3DKAA

Crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
150
structure length
143
Chain Sequence
NQIVSHFLSHRNVTNELAEKISKDHYSYKPAETSMSAEELVKHILTSFHLFANVIKEGNASPFQNTETDLNVLAKTYTEKTVAILEQLTEEQLDREIDAFGRKVTGRALLQLAMEHEIHHKGNLFVYVREMGHTELPFYQQRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DinB-like Protein
publication title Crystal structure of a DinB-like Protein (NP_389123.1) from BACILLUS SUBTILIS at 2.30 A resolution
rcsb
source organism Bacillus subtilis
molecule tags Unknown function
total genus 48
structure length 143
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 3dkaA01
2NSGA 2QNLA 2F22A 4N6CA 2OQMA 2NSFA 5COMA 5COGA 1RXQA 5CIVA 2YQYA 3DKAA 2QE9A 3QTHA 3CEXA 5COFA 2RD9A 3DI5A 2HKVA 3GORA 2P1AA 2OU6A
chains in the Genus database with same CATH superfamily
4CIHA 1EI7A 1V55C 2UUHA 1JOGA 3GWNA 2VCCA 5BQGA 5A6AA 2H7OA 2CGEA 3DMDA 4O6MA 1RKEB 1ZYRF 2QUPA 2M64A 3JT1A 4JW1A 5DLJA 3LNRA 1OCCC 1RXQA 2L6HA 3DAFA 4BJ6A 4YT2A 3DKAA 4DVYP 2EIJC 2KNHA 1SYQA 4NC3A 3PHF2 2A68F 1PD1A 4KNVA 5B1AC 2VC9A 4P9TA 2YRFA 3QTHA 3NMKA 3AG1C 4AL1A 4EBJA 2WVNA 3EGXA 3RQGA 2OCCC 3ZTMA 3X2QC 1VOMA 2P61A 5L0GA 5L0JA 1LI5A 1LVKA 1BR2A 3KYIA 4U5BE 3LUTB 3G4ZA 2W4MA 3OEOA 3U0CA 2OEXA 4LDRA 3TK0A 2R25A 2ASRA 1ZW3A 2JD3A 3IQ5A 1RKEA 2R7WA 3QZCA 2AVKA 4LDQA 3EH2A 1JPJA 3TOLA 1KTMA 2R7SA 3RW0A 3TQOA 3ZTZA 5DS6A 2NSFA 2OQMA 4PFPA 4PJLA 1HW2A 1I4YA 1K05A 4W8PA 4IARA 1LM3B 4Z9IA 4CIPA 1LIHA 2I8BA 1QKRA 4BJ6C 5JS5A 3JZ0A 3FAPB 1M2VB 1Z63A 1TWHA 4LLEA 4BPMA 5L3QA 5JUAA 1PD0A 1RJ9B 1YA9A 3AOUA 5F5FA 4JIOA 5JRAA 2H7VC 4UDVA 4I44A 4MS2A 5CI9A 1MNDA 3NYMA 3RF3A 5COFA 3W8HA 1O3UA 1CGNA 2PX3A 1NZEA 1E84A 4XEKA 2J9UA 3NKEA 2Q7RA 3SP1A 2HKVA 1ZVZA 5KYYB 2R05A 3FVYA 3L8IA 1HMDA 4O7GA 4PJMA 4U5DE 3RKOF 3PCVA 2D5RB 2HJ3A 1G4US 4X0RA 3W8IA 5KYNA 1GS9A 1O87A 2XXAB 5HSWA 2L9JA 1OXBA 3EG9B 3FOPA 1GQAA 4HFKB 1M2VA 3LAYA 3TD7A 3FDQA 4MTFA 5L3VA 3I5PA 4ER9A 1RJ9A 3W4YA 3W2VA 3CZ6A 4I1OB 4OIRF 2A1DD 4AE4B 3VYWA 3MYIA 1OW7A 1HE9A 2I15A 3ATPA 4EBKA 4CSAC 2DYSC 4BJ1A 5KYYA 3T4RA 3VRCA 3T6GB 2LP4A 2J7PD 2OG2A 4XQ1A 2YVKA 1LI7A 3B0PA 3U5SA 3DJUB 1IZMA 5JSLA 3AG2C 1B68A 2J9VA 4C3DA 3C8GB 2YZSA 3JYHA 4JCZA 2J7PA 4XWJA 1DOVA 4DOZA 3SXZA 4CDAA 3GEEA 3LLKA 4AX2A 1EA8A 2IYLD 1YYJA 4I1MA 3NYLA 3SNHA 1OCOC 2XS8A 3SXYA 4J32B 2Q9CA 2KSFA 2Y3BA 4BG0A 4AE4A 1WGWA 3TJ6A 1ST6A 2Q3TA 2WB7A 3SXMA 3JRTA 1D0ZA 1H9GA 2IXOA 3O10A 3ZVRA 3ZSUA 4MVQA 4U5EE 5GPGB 3RQEA 