFA 2C7OA 1SXQA 1PT5A 1CUJA 3MJDA 4NI5A 3I9NA 3VO2A 1FW6A 1QE0A 1HG1A 1NNLA 1VE9A 3A4LA 3D81A 4AP6A 1P0PA 1W4AA 1BVUA 3DVAB 4G1EB 4AJNA 1O0CA 1Q1BA 2YMLA 4HZIA 3W6OA 1YR7A 3OPXA 3R23A 4CN9A 3AL0C 4BFWA 5IUJC 4B7ZA 1GTZA 4JWTA 5CDFA 2DBYA 2IIVA 3RIYA 4O29A 2W2XA 1QYIA 3ENNA 3INYA 2WF9A 2FLKA 1MAUA 1W35A 2A2ZA 4P9NA 3QPWA 2EFYA 4RKEA 1R88A 2CN1A 2GASA 4EPVA 4MW0A 3NATA 3CWQA 2IU4A 1OT5A 2Y99A 4QQ8A 4S1VA 2E9SA 4GEGA 4N5LA 2HO5A 4CDGA 3LVQE 1G5IA 3L9WA 4YJDA 1WD7A 1G3IA 3C3AA 3ZJVA 4JQOA 4I50A 1KXZA 1KEKA 3G0IA 3MWJA 2AG5A 1I51A 1Z68A 4G86A 4LRTB 3VU0A 2X0FA 3AFMA 1DBPA 1F1JA 4OGKA 4KQ6A 5DNYB 3NXSA 5AM1A 2RGEA 2YYSA 5LNK1 5EIAA 1H0HA 2J09A 1AXGA 2N46A 4IIJA 2EZUA 1XQ9A 3LBFA 5E6RB 3TLXA 3K0FA 2GNOA 3VNQA 4D79A 3G5UA 2XCTB 3H6GA 1DL5A 3RSQA 3W4JA 4Z6KA 1KTVA 4G36A 4LCBA 3BK1A 4ND5A 2I34A 1RI4A 3MMZA 5D87A 3TBKA 4N0EA 3QVJA 5JXGA 3BB1A 2GPJA 1Y6GA 4B76A 3A9TA 4UASA 1X80B 1R0YA 3DMTC 1GTG1 3UH1A 3AEUB 1GAQA 2CXSA 1SRRA 5K20A 5EUBA 2UUCB 4EG7A 4DQ0A 3JQFC 3H3JA 3AW8A 1UBUS 1AT1A 1D2AA 2CL6X 3BPSA 1BOOA 1ZEJA 3KJQA 3L8FA 3P0JA 1VMKA 4J1SA 3VX3A 3S2EA 2A5DA 2NZUG 1C8LA 4UJ5A 1C0LA 4MYUA 2NV2B 3KDSE 4FE4A 2PLAA 1BE8A 2NUTA 2FG5A 1K06A 3EBLA 2J5RA 1UODA 3OWHA 4K9DA 3LP5A 3VR6A 4Q4LA 2VHQA 3KXIA 3FDJA 4B3FX 2IZ1A 2OAQ1 1F8XA 4RTJA 3KXDA 5C8XA 4H59A 1EVIA 1XDBA 2ZRAA 1U81A 2IDKA 4LF6B 2ZYAA 3WKCA 3D7KA 4XSGA 5DCWA 3AJDA 3QJYA 4WNYA 4H17A 5E3JA 4BMSA 5KJ6A 4RGYA 3UMRA 1USVA 2EJVA 1II0A 2QM7A 4HDOB 4ZODA 3M6FA 4OHMA 2H08A 2QQ0A 3LWBA 3SZOA 2IOFA 3JVIA 3LJKA 4LXQA 3UUFA 2RGRA 3M81A 4YHHB 2H92A 4MRNA 3QQ5A 3FHCB 3HVIA 4OOEA 5C4GB 3NRCA 3EXIA 4JZKA 3I01A 1PFVA 4NENB 1BH2A 3L1IA 4TLDA 2NV6A 4PWZA 5KQSA 1PNRA 3HRIA 1XDUA 1IBKB 1DFIA 1SBHA 3MCTA 4LI0A 4L8WB 4PY2A 5KDOA 1X9GA 2GKGA 1OGYA 2R4TA 2X86A 3F2IA 4Y2PA 5AXDA 4KDEA 3ZHUA 5C3MA 4KQKA 1T6ZA 1RYYA 3GYBA 3B1VA 4TSRA 1K8XB 2BLLA 4R81A 3MWDB 5JO0A 2J6HA 1U3GA 2GTPA 2P77A 3OLCX 4WV3A 1QLHA 2YXBA 1TQ2A 3AO0B 4ER7A 2G5PA 2QR5A 3G2IA 2VUSA 3TB6A 5JAOA 2ZVQX 4LYYA 4JR2A 1CQIA 3UK7A 4E03A 1B16A 1H65A 1ZP6A 1VJGA 4UM5A 1JMVA 1MR3F 1X7WA 4TTQA 3B3GA 4Q21A 2Q9CA 4Y0AA 5ECYA 5B1DA 1FXWF 3S28A 3VZDA 5AHXA 3M83A 4MLPA 4CGZA 3CCCA 3KZXA 4Y2QA 2ASEA 4MR7B 5DYIA 4MZDA 3COVA 1D8TA 4DBVO 1MEEA 2QXTA 3SXUA 1J0BA 1NVFA 4Y2YA 2FZWA 2WJ6A 4MUGA 4DSAA 3QE9Y 4BGEA 2FEXA 4O3MA 3D4LA 1ZFNA 5DSZA 3KU4A 3CCFA 5IBRA 2FWMX 1JQLB 2O2ZA 1ORVA 1HMYA 3I5UA 5FOXA 4F4JA 2QS9A 5JQWA 1U99A 3BWEA 5HKAA 2VQ6A 2AXNA 1KNXA 4QBFA 2QNBA 4WLUA 1TC1A 3AEYA 5JPIA 4OOFA 1UBEA 2KB0A 3ZHZA 1BJKA 2CXTA 3VR0A 1H93A 2Q3HA 1G8FA 4Z9XA 2DQZA 3GARA 3N39C 4JU8A 3KSZO 2R79A 1QIMA 4LQCA 1VL8A 2JHPA 3IUQA 4O5OA 1RWBA 3PWZA 3QI2A 1JXMA 1PZMA 5J2UB 4JBHA 3FR7A 1W0KD 2NYVA 1U8FO 1JHMA 2E85A 3EEYA 1HK7A 4NP6A 4Q4HA 2QP3A 1LK0A 3WQHA 4A0HA 1VM6A 5ALPA 1P44A 2B4AA 3RK0A 1E1LA 1FSFA 1VKZA 2Q28A 2R4UA 4NX2A 2VNJA 4CEHB 1O0SA 1VLHA 4JR1A 4XD2A 1EWRA 4R1NA 4YXWD 1LC3A 4NDZA 4DA0A 1GGHA 1B41A 3RUAA 4IM7A 3W2HA 3ZIAA 5EHQA 1YR9A 4FFVA 5DNDA 3FFAA 1JIUA 1BSVA 2TS1A 3I04A 4AS3A 5IVPA 3LOUA 3EASA 2OLEA 3U0VA 4DSOA 2KX7A 1I14A 4X6LA 4IDGA 4G24A 5ITSA 1K66A 1LRJA 5C8YB 1NLUA 1VQ1A 1YS2X 3BF7A 1D1PA 3RUDA 4B85A 2E5WA 3JW8A 3GJ4A 1F5NA 3KTAB 3ROKA 3TZQA 4C04A 2TRSB 3NGMA 2FJPA 4L2IB 2GHTA 4GEKA 1J00A 1KJIA 4WY8A 2XYGA 4UNQA 5A9TA 3RTAA 1AO0A 5DN6A 1QFXA 2HEIA 3JQGB 4YEDA 1Z28A 5GINE 1DIBA 4RSMA 5IXSA 4G1FA 2X8WA 4D8VA 4DJDC 1CIVA 5HUHA 1TQ6A 3G2KA 2CGEA 4KK3A 