3DKPA

Human dead-box rna-helicase ddx52, conserved domain i in complex with adp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
242
structure length
240
Chain Sequence
b'SMKINFLRNKHKIHVQGTDLPDPIATFQQLDQEYKINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKISEGTGFRIHMIHKAAVAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPPGIDLASVEWLVVDESDKLFEDGGFRDQLASIFLACTSHKVRRAMFSATFAYDVEQWCKLNLDNVISVSIGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase DDX52
molecule tags Hydrolase
source organism Homo sapiens
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
total genus 85
structure length 240
sequence length 242
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dkpA00
3CM0A 3EG5A 4D4MA 4DLTA 2QSZA 4OQFA 1Z06A 3KTAB 1FQKA 1Z08A 2DFKB 4GP7A 4AIIA 2DCUA 1EFTA 2N42A 3K0FA 3BWDD 2ZRKA 3NIBA 2A7QA 1P60A 2CHVA 4PC3A 2NPFA 2ODBA 2PEZA 4WAUA 1E3MA 4CVNA 1U98A 1A2KC 1VIYA 1AZTA 2XZLA 3GLFA 2Q9BA 5E7MA 1N6OA 1T5IA 4BLRA 1YR7A 2VSXA 4OJQA 4LV8B 2DFNA 4QHSA 1W5TA 1NVUQ 4KYUA 3QVUA 2ORWA 1D2MA 1II8B 5HZKA 1G4AE 1Q1ZA 2BOVA 1JBKA 3U3KA 1QHIA 4JJZA 1TL7C 2O0HA 4EPVA 1VDZA 4LJYA 3GP8A 2WWGA 1GP2A 1QF9A 1O3YA 3AF2A 3UMSA 1R5OA 5C1BA 2L0XA 4M0LA 1R0ZA 1R2QA 1UDWA 5KNDA 5CLLA 2HJGA 1XPUA 2YZ2A 3WY9A 4M22A 4L9WA 4M1KA 2JLQA 1VTKA 3AQ4A 3KJHA 3MWKA 4POAA 2ZRLA 1IN5A 1F2TA 3LXRA 4LK2A 3O47A 3MSXA 3I3SR 4W5HA 5DSZA 4WZBE 3I32A 4YDSA 1TQDA 1S96A 4S35A 4C0QC 3TQFA 3GLIB 1OW3B 3K70B 2AN9A 3QXHA 4B3CA 1L8QA 5CLQA 4ZO4A 4BLTA 4Z1MD 4U02A 2ZUDA 3LO5A 5G3ZA 3I5YA 2ZAMA 1MV5A 2FEMA 4Q4LA 1F2TB 1W0JA 1XJ0A 3TUZC 4KBGA 1NLZA 3EZ9A 5J40A 3SS8A 1NBMA 3LLMA 5JCZA 621PA 2WSMA 3ND8A 2AX4A 4KBFA 2GNOA 2ZU0C 1YR6A 3GFPA 3WNBA 1CP2A 5AWFC 3PITA 4G3XA 3C14C 4F7WA 4P4SA 5CIWA 3TNFA 2WWWA 3VR4A 3B8HA 4JLOA 3EX7C 2PLFA 1G8HA 4L4UA 1GOTA 2O8BB 1HY3A 1IXRC 4B74A 2FSFA 2OAP1 3HR7A 2DYKA 3LY5A 1Q1BA 2CJWB 3N5CA 3QG5A 4PC6A 2CEAA 3EA0A 4B3BA 1G7CA 4DDTA 1IY1A 1R6BX 1AK2A 1F48A 4DJTA 4ERNA 2Q3HA 2ZS8A 3VX4A 3P20A 4TT3A 1U81A 2IX3A 1OFUX 2V55B 2FGKA 1M8PA 2ZQ5A 3IO5A 3U6KA 4KSCA 5IHPA 4TMZA 2I1VB 1WE2A 2G83A 1GNPA 3LDAA 2OO7A 4CW7A 4LYHA 1R7RA 1VIAA 4PXAA 1LNZA 3GJXC 1JR6A 1J8MF 4LHZA 1AKEA 1Y3AA 3THXB 2FDCA 1ZUIA 1Z0IA 2QRZA 3OZXA 1G8FA 1RKBA 1Z47A 5C4MA 2HXYA 1LY1A 2GCPA 3IO3A 3WXMA 4UXIA 4QM6A 3MJRA 1HURA 3AGPA 4OJKA 3QEJA 2O8FA 3AGQA 1P7CA 4JLMA 2IYQA 5B57C 5AJYA 5IF9A 2ZVPX 3RWOA 4C2UA 1D9XA 3DO6A 1G3MA 1MO4A 4HLQB 3T12A 2EQBA 4LUCA 4PPNA 4QHTA 4DVGA 5IK2D 4OQXA 1G6OA 2XJ4A 1CU1A 1NKSA 1KDPA 5DI3B 2ZI5A 4HB2A 4V0NA 3TW4A 4YMWA 5KTYA 1SVWA 4TLDA 5SZHB 2R6AA 3A1VA 3EAQA 4Q9HA 2ORIA 2V4ZA 3QKUA 2JLRA 1NLFA 2YVUA 4C0JA 2IYSA 1KSGA 4JLBA 4Q7KA 4QJ3A 3HU1A 3LBNA 5J4YA 3RWMB 1F5NA 2ZJOA 4B2LA 3U61B 1QVAA 2QT1A 3SE0A 4WVFA 2RGNC 1QHNA 4PX9A 1S1MA 3QSYA 2A3RA 3CZPA 3RSLA 1YZQA 1QBKC 2FH5B 2NG1A 2VP2A 2GEVA 4Q7MB 3VHLB 2O8FB 4ZPXA 1P9WA 2FMXA 2OFOA 