2FAPB 2HSBA 3C8GD 4MVZA 1RKCA 3EFOB 1R4TA 4OD5A 1NFNA 2O9XA 2H7BA 4WABA 1GGQA 4O6YA 1M6TA 2PFDA 3TOMA 4AL0A 1C03A 3F47A 3ZQVA 2V26A 5EHHA 2QLAA 2VASA 4M63A 2UUIA 3GORA 3S0XA 3V5ZA 1E86A 3C8GA 1ZU4A 4JTDB 2ZXWC 3NMJA 5L0IA 4G7HF 2R7OA 2XLVA 1A7VA 1ORYA 2QNLA 3MX3A 2A69F 2ZXOA 4N4WA 4BJ5A 4QI0A 3O39A 2WL8A 2YKZA 1MMDA 4LDKA 4CBEA 5COMA 2W9YA 2WVQA 3K1HA 1WATA 1CPQA 3EZHA 1FFHA 3UMKA 2YL3A 4FESA 3EFOA 4MQ9F 2VB6A 2G62A 3J06A 2DYRC 3MLGA 2YHSA 1C17M 2HFIA 2IXNA 2Q9BA 3G50A 1V74B 4LLCA 1G4WR 2W45A 4G7ZF 1T6QA 2C04A 3HLZA 4KNWA 4IAOA 2NUPB 4E7ZA 3US6A 3IQCA 3MYFA 2WVOA 3FAJA 3KL4A 5DVWA 2GWWA 2J9WA 1FMVA 1MMAA 1OR3A 2HZ8A 3OA1A 4A2NB 3M4BA 2AU5A 4RBNA 2AWCA 1H7IA 1TR2A 5FCLA 1EKYA 5DS5A 1WASA 3ZG1A 4C3BA 3JCUQ 3POVA 4JCHA 3B29A 2H8AA 1D1BA 4WJ0A 1BDJB 3FOOA 4OIOF 4QI2A 2YL0A 1T01A 3RVYA 4CS8A 5FZTA 2Y69C 3U2LA 1Q0KA 4MVSA 4YL1A 2HJMA 3GM1A 1JRAA 1JPNA 4CDYA 5A6JA 3GODA 3X1OA 5EK0A 1YAUO 1TQGA 4CJOA 1IW7F 3Q7GA 3B0UX 1OKKD 3G4XA 4J7TA 4NTFA 1LE4A 5E3AA 4K7BA 4XTKA 4DJ9A 3AGTA 3K1IC 2LK4A 4ULWA 1GM5A 2MHRA 2XLEA 3IQTA 2B0HA 3QW0A 1D0YA 1ZU5A 1OKKA 4D4XA 3E70C 2OEVA 3HJCA 1CGME 2IXMA 2GDCA 3M79A 1Y4CA 1S05A 1ZW2A 1YA7O 3RVZA 2DGJA 3KKBA 3ECSA 1YLMA 3FXHA 4XEVA 2HMZA 4CS9C 3LLIA 2Q4FA 1JMWA 4WGYA 2DB4A 1Z5ZA 3FMSA 1E85A 3LNMB 2KGOA 3RYLA 4K0DA 4BEMJ 2ZXRA 4XPYA 2GA0A 2HMQA 2XLDA 3HNJA 3H65A 2YEVA 4IWBA 1M2OA 4MW3A 4CSAA 3IPMO 4YK5A 3BEHA 3ZC4A 1WTYA 3B9QA 1AUEA 1PCXA 3OWTA 2R7VA 4U9EA 1PV3A 1D1CA 3RH3A 1APCA 2YL7A 4FWVA 4QDLA 1JAFA 3T6JA 1LS1A 3TJ5A 2TMVP 3AGUA 3N2ZB 4C7OB 1OR2A 3JSZA 3UR3C 3UMIA 3CSKA 2XRHA 2R7RA 1T5OA 1C02A 1R5ID 3AG3C 4NQFA 4DRHB 1A7EA 1KNYA 4G0HA 3AJMA 3JSEO 3LS1A 4P9FA 4DRJB 4DVZA 2PX0A 3DAGA 4NTBA 2D4UA 2Q9AA 1KU2A 4H54A 4IRUA 4CX9A 5A6KA 4I3MA 3HNLA 2KJGA 2OKUA 3NRHA 4HEAJ 4Q7CA 3A9CA 1Q0GA 2HSQA 4J7YA 2B0JA 4EWCA 1U0BB 1YZAA 3UMHA 3DI5A 4DXWA 1A0BA 1WN0A 2CYDA 3JYYA 2XXAA 2A0UA 4C7OA 4EBBA 1OW8A 3NKDA 3EG9A 5KYWB 4O79A 1NBBA 4EHPA 3U8VA 4F4BA 2LQGA 2P0NA 2Q00A 4PK4A 1L7CA 3DXJF 3N24A 1HMOA 5COGA 4NY3A 2J0WA 3M4CA 3O6XA 3TULA 3B0VC 3ABMC 2NPUA 3CQZA 3S84A 4DRIB 5IY5C 1NU9C 3K33A 1QZXA 2PF4E 3HNIA 2XM4A 5E3CA 3L0IA 1G8XA 1Q0FA 1SZIA 1FR0A 3UGOA 4Z9HA 1MMNA 4PACA 5E33A 2R9RB 4IGGA 3C63A 3LESA 1CGOA 1I4ZA 5KYWA 3RQFA 5KYUB 1AEPA 2NSGA 2OJQA 3U3BA 4ZLCA 2YL1A 4JEAA 5EGYA 2J0XA 3SYNA 4N6CA 1YYXA 5D92A 2C03A 1XZQA 3LEOA 3SEOA 4Q4ZF 3EHMA 2CNWD 4U9DA 2FFHA 5L0DA 3U8PA 4DBQA 2Y3GA 2ZXPA 3C8ZA 