4PF1A 2YNMA 1UWKA 3A4YA 4CV0A 4AI6A 4HN4B 1JB1A 5DULA 3NG1A 1M2OB 2QENA 2X9VA 3CKKA 3RVQA 3AI1A 3VOTA 4EA6A 3L82B 2CMKA 2CJWA 2W2TA 4NSNA 4PG8A 1PLLA 5MFPA 2QTWB 3KSBC 1AU9A 3BXHA 4Q1AA 1ISRA 2IL1A 3QX7A 5IJZA 4OV6B 4AVYA 1OFTA 1E9AA 5DH9A 4M89A 3V8VA 3X43A 4BC0A 3AW9A 1EA7A 3GI1A 2PL9A 1QB8A 1UJMA 2QD3A 3NC4A 4L51A 3PUZA 1KGDA 1XNHA 2JLXA 4JFRA 4LDJA 2J5XA 1OMOA 5CCXA 2CV0A 4MRPA 3E81A 1W0CA 2CVOA 2VIIA 3LU1A 1QP7A 1H2AS 1CUFA 3CLKA 5LXTF 3P19A 4OQLA 5P21A 1Y3BE 3AP2A 2WUVA 1XAGA 3IILA 4HV4A 3KG2A 2IEAA 1ENOA 1XTKA 1ZPDA 2FPSA 2DAPA 3HCOA 3ZE1B 3UBTA 2IY7A 1TZ2A 1X9IA 2IE8A 2VPPA 3LUPA 4KR0A 3S3TA 3HFJA 2HA4A 3BBPA 4II7A 4PFSA 2R60A 4UTXA 5J2TB 4Z9BA 2VP4A 1KZGB 4BZXA 1WXHA 2WDPA 3R0JA 4GXTA 1PX0A 4JEHA 4D0LB 1NATA 4B84A 1BJTA 2PY6A 1NUPA 2I4IA 2A1TS 4C7MA 2HYIC 1HQYE 2XAUA 1X1AA 4ZVVA 3ORYA 4E2WA 4N5DA 4MVJM 3TDKA 3OX3A 2YWXA 5CVEA 5CXQA 1TEZA 3VZQA 1BFDA 2CNBA 4EENA 1WDTA 3U7RA 3IJ5A 4WFJA 1SHJA 3X44A 3U19A 3C8DA 2XOKD 2JVJA 2WJGA 4TYYA 3DP9A 5ALWA 1E9VA 3ZV3A 2Q49A 1JT2A 1LB1B 2M98A 4ND3A 4UCFA 2DFKB 1TTHA 2C1XA 2O23A 2Q6VA 5HIJA 1SY7A 1ZONA 3DC7A 3S0JA 4JROA 1MTZA 2NACA 3T7EA 6ABPA 2AF4C 4PO8A 1ORDA 3PFIA 4IFEA 4MMYB 3GBPA 2B4YA 3PG5A 3Q3EA 2NUAA 5ECGC 4EGAA 3A6GA 1GPBA 3QNMA 5KQLA 2HK7A 3P9YA 5CT9A 1EFKA 1L5SA 3EPRA 2Y76A 4E6PA 1DQPA 1OHHA 3E6AA 3FH0A 3QKWA 5TDHA 3U5TA 4I9GA 2J31A 3HYLA 4QWMA 1UKCA 2DEUA 1FSGA 5T3UA 3E1KA 1BHSA 1L4GA 4FE3A 4OYRA 1CF4A 1R0SA 3UN1A 1A7KA 1O8BA 1O97D 1T29A 4NJEB 4AYWA 2C20A 3W5VA 2C2KA 1KAHA 1A1VA 2EW8A 4Y2RA 5KREA 4IOLA 1E6MA 4NK5A 4JWKA 4BVFA 1I2CA 4RYLA 5T8KA 3ZBUA 4C29A 4Z8XA 1E1MA 1JR3E 4NCHA 1US8B 1BEUB 1E20A 1YDHA 1L4MA 3PUYA 2BBTA 2N47A 1G8JA 3OEWA 5TT0A 4JQCA 1TK2A 1DAPA 1X13A 1CS0A 4BLVA 2P90A 1D6NA 3FNFA 4YHBA 4XI9A 5LWHA 2GZRA 4UATA 4MV0A 1W2GA 2PYDA 4C22A 3H4TA 1G60A 1D4OA 1ZYUA 2BGNA 4UDXX 1AGRA 3K9FC 2PD4A 5ALHA 1RJGA 2DKNA 1J8YF 2BFCB 2R6JA 2WE8A 2FPGB 2ZBQA 3FR8A 3MT7A 5CEEA 2Z6VA 3DB2A 5H59A 4AT1A 2XYVA 1V45E 1IHXA 1Q1GA 4NJOA 1ZK2A 4Q9LA 2IYYA 3EF0A 4FYJA 5F9MA 2FZGA 3RVNA 4EYGA 5CDUA 1HFWA 1K5GA 3FRJA 4OA8A 1LPNA 5GJBA 3JD4A 3WFIA 4CMGA 1WTAA 4ETNA 4O2BF 5IVHA 4KE9A 2GH1A 4B3SB 2LVBA 3NR2A 4A1FA 5LQRA 1B93A 1NW3A 1XZJA 2NYUA 2GNPA 2G8LA 2IV7A 2FN7A 2PNFA 4N3CA 4BE9A 5A9RA 4YI3A 3ZXYA 1FTQA 4JFAA 2W6NA 5D7BA 4YRPA 2B8EA 2IK8A 3KNZA 1GU1A 4HLUA 4JSTA 1IMJA 5SYMA 3TCKA 3ZKAA 4PZPA 4LMAA 1P73A 1ML4A 5K4AA 4XTCS 5K3DA 4NV3A 4P36A 1TIBA 3ND8A 4JOSA 2PUEA 5CRIA 5DMXA 1J2EA 1RJDA 1ILEA 4W8GA 2D1YA 5DEOA 3E7WA 1OFUA 2WF8A 1PZHA 3BSYA 4CKCB 4EATA 4KSBA 1A8IA 1IZYA 2CNNA 1T2AA 4QYTA 2I7VA 5EHIA 5KTSA 2G70A 3IAS6 4RA9A 1PR5A 1TMYA 4H3HB 3UG7A 3LA6A 3QKIA 5EWJA 4C3OB 3MTAA 2IY9A 2X0RA 4G1MB 4A0FA 3Q3HA 1M1ZA 2P7HA 5T4EA 1XA0A 3N86A 1A95A 1E2BA 3SFZA 2FY8A 3A4TA 4BO2A 3EWSA 2H2WA 2BKEA 2C42A 2WG1A 4P7BA 1QPBA 2IF2A 3BGDA 4LZJA 1GL9B 2F1KA 4WMLA 4GC5A 4MI9A 4EKGA 2DB3A 2PZMA 4X7MA 1IG0A 1NQWA 4KK4A 3O92A 4JLVA 4ZDIA 4M1KA 1U04A 4NMXB 5T6BA 3DMFA 3SEZA 1YFJA 4QOHA 4BU0A 5EE1A 4G1BA 2FSHA 4ER0A 1UJ5A 4YUAA 2YYZA 1F3OA 1P3Y1 3LPAA 4IYJA 3TIVA 1XLTA 4EFLA 4QU5A 4US2R 2CUNA 4IHJF 4QOIA 4L7QA 5LPNA 4HVAA 3UPUA 1SHTX 1YS6A 1SOVA 1B15A 3IULA 2WJVA 5DYWA 2A5YB 1V5IA 2BEWA 2ZI9A 4H7FA 5C81A 1I4LD 3EFEA 4MUHA 2WBLC 3JQBC 1E92A 1UMBA 4CQJA 3GD7A 3K1JA 1CEXA 1CJBA 4GZ5A 4RULA 2A0WA 2V6MA 1J70A 4PZYA 1QE3A 2I8AA 3UHAA 1A9TA 1N5IA 1UOPA 1Z6TA 4ESVA 3HO6A 3ZE8A 4XFDA 1J21A 3R8CA 2FF5A 