3R20A 4A2QA 4ZCIA 2BBSA 4LGMA 2EU8A 3KXLA 1JJ7A 4OHVA 3I4LA 121PA 2P0EA 5CB8A 1VMAA 2CL7X 1PJRA 2DBYA 1XMVA 4Q02A 2R62A 3F0TA 1Z6XA 3RNLA 5JBQA 1U9IA 2YJTD 4NPHA 5IT5A 4MGYR 3W5IA 3TIFA 1COWD 4IFBA 1KAGA 4RZ3A 4LV5B 5DNYB 3B82A 1N2CE 2WMNB 3SBDA 3CNNA 2C9YA 1ZM9A 1RZ3A 2H7VA 4DC9A 1CJUC 2G6BA 4YMSA 4LWZA 3U2QA 1T4GA 3EASA 3R8FA 4ZIRB 5EXSA 3DMNA 3TMKA 1XEXA 4GMDA 1TUEA 5CB6A 3DEFA 1E9FA 1Q22A 3K9LA 2A5FA 2JLWA 1JJVA 3CR8A 2F43B 2HXSA 2AXNA 4G0NA 3HWSA 5JHGB 2BCGY 2O8EA 4DSUA 1A82A 3QBVA 1I4TD 2NQ2C 2WTUA 3M6AA 3Q5EA 1G20E 2CE2X 4A1FA 4Q9LA 4DCUA 2R9VA 1E1QA 1K8RA 1F6BA 3AF4A 4ZV4A 2QBYB 3C16C 3IGFA 3GLGA 3GPLA 3NBXX 2IYZA 3A36A 4N0EA 4QXAA 3SDZA 2ZE6A 3AEZA 3IBGA 2J7PA 4C7OB 1E2EA 5FPSA 2WWIA 2IXGA 4MKFA 4ESHA 1Z22A 4QNRA 4DSNA 4JLPA 1ZCAA 5L3QA 4YMTA 5EE0A 3W6OA 1Q12A 2BBTA 2CHGA 3AP3A 3AUXA 5AK0A 1LFDB 4WZAE 4GP6A 3KB1A 4CT4B 2CCKA 2OT3B 1U9IC 4K8OA 1M1YE 2Q3FA 4RFSA 4RCYA 3AVVA 4XD7A 1Q3TA 2AK2A 2C5LA 1NMYA 2O8DB 5FOUA 1X3SA 2CVHA 4UNSA 2VP4A 2ZROA 4DDWA 8OHMA 1JPNA 1ZIPA 3C41J 3BC1A 2P6NA 2IW3A 1ZM7A 1Z6AA 1F60A 4B48A 1I4DD 3ZJYA 1TX4B 1W0KA 1Q1QA 2F3RA 3AKDA 1FNNA 4A0FA 3RYTC 1XJCA 4FWTA 4M9XA 5LB4A 3VHXA 4DLYA 2R6GA 1G291 5F98A 3IDQA 1E9BA 3ZH9B 5A5GA 3N2EA 4TN1A 1W5SA 2UZ3A 3GJ5A 3HJNA 4FD2A 1E9SA 1T0HB 4N1AA 1S9HA 4B6EA 3LVRE 3GLFB 4M1TA 1WF3A 1Q3HA 1N5LA 2W6JD 2ZUCA 4R71A 1OLOA 1UEIA 4A0GA 1ETUA 2H57A 2J45A 2D62A 3QNUA 1II8A 3W3ZB 2JA1A 1Z6YA 4W5WA 4B32A 2CL6X 1HEIA 2CLCX 2ZI3A 4LHXA 2QSYA 2XNDA 2QT0A 1MO6A 2B8TA 2ODWA 1VHTA 1X1RA 2FN4A 4M8NE 1BMFA 1UKYA 3CX8A 4P4UA 3K0EA 4KJZA 2EFEB 5BW8A 2B92A 3IIMA 4H9GA 4DZZA 5K8IA 4QBFA 2V3CC 1KK0A 2JEOA 4KI0A 2EWWA 1JAIA 1OXUA 4MRPA 1QZXA 3RAPR 1S0UA 3IPXA 3TBKA 4YMVA 4LOAA 2ZJAA 3DVLA 4NCJA 2GEDA 5TDHA 1A4RA 4ACBA 3ICQB 3THOA 1ZCBA 3L0PA 1A1VA 5B58C 1ZUNB 3NTUA 3TLXA 1S3GA 1XPOA 1EWRA 2ZJBA 1L7VC 1E1QD 3UIEA 2J0UB 4HEJA 4KU4A 4GNKA 5BYKA 3OAAA 5JEDA 1OH5A 4NMMA 2IUTA 5G40A 3OHMA 3T06B 3KXIA 2WPDA 4OQLA 4PAQA 2G9NA 3CR7A 1DADA 4F4IA 1E6CA 2F9LA 4KLZA 2BKEA 1II9A 1J70A 3H0KA 2CE7A 1XTQA 1CJVC 4RZXA 1IHUA 1X8JA 2VP0A 3QG1A 3EC1A 1G8YA 3QENA 1G5RA 3NG1A 5FTLA 1HTWA 5KO2A 4FMCB 3OIVA 4HAZA 1KDRA 3TR5A 4CEHA 3U3OA 3HU3A 1SXJD 1R0WA 5FUYA 2WAYA 2YOHA 3OIWA 2JLXA 3W34A 4DDUA 3PUXA 3T1OA 1PVOA 2O8BA 1AS0A 1G7TA 1UBFA 4Q7LA 3A1UA 3Q8XB 4TTQA 3T1QA 2W6IA 3T35A 3RANA 3NKVA 1XZQA 1GVNB 2RGCA 2N46A 5JI2E 1YZNA 4Q48A 1TU3A 1CULC 3BBPA 1MRNA 2KBFA 1N3BA 1VG0B 2ZRMA 3IILA 2V9PA 4URWR 1J90A 4MYHA 2O52A 5L8VA 2ZU6A 3TW8B 1R10A 5EP1A 1CXZA 2D7CA 4QKQA 1KMQA 3UMRA 3AVQA 2B7CA 1CRQA 1OKKD 3LWNA 1TADA 1GL6A 1CRPA 4JKIA 1AA9A 2VTKA 3DMDA 5J5CA 3FKSD 3QKTA 3CF6R 1Z6TA 2A78A 4D6PA 2OFWA 1DAIA 1E69A 3OIUA 1OE0A 2WOJA 3M4YA 4E22A 3NC1C 4C2TA 1KI1A 3KKOA 2Q6TA 4Q19A 4UQOA 1L2TA 4A8JB 2FA9A 4TQUS 1Z0JA 4ZDWA 4GRAA 4QL3A 4XVRA 5D3MB 2ZM5A 3UPUA 4DB2A 3CH5A 1T8TA 4FIDA 1TNDA 2C77A 3EWAA 3IBYA 3VU9A 