1V54C 2HUJA 3DWWA 1E83A 3I4UA 2R7QA 1QSPA 3KMIA 1D0XA 1G5ZA 1MNEA 4JZAA 3PMRA 4MTOA 5T1DB 3L8JA 3DM5A 1NSGB 1TWGA 1XWJA 2XL6A 4GQHA 4JC7A 4MVUA 4PJJA 1RCPA 2XLWA 2CNWA 5L0CA 3IHUA 3N0TA 3HTKC 4IJJA 2YLIA 2M4EA 3MFNA 4OIPF 3KPHA 2LD6A 5E2QA 3K7DA 5KYUA 2AP3A 3ABLC 3DE9A 4NTAA 1SR2A 4W8KA 3KYJA 1U89A 4XPWA 2XLMA 1ZHXA 1OW6A 5B3SC 3DM9B 2KK1A 2EILC 3KH2A 5AGFA 2KYHA 3JTLO 4YT4A 3IQ6A 1MMGA 3U3FA 2J8WA 4CDVA 3HNKA 5JT4A 5A69A 4MVOA 5CIVA 2PNOA 4JURI 1OCZC 4XLNF 1YJGA 3V7OA 5JVEA 2XS1A 3EPVA 1SF8A 1T9KA 2LFFA 4YT5A 3NYJA 3WHNA 4JKVA 1QLEC 1TWAA 5CI8A 1Q0DA 3ZWIA 4AK9A 2XM0A 3SXKA 3GM3A 3LEVA 3S28A 3I5QA 3QW1A 3EQLF 4YT8A 2NUPA 1ZZPA 3JRMO 1FAPB 4MVRA 2EPNA 1NFOA 1Z7Qc 4Q5SF 3IEEA 3UNGC 4XEFA 4MVMA 1W2WA 5HV9A 1AVOB 1M57C 2R7TA 1ZHTA 2QY9A 2YWAA 1ORJA 4P6IC 3WAQA 2X51A 3S9OA 3U9MA 1M56C 5DQZA 1VYIA 2XSEA 4E0IA 1S7ZA 2ICWG 4YJWA 4OIQF 5AC4A 3Q7LA 4N06A 5A6BD 4ONSA 2EPLX 2G3KA 2QE9A 4IAQA 2IOQA 1F1MA 1FTSA 2CCYA 4O6NA 3L34A 3M1CB 1OXKA 3R2PA 3H2UA 1VLSA 1QVXA 3K6BA 2KW3C 5A6BA 2IM8A 2JPUA 2LIGA 3QMKA 3EHNA 1T6UA 2L6FA 3ZQYA 5AC5A 1BR4A 3ITFA 1YARO 4K1OA 1K04A 5L0HA 1ORSC 2EIKC 1UG7A 2VH3A 3V5YA 4JJGA 3S90A 4U5CE 3VM6A 2HV7A 2VCBA 1TFOB 4FX5A 4HFFB 3NDBB 2QTVA 4D4NA 2EINC 3MBGA 2LCHA 2XL8A 3NG1A 3QVZA 3V5XA 2WZGA 2KQ9A 2Z15A 4IB4A 3DD7A 1LE2A 3VF0A 3H2VA 2V3CC 2CW0F 4ULVA 3F46A 2EPMX 3AG4C 1BZ4A 4MNDA 4GYTA 1NLXA 4BEJA 2YLDA 3PDMP 4E17A 2R7XA 2ZD9A 3B71A 3VAYA 3T9OA 4WGZA 1H6GA 3GWLA 2RD9A 5L0FA 1UFBA 1YZCA 1Z6AA 1ZHYA 2KC3A 3GM2A 5B1BC 3DE8A 3W2WA 3ZDLA 2IBFA 2J46A 2PBEA 3WODF 5BQHA 1VTMP 4OD4A 4PR9A 4G7OF 1D1AA 2P1AA 2OU6A 3BRJA 4G78A 1Q0MA 2AWYA 1NU7D 2OOCA 1FFTC 2W4BA 2DI3A 3EZIA 1HE1A 4MTGA 3U9JA 1I5NA 3K1IA 4E0HA 2F22A 4BJ5C 1VB5A 4DBRA 2NG1A 3E9VA 2J9BA 2MYSA 4U5GA 4JVSA 5BUOA 2R03A 5T3TA 4RD9A 3DJNB 1U6HA 1BR1A 2X0CA 1FNTc 4CS9A 5BQIA 1LKXA 4PJNA 1TFKB 4HE8D 4JE9A 3T6BA 5DS4A 1CPRA 4ZLDA 1WWPA 5D91A 5KYXB 3CEXA 2ZPAA 5T3WA 2J45A 3RFYA 3M15A 1TWCA 3UGPA 1LS4A 4B6IA 3AQBA 3FHDA 1H9TA 3NMIA 1VYKA 5JP7A 1OQCA 3QVYA 1HW1A 1ZHWA 2XL4A 4GEHA 1YDIA 2VCAA 4ANJA 2MWQA 2A6HF 2BC5A 4YL3A 2E87A 1QQ3A 1E2XA 3EGDB 3GEIA 3C18A 4PFOA 3EH1A 4H4KC 4JEBA 2EPOA 2NUTB 2Y3HA 4YL0A 5DQTA 4C3EA 1EQ1A 4YWQA 2LFDA 4U5HA 3LJBA 2BE5F 2YQYA 3Q6NA 4OINF 2YLGA 3C7JA 3CAXA 5F28E 2L7AA 5K0IA 1BBHA 3S29A 1FMWA 3O55A 5F5HA 5KYXA 4J30B 3HKKA 5JLIA 4XPXA 1VK5A 1Y6DA 3ASOC 2IXPA 3A11A 3RIPA 4MW8A 4EIYA 4CS8C 1A41A 1K40A 2G3VA 3L1MA 3GEHA 2EIMC 