2A5JA 1ZAYA 4KGVA 4PXSA 2AQIA 5IYZA 1EFCA 1EFRA 5F23A 4HLUC 1GPKA 3F1LA 1S2NA 4C4OA 4DJ5X 4DF3A 3H11B 1Z33A 2Y0BA 2WUEA 2AFHB 3DH0A 3U3KA 1IVNA 1FCJA 1PGOA 4R69A 4BV2A 1RNLA 4DRYA 1AC5A 1KZYC 1N8KA 1QIIA 2PSEA 4G3XA 1KZ1A 2JGLA 2I5PO 4LWQA 4P33A 3B2NA 3HY6A 2IA5A 4RSGA 3L7CA 4A2QA 5KTNA 1F12A 4CU5A 4R6WA 4KMOA 1Z4PX 1O97C 5EJEA 3BULA 4WCFB 2H7XA 3MB8A 4M8LA 1P17A 3QKSA 1P7CA 1Z0AA 3NONA 2IHZA 1ZESA 2J4CA 3D0QA 1KIAA 3QU2A 4Q39A 2JLVA 1RWPA 2Z4SA 4G63A 1QQTA 3HSYA 1WHSB 1JR4A 4V0LA 4XCQA 2NU8A 1MN6A 1O4VA 5J2UF 1JSZA 3EXG2 3MB5A 3NP7A 1YU6A 1V5GA 2OQRA 5GJVC 1M74A 3NBKA 4ZC8A 4HHEA 3T1VA 3TOCA 1K08A 1VE5A 2XB9A 1T2CA 1HYEA 3H4VA 2FWPA 4OYYA 2WM3A 3ZGVA 4BPRA 1P1HA 1I7NA 1PEAA 3A9RA 3VX4A 3PDWA 4GGMX 2YWGA 2E0IA 3NAQA 1J2UA 2H59A 3AG5A 3R3ZA 4GMFA 3AEXA 4J6EA 3UGKA 3VSEA 4IJQA 1M67A 3D3EA 3FPKA 3LY5A 4YUZA 2VYNA 2W6JA 4QBHA 5M2QA 4Z53A 1Z35A 4H7HA 5JJCA 1HETA 2GJAA 2SKDA 4ND1A 2NO4A 2PMFA 3FHLA 4CCWA 3RYHB 3URMA 5A4DA 5LIPA 4C4ZA 1U9IC 3KZ1E 4GS5A 3SYNA 3WIUA 3LWZA 3QLVC 3IDZA 1WB6A 1Q7EA 4W1SA 3ZUGA 1G9SA 3L8GA 4D6PA 2JL1A 5H7XA 4ARVA 1WWKA 1OA0A 2G1AA 4Q9DA 1EQ2A 3ND9A 1ZOLA 4JEUA 3H7IA 4YQEA 3U49A 4JJ7A 5KNDA 1M2FA 2FHSA 2ZJ5A 2I80A 5FWAA 1C1DB 1XOIA 4GD3Q 3C7CB 3OA2A 4CLOB 2QMYA 5CX4A 1NYRA 4B0OA 3CEJA 4ND8B 3OT1B 3OLVA 4PG6A 3F90A 4PGAA 2G9ZA 5B3LA 5BYBA 1JJFA 3U44A 4CMKA 1DOAA 1BS1A 2LUOA 3CLSD 2DLCX 1E61A 2XUKA 1I3CA 3E03A 2GBLC 3FCAA 3N05A 3RAFC 2RBGA 4HEJA 4RV9A 5DX1A 4AP9A 5C9ZA 4DR7B 4K6KA 1QWOA 3K2QA 4UEQA 2JFHA 2QTGA 3R4VA 1Z0UA 1RR6A 4TTAA 2ENUA 2R751 1SJ9A 4PG7A 3UT0A 3MOSA 1EX9A 2I1WA 4YO8A 3R8FA 5A6VA 5LKAA 3IV9A 4F9TA 4EMBA 1EUQA 4UOZA 1KAGA 1SZDA 2Y93A 1X94A 4LNAA 3PUVA 5D3KA 3RC1A 4XWGA 3SBOA 4R5MA 4CQMA 2A4KA 4EB8A 3B8EA 1ZM2A 2QN2A 2GZSA 1WY7A 1ADFA 2P2DA 1DDIA 4QOFA 1GTSA 3IUNA 3FROA 4KIFA 4I55F 2BHTA 3ABQB 3ZXXA 5LQAA 2GFIA 5I6DA 3UHJA 4UFNA 1RD4A 3LGXA 3RVBA 4ZRDA 1UJ2A 2EXXA 3GMTA 5I9BA 3VU3A 1WBJB 1PU2A 4GH5A 3B1XA 1VLQA 5LP6F 1E3MA 1M8FA 4OKSA 3UW3A 4RKWA 3O7WA 4K2AA 4DG5A 1YHYA 3ZLJA 2ZSUA 4DV2B 4X1YA 1LDMA 1MCZA 3EUWA 3EWAA 4LPKA 3KU1A 3VRHA 5BW6B 2FQQA 3M6VA 1O7JA 2WWRA 4DC1A 2KLHA 1USKA 1Y1TA 3B3JA 2X8AA 3LBNA 4N7MA 5F77A 4K8RB 2ZSJA 2X42A 4GHWA 8MHTA 3L02A 1DSSG 3AGPA 3OJOA 5KNCD 2CVZA 3HKEB 3ITNA 4M7RA 4LHYA 2F8SA 3DV0B 2C77A 3GAAA 4AW9A 5HM6A 4FHCA 3WYNA 3QEKA 5CB8A 5JY6A 1GFSA 1PUJA 1VG0B 3GLHB 4C2AA 1UK9A 221PA 3ICVA 3CNEA 1QH8A 4ENPA 3FSJX 5K6AC 5TGTA 5BP7A 2ARKA 2B4QA 3I72A 2WJPA 3QA3E 1DIAA 2QQEA 4BN4A 4IG4A 5CR9A 2K7ZA 3LE8A 2HU2A 5IVKA 2VQDA 5BSEA 5LSAA 1YVUA 5LNK6 5TX7A 1O89A 3A1WA 3MAJA 1Z0ZA 1JJ7A 2C1EA 2ZYIA 4LNHA 1GTRA 4ROSA 2NU7A 1PV4A 4CWAA 3BILA 1EIWA 4CQLA 1WDMA 5KKNB 2YHIA 1F6WA 4LV6A 2A30A 2FUG6 4RIEA 1WCXA 3SSMA 4L16A 1TADA 5JS8A 1N92A 1VHWA 1J5PA 1Y0BA 1NA5A 2HPVA 1E63A 4FKMA 5DYTA 4B3CA 1YRBA 4WFIA 4IDHA 4A36A 5TF4A 1VP3A 1YBFA 2XGJA 4F84A 3TQTA 3WGQA 2QM0A 1B0UA 1NIPA 3GLVA 1G63A 3FUTA 4HUQA 4MK4A 2AUNA 3ZV7A 1A4XA 2JIOA 3LRXA 4JLDA 4BV3A 1WETA 1U4NA 2R65A 4PRZA 3W8FA 2CT8A 2OM2A 4MWSA 2ORVA 2CF6A 3EHDA 5FI5A 4CTNA 2ZB7A 5AKLA 5HJEA 4DTIA 4WOCA 1PG0A 1AIPA 3ST7A 1VKRA 1ACJA 1CR0A 2PEYA 1S0UA 2B83A 1NI4A 1E6EA 1P61B 1UINA 3EFOA 4TSFA 4XB2A 3T4XA 1L8OA 4BKMA 4JLOA 1IWOA 3QV2A 2ZUTA 3WYGA 3Q72A 1BROA 2CXQA 5HUQA 1OW3B 2FMHA 2FR0A 3Q4GA 3U39A 3ZHOA 1UCFA 2PCJA 2VVTA 2X5NA 4FXOA 4OD0A 3T3OA 2O8BB 1Y7TA 4JSYA 3Q9NA 1C81A 3VYVA 2V7BA 2WIGA 3G7UA 4JY7A 4DNPA 2FSIA 