3DJMA

Crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
113
structure length
113
Chain Sequence
b'MNNHIRLRKAEGKWVIRTDSAVLGETLNAIELTEGSRDPVIYFPREDVAMVMFDKSEKVTACPLKGEASYYSIVGASGTLKDAAWSYESPKEGLEAIAGYLAFAPDCTKVGQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized Protein DUF427
publication title Crystal structure of Protein of unknown function (DUF427) (YP_001042567.1) from RHODOBACTER SPHAEROIDES ATCC 17029 at 2.51 A resolution
rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Unknown function
total genus 19
structure length 113
sequence length 113
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04248 NTP_transf_9 Domain of unknown function (DUF427)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.150.40 Mainly Beta Beta Complex Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A 3djmA00
3DJMA
chains in the Genus database with same CATH superfamily
1FWQA 4TZUA 4V2ZA 3EBMA 4BPBA 5E3HA 2W4RA 3LRNA 4V30A 3E0OA 3ZD6A 1L1DA 2QFBA 2QFDA 4V31A 3DJMA 2RMJA 3HCGA 3P3KA 4AY2A 2KZNA 1H7YA 3HCHA 3WX2A 3OG8A 4TZCA 2YKGA 3FACA 4V2YA 3EQTA 3E0MA 5AMHA 2HR9A 3HCJA 3MAOA 5F98A 4CI3B 2KV1A 3NCUA 3CXKA 1YZ1A 3WX1A 1H6QA 3ZD7A 5F9HA 1HXRA 2KWBA 2LVLA 3CEZA 4CI2B 2RQBA 4TZ4C 2FU5A 1TXJA 5F9FA 2RQAA 4A2VA 2K8DA 2LOYA 3LRRA 4A2XA 3HCIA 4CI1B 3GA3A
chains in the Genus database with same CATH topology
1FWQA 4BPBA 3EBMA 5E3HA 2W4RA 3LRNA 3ZD6A 2QFBA 2QFDA 3DJMA 2RMJA 4AY2A 3P3KA 1H7YA 3OG8A 2YKGA 3FACA 3EQTA 2HR9A 5F98A 3NCUA 1YZ1A 1H6QA 3ZD7A 1HXRA 2KWBA 2LVLA 2RQBA 2FU5A 1TXJA 5F9FA 2RQAA 4A2VA 2LOYA 3LRRA 4A2XA 5F9HA 3GA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJM A; 
#chains in the Genus database with same CATH topology
 1FWQ A;  4TZU A;  4V2Z A;  3EBM A;  4BPB A;  5E3H A;  2W4R A;  3LRN A;  4V30 A;  3E0O A;  3ZD6 A;  1L1D A;  2QFB A;  2QFD A;  4V31 A;  3DJM A;  2RMJ A;  3HCG A;  3P3K A;  4AY2 A;  2KZN A;  1H7Y A;  3HCH A;  3WX2 A;  3OG8 A;  4TZC A;  2YKG A;  3FAC A;  4V2Y A;  3EQT A;  3E0M A;  5AMH A;  2HR9 A;  3HCJ A;  3MAO A;  5F98 A;  4CI3 B;  2KV1 A;  3NCU A;  3CXK A;  1YZ1 A;  3WX1 A;  1H6Q A;  3ZD7 A;  5F9H A;  1HXR A;  2KWB A;  2LVL A;  3CEZ A;  4CI2 B;  2RQB A;  4TZ4 C;  2FU5 A;  1TXJ A;  5F9F A;  2RQA A;  4A2V A;  2K8D A;  2LOY A;  3LRR A;  4A2X A;  3HCI A;  4CI1 B;  3GA3 A; 
#chains in the Genus database with same CATH homology
 1FWQ A;  4BPB A;  3EBM A;  5E3H A;  2W4R A;  3LRN A;  3ZD6 A;  2QFB A;  2QFD A;  3DJM A;  2RMJ A;  4AY2 A;  3P3K A;  1H7Y A;  3OG8 A;  2YKG A;  3FAC A;  3EQT A;  2HR9 A;  5F98 A;  3NCU A;  1YZ1 A;  1H6Q A;  3ZD7 A;  1HXR A;  2KWB A;  2LVL A;  2RQB A;  2FU5 A;  1TXJ A;  5F9F A;  2RQA A;  4A2V A;  2LOY A;  3LRR A;  4A2X A;  5F9H A;  3GA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...