1A7DA 2LSEA 2OJED 2Y39A 1RMVA 2JX0A 4Z9JA 3WG7C 1QPUA 1L3PA 4LERA 4JRZA 2Y3DA 2GFHA 3EGDA 1LPEA 4YN0B 1WOLA 256BA 2ETSA 2WZLA 1HY5A 1N1CA 2P7VA 4N6HA 1XZPA 4RDAA 2NUTA 3R7CA 4CJGA 2WZFA 2XLHA 3ASNC 4KBLA 2XLOA 4EKWA 1OCRC 4CS7A 2RSEB 4JTCB 2HV6A 1YVIA 1Z3IX 3ZIBA 2R7UA 5TJ5E 4JJFA 3SZRA 3Q6MA 2GAQA 1DOWA 1J8MF 4E18A 1VMAA 1ZHZA 3ABKC 1Z23A 2PP4A 2BL2A 1VLTA 2EPKX 1NG1A 2FGYA 4EUKB 4A4AA 4FAPB 4BJTA 4KI2A 1T6IA 4R32A 1J8YF 1SMYF 2L6GA 1V4AA 3LS0A 4E7SA 3C62A 3K66A 3AQCA 1O5HA 2A6EF 2HS5A 4LACB 4L6RA 1TKNA 2R02A 4U5FE 3S27A 2CDQA 3DZAA 2L81A 4NCQA 4KC9A 3EGXB 3EJNA 4XLPF 3GANA 1MQVA 1JR8A 5B3IA 2A0BA 2P6VA 3U2MA 4JTAB
chains in the Genus database with same CATH topology
2NSGA 2QNLA 2F22A 4N6CA 2OQMA 2NSFA 5COMA 5COGA 1RXQA 5CIVA 2YQYA 3DKAA 2QE9A 3QTHA 3CEXA 5COFA 2RD9A 3DI5A 2HKVA 3GORA 2P1AA 2OU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NSG A;  2QNL A;  2F22 A;  4N6C A;  2OQM A;  2NSF A;  5COM A;  5COG A;  1RXQ A;  5CIV A;  2YQY A;  3DKA A;  2QE9 A;  3QTH A;  3CEX A;  5COF A;  2RD9 A;  3DI5 A;  2HKV A;  3GOR A;  2P1A A;  2OU6 A; 
#chains in the Genus database with same CATH topology
 4CIH A;  1EI7 A;  1V55 C;  2UUH A;  1JOG A;  3GWN A;  2VCC A;  5BQG A;  5A6A A;  2H7O A;  2CGE A;  3DMD A;  4O6M A;  1RKE B;  1ZYR F;  2QUP A;  2M64 A;  3JT1 A;  4JW1 A;  5DLJ A;  3LNR A;  1OCC C;  1RXQ A;  2L6H A;  3DAF A;  4BJ6 A;  4YT2 A;  3DKA A;  4DVY P;  2EIJ C;  2KNH A;  1SYQ A;  4NC3 A;  3PHF 2;  2A68 F;  1PD1 A;  4KNV A;  5B1A C;  2VC9 A;  4P9T A;  2YRF A;  3QTH A;  3NMK A;  3AG1 C;  4AL1 A;  4EBJ A;  2WVN A;  3EGX A;  3RQG A;  2OCC C;  3ZTM A;  3X2Q C;  1VOM A;  2P61 A;  5L0G A;  5L0J A;  1LI5 A;  1LVK A;  1BR2 A;  3KYI A;  4U5B E;  3LUT B;  3G4Z A;  2W4M A;  3OEO A;  3U0C A;  2OEX A;  4LDR A;  3TK0 A;  2R25 A;  2ASR A;  1ZW3 A;  2JD3 A;  3IQ5 A;  1RKE A;  2R7W A;  3QZC A;  2AVK A;  4LDQ A;  3EH2 A;  1JPJ A;  3TOL A;  1KTM A;  2R7S A;  3RW0 A;  3TQO A;  3ZTZ A;  5DS6 A;  2NSF A;  2OQM A;  4PFP A;  4PJL A;  1HW2 A;  1I4Y A;  1K05 A;  4W8P A;  4IAR A;  1LM3 B;  4Z9I A;  4CIP A;  1LIH A;  2I8B A;  1QKR A;  4BJ6 C;  5JS5 A;  3JZ0 A;  3FAP B;  1M2V B;  1Z63 A;  1TWH A;  4LLE A;  4BPM A;  5L3Q A;  5JUA A;  1PD0 A;  1RJ9 B;  1YA9 A;  3AOU A;  5F5F A;  4JIO A;  5JRA A;  2H7V C;  4UDV A;  4I44 A;  4MS2 A;  5CI9 A;  1MND A;  3NYM A;  3RF3 A;  5COF A;  3W8H A;  1O3U A;  1CGN A;  2PX3 A;  1NZE A;  1E84 A;  4XEK