5IASA 1ODSA 1Y5IA 3O3OB 5EESA 1GNRA 1IHUA 4YMSA 4DAEA 2E6UX 1UBGA 3HBLA 1QUEA 5LOVB 1IYZA 1M6VB 3IOMA 4NH0A 3B6IA 2P62A 3CRVA 4NCKA 5K8LA 3MAGA 2CD7A 1TE2A 4ZXPA 3EC1A 3WSTA 1OI7A 1E4EA 2RGGA 4NBUA 5IM4F 4F3TA 2FU5C 4A23A 2OO3A 1XE3A 3NOXA 3RROA 1JFFB 3UV7A 4K9OA 4RD1A 4CU2A 3WGHA 3DCYA 4X1OA 3KZKA 1SKMA 1KFCB 4AKHA 3OX1A 2H5JA 2PRIA 2X19A 3HDGA 3UMCA 3QE4A 1EP1B 4Y9RA 3OPYA 4NYMQ 3D7MA 4OQEA 3I3SR 4LJ6A 2B4TO 5C1OA 1PVVA 1DAMA 2E18A 3AKEA 1O5OA 3HYRA 4MWZA 4TLAA 1Z6ZA 2BFMA 3L6OO 5F7OA 2BVNA 1PAUA 2HA7A 3I6MA 3JALB 1VJ5A 4J0CA 4LFBB 3I45A 3GAMA 2QV0A 4KWHA 1SXJB 1E5VA 3UYLA 2B1RA 2Z4TA 4XFJA 3AKDA 4KO2S 4JC5A 4OL0A 4KRYA 2HCJB 4W4TA 5TGDA 2APJA 3QHQA 1KI6B 3A2MA 4I4NA 1BEZA 4YJGA 2QTLA 4NV1A 3T6KA 2OG2A 4GECA 5AJYA 3W6UA 1PFQA 1T1EA 4ILKA 2VPIA 4IDQA 5DBGA 2GFQA 1GUYA 2H5LA 2JAXA 3C5WP 5ITZB 3V46A 2ES4A 2VJQA 1RYMA 3ZWPA 1KI9A 5G1NA 1OLXA 3UYKA 1TT7A 4LECA 1DBWA 4TRMA 1GFWA 3W05A 2XECA 4IV0A 3MLAA 2YV5A 4OBEA 4KXLA 5ALZA 2FSVA 3IKLA 5KDLA 1E1QA 2QL7A 5CX1A 3SR4A 3EZXA 4RTLA 1RFGE 4NICA 4X95A 5KSOA 1JEYA 3RVKA 1U3TA 3JQAD 4Q47A 4R1OA 1YQEA 3PVCA 5CTAA 3JVDA 3GLIE 3OQOA 1E9EA 4RSRA 1QHYA 2OKGA 2F3PA 5AVJA 1Z5OA 1S8OA 3IAXA 4JI1B 1UFRA 2YXLA 5T3YA 1RC0A 4LTNA 3VKWA 2ZB8A 1UOOA 3ZHCA 2UVQA 2ZU0C 1E3IA 2WDZA 4YPFA 2WA2A 4MGZR 2H17A 5H82A 3WWDA 5DM60 5B3JC 1OE0A 1NBAA 3KR2A 2ZKLA 3ACCA 4LE0A 4QFDA 2ZUFA 2P3SA 1J0AA 1LSSA 1ES9A 1ORWA 3BMCB 3IMEA 4O1IA 2RC6A 1XEFA 3CNLA 4C05A 1DKMA 1NGSA 2ZRGA 4WN9B 2C0PA 5J5VA 2AC2A 5CU7A 2I2DA 1XMVA 1AKYA 1Y9EA 2D59A 4JOCA 1KNQA 3JS5A 1PN3A 3ETDA 4DCPA 2ZBRA 5JSZB 2QXUA 1TJPB 1MFZA 4BNYA 5DK4A 4I4CA 3B6JA 2A1TR 4LXUA 4A2CA 5A0TA 1H0SA 5BPFA 1CZOA 1H1LB 1EJ6A 2NSHA 2OZVA 1PI3A 3DLPX 4HEQA 4IWXA 5G2OA 4Q5IA 5GP1A 4AG3A 1ZCAA 2BDTA 2F9FA 4DL9A 1EX6A 2R8OA 1U0OC 3ELWA 1PQUA 3L0DA 2FPIB 1QMPA 1O08A 1Y1RA 4GMKA 2G9VA 3NAGA 4Q4JA 4ISBA 3KSMA 1THGA 2UUPA 3GH3A 4R40A 1KI7A 1E7MA 1XL0A 3VPDA 5JAMA 2QHXA 2R4QA 4ZQGA 5K51A 1S2MA 2OPHA 3I8XA 3PGLA 4D6XA 1AQIA 1P2FA 4Z2YA 1G4AE 1N1GA 3ASYA 2QRJA 2BCEA 2DCUA 1GFIA 2GKSA 1KK0A 1QV6A 4Y7DA 1AA9A 5JYBA 4DJJA 3HEBA 3I0MA 3NT2A 1FU7A 3H2KA 1NVAA 4CKCA 3VU9A 4HNSA 4XJSA 2XT9A 2AN4A 1PQPA 1ZI9A 1P2UA 1V25A 4GU5A 4HN2A 4TQUS 1M2GA 2WT9A 4FZVA 1ZRSA 2XNCA 2HJSA 2JLCA 4UAJA 3TL3A 3AR5A 4D4MA 3AXTA 1C0KA 2OG1A 3NEPX 4H4CA 4I81A 1JU3A 1U7DA 1YCGA 3HKDA 4M9SA 4YRDA 1GYRA 3O8RA 4FJ0A 1XTRA 3ENVA 4JT8A 4I1PA 2A9RA 3G5AA 3WHIA 3SX2A 4IVRA 4W9RA 1POXA 3SSNA 1YZTA 4B6FA 3ML1A 4MKRA 3BFPA 1KFBB 3KVVA 4H7DA 4EYEA 1VSVA 3TIFA 3WJAA 3WNBA 2BGGA 3ASZA 3O9ZA 5E2IA 4CR6A 2HWUA 3FUWA 3AFOA 4PIVA 3K0CC 4FGKA 4PC2A 2HJWA 2M32A 3AK4A 4HDKA 4MPPA 5IT9A 2JGFA 4PGGA 4QDXA 4BFSA 2HDOA 4B2LA 3ZVMA 1ECLA 5JECA 3EZGA 3MTIA 1XZHA 1E3TA 1ZO8A 4U2KA 3AETA 4R2IA 2OORA 5EIEA 1XLVA 3GFRA 3MHPA 4DUGA 4BFCA 2PUCA 5EP3A 3P9QA 3R7BA 1K68A 4EUKA 1U3CA 1R6UA 2D3TA 1BE0A 5CLQA 1ZNYA 2HHJA 4MX8A 3U4CA 3LQ1A 4EH1A 1D1QA 3BIFA 3PV0A 4KFTA 3TM5A 2PV7A 4U3JA 4Z5XA 3EXHC 2B37A 4XIYA 5F7JA 4OI0A 1T91A 2DFTA 4PO3X 3P2OA 4M9CA 1UMDB 4Q7QA 1WSBA 2EFHB 1T36B 5TMBA 3IJPA 1B23P 2ZJ6A 2UZ1A 2SICE 4BVGA 1U31A 3B78A 4DZRA 2QRLA 1ZN9A 5EIFA 3WIBA 4CCYA 3EZ6A 5IM4A 2IZZA 4P53A 3D8NA 5A04A 2ZANA 4MR7A 2X3YA 1M72A 1HG0A 3P2YA 4ARSA 1AQLA 2DQKA 1G1AA 5EVCA 4KQXA 5JSYA 5K5EA 1MHTA 3LP6A 1JR6A 3FYDA 4INPA 4UVEA 4M4SA 1J1IA 2X0JA 5CK5A 3I2YX 3QVLA 1D0IA 4H3VA 4OXXA 3H9EO 3F46A 1KAMA 1QH1A 2B4KA 3I8SA 1V8OA 1J2JA 3ITEA 