1Q20A 5AUPB 4GT1A 4BECA 4AYTA 4BZQA 2LKDA 1UKVY 1ZMXA 1N25A 1Z07A 3RLFA 1XD9A 3WMEA 3KJIA 1U2RA 1G21E 3EA5A 2XB2A 2CHQA 3KL4A 3NHBA 1GUAA 4B35A 1BH2A 5L3VA 5LDDC 1ZU4A 1AM4D 1IONA 1T8UA 5FUVA 2CNWA 4IEEA 4KYIB 4F93B 2C8VA 2IC5A 1E98A 4MYTA 4M4SA 2OBNA 2VPPA 3BK7A 1W36B 1N0UA 4F92B 1E99A 2WM9B 3VKHA 2WIBA 3HYTA 2J0SA 3LH5A 2QP3A 2WJHA 2RH5A 4HZUA 4ZCLA 2QM8A 1W7AA 2ZAOA 1E2NA 3QF4A 4M1MA 3L0OA 4TLEA 1SVMA 1MKYA 3ZQ6A 4HYYA 2ZRFA 2X2EA 5DO9A 4US1R 1CR4A 1S1CA 2A30A 1KI6B 4B34A 4QNMA 1KKLA 1S8FA 4Z1MA 3CRRA 4I1OA 2EYUA 1XCPA 3ONWA 5KSZA 4ZDIA 3ZVRA 4URXR 3THYB 2Z0MA 1JEEA 1T0JB 2RGDA 4Q1FA 1VPLA 2CK3A 1E32A 5FOXA 4GOJA 4LHYA 5FR2A 1Z83A 5E7IA 1KI6A 1W46A 3FHCB 4JBXA 2FV8A 5GJWC 2ATVA 4L9SA 3U4QB 4A15A 2O8EB 1KAOA 2ATXA 1FMJA 2AXPA 2QY9A 2P3SA 1UFQA 3MD0A 3GD7A 2HCJB 3EIQA 4BFTA 3KQUA 4M9QA 1KMHB 2ECKA 1DS6A 3Q7PA 3UWOA 1KK2A 1T91A 2OEPA 3QPUA 4HAWA 2WMOB 3DPUA 2ORVA 4A2WA 2QN6A 4DBLC 1TF5A 2WVJA 3LFUA 4NDZA 1ZW6A 4TMTA 1DAHA 4BRUA 4HAUA 2UKDA 4DRZA 4D80A 3BD9A 4HDQB 4FMDF 2JLSA 3NVAA 3OFND 2J7PD 4Q9KA 4DSTA 1XMJA 1YR8A 2D3WA 1E9CA 4TTRA 1SXJB 4MYCA 2KBEA 2AR7A 1OH8A 4HZIA 5EUMA 1XXHA 3I73A 3CRQA 2BMFA 3EPLA 1CJMA 1HYQA 3LQRA 1CKEA 2ANCA 3QOFA 1G41A 3B60A 4CIDA 1XPRA 3TUIC 4RD4A 4D0GA 5J4HA 1TEXA 1XEWY 4IXMA 4BRWA 2WOOA 2R8RA 2FFBA 2ZRAA 1J99A 4GMXA 4HUQB 4BZPA 4AY2A 3LNCA 1T5LA 1QRAA 5B2ZA 1EGAA 5KDLA 4KCGA 2A5DA 2E9SA 1ZD9A 3AB3A 4OI1A 3LW7A 4GDFA 2J1LA 3SZRA 2QBYA 4DEYA 2BIFA 3GJ6A 4BLQA 3SHFA 1EFCA 1R4AA 1OYYA 1ODFA 2QTFA 4B2PA 1EX6A 3PXGA 2PT5A 1WP9A 1XB2A 2O0JA 4CYMA 3ZQJA 4DB4A 3AVOA 1KMHA 1BKDR 2FFHA 1OH6A 4LC1A 1VCIA 1KDTA 2GDJA 1JQLB 1UPTA 2YV5A 3PEUA 2WWYA 1IQPA 1DOAA 2QNRA 5TV2A 3LXXA 3K0SA 4PQRA 3P32A 4DUGA 2JIZD 2JLZA 1SQ5A 3ASYA 2QAJA 1DPFA 5F9FA 1NMXA 2VHQA 1XZPA 4RFSB 4OQNA 5DN6A 4TZ6A 4CRWB 1VYTA 4CDGA 2J0QA 3KQKA 1YKSA 4JLDA 4TZ0A 1NG9A 1FTSA 1Q57A 1RRPA 1O87A 4JVMA 3PV0A 3DDCA 2FJUA 4X8MA 1NY5A 2DWQA 3A58B 4QGAA 3DOEA 1IN6A 4XTRA 2NO7A 2REOA 3E70C 1XJQA 4WXRA 1KSFX 4CEIB 1PUJA 5ELXA 3LBHA 4TMKA 1S3SA 3KKQA 4ITRC 4JZKA 3OEHD 1TTTA 3TQCA 1P4SA 4IRUB 1U0JA 1F2UA 3M0EA 3BH0A 1OXVA 1OF1A 4LYAA 2V6JA 3AVXA 1AS3A 2K5UA 2HUPA 1KI8A 3ZIAA 5JWRA 1LS6A 2MSCB 3KDSE 3MGCA 4C9BA 3KXKA 4AC9A 3K9NA 4HATA 4BZXA 3UG7A 3SEAA 1QHHB 2ZE8A 3THWB 1AN0A 1W4CA 2N1BA 4KVAA 3TKLA 3AUYA 2SHKA 4JLVA 2IS2A 5B30A 2BKUA 5L3QB 1EFUA 2Z83A 2WJJA 1N6RA 2ZIAA 4QRHA 3PEYA 3QVVA 1IY0A 2VHCA 2QMUA 3RS0A 4EPYA 3ICEA 2OCPA 5EZ6B 2XJ9A 4MUAA 4QGFA 1XU4A 1BIFA 2WJIA 3C4JA 3SFVA 5JS7A 1Z63A 1KO4A 2PX0A 5HTKA 5BYJA 3Q3JB 3ZVMA 4AKGA 1PUIA 5AR1A 4JIMA 1WCV1 4NYJR 3ETLA 1XMIA 1PLLA 3CPEA 2ZR9A 4A2PA 4B6FA 4RVCA 2RGAA 2QROA 3PUWA 4G5OA 1I2MA 2B8WA 5DHAA 2J7KA 4B47A 1Q1EA 1FNMA 2D06A 2V7QD 5JEEA 3G0HA 1N0VC 3HP1A 4NU0A 1KK3A 2HF8A 1CF4A 1KIMA 4IVRA 4FCTA 4MKIA 2J0UA 2V6IA 3PENA 2HDNB 3BFKA 3MJHA 3CUEF 3T1VA 2EFDB 4IOJA 4DLVA 1X86B 3OEED 1Z0FA 