A;  2J9U A;  3NKE A;  2Q7R A;  3SP1 A;  2HKV A;  1ZVZ A;  5KYY B;  2R05 A;  3FVY A;  3L8I A;  1HMD A;  4O7G A;  4PJM A;  4U5D E;  3RKO F;  3PCV A;  2D5R B;  2HJ3 A;  1G4U S;  4X0R A;  3W8I A;  5KYN A;  1GS9 A;  1O87 A;  2XXA B;  5HSW A;  2L9J A;  1OXB A;  3EG9 B;  3FOP A;  1GQA A;  4HFK B;  1M2V A;  3LAY A;  3TD7 A;  3FDQ A;  4MTF A;  5L3V A;  3I5P A;  4ER9 A;  1RJ9 A;  3W4Y A;  3W2V A;  3CZ6 A;  4I1O B;  4OIR F;  2A1D D;  4AE4 B;  3VYW A;  3MYI A;  1OW7 A;  1HE9 A;  2I15 A;  3ATP A;  4EBK A;  4CSA C;  2DYS C;  4BJ1 A;  5KYY A;  3T4R A;  3VRC A;  3T6G B;  2LP4 A;  2J7P D;  2OG2 A;  4XQ1 A;  2YVK A;  1LI7 A;  3B0P A;  3U5S A;  3DJU B;  1IZM A;  5JSL A;  3AG2 C;  1B68 A;  2J9V A;  4C3D A;  3C8G B;  2YZS A;  3JYH A;  4JCZ A;  2J7P A;  4XWJ A;  1DOV A;  4DOZ A;  3SXZ A;  4CDA A;  3GEE A;  3LLK A;  4AX2 A;  1EA8 A;  2IYL D;  1YYJ A;  4I1M A;  3NYL A;  3SNH A;  1OCO C;  2XS8 A;  3SXY A;  4J32 B;  2Q9C A;  2KSF A;  2Y3B A;  4BG0 A;  4AE4 A;  1WGW A;  3TJ6 A;  1ST6 A;  2Q3T A;  2WB7 A;  3SXM A;  3JRT A;  1D0Z A;  1H9G A;  2IXO A;  3O10 A;  3ZVR A;  3ZSU A;  4MVQ A;  4U5E E;  5GPG B;  3RQE A;  2FAP B;  2HSB A;  3C8G D;  4MVZ A;  1RKC A;  3EFO B;  1R4T A;  4OD5 A;  1NFN A;  2O9X A;  2H7B A;  4WAB A;  1GGQ A;  4O6Y A;  1M6T A;  2PFD A;  3TOM A;  4AL0 A;  1C03 A;  3F47 A;  3ZQV A;  2V26 A;  5EHH A;  2QLA A;  2VAS A;  4M63 A;  2UUI A;  3GOR A;  3S0X A;  3V5Z A;  1E86 A;  3C8G A;  1ZU4 A;  4JTD B;  2ZXW C;  3NMJ A;  5L0I A;  4G7H F;  2R7O A;  2XLV A;  1A7V A;  1ORY A;  2QNL A;  3MX3 A;  2A69 F;  2ZXO A;  4N4W A;  4BJ5 A;  4QI0 A;  3O39 A;  2WL8 A;  2YKZ A;  1MMD A;  4LDK A;  4CBE A;  5COM A;  2W9Y A;  2WVQ A;  3K1H A;  1WAT A;  1CPQ A;  3EZH A;  1FFH A;  3UMK A;  2YL3 A;  4FES A;  3EFO A;  4MQ9 F;  2VB6 A;  2G62 A;  3J06 A;  2DYR C;  3MLG A;  2YHS A;  1C17 M;  2HFI A;  2IXN A;  2Q9B A;  3G50 A;  1V74 B;  4LLC A;  1G4W R;  2W45 A;  4G7Z F;  1T6Q A;  2C04 A;  3HLZ A;  4KNW A;  4IAO A;  2NUP B;  4E7Z A;  3US6 A;  3IQC A;  3MYF A;  2WVO A;  3FAJ A;  3KL4 A;  5DVW A;  2GWW A;  2J9W A;  1FMV A;  1MMA A;  1OR3 A;  2HZ8 A;  3OA1 A;  4A2N B;  3M4B A;  2AU5 A;  4RBN A;  2AWC A;  1H7I A;  1TR2 A;  5FCL A;  1EKY A;  5DS5 A;  1WAS A;  3ZG1 A;  4C3B A;  3JCU Q;  3POV A;  4JCH A;  3B29 A;  2H8A A;  1D1B A;  4WJ0 A;  1BDJ B;  3FOO A;  4OIO F;  4QI2 A;  2YL0 A;  1T01 A;  3RVY A;  4CS8 A;  5FZT A;  2Y69 C;  3U2L A;  1Q0K A;  4MVS A;  