1NUTA 2PR7A 1E3JA 2ZIUB 3L1JA 3N7AA 1NG9A 1E3SA 4J1NA 3KD2A 3ERCA 3WDKA 4KN5A 3ZDRA 5ERGB 2D1TA 4N9WA 3LCJA 3CT6A 2PV0A 3ZXSA 4B9AA 1LPOA 1O94C 2XRYA 1PLKA 3EVZA 2AMVA 4FYIA 4UCQA 4DMKA 1Z4LA 2IX9A 1WF3A 1PZXA 1UBLS 3GJSA 2XOXA 1ISJA 5B36A 5ILOA 2A9KA 3RLIA 3R3XA 1XF9A 3QV1A 1QYCA 2ZUSA 2ZRFA 3GIDA 1KTIA 4E15A 1NVWQ 1M34E 4Q4HB 1Q7BA 1SB9A 1Z2CA 2J7PA 1S4MA 4E5KA 4X71A 1HQCA 3ZWXA 4DXHA 4CEHA 1QRAA 2Q46A 1JEDA 3C8HA 3VH1A 3JWHA 4DMGA 2NQTA 4FUTA 3UGQA 3TN7A 2GXAA 2ZRBA 1V8PA 2VZ0A 2PMWB 3CUTA 5K0SA 5C51B 4TSKA 2EFJA 1MTOA 1OXSC 4I5GA 4Q1VA 5J3JA 1ZHHA 1E4YA 1VP9A 4LVNA 4AZVA 1FNMA 4DIFA 1MOSA 1VDZA 3AP3A 1T35A 2XUIA 3LUAA 1ZBQA 4M2LA 3WQSB 3IIKA 4JAVC 3T9FA 4D9KA 1JFLA 3D0RA 1N2GA 1N6RA 2I2XB 2WTBA 1Q0QA 3JD3A 3M5CA 4EARA 3AEKB 2QX6A 4PSKA 3B6MA 1IBSA 3CSDA 3IQWA 1SIOA 5FBKA 5HVNA 1IWBB 4MV8A 1VL1A 1CWUA 3EXG1 2B25A 3V8EA 2CNWD 1WUTA 1C9YA 1RTTA 2WJJA 3LXRA 5DW3A 4EI8A 1Y1SA 1OHHD 1OI2A 2OV4A 1EH5A 3BSSA 4JT2A 5EGSA 1CUZA 4EFNA 1RE1A 4WH0A 1NUUA 1NMZA 4TWIA 3DC2A 2Y68A 2WB4A 4J7AA 4E4YA 4FCWA 4WXRA 2YRXA 2C00A 1K6EA 3CZRA 4TROA 4J3NA 1NVUQ 3DZHA 4JNCA 3TQRA 2BGRA 3WB9A 2G6BA 3KOUA 4K6HA 1QG6A 5IJWA 4HQLA 4HWKA 5KMGB 1UEIA 2WJ4A 2D2FA 3UJCA 4ZK6A 4Z4CA 3WLTA 1DJNA 1UC4B 1ADJA 1UBMS 3B60A 4QNNA 1CJVC 3EN0A 4M87A 3L4EA 4RETA 5DM4A 5DYNA 3RUPA 3ZVLA 3HXKA 2ONCA 5EAIA 1NR5A 1DC3A 4X63A 2KPOA 4DCJA 5CCEA 4QDZA 1KBQA 4TLEA 1YB2A 3TOVA 3B1ZA 4E1AA 5AM3A 5HDBB 3CEAA 1MX3A 2WAOA 1B6TA 1H2RS 2QRMA 1PCXA 3A10A 3REGA 3TQCA 2OO5A 3PRYA 4CM6A 2WIAA 3RSSA 4AX4A 4XRRA 1D1TA 3H04A 4WLOA 4UCWA 4XVUA 3SJUA 3HDVA 3A3OA 5DXAA 4Z4GA 1G5RA 5K3CA 4YMLA 2I7CA 1F9EA 2C04A 2C0CA 4XA8A 1N5MA 3LCCA 3G59A 4LOAA 2UVPA 1H9BA 2JHAA 4FX5A 4DV0B 2NVWA 1XEWX 3W2EA 1B00A 2NT3A 4C7OB 2WF6A 1PDVA 2YZGA 1OBVA 4K86A 5FOQA 5JISA 3TEFA 1TKBA 1ABEA 3UMFA 2WICA 3RWMB 4WZ6A 1SVUA 2OHJA 3H5AA 1YQTA 4G5FA 4B09A 2HCTA 2Q9UA 5HM8A 1E1CB 3EIWA 2O20A 1QQ7A 4QTYA 2ZWVA 5DTEA 5I4CA 5KNCH 5I9MA 3VDMA 1JBKA 2ZJYA 4TZTA 3DOUA 1I4EB 1EXNA 4RGBA 2IHNA 4D9FA 3HNOA 3KQTA 4U7HA 5DX8A 5A3QA 3TB4A 1T8YA 4YCAA 3EEOA 1FDWA 2WKRA 2B34A 2X6RA 1EFVB 2FLVA 3LOPA 3PDIA 5HWSA 2VTBA 3N0VA 3O2JA 3PPIA 4Z3DA 1ADYA 4P22A 1OILA 3ORSA 1QB7A 3INNA 2WIKA 2QX7A 3HRKA 3VNSA 3MQ4A 2IVFA 3U5ZB 1UH5A 2D7CA 4P6VF 2IEDA 5F2KA 5A4AA 2ODEA 1URPA 4G65A 2JIPA 4RLHA 1MC8A 3EUEA 3OZUA 3IO5A 4MKHA 4G5OA 2O8CB 5J5AA 1R7RA 3L7LA 2I67A 1E58A 3R9IA 4IXWA 3CPSA 2JJ1D 1RXVA 4JBLA 5BWCA 3WK6A 1U6JA 4PAQA 4HUQB 5HYVA 4O25A 1O9GA 3L9XA 2O0JA 2D2VA 3AR9A 5E7IA 4URYR 4KACA 4LJ4A 4R2MA 1Z7YA 4KXMA 4YP0A 4Z4EA 1V2GA 5ISMA 2A9FA 3N2GA 2G06A 5F1PA 4FDTA 1JU9A 1R10A 2H54A 2OO5C 1W2WB 3KR9A 2QLMA 3T0GA 2BMAA 2CJXA 3F1KA 1VZ2A 5EYPA 2MTBA 3H5IA 4JLJA 1C8VB 2GNAA 2BE9A 3A0RB 1G5TA 1IOWA 1I5OA 1E2NA 1WXGA 2VA8A 2V7VA 2W37A 5AI8A 4HNGA 2O3RA 3PXCX 1YVPA 2R1VB 3RC8A 1ZQ9A 3MWEB 2VSFA 3G2NA 5IJAA 4YP6A 3H84A 4RACA 2DPMA 1GZ7A 3OU7A 4I4IA 1K1EA 1SXJD 1O9BA 2HXGA 1ZSYA 6GPBA 1DT5A 3MELA 2O8VA 2W2LD 3NHZA 1BS2A 4C5BA 4BFZA 2EHJA 1Y8QB 4LOIA 4QUAA 5J4VA 3FMVA 4Q4AA 2RAVA 1RS0A 2P11A 5BORA 2EGUA 1R0XA 4A6XA 4CTOA 4DR5B 1P9NA 1PR3A 2XTMA 3SLRA 5FPYA 1D04A 3QFSA 1INLA 1X86B 3IQIX 3ZHYA 1ONBA 4MVXA 1EVQA 2YCLA 2RGXA 1U5CA 4MICA 4S1TA 3F5SA 1BCRB 1YS4A 2ZUEA 2PZKA 4JODA 1RYNA 3GCGA 3D6HA 3AKYA 4OFBA 3GDOA 3RWBA 4ALIA 3RSOA 1ULSA 4EAAA 4JJEA 3D2CA 3MPUA 3AH8A 1PS9A 1RHRA 3VVMA 2PX5A 5K09A 4NTZA 2CXOA 1HDXA 1WHTA 1JLHA 4FFPA 2YIMA 4RMGA 