221PA 1M7HA 2JGNA 1CEEA 1E0JA 2IXEA 4ZCMA 2YWGA 2F1JA 5KYKA 2W00A 2HCBA 3MWYW 1EG7A 4MRVA 4OK6A 5SZKB 2OXRA 1U0LA 1NN1A 1SXJC 4B71A 1GL7A 2JASA 4NCIA 5CJPA 3LV8A 4A8JA 3GLGE 2FU5C 4FXPA 4U5XA 1KO8A 2IT1A 1Z2AA 2CL0X 1ZYUA 1YE8A 2QL6A 1UBCA 2XOKA 2XZOA 2YNMA 4L5BA 2ONJA 3GEIA 4DIDA 3PIRA 2ZXUA 4UJ5A 4V0KA 1G1MA 3D6TB 3LW8A 2Q9CA 1XD2A 4NYJQ 4B73A 2ZREA 3P27A 3TSOA 1B23P 2Z43A 2GXUA 4AURA 5KUTA 1L4YA 1IXZA 4HLDA 4XTCS 2ANBA 1W4RA 3EC2A 3GLIE 1Z2CA 3FOZA 2D7DA 4XVUA 2OCBA 3X1DA 2ZS9A 4BFYA 1M74A 2RB4A 2WJGA 4Q4HB 2VP6A 5CDFA 4R7ZA 3R9IA 1SKQA 3W6NA 3FMIA 5K8LA 1DAKA 4DCNA 1S9DA 1YZLA 3ZDQA 4RFVA 3AF0A 1NY6A 1EXMA 1KK1A 2BCJQ 4KFRA 1OHHA 1H8HA 3KZ1E 4TYNA 4ARZA 3IIJA 4TMVA 5HCNA 4TLBA 2VP5A 1W4BA 1NI3A 2NOAA 1NIJA 4Q4HA 2VL7A 1NN0A 1NLYA 2JDID 2YHSA 4HB0A 2C95A 1KI4A 4G5RA 2OUKA 5FPYA 3TAHA 3A1TA 4LX0A 1YVDA 1Z28A 5HCIA 1YQTA 1FPMA 4IW3B 1OT3A 3ZD7A 2GK7A 1QVRA 2BM1A 2IYYA 4IVPA 5HE9A 1OB5A 4EDHA 1RPZA 5FOWA 4NCHA 3O8BA 2QMEA 3W9YA 3KQHA 2GTPA 1YZTA 3LX8A 4PO9A 4M1OA 1ZC3A 4URYR 3TR0A 1KNXA 3CLVA 3RRZA 3ZLJA 1BOFA 2FPLA 3BGWA 1SGWA 3BIFA 3ZVNA 3U60B 1US8B 5J47A 2GCOB 1OIXA 2QQ0A 2WWXA 5JHHB 5KSOA 2VEDA 2XZPA 4DLXA 4U00A 1U8AA 4R98A 4D0LB 5E4FA 2G1KA 3CB4A 1JR3D 4US0R 2ZRDA 3AP1A 3DZ8A 2G0TA 3AP2A 1F3OA 1TQ4A 2GKSA 3B2EA 2NZ8A 5EP3A 3SR0A 4NCNA 4EAQA 1FW6A 5DI9A 3GJ8A 2PZFA 3ND9A 3HU2A 3SJCA 2P6UA 4HAXA 4P4TA 4Q9JA 3I62A 3KKNA 3B9QA 2AWOA 1GKUB 1ZM4A 1VKJA 2ZYUX 4BQSA 2QAGA 3VR6A 3U5ZB 1DELA 5KOYA 2C03A 4OQMA 2DB3A 4PTLA 3KKMA 4NONA 2AFHE 3PJRA 3PUZA 3QPVA 1EESA 4MQBA 1YR9A 4ILEA 3ZS8A 4C0AC 3CBQA 4PHTA 2B21A 3CF2A 3U7EB 2IA5A 2RGXA 2H8KA 2XB4A 2VBCA 2OILA 2PMKA 2DHRA 1UM8A 2PCJA 1RRCA 1ZUHA 4MRRA 2I4IA 1E9RA 1U94A 1E2FA 4CT5A 1UF9A 3LA6A 3TK1A 3F5FA 1JPJA 4HUQA 5E7JA 1CIPA 2NZJA 1SXJE 1GNQA 2C04A 3RS5A 1NNEA 3U7FB 3HYRA 2R44A 5G3YA 1XEWX 1ZINA 4Q47A 2HF9A 1E2GA 1KOFA 1AIPA 4ASUD 3OE7D 2HEIA 1N0WA 2ZI7A 2ZRCA 1QG2A 3VKWA 4NYIR 2XNDD 3FDIA 4K81B 5EXXA 1GFIA 4AD8A 3Q9LA 4EJSB 2AD5A 2ZRNA 1W2GA 1UJ2A 4D4JA 2BDTA 2LWIA 5AJZA 2ZYTX 1KGDA 4LYJA 4M53A 3X1XA 1ESNA 2PZEA 1NJGA 1JR3E 2VHTA 2GJ8A 4PO1A 2WPDD 3U3JA 1UADA 2WICA 4PPFA 2QG6A 2CXXA 5H70A 2GXSA 4PZLA 2IBMA 3RC3A 1QHYA 1MOZA 3JZMA 4N3NA 3SNHA 4X8OA 3EXAA 1U90A 5CITA 1PZNA 1QHGA 3UWKA 3FKSA 2IS4A 2EW1A 1ZRHA 1P2VA 5EE5B 2AKYA 1SHKA 2GJ9A 4CEHB 1Z3IX 1XRJA 3RDPA 2JJ1D 3RSOA 5HPYB 4RD0A 1GKYA 5P21A 4DDVA 3U6BA 2ZPTX 4BLPA 1A2BA 4JVNA 5KHOC 1UEJA 5JRZA 5J4KA 3NXSA 1E4VA 2BJVA 2HT6A 2X2FA 5SZJA 3RRMA 3PUYA 1LV7A 3WMGA 5G41A 3TH5A 1JECA 2VSFA 5FPTA 2XX3A 5A0FA 2R6CA 1IY2A 3K09C 2DFTA 4TSFA 2V1XA 1XTSA 2YC2C 1H65A 2FSIA 4D4KA 3AKEA 1ZJ6A 1Q0UA 2VH5R 3PG5A 4Q7JB 5A4JA 1JR3A 4HB3A 5EZ5A 5TB5A 4JSTA 4IFEA 4BFXA 1ZU5A 3TE6A 4KVGA 5FOTA 3EZ6A 1EFRD 3MUFA 2E87A 1C9KA 3MWJA 2PL3A 1W2HA 4W5JA 4CEJA 3K0CC 4GZMA 2DWPA 4MRSA 2YKGA 1OKKA 1YU9A 3TJZA 2HLDD 4AI6A 3RS3A 2ZANA 3VAAA 2C9CA 