4YL1 A;  2HJM A;  3GM1 A;  1JRA A;  1JPN A;  4CDY A;  5A6J A;  3GOD A;  3X1O A;  5EK0 A;  1YAU O;  1TQG A;  4CJO A;  1IW7 F;  3Q7G A;  3B0U X;  1OKK D;  3G4X A;  4J7T A;  4NTF A;  1LE4 A;  5E3A A;  4K7B A;  4XTK A;  4DJ9 A;  3AGT A;  3K1I C;  2LK4 A;  4ULW A;  1GM5 A;  2MHR A;  2XLE A;  3IQT A;  2B0H A;  3QW0 A;  1D0Y A;  1ZU5 A;  1OKK A;  4D4X A;  3E70 C;  2OEV A;  3HJC A;  1CGM E;  2IXM A;  2GDC A;  3M79 A;  1Y4C A;  1S05 A;  1ZW2 A;  1YA7 O;  3RVZ A;  2DGJ A;  3KKB A;  3ECS A;  1YLM A;  3FXH A;  4XEV A;  2HMZ A;  4CS9 C;  3LLI A;  2Q4F A;  1JMW A;  4WGY A;  2DB4 A;  1Z5Z A;  3FMS A;  1E85 A;  3LNM B;  2KGO A;  3RYL A;  4K0D A;  4BEM J;  2ZXR A;  4XPY A;  2GA0 A;  2HMQ A;  2XLD A;  3HNJ A;  3H65 A;  2YEV A;  4IWB A;  1M2O A;  4MW3 A;  4CSA A;  3IPM O;  4YK5 A;  3BEH A;  3ZC4 A;  1WTY A;  3B9Q A;  1AUE A;  1PCX A;  3OWT A;  2R7V A;  4U9E A;  1PV3 A;  1D1C A;  3RH3 A;  1APC A;  2YL7 A;  4FWV A;  4QDL A;  1JAF A;  3T6J A;  1LS1 A;  3TJ5 A;  2TMV P;  3AGU A;  3N2Z B;  4C7O B;  1OR2 A;  3JSZ A;  3UR3 C;  3UMI A;  3CSK A;  2XRH A;  2R7R A;  1T5O A;  1C02 A;  1R5I D;  3AG3 C;  4NQF A;  4DRH B;  1A7E A;  1KNY A;  4G0H A;  3AJM A;  3JSE O;  3LS1 A;  4P9F A;  4DRJ B;  4DVZ A;  2PX0 A;  3DAG A;  4NTB A;  2D4U A;  2Q9A A;  1KU2 A;  4H54 A;  4IRU A;  4CX9 A;  5A6K A;  4I3M A;  3HNL A;  2KJG A;  2OKU A;  3NRH A;  4HEA J;  4Q7C A;  3A9C A;  1Q0G A;  2HSQ A;  4J7Y A;  2B0J A;  4EWC A;  1U0B B;  1YZA A;  3UMH A;  3DI5 A;  4DXW A;  1A0B A;  1WN0 A;  2CYD A;  3JYY A;  2XXA A;  2A0U A;  4C7O A;  4EBB A;  1OW8 A;  3NKD A;  3EG9 A;  5KYW B;  4O79 A;  1NBB A;  4EHP A;  3U8V A;  4F4B A;  2LQG A;  2P0N A;  2Q00 A;  4PK4 A;  1L7C A;  3DXJ F;  3N24 A;  1HMO A;  5COG A;  4NY3 A;  2J0W A;  3M4C A;  3O6X A;  3TUL A;  3B0V C;  3ABM C;  2NPU A;  3CQZ A;  3S84 A;  4DRI B;  5IY5 C;  1NU9 C;  3K33 A;  1QZX A;  2PF4 E;  3HNI A;  2XM4 A;  5E3C A;  3L0I A;  1G8X A;  1Q0F A;  1SZI A;  1FR0 A;  3UGO A;  4Z9H A;  1MMN A;  4PAC A;  5E33 A;  2R9R B;  4IGG A;  3C63 A;  3LES A;  1CGO A;  1I4Z A;  5KYW A;  3RQF A;  5KYU B;  1AEP A;  2NSG A;  2OJQ A;  3U3B A;  4ZLC A;  2YL1 A;  4JEA A;  5EGY A;  2J0X A;  3SYN A;  4N6C A;  1YYX A;  5D92 A;  2C03 A;  1XZQ A;  3LEO A;  3SEO A;  4Q4Z F;  3EHM A;  2CNW D;  4U9D A;  2FFH A;  5L0D A;  3U8P A;  4DBQ A;  2Y3G A;  2ZXP A;  3C8Z A;  1V54 C;  2HUJ A;  3DWW A;  1E83 A;  3I4U A;  2R7Q A;  1QSP A;  3KMI A;  