3QVWA 1T0UA 2V4ZA 2JH9A 5EWJB 3TMYA 4ZEXA 1TMOA 4WD3A 5DBIA 4AIIA 1IUKA 1JHZA 4G89A 5FFMA 4IHAA 5DJ5A 2Y77A 3VKHA 1DBVO 1Q74A 5ITZA 1NBME 4XIGS 1ECBA 2HEGA 3CMCO 4AAYA 1VBKA 2KI5A 2W2QA 4ERNA 4OREX 4M49A 2VTDA 1SOMA 4BY9E 1ATZA 3AUUA 5G0SA 1F4LA 1OU0A 3SU8A 5IJ9B 4P34A 3PA6A 3ESBA 2SECE 4CNQA 2TYSB 3ZOKA 4U1RA 4ZOLA 1G5FA 3E2MA 3OY7A 2CDCA 2XE8A 4UU0A 2DUWA 3OOHA 4K6MA 3GFBA 4LKRA 1ONSA 2H07A 4EG0A 2FI1A 4WKOA 4P3OA 2AJ8A 4O2AA 2YV2A 3UIEA 3VSAA 5ADHA 5IP5A 4GKVA 4WBNB 4GSLA 2ZE6A 3SVLA 2WA1A 2J87A 4DA7A 3RJ5A 1OASA 3KHSA 1JAZA 5J5CA 4F9FA 1KRWA 1PK7A 1G9XA 1BZYA 2OPBA 3OURA 1R8SA 3QUSA 4RV4A 1P1FA 4Z9AA 3TK1A 3UMSA 3U3DA 5GONF 3ABSB 1RM0A 2JFOA 4MWBA 3PQEA 4XOIA 4C43A 3H5RA 3R7FA 4CT4B 1MX1A 4BNNA 4DCVA 1EAMA 1J2TA 3DO8A 5FQOA 2D1FA 2P9CA 2WWWA 3LQFA 5B3KA 4DLYA 2L82A 4NAVA 2CFSA 3EQ7A 1DRUA 4A6DA 5IFKA 1QUFA 2W2OA 3MWFA 1YQWA 3L4BA 2QU8A 4DEVA 4AY4A 3G85A 1PRYA 2E4XA 4WUVA 4GR5A 3UB2A 4A2WA 1CJMA 2V6GA 1T9GS 2QL9A 3CWZA 4HH0A 2FPIA 1ZIPA 3JAWB 1AQJA 1B74A 1IY0A 2A84A 2HBRA 1E8MA 4N65A 4XM0A 1SD2A 5KVCA 1EE9A 4MIOA 3FKQA 2ZSEA 4RA9B 2JLBA 5LBIA 2B2XA 2XB4A 3GZNB 2NUPB 2IXBA 3WMGA 4LDZA 5FV7A 1CTQA 2D1SA 3Q98A 2GEBA 1PV1A 4OXRA 3DUFA 1X39A 2VO1A 2XLBA 4NABA 3O1JC 1D7AA 1NULA 4MV5A 1QC5B 4AQDA 3MMXA 1RQGA 1XF1A 2BR5A 2X4LA 1RVDA 3DS8A 3HB5X 3MJSA 1CB0A 2HM7A 4B2PA 2O3SA 4MRMA 5EJ8A 4KVFA 4YRRA 7MHTA 4HLNA 2JHFA 3QQPA 4RPGA 1QDLB 1GRQA 3U1BA 1PWXA 1GYQA 3GNTA 1SVSA 3H0EA 1GOTA 3EMKA 3HY3A 4M0DA 4ZVMA 1PYGA 2EGGA 3QUCA 3K0BA 4WPGA 3I6ZA 4C1BA 1Z4OA 1ZSVA 2HY7A 3UXHA 5LP1A 2G0NA 1QX4A 1MBZA 3KQQA 4OLHA 1SZCA 2WF5A 3AFIA 3U9SA 1PWEA 1SQFA 1IHDA 2H1HA 2P3OA 3KIPA 3ZXIA 1SFRA 4MSUA 4LBVA 3JU3A 2RI1A 1ZJZA 2WTAA 1HLGA 1ODJA 2IIBA 3MMSA 3EXFB 3KL4A 1IXZA 1Y9JA 3JQQA 5DGXA 5AW1A 4CLRB 2IXEA 4IMJB 2D06A 3PUWA 3GGDA 4O8CA 4R31A 5LD2B 1RDFA 3A70A 4OLFA 1NVDA 2Z5GA 3TKAA 1RLMA 3GJYA 4A8PA 5I7WA 1IEWA 2J3EA 3U1TA 4JI5B 5JNSA 3QW2A 2OOKA 2II6A 5EIHA 3BN3A 5JALA 1I3LA 1QOPB 5KAPA 3T0IA 3C3DA 3ZWCA 2UYCA 2OGSA 2Z83A 3U44B 1LEHA 2IW1A 3RU9A 1FMLA 4FI3F 2VP3A 3LUJA 3BZWA 2CHEA 1IBMB 1QCDA 4JB0A 4U3JB 4MQBA 1BTOA 3DLAA 1WXXA 3ZDCA 1FVHA 1NXSA 1SIBE 4MPRA 4Z0PA 2R48A 3GNQA 3NHAA 3OHMA 3UCEA 3SC3A 4WCFA 3GIWA 1ORRA 3GFQA 1R00A 2QD2A 1AM4D 4Z4HA 3JYPA 1C7JA 4QBKA 3FCSB 3QA9A 4LPSA 3D7RA 3O4IA 4QNRA 3PFCA 3QPBA 3K70B 4B4WA 3LHIA 4D9HA 4XGKA 2QTTA 2O3QA 5KVAA 5L45A 4YMTA 1JZSA 5F33A 3U61B 4KQCA 4GP7A 1SBTA 3ACBA 1STOA 2P7IA 4OHZA 4GSYA 4L0CA 1FPMA 2JEOA 1E1NA 2YIDA 1UZMA 3CF4A 4G4SP 4GPEA 4WN3A 5AKKA 3TM4A 3W9YA 5BR1A 1JIJA 3PBKA 4TT8A 1ABBA 4OJTA 2HQBA 1MU0A 1NBMD 3DE1X 4LSZA 1E5XA 3JPWA 4HBGA 1M2NA 1HO3A 3W1EA 5H3CA 3GT4A 2HH9A 3NHKA 4XX0A 5B53A 1QK4A 1W2HA 2PT9A 2B69A 2ZTMA 2OSVA 3N07A 2HZ7A 1FYXA 3NFYA 2PUHA 2ID7A 5DHRA 5DPMA 1R6VA 5F1OA 5SZKB 3T9CA 4UVDA 1HTTA 3EZNA 2Z5LA 3D43A 3AVTA 3PUHA 4NFYA 3GAFA 1NJGA 3F2VA 4MGKR 2P9BA 3PEYA 4F6RA 2GHRA 1OX4A 3B82A 2IW3A 3R5SA 2DFLA 5I3CA 1OBFO 1Z34A 3OIYA 4R1QA 2JD0A 3H4MA 4I1YA 3WY9A 1BVYF 5JDCA 5AI0A 3VUEA 1B0AA 4I55B 5JH7A 3V55A 1CK4A 3A7DA 3E23A 3OCZA 1C1DA 4A8JC 2Y1LA 3MT8A 5HIKA 5EY5B 1QG4A 2YWDA 4FINA 1QH8B 1RXWA 2GXUA 1YRWA 1J9EA 2ZTSA 1X77A 3AUYA 2I55A 2QN1A 3DFIA 3K1AB 3X1XA 1FMJA 2NADA 4FQ7A 2XQIA 4IP0A 1YE8A 1B2LA 4MB2A 1ULTA 5ETJA 1GDHA 3KQSA 2YZ2A 4U63A 4AM8A 1G9TA 3IIEA 4UAGA 3HCWA 4I4TF 4J0DA 4Y1RB 1ZMRA 5ECDA 4OHBA 3SQXA 4EG6A 2VNHA 1Y4ZA 2ZDQA 1HT3A 3CRW1 4RL6A 5H83A 3EEBA 