3WHLA 4ZDJA 2WSSD 4UNNA 3WNCA 3B13B 3PUVA 3BB4A 4DLRA 3C5HA 1TUIA 3EIHA 1XXHE 4AYWA 4EJSA 4YQFA 2XSZA 2QP4A 1NG1A 5GJCA 2C96A 1DAEA 1E2QA 1P6XA 3UK6A 3THYA 1D2EA 1XMSA 4NYMR 4M2LA 1ZD1A 5GJBA 2FZLA 2MMCA 4YMUA 4XSHA 3FHTA 3CRW1 1M7BA 2VP9A 1KTVA 4NZYA 2IUSA 5AJXA 4BFUA 1UBGA 4JS0A 4DT1A 2PX3A 4PPQA 2IYUA 1E2MA 2KWIA 2XXAA 1NVWQ 3CWZA 1AS2A 4QOSA 2P67A 2CK3D 1N6HA 3GLFE 1DARA 2OE2A 5DN6D 1GNRA 3VMFA 3SJAA 2HYIC 4EFNA 1WBBA 4GL2A 2ZJ5A 3A4MA 1ZAKA 3GLHE 3IKJA 3OESA 4HDCA 1J7KA 1GILA 5JI3E 1GDDA 3REGA 4JT4A 4DCTA 1J2JA 721PA 2H17A 1RYFA 1E2IA 3RC8A 4B44A 2QU8A 3WBJA 4IVQA 4EPWA 4EJSC 2F7SA 3WYGA 3FFAA 4L8GA 4QC2A 2BMJA 4LRWA 4EQ6A 4EPRA 1JNYA 5KDOA 3AVYA 2NTYC 1NKTA 2CCGA 4ZKEA 4ZIRA 1ZM2A 2FOLA 3VTKA 3QF7A 2EVWX 4PSAA 3LRPA 2PH1A 2J9RA 5JSZA 4FMBB 4W9MC 4O25A 3KB2A 2QPOA 2YOFA 1NVVQ 2ZRPA 2FFAA 1E0KA 1JALA 3F8TA 4TQAA 4Q1BA 1WMSA 1VCOA 3NHAA 4N0DA 4CEIA 3REFA 5G53C 2ZSBA 1H8ED 4MYUA 2QA5A 5FL7A 1U8ZA 1UBEA 1D8TA 1OYWA 4OKSA 2G0NA 2OV2A 4LCBA 1SVKA 2AD1A 2ZYVX 1XWIA 4IDQA 4WIAA 5DGXA 5TMPA 3OF5A 3P26A 1R0XA 1G3IA 1K6MA 1NBME 3C5CA 4OI4A 4P0TA 3DKPA 4DLWA 1IBRA 3A37A 3BOSA 2QI9C 2G3YA 3ECCA 1OFTA 3HPQA 3U7HB 2GZHA 1FP6A 4ARZB 4FW9A 4QHYA 4QG7A 1QHHA 4TQ9A 4RD1A 5LD2C 2ZR0A 5FOSA 2OBLA 1B0UA 1BS1A 3H84A 1ELOA 3JVVA 4MDFA 4EPXA 2JCSA 2ZRBA 3VQTA 3EPJA 1JAHA 2ZRJA 3KQNA 1G18A 1W0KD 3TSZA 2CMKA 3AV0B 1Z0KA 2JDIA 2GESA 1KHTA 4QJ5A 2X77A 2ZI4A 1IM2A 1NJFA 4P31A 4U7DA 4QBGB 3QXXA 4NL4H 1DG3A 4BGDA 1G3UA 2YYZA 2ZE7A 3M1IA 4RKFA 1LB1B 1E2PA 1NVVR 4V03A 2QM7A 3N70A 3K8YA 2BEKA 4OK5A 1KY2A 1CS4C 4NHOA 3A8TA 3B1YA 4Q4AB 2VO1A 3L2OB 1X6VA 4BASA 3VNVA 2PMDA 1P73A 5FI0B 1GRNA 3UXMA 3TGPA 2QTHA 3HPRA 3BAFA 3QQ5A 2P5SA 3V9PA 3VX3A 2XAUA 1R5NA 3IEUA 2DR3A 1XNJA 4FCVA 4GOKA 1JI0A 5FL3A 3L0IB 3FHOA 1FTNA 2RGNA 2OESA 3IUYA 3W90A 1AJEA 3O8CA 1TF2A 4GOXA 2QP9X 6Q21A 3WNDA 4G5SA 4Y0AA 4ZI2A 5CYOA 1ZNZA 2ZS7A 3QJYA 1C1YA 1DVRA 2FSGA 4NE2A 4Q1DA 4S2EA 4JL8A 5EP4A 4BFWA 4CZ2A 2KI5A 2EWVA 1EK0A 3ASZA 4JBWA 3WRYC 5DLQC 3GFTA 2FSHA 1S2MA 3C8UA 2ZE5A 4UNRA 2QMOA 1GRQA 1ZVQA 1P61B 2NO9A 1VECA 5AUNB 4Q03A 3KQLA 3SYNA 1RJ9A 2W58A 2ODNA 3K9HA 3AVTA 4X8LA 1IN7A 4A9AA 5JJKA 3QPWA 2VRWA 1CR0A 3OFNA 2RGEA 4BE7B 1G3QA 4XVQA 1TF7A 1A5TA 2P2LA 3BH7A 4YXWA 1XD8A 1E96A 4DLSA 2C99A 4ESVA 4B75A 1D2NA 4ACAA 2BC9A 4CF7A 1CTQA 1M2OB 1NBMD 2AK3A 2REXB 1P72A 3IHLA 3QE0A 2YC4C 5IDVA 1M34E 1M7GA 4C30A 1S4QA 4B76A 1EWQA 5CM9C 3EIEA 3K0CA 4B3DA 1E1RA 2F1RA 5JFGA 2IYTA 2WKQA 2QENA 3O8DA 4II7A 3K0FB 2ZUBA 5HKKA 4B33A 5TVKA 5F2EA 5EE9A 1AGPA 1HE1C 4D0NA 5KNCA 5KU1A 4AYXA 1DE0A 1XTKA 1IJEA 4DLUA 4IOLA 1P2TA 1G16A 1QHXA 5C18A 1TQ2A 3FE2A 5DYGA 3R9WA 2CLSA 1ZIOA 2JATA 2JLVA 3QUSA 2DY1A 3B6EA 3GEHA 4LZZA 2WJVA 5BN3A 2VHUA 4IOMA 3DKVA 4TT3D 5F9HA 1ZM3A 4M1YA 5IK2A 3SC3A 4I1SA 1YZGA 2HYDA 2IF0A 2TMKA 4P4SB 4Q21A 1II0A 2GXAA 1TQ6A 1UKZA 2GVZC 2W2TA 3N2IA 1P9NA 4AK9A 3QEOA 1XX6A 