1D0X A;  1G5Z A;  1MNE A;  4JZA A;  3PMR A;  4MTO A;  5T1D B;  3L8J A;  3DM5 A;  1NSG B;  1TWG A;  1XWJ A;  2XL6 A;  4GQH A;  4JC7 A;  4MVU A;  4PJJ A;  1RCP A;  2XLW A;  2CNW A;  5L0C A;  3IHU A;  3N0T A;  3HTK C;  4IJJ A;  2YLI A;  2M4E A;  3MFN A;  4OIP F;  3KPH A;  2LD6 A;  5E2Q A;  3K7D A;  5KYU A;  2AP3 A;  3ABL C;  3DE9 A;  4NTA A;  1SR2 A;  4W8K A;  3KYJ A;  1U89 A;  4XPW A;  2XLM A;  1ZHX A;  1OW6 A;  5B3S C;  3DM9 B;  2KK1 A;  2EIL C;  3KH2 A;  5AGF A;  2KYH A;  3JTL O;  4YT4 A;  3IQ6 A;  1MMG A;  3U3F A;  2J8W A;  4CDV A;  3HNK A;  5JT4 A;  5A69 A;  4MVO A;  5CIV A;  2PNO A;  4JUR I;  1OCZ C;  4XLN F;  1YJG A;  3V7O A;  5JVE A;  2XS1 A;  3EPV A;  1SF8 A;  1T9K A;  2LFF A;  4YT5 A;  3NYJ A;  3WHN A;  4JKV A;  1QLE C;  1TWA A;  5CI8 A;  1Q0D A;  3ZWI A;  4AK9 A;  2XM0 A;  3SXK A;  3GM3 A;  3LEV A;  3S28 A;  3I5Q A;  3QW1 A;  3EQL F;  4YT8 A;  2NUP A;  1ZZP A;  3JRM O;  1FAP B;  4MVR A;  2EPN A;  1NFO A;  1Z7Q c;  4Q5S F;  3IEE A;  3UNG C;  4XEF A;  4MVM A;  1W2W A;  5HV9 A;  1AVO B;  1M57 C;  2R7T A;  1ZHT A;  2QY9 A;  2YWA A;  1ORJ A;  4P6I C;  3WAQ A;  2X51 A;  3S9O A;  3U9M A;  1M56 C;  5DQZ A;  1VYI A;  2XSE A;  4E0I A;  1S7Z A;  2ICW G;  4YJW A;  4OIQ F;  5AC4 A;  3Q7L A;  4N06 A;  5A6B D;  4ONS A;  2EPL X;  2G3K A;  2QE9 A;  4IAQ A;  2IOQ A;  1F1M A;  1FTS A;  2CCY A;  4O6N A;  3L34 A;  3M1C B;  1OXK A;  3R2P A;  3H2U A;  1VLS A;  1QVX A;  3K6B A;  2KW3 C;  5A6B A;  2IM8 A;  2JPU A;  2LIG A;  3QMK A;  3EHN A;  1T6U A;  2L6F A;  3ZQY A;  5AC5 A;  1BR4 A;  3ITF A;  1YAR O;  4K1O A;  1K04 A;  5L0H A;  1ORS C;  2EIK C;  1UG7 A;  2VH3 A;  3V5Y A;  4JJG A;  3S90 A;  4U5C E;  3VM6 A;  2HV7 A;  2VCB A;  1TFO B;  4FX5 A;  4HFF B;  3NDB B;  2QTV A;  4D4N A;  2EIN C;  3MBG A;  2LCH A;  2XL8 A;  3NG1 A;  3QVZ A;  3V5X A;  2WZG A;  2KQ9 A;  2Z15 A;  4IB4 A;  3DD7 A;  1LE2 A;  3VF0 A;  3H2V A;  2V3C C;  2CW0 F;  4ULV A;  3F46 A;  2EPM X;  3AG4 C;  1BZ4 A;  4MND A;  4GYT A;  1NLX A;  4BEJ A;  2YLD A;  3PDM P;  4E17 A;  2R7X A;  2ZD9 A;  3B71 A;  3VAY A;  3T9O A;  4WGZ A;  1H6G A;  3GWL A;  2RD9 A;  5L0F A;  1UFB A;  1YZC A;  1Z6A A;  1ZHY A;  2KC3 A;  3GM2 A;  5B1B C;  3DE8 A;  3W2W A;  3ZDL A;  2IBF A;  2J46 A;  2PBE A;  3WOD F;  5BQH A;  1VTM P;  4OD4 A;  4PR9 A;  4G7O F;  1D1A A;  2P1A A;  2OU6 A;  3BRJ A;  4G78 A;  1Q0M A;  2AWY A;  1NU7 D;  2OOC A;  1FFT C;  2W4B A;  2DI3 A;  3EZI A;  1HE1 A;  4MTG