3NDIA 2EKQA 1FRQA 1Y9ZA 2DTDA 4W8OA 4GP9A 5AKZA 3PTAA 3Q0EA 4L57A 3QEJA 1QM5A 3PB3A 4N6OA 4TUYB 4X1KB 5ERXA 5FWYA 2PH3A 4OHUA 1OWLA 4RF3A 4TV9A 2GX6A 4BX2A 2YHIB 2FLWA 3OAAA 4J16C 4LWZA 2GPNA 4HFRA 5D85A 3S2YA 3SOPA 4L5CA 3D0KA 3GJQA 3NKFA 5DTQA 3RANA 5CLJA 5HR5A 4C3ZA 3GP5A 2XUPA 3AVPA 2AHOA 1YHNA 1ZVJA 2BSAA 1Z18A 2PXCA 3JWEA 1DC7A 1YUMA 2XJ9A 4PTLA 2PQ2A 2ZUVA 4S3MA 4ZDWA 3T3IA 1DX4A 3OX4A 4CXMA 2QPTA 3KYCB 4PSAA 5LXTA 4WBXC 1P62B 4MUFA 5BSVA 3C4VA 3KT0A 3FPFA 1H69A 4QREA 4KITB 3C7KA 2XCOA 5H5JA 1RHQA 4DSNA 3NHJA 3B2EA 1I4WA 2HA5A 3DDOA 1MKYA 4G0QA 3UVEA 5HGXA 3RASA 1C50A 4B3XA 2JDID 1WXQA 4TPKA 4Z54A 4FDAA 1QTRA 1QTQA 3ILSA 1A2QA 1TGYA 3OCCA 4EM6A 5H02A 2IZ0A 5EA2A 2X6QA 3R6WA 1L5HB 4XFKA 2JGIA 3K30A 1YK1A 4MEBA 5GV8A 3TTWA 4N5NA 2G5GX 3BWYA 1J33A 2XGOA 3WWYA 4DM3A 4Q1EA 1NVXQ 2H5EA 1XXHB 2Q3LA 3V80A 3BD8A 3NUZA 5DW0A 5KJ1A 1JN0A 3FETA 1Z0FA 4AG5A 4DV5B 3FDFA 4J0QA 4MW9A 2DT5A 3FFBA 4YMWA 4OHXA 5AFSA 2WVJA 4P3NA 3UT6A 2R2GA 2UVDA 4XYMA 4BE7B 3ZJTA 2QRZA 3SNKA 1NVTA 1T4DA 3EEFA 2GUWA 1AY0A 1RI1A 4KSCA 5J4KA 4EABA 4LY9A 1RC8A 3KB1A 3OQIA 1ZGCA 1EK6A 2JAQA 3QELA 4EA8A 3PGMA 1KDPA 4L72A 1SBNE 3HS3A 2CEKA 3C5HA 4UBLA 3UENA 3THSA 1ZUIA 2NP6A 1Y7HA 4MWDA 1VCNA 3AR4A 4YR7A 3E8XA 5TMPA 4ZJUA 4LF8B 1N7HA 3I39X 2OWEA 1H9CA 5F5NA 4IOJA 1COWA 5JVDF 2A9VA 1E2JA 1PWHA 3E9CA 1G38A 3FSEA 4ODIA 4MQ6A 2PX3A 2B5WA 2Q5IA 2B6HA 2F67A 4US1R 5IAOA 2ZB4A 1XWFA 4IDPA 2XXAA 5LA6F 1SNYA 3QUQA 4GNKA 5TEVA 1S2LA 1IQUA 1DC8A 5BWOA 3G5LA 1RZVA 3C45A 1RAHA 1SXJA 2JI8A 2FQWA 5CDYA 1B1AA 4JVLA 2VTBB 5LMNB 2H0RA 1DE0A 1P74A 3PU6A 3M3HA 1WM1A 3VTKA 2ANBA 1QIHA 4HZUB 4ZU3A 4REMA 3GLHE 3SC2B 4BKRA 3HXLA 5K6AA 3HMQA 4PZZA 4EVSA 1CSEE 4C2BA 4OVKA 3DDWA 4HWPA 1L7PA 2VDVE 3BOSA 1HC7A 3CSSA 1NI4B 3CR7A 4QPZA 3MW8A 1KSFX 1YFZA 3ZIDA 4ZHQF 2JI6A 2WUFA 5LYYA 3DJYA 1BEEA 2JRCA 3ETCA 2XNDA 3K2IA 4FDUA 4MYDA 5JMWA 2GQ0A 2PL3A 2DPGA 5CP8A 4YFVA 4BWFB 1KVUA 1XRRA 1WCIB 5DT9A 1HZJA 4NCAA 3F0TA 5JD4A 3ZOZA 2IYEA 5ED0A 1DIOB 5FR1A 1DELA 3GVCA 2JJ1A 2WIJA 3OJLA 1RKUA 1CZKA 1MG5A 1KVRA 1J22A 1WUIS 3LIIA 2O1EA 3Q9LA 3WGLA 1ZITA 3SS7X 5A3RA 1NOJA 3EVAA 2WT4A 2HLDD 4OJYA 4TV9F 3IYLW 3AV0B 1ZH4A 4J94A 4YMVA 2JFNA 3EBOA 3GQBB 2Z1MA 3AU8A 4M55A 5EPEA 2X23A 5K3EA 3RKSA 4YJFB 2GDZA 5D00A 5JRDS 2HRCA 2A9JA 3NALA 5GZ1A 3I5XA 3I8OA 4ERXA 1MIHA 3FI9A 2BWJA 3KB8A 2ORED 5AP9A 1RAFA 3LPCA 2Y6VA 1DRJA 3HJTA 1JWBB 1DEHA 2O0KA 2IDJA 3NM5A 3T1HB 1SXJC 1GR1A 5JQGF 4BFLA 2HCRA 4RMJA 2BI7A 2GM4A 4OFWA 1KMCA 3HZRA 4NNOA 1HTBA 3MTDA 1I30A 1K2VN 1A96A 2PBZA 3HB9A 5JAUA 5TPZA 3MUOA 1TPZA 3IHLA 4IIJF 1IOLA 4D8WA 2C07A 4DA9A 1HGXA 1Q7GA 4EIWA 3RS8A 1NNUA 4Q05A 5DI3A 1WEKA 5C7OO 1RPTA 1T3ZA 2P35A 1BCRA 1ULZA 3G0HA 4PRLA 4N47A 1RIFA 3KLNA 1K27A 1DBRA 1LFDB 3JYNA 3QVVA 3QWBA 3IKVA 3EPHA 1QKIA 3K9BA 3CVVA 2FQYA 3QX8A 3MERA 3SIWA 4IG9A 4JVOA 4MDFA 4FDLA 1JU4A 1Y3FE 4BMXA 3AKZA 4OHCA 3TTXA 2EBUA 4FOLA 1SBCA 2QVCA 4BJHB 1Z63A 5TMEA 2VQEB 2LZ0A 2IC5A 4RCZA 1T5IA 4TXNA 1U7ZA 4GVLA 3MBIA 2Y6UA 2VF5X 4JYCA 3TL2A 4D2IA 5BMVF 5CIYA 1MFPA 1JV2B 2B82A 4CMJA 3KKOA 3ZCSA 4W1PA 4LVUA 9GPBA 4R9UC 4Q3EA 3DCJA 1EXVA 3B70A 2RCYA 3EGEA 4QUKA 2XCSB 1XB2A 3VYUB 5FHRA 4NYIR 4YALA 2R7MA 3MIZA 1H2FA 3WGZA 3ZZ0A 1FFXA 3RYCB 3K4HA 4QNMA 3RNLA 3WGNA 1HEUA 1RPAA 1TEVA 2FW1A 4D41A 4CM9A 4L9RA 3KT3A 4QLOA 4JOBA 1Y98A 2IHBA 4LFCB 4NS4A 3TSOA 5LQJA 1LNZA 1NXQA 1XLWA 3ZCXA 1FX0A 1TK3A 1HFEL 3AETB 4UQLA 2BAGA 4FEYA 5FUXA 1IJFA 2P5YA 3L40A 1TQHA 1G20A 3BDIA 1NXPA 3AI7A 5AJUA 3TLEA 1APBA 4ALJA 2J9GA 1FFHA 1M6HA 1QGZA 3F96A 4I8XA 1M54A 3O9VA 4C07A 2VWGA 2VDUE 1A0OA 3PI7A 2GN4A 3COWA 2H57A 4GR9A 2FV8A 4EHDA 3IESA 4PLHA 4QAJA 1QKJA 1WVGA 2ZTUA 1WXIA 1SUWA 2ZCJA 5AVSA 4DLXA 2PKEA 1T36A 4WOJA 2GZAA 2G7ZA 5BQ5A 4MUYA 5TVGA 3BJEA 4YJHB 4EUFA 5M5BA 2BMVA 1HY3A 4TZ0A 2CNLA 1FUYB 1UBSB 4B7CA 3JTMA 2WQ7A 2C82A 3EXAA 1IUNA 2AW5A 1NY6A 2BGLA 2GRJA 4K87A 1CUYA 1K7SN 2BUBA 2XA9A 1FJ2A 1ZVMA 3VR3D 2P6RA 2EF0A 1U8AA 1UUFA 4HB2A 4I8DA 1N36B 1NF9A 1XXHE 3BDAA 4P5DA 4B3IA 3JASA 1GKYA 2PS3A 3A06A 4L9AA 4R2KA 1TEXA 4KQ2A 1KR5A 4CMBA 4CODB 4DLZA 1GZ5A 2BELA 4FWTA 5AJXA 4KDCA 3F6SA 4ITUA 5SY6A 3GMIA 3GHYA 3F8WA 3DUFB 4DBLC 4UULA 2R6FA 1SM4A 3IEXA 1SBYA 4BLOA 2VDWA 4KAXA 1J5XA 4RZQA 5E6SB 3SJ7A 2GBCA 1ZS9A 3PCRB 1H05A 3TNDA 1MH1A 1ZZEA 2H1RA 4BEVA 3CPHA 5H3LA 5ITVA 4FNGA 4YCJA 1IZ0A 2GTIA 2AEJA 2Q5FA 2HIHA 1K75A 3CNQS 1IL0A 2BFOA 2FZ4A 3K8QA 1MPXA 3TRDA 3O8LA 2OV8A 2YQ5A 5KNBH 4OLBA 3C6QA 1QGUA 4RNDB 3UC9A 2CCKA 3LZCA 4FNAA 4V0MA 2HQSA 1UBKS 5MGBA 5B58T 1DNPA 2J0VA 3QWIA 4JZYA 2Y67A 2QVLA 2GCIA 2J5BA 4FOTA 4HWGA 2BM9A 5TT1A 5E2BA 4UVHA 3F47A 1ADCA 3COPA 1FEZA 1M0TA 4ZT3A 2XB2A 4N18A 3KCQA 1ESEA 3ANXA 3P2KA 4NU8X 2OCKA 3Q8XB 3R0ZA 4YS6A 5EUCA 5GZ6A 3CGWA 1YIOA 4RM2A 2RH9B 3CUVA 5F2EA 5HGJA 3A3YA 4ENQA 4F91B 3NV9A 3B1KA 4IDEA 4EHLA 1CFJA 4OP2A 3STUA 1TFUA 1L7RA 4DIMA 3HV0A 4J9UE 4GF5A 1DEAA 3ZEAA 5A5DA 3E53A 3RTGA 3V1TC 3TPCA 3JX9A 2F2TA 2XQKA 1JEAA 1DWOA 1T24A 2DWQA 2O8NA 2HAEA 4K9PA 4RZ3A 2QBYA 1PZGA 5A4MS 5L7TA 1CY6A 4Q7KA 1H42A 4PXYA 3ZNNA 1JA9A 1V47A 2DHEA 2JIQA 2RGAA 4EJ6A 4DMLA 1USIA 4MVJG 4B3MB 1JLMA 1LZKA 5IBQA 4DV4B 3WKAA 2C88A 1FQWA 4B6OA 1SGWA 1U0JA 4JC4A 1SR8A 1QR2A 1J7JA 3LBHA 2XCUA 3P0HA 4YFYA 1VFNA 5JDCC 4OHRA 3PNOA 1THMA 2XUGA 4MVJA 2KM1A 1DRKA 3RIMA 3VTAA 3PXGA 4CV3A 3AUAA 1KEVA 1SD5A 1TM3E 2JA1A 2QORA 3F9CA 1YR3A 1RLIA 2IE0A 5G4KB 1O03A 3REQB 2OHVA 2GF0A 4QQNA 2F43B 3C3XA 3EVDA 3Q3GE 5TS2A 2C4HA 3O21A 1PJBA 5DHPA 5CAEA 5HKLA 4A4DA 2W6ZA 2P2LA 2FOLA 4GDFA 4LFAB 2VT6A 3C3YA 1SHKA 1WMSA 2IYQA 4N39A 1RPJA 1QCZA 4AN4A 3TUIC 3M2PA 3Q2KA 5EHZA 2W8BA 1NBMA 1Z47A 2Z30A 2WKPA 3IEIA 2WSIA 3RTCA 5JPCA 1V5EA 1SA0A 5FOTA 2ACWA 2H1IA 4EELA 3PUIA 1F17A 1OXBB 2VS1A 4YMIA 3DF7A 3HR8A 3A04A 2G67A 3QF4A 4FW9A 1EZ4A 1RXIA 2DWCA 1WZCA 2W2KA 1W19A 2AZ4A 2P2SA 3HY4A 3USCS 2W93A 1E1CA 2AI2A 1V48A 2YMMA 4ZK2A 5AW0A 1PJSA 3HHPA 3SSOA 4BBAA 3FBWA 4B80A 2FVYA 4ANFA 9ABPA 5FUMA 1Q21A 1GQQA 2HR1A 4KVAA 4JI8B 4WZAE 4JBNA 3VR2A 3ZHQA 5HPYB 4RD0A 1N6NA 4FPXA 4L75A 1PQ4A 2FP4B 2V7QD 1VI6A 2VPZA 4G5YA 4WNAB 5GOZA 1YFLA 4C7JA 3I61A 3F3YA 4V2UA 1KYVA 1MD9A 4Z7JA 4MW4A 3E7XA 3DBRA 3ECCA 1XLUA 1JDVA 1M73E 3G9TA 1U5BA 1VE3A 2GEFA 3QH4A 1RIIA 4TUYA 3VR6H 4B87A 3KKPA 5KQMA 4RE5A 5BWLA 3E2IA 4OTZA 1RI5A 1WZ2A 4ALNA 3NYRA 1ZK4A 2AMFA 7REQB 5DNEA 2EG5A 2XF2A 3PJDA 4L3WA 3LVBA 2VXOA 5JMTA 1XTSA 4B44A 4OI2A 2W2PA 3MJCA 1G3QA 3NAMA 4IPTA 2Q3DA 4HJXA 1H6DA 4DLNA 4F3CA 1X1RA 3ZWKA 1JL3A 2IU3A 1KEZA 1QO7A 2AJTA 3AVOA 3HLKA 2QUHA 3A05A 4ER3A 1HFJA 1L5KA 3F7TA 1YAHA 3ZWAA 2JRLA 3FOEC 1OFIA 3HVJA 3R5XA 4CM4B 3A25A 4NU6A 4KQWA 5DHSA 1K7XB 5FTJA 4O4HF 1P9RA 3SI7A 5SZHB 1YI8A 2P41A 5HK9A 1FP4A 1ZJWA 2VJMB 3I62A 1Z5WA 3I5MA 4W9NC 5KOIA 4UXJA 4I5FA 2PWAA 4LV5B 3WAJA 1MO5A 3HZOA 1KC3A 2VP6A 4AJOA 3WBBA 1OIVA 2GAFA 4LYFA 4MQFA 3D1VA 4H6PA 4EKIA 1CETA 3SYMA 2YH2A 4PONA 5IDQA 1PL8A 3RVLA 3MXOA 3M5WA 4GUDA 4OL9A