1A7JA 2J5XA 4TMXA 4A36A 1BO6A 4LJ5A 4IDOA 4LBWA 2WIAA 1XP8A 3EARA 3R8CA 4JLJA 2IF2A 4LBVA 4LYFA 2Q21A 1OJLA 3UKDA 4Q4JA 4IDNA 1DAGA 2P65A 1SKYB 3F3YA 2JLUA 1NL3A 3QKSA 3DOFA 5BQ5A 3I92A 1HQYE 2J3EA 4BEJA 3NBYC 3A1SA 2AWNA 3H1TA 3QKRA 4HLCA 4RZ2A 2WJYA 2RHDA 3O8RA 1OV4A 1W0JD 5AUQA 2ERYA 2ZETA 4TSFD 2PT7A 3EW9A 5CK5A 3AVWA 2Z6VA 4PC7A 1YRAA 3ZS9A 2OM2A 3AF1A 2PCLA 2ZSEA 1NSFA 5JMTA 2QAGB 4XD7D 1E94E 5CDFE 4FINA 3DM9B 4DCVA 3W3AA 3KKPA 4QBIA 5FFMA 1YJ5A 5AJWA 1MO3A 1VHLA 2J87A 1NP6A 4LJ4A 1KZGB 3V4RA 1COWA 1WDTA 2F1HA 1XCMA 3B5JA 3B9PA 4PSKA 3CRMA 5TARA 4XWOA 4AWXA 4JVSB 4YDHB 2EFCB 5FOVA 3WBKA 3PQCA 3U44B 2F3TA 2YWFA 4K46A 2WV9A 5D3MA 2GF9A 4QGGA 4HUTA 3P4XA 1NSTA 2CVFA 3RRNA 1E2DA 4IDPA 1OFIA 4PAMA 3RHFA 3ZVLA 2RHMA 4DXAA 3E5HA 2H18A 4DIEA 1N5KA 2GCOA 1E2LA 4A0RA 1WBDA 1KNQA 3QXJA 3P1JA 3KX2A 4X8HA 3QBTA 3JVUA 3NBZC 3NH6A 5H68A 5KPJA 4HLUC 2JJ2D 3FMPB 1E4YA 1KJYA 4KHZA 2QQEA 1GITA 3TSWA 3KTAA 1D5CA 2GAAA 1ZC4A 4XIGS 2XOKD 1FQJA 1LF5A 2F9MA 3FYHA 4QGHA 1Z0AA 521PA 3ZD6A 4AG5A 4ASUA 4BFZA 4HSEA 1SVOA 3OE7A 3RABA 2H5EA 2IK8A 4HDOB 4E07A 1KZ7B 4FMCF 4OI2A 4Z8XA 4J0QA 4O2RA 1XDBA 1IAQA 1W49A 2GBLA 2AHOA 2BMEA 3Q7QA 4G01B 2G88A 2OFXA 3THWA 3RRYA 2IWHA 4Q1EA 4LV6A 4A82A 2NO0A 3U3RA 2GXQA 4URZR 1T6NA 1LVGA 2ZYWX 3U4QA 1ANKA 1OXSC 4JBYA 4PPGA 1QG4A 4TL9A 4NBSA 2OLJA 3QXCA 1X8KA 5L3SB 3BRWD 2BJWA 2ZRHA 3P4YA 1E2KA 1KY3A 4C3ZA 5K8TA 2J46A 1OSNA 5JRJA 1N6PA 1OHHD 1ESMA 2FPMA 3Q72A 4A6XA 3SQWA 2DFLA 1TPZA 5EJEA 5E3HA 2GJAA 2I1QA 4KFUA 4UXHA 2GHIA 2IEZA 1GRRA 2F6RA 3X1WA 4TYYA 1AQUA 2LKCA 2BM0A 4JL6A 1VYVA 1Z8FA 1E79A 4HLUA 4GPTA 2NMVA 2C98A 1SKYE 4TMWA 2IYXA 1YHNA 4PC2A 5FTJA 3GLGB 5EP2A 1RRGA 4DWJA 1FMLA 2GBLC 3TRFA 3MCAA 5GVSA 4Q1CA 3SBEA 4EQ6B 4MKGA 2OBMA 2ONKA 2ODEA 1U0HC 5EE1A 2F43A 1GIAA 4IDHA 1UAAA 4LBZA 1CLUA 1KI2A 2PBRA 1CR2A 3FPAA 5KDDA 3OIYA 4OHZA 4I1UA 4C0LA 3GEEA 3WHKA 1LTQA 1FP7A 3WYFA 4MGKR 5DHFA 1RIFA 3VR3A 1G5PA 4WZ6A 3IPYA 2QE7D 4DHEA 4TLCA 3R7WA 4B3GA 4JLKA 2P5TB 5DYIA 5EUQB 3VR2A 2IUUA 1E2JA 4Q1AA 821PA 1CJKC 1KO1A 3X1ZA 3WRXC 4AKEA 1GAJA 3FVQA 3L8ZA 4I1VA 3K70D 3D3QA 3FWYA 2V1UA 4GFDA 4TLAA 4C4PA 2OHFA 1VCMA 2BMDA 5H8WA 2GVDC 2GF0A 1Z29A 2LCFA 1E79D 2NO6A 5FUXA 3BFVA 1MO5A 3V00A 5JJLA 5JWOA 1N6LA 1PV4A 2Q0HA 3KJGA 3FKQA 2A5GA 4R2HA 4AKIA 3BH6A 2AKAB 2FGJA 2ASEA 3X1YA 4O3MA 2H1LA 3J81k 2QPAA 2MSEB 2IYVA 4B3XA 4RD6A 4BLSA 4EUNA 4MITA 1KYIA 5DH9A 1XCGB 3BJIC 4LJ9A 4V02A 2VHJA 4LPKA 2J59A 2QMHA 1HH4A 3T5DA 1IN4A 1PLJA 4M1WA 3NDBB 1IJFA 1SZPA 2VSOA 2CNWD 2Z5FA 4RCZA 3LAWA 1ZNWA 4YC7A 4KITB 3DM5A 1WA5A 4M21A 3L8YA 3NBFA 4MA4A 4IOKA 3ZYCA 2GAOA 4LI0A 1RC8A 1XTIA 2MMGA 2ZJYA 3LLUA 4QFMA 4WA7A 5GADl 5FI1B 2FWRA 4BFSA 1L4UA 2VIIA 4NH0A 4TL7A 3PEVA 5SZIA 4RKEA 2JJ1A 3K53A 1Q21A 1DAMA 3V4FA 3FMFA 1FL9A 3AKCA 1HT1E 2RGBA 1VCNA 3K09A 4KODA 5JS8A 1E0SA 1SVIA 4UJ3A 1WQ1R 4D26A 3GJ3A 4IJMA 3C7KA 3B78A 2OLKA 1W36C 2WZQA 4F4CA 3IIKA 4HAVA 3K1JA 2XNSA 2OAQ1 4FMDB 2J41A 3CPJB 4JLNA 3NEYA 1IN8A 1R8SA 1XF9A 5FL7D 4F4JA 4FI3C 2PEYA 3GMTA 4ZKDA 4OHYA 3B1WA 3LD9A 3FFBA 2H92A 4PZYA 2RGGA 5FTKA 2WAXA 1W48A 3B7GA 1MABB 1XEFA 4MH0R 1C4OA 5FBWB 3WP1B 4KO8A 3IQWA 1R5BA 1MR3F 3PFIA 3I72A 4MGZR 4RD2A 4D25A 2IS1A 1CJTC 2F1IA 2VF7A 1G8GA 3ADKA 3G5UA 1LF0A 4Q18A 1YRBA 4KAXA 2X19A 3TAUA 1OXXK 1CR1A 1SULA 4B3FX 4PAOA 4LJAA 1WRBA 5EQTA 1Q44A 3NEJA 4B2IA 2GILA 2XTNA 5JSZB 3D7MA 2WBLC 3SJZA 1GG2A 3GJ4A 3RS4A 4DKXA 5J4VA 1NF3A 1MABA 1VYUA 3VR1A 4Q00A 1N5JA 1JXMA 4Z54A 2GJSA 3CNLA 1P75A 2QTVB 4RD3A 1MRSA 3EPHA 5GVRA 2E1RA 5FTNA 2WWHA 3DZDA 4WW0A 1D6JA 4E5UA 1RFLA 2C9OA 1I2DA 4IXNA 3I8SA 3OAAD 5JECA 3QKRB 2RKOA 2JJ8A 1KDOA 2CBZA 1ZNXA 2D4HA 2C78A 3CZQA 4TL6A 1HA3A 2X8AA 4A92A 1E9AA 3AM1A 5EXPA 1VG9B 1KI7A 4PQFA 1N6NA 4PHFA 4Z8YA 2XSZD 1BYUA 4YLGA 5JJIA 1YZUA 2IYRA 2UVQA 4EFMA 4YXWD 1KSJA 2QZ4A 3BXZA 4HI0E 2BWJA 2GZDA 4UNPA 4BEBA 1VG1A 4L16A 2HJVA 4RY2A 5AJVB 5EE3A 4Q5IA 4KLNA 4LJ7A 5L3RA 1TMKA 4E09A 4KFSA 5H1YA 3QIAA 4GBMA 4A8JC 2ZI9A 4HAYA 3UMFA 4LHWA 3MAAC 5KSPA 1ZNYA 3BORA 3W8RA 3ZIAD 1RRFA 1W4AA 4W7SA 3UG6A 2QEQA 2ZTSA 2UZIR 5AUOB 4C0SA 3ADDA 4LJ8A 2QAGC 3G82C 1IOZA 2WKPA 3QXSA 3VFDA 3U44A 2WHXA 2ZJ2A 2GETA 4TYWA 2RCNA 1FFHA 1FOEB 2H16A 2RMKA 2BBOA 5D3QA 1G8PA 4WBSA 3GLHB 4TTPA 2WWFA 2OZEA 2ZJ8A 4JYCA 4M1SA 5LB2A 3AKYA 2GWHA 2ZSFA 4FWIB 1KJWA 3LX5A 4OYHA 1OIVA 1GL9B 4OHXA 3WMFA 1HV8A 4BUJA 5K8UA 2YOGA 4QM7A 4ABYA 4HB4A 2KB0A 3BS4A 4BFVA 2F55A 2KSQA 1US8A 3L82B 2NGRA 2EYQA 3EPKA 2JIZA 5FBRB 3VU9B 2ZJZA 4JKYA 2Z4RA 2G1JA 2IHYA 3ZGXA 2IYLD 1P5ZB 1TAGA 2B7BA 2IXFA 3SOPA 1E0AA 1QHSA 4AG6A 1AKYA 3QF4B 2D74A 4YONB 1GSIA 3IEVA 4JLAA 2REBA 3CWQA 3SQXA 3B1XA 1J8YF 2FNAA 1G7SA 4QBHA 1OXTA 3T5GA 1JEDA 4PR0A 3THXA 1FZQA 1AGRA 1D9ZA 2AL7A 4KSBA 1SVLA 3U7GA 2HT1A 1V43A 3B1ZA 4RZUA 3Q5DA 1GKIA 4JSYA 3KUDA 2Y8EA 2C2HA 4PFSA 3A6PC 4MDEA 2Q3MA 2D2FA 2HV8A 2QGZA 2XGJA 5FPHA 2W83A 3CO5A 5LPNA 1GM5A 2PJZA 3MWLA 1T3HA 2DWOA 1V5WA 3L43A 3IQXA 2ZR7A 4F91B 4EKDA 3VR5A 3Q85A 4NTZA 4RSGA 2ZEJA 1W47A 1P2UA 2CJWA 2FZ4A 4BLOA 5FPKA 1AQYA 1JXOA 2GJKA 1XTJA 2XTMA 4NKRA 5HE8A 1DO2A 3JZAA 2P6RA 4XH9B 2EFHB 4ON9A 2GCNA 1KI9A 2XEXA 4M9ZA 4OI0A 2BVNA 2MSDB 3UATA 2V8OA 3C15C 3VNUA 1NMZA 2W0MA 4MGIR 2ERXA 2AFIE 2WKRA 5CK4A 1KI3A 4HZUB 4OBEA 4TYPA 2IS6A 2VA8A 5GJVC 3E1SA 1JB1A 3E2IA 4O0MA 3W5JA 3WYAA 5HZHA 4UKDA 3SJBA 3KUCA 4JL5A 1WXQA 3EZFA 1RVDA 4EPTA 3A4NA 2XITA 3A1WA 3LVQE 3SI7A 1G64A 4LDJA 2A5JA 4LSGA 5CJ2A 4ZDKA 1G19A 1KO7A 4F38A 1G5TA 2V7QA 1N5IA 2IYWA 5TY0A 5JWHA 4DSOA 2Z4SA 3ADBA 3H86A 3U3MA 5KSYA 2FPKA 4D4LA 2YINC 1P3JA 4G5GA 4FCWA 5JLJA 4P3YA 3AVPA 4EFLA 3ZZ0A 3I1FA 4PC1A 3LQQA 1HUQA 3SHWA 2IHBA 2OG2A 2ZITA 2VF8A 4MUBA 2R2AA 2I3BA 3QKSB 2A2ZA 3EZ2A 1HE8B 2NO1A 3QY0A 1M6NA 4IHQA 4C0BA 5IRCD 2IEYA 2ZSDA 1OFHA 4C0KA 3CF0A 3TUJC 3FTQA 5M04A 1MH1A 2FE4A 3EZ7A 1Z0DA 4G1UC 4QJ4A 4NP6A 1G4UR 4O2LA 4FN5A 2JJ2A 2GK6A 2FF7A 1NN5A 3RVBA 3CPHA 5JCPA 3BE4A 3FB4A 1ONBA 4PHGA 2IWRA 3H2YA 1R0YA 5LD2B 1YZKA 3NDPA 3KJEA 1XFAA 3K9GA 1XXHB 1K5DA 3AF3A 4P32A 3GLIA 4MRNA 3QI2A 1OH7A 2O8CB 2VLIA 3D31A 2GA8A 4PZZA 3ZZTA 5FR1A 1W36D 5L3SA 2PLRA 2NPIA 1NVXQ 2R6FA 1KJZA 3IHWA 4URVR 4NYMQ 3RS7A 1NN3A 1P62B 1BMFD 2OXCA 5BN5A 5KPDA 1RW4A 4KFTA 2FFQA 4LJ6A 2PZGA 3FGNA 5FTMA 2G77B 1X8LA 3HR8A 1OPXA 5C46F 4G5QA 3SN6A 3I61A 3I5XA 4IEIA 3DHWC 3MRSA 5DIFA 1MT0A 1I4LD 2ZRGA 2R65A 3MLEA 3GQBA 3MFYA 5DE3A 5FBQB 2QORA 1DO0A 1F2UB 4CEJB 1GWNA 2QPTA 1TU4A 3NC0C 3SYKA 1OB2A 1XEXB 2CCJA 1P2SA 4LBYA 3A4LA 2GEUA 2OCAA 3GJ7A 3UANA 1HQCA 1G17A 2QE7A 5C2JB 2GZAA 1PLKA 1UKEA 3T61A 5CIQA 5BWMA 3PEWA 3T34A 5DISB 421PA 2W6JA 1BYIA 1KO5A 4LC0A 4WXPA 3LBIA 1DEKA 5KNBA 3NH9A 3ADCA 4R9UC 1E9DA 4JT2A 1IXSB 1E1RD 4V0ME 1N6IA 3TVTA 4Z51A 4A6PA 2ZRIA 2W6ID 1NRJB 2BHRA 5F3WB 1DBSA 2O0KA 1XD2B 3GFOA 1E9EA 4LHVA 4XWAA 5BN4A 1UDXA 5FUWA 2B6HA 5BXQC 1H8HD 4PANA 1OIWA 1LS1A 1R8QA 4NYIQ 3R7WB 3WP0A 4JYBA 5UKDA 2IL1A 3T15A 3CRVA 5B64A 1RJ9B 2NIPA 4CGZA 1LW7A 1W44A 2VQSA 2O8DA 1W1WA 2O8CA 4Y0VA 1WB9A 2QRNA 5CYPA 1ZD8A 4Q66C 2OSBA 5DI3A 4DUGD 1NIPA 3CX7A 3K0AA 4PQYA 4Q9IA 1XBTA 4BPBA 2JAQA 5LBIA 1ZP6A 2D2EA 4DT1B 3FMOB 4B43A 2XXAB 2KE5A 2O5VA 3PVSA 4KXFB 3S1AB 5JZVA 4TYQA 4D2IA 4V0MA 3R9XA 3SU8A 3VKGA 5C4GB 4LY6A 4DEXA 1N6KA 3BERA 4Q01A 2W2XA 3CONA 4PHHA 4GSYA 1E2HA 1DTSA 2A5YB 3DL0A 2RAPA 2ZI6A 3SYLA 1FUUA 4L15A 3K0AB 4UXJA 4H1UA 4US2R 5HR5A 3OEHA 1SXJA 2BEJA 3D8BA 3PR1A 3RS2A 2OCYC 5FBVB 3CX6A 1T3LA 3S1AA 1KKMA 2BV3A 3MG9A 4JMPA 4E03A 1P9RA 4I4LA 3H4MA 2YWHA 2XTZA 1QDEA 2J0VA 3GLHA 3NWJA 5TXGA 2CDNA 1X1SA 1FUKA 3BFXA 4KV9A 1DAFA 3CW2A 4PSVA 4WOPA 2W0SA 1CBUA 3CNOA 4V0OA 1G6HA 3CIOA 2BBWA 4URUR 4A0HA 2VYFA 2QUZA 2KJQA 2W2VA 3HDTA 4P33A 4GI7A 3B85A 4GZLA 3CH4B 4TL8A 3EWSA 4I99A 4TWZA 3MMPA 1U8YA 4Q4AA 2X1VA 3AH8A 2JLYA 1RE0A 5CM8B 4RJLA 1G3RA 2GRJA 3X2SA 4IKEA 4A4DA 1JQJC 1U99A 2HLDA 2YWEA 3CKLA 4Q4JB 4D82A 4DLZA 1HT2E 4C0HA 3AVUA 3TVDA 3GCGA 5FH9A 2V54A 1ZBDA 5J4LA 3K70C 4NCKA 4OK3A 2A9KA 3KFXA 2FG5A 1TEVA 2QGNA 4D81A 2ZSAA 4ZI3A 4MKHA 4XSGA 4AKHA 4C7OA 3B1VA 2R6DA 4V0LA 4OHWA 1FX0B 3T1TA 4XOIA 3KFVA 3PCRB 5E95A 2DPXA 2Q9AA 1DG1G 1Z5ZA 3I8XA 4UNQA 1G9XA 1K5GA 2FEOA 4BWYA 4I81A 5HKKD 4R2IA 4JJKA 4M9SA 4JVLA 5EXTA 2EFGA 2ZVQX 1KSHA 4PO8A 1EFRA 4DCSA 4XWKA 3GJ0A 1Z6GA 1EX7A 1FX0A 4OL0A 5FBLB 2WSSA 3L0SA 2FX3A 2CLDX 1GTVA 1Y63A 1VG8A 3W6PA 1T9HA 4XJXA 1SHZA 4H1VA 5ANRB 4LPSA 1T3SA 3OEEA 3W8NA 1SVSA 1GZSA 2PJRA 3BB1A 3SFZA 3ZZUA 1XTRA 1H8EA 1AZSC 1G7RA 3BB3A 4EIWA 1EFHA 1RYHA
chains in the Genus database with same CATH superfamily
2IIQA 4PGHA 3EWNA 4DLTA 2QSZA 3TQOA 4AIIA 4GP7A 1Z08A 1NYRA 2W2KA 3MWFA 5D5PA 2OXFA 3K0FA 5KC9A 1FMCA 3NIBA 3OM1A 2NSDA 2XUJA 1EPUA 1T10A 1P60A 3DP7A 3E5MA 3PC2A 2OXIA 2NPFA 1GYPA 2ZYIA 2FB9A 3F49S 4HQ6A 4RHXA 4WAUA 5JISA 4W5QA 2OA0A 2G4LA