A;  3U9J A;  1I5N A;  3K1I A;  4E0H A;  2F22 A;  4BJ5 C;  1VB5 A;  4DBR A;  2NG1 A;  3E9V A;  2J9B A;  2MYS A;  4U5G A;  4JVS A;  5BUO A;  2R03 A;  5T3T A;  4RD9 A;  3DJN B;  1U6H A;  1BR1 A;  2X0C A;  1FNT c;  4CS9 A;  5BQI A;  1LKX A;  4PJN A;  1TFK B;  4HE8 D;  4JE9 A;  3T6B A;  5DS4 A;  1CPR A;  4ZLD A;  1WWP A;  5D91 A;  5KYX B;  3CEX A;  2ZPA A;  5T3W A;  2J45 A;  3RFY A;  3M15 A;  1TWC A;  3UGP A;  1LS4 A;  4B6I A;  3AQB A;  3FHD A;  1H9T A;  3NMI A;  1VYK A;  5JP7 A;  1OQC A;  3QVY A;  1HW1 A;  1ZHW A;  2XL4 A;  4GEH A;  1YDI A;  2VCA A;  4ANJ A;  2MWQ A;  2A6H F;  2BC5 A;  4YL3 A;  2E87 A;  1QQ3 A;  1E2X A;  3EGD B;  3GEI A;  3C18 A;  4PFO A;  3EH1 A;  4H4K C;  4JEB A;  2EPO A;  2NUT B;  2Y3H A;  4YL0 A;  5DQT A;  4C3E A;  1EQ1 A;  4YWQ A;  2LFD A;  4U5H A;  3LJB A;  2BE5 F;  2YQY A;  3Q6N A;  4OIN F;  2YLG A;  3C7J A;  3CAX A;  5F28 E;  2L7A A;  5K0I A;  1BBH A;  3S29 A;  1FMW A;  3O55 A;  5F5H A;  5KYX A;  4J30 B;  3HKK A;  5JLI A;  4XPX A;  1VK5 A;  1Y6D A;  3ASO C;  2IXP A;  3A11 A;  3RIP A;  4MW8 A;  4EIY A;  4CS8 C;  1A41 A;  1K40 A;  2G3V A;  3L1M A;  3GEH A;  2EIM C;  1A7D A;  2LSE A;  2OJE D;  2Y39 A;  1RMV A;  2JX0 A;  4Z9J A;  3WG7 C;  1QPU A;  1L3P A;  4LER A;  4JRZ A;  2Y3D A;  2GFH A;  3EGD A;  1LPE A;  4YN0 B;  1WOL A;  256B A;  2ETS A;  2WZL A;  1HY5 A;  1N1C A;  2P7V A;  4N6H A;  1XZP A;  4RDA A;  2NUT A;  3R7C A;  4CJG A;  2WZF A;  2XLH A;  3ASN C;  4KBL A;  2XLO A;  4EKW A;  1OCR C;  4CS7 A;  2RSE B;  4JTC B;  2HV6 A;  1YVI A;  1Z3I X;  3ZIB A;  2R7U A;  5TJ5 E;  4JJF A;  3SZR A;  3Q6M A;  2GAQ A;  1DOW A;  1J8M F;  4E18 A;  1VMA A;  1ZHZ A;  3ABK C;  1Z23 A;  2PP4 A;  2BL2 A;  1VLT A;  2EPK X;  1NG1 A;  2FGY A;  4EUK B;  4A4A A;  4FAP B;  4BJT A;  4KI2 A;  1T6I A;  4R32 A;  1J8Y F;  1SMY F;  2L6G A;  1V4A A;  3LS0 A;  4E7S A;  3C62 A;  3K66 A;  3AQC A;  1O5H A;  2A6E F;  2HS5 A;  4LAC B;  4L6R A;  1TKN A;  2R02 A;  4U5F E;  3S27 A;  2CDQ A;  3DZA A;  2L81 A;  4NCQ A;  4KC9 A;  3EGX B;  3EJN A;  4XLP F;  3GAN A;  1MQV A;  1JR8 A;  5B3I A;  2A0B A;  2P6V A;  3U2M A;  4JTA B; 
#chains in the Genus database with same CATH homology
 2NSG A;  2QNL A;  2F22 A;  4N6C A;  2OQM A;  2NSF A;  5COM A;  5COG A;  1RXQ A;  5CIV A;  2YQY A;  3DKA A;  2QE9 A;  3QTH A;  3CEX A;  5COF A;  2RD9 A;  3DI5 A;  2HKV A;  3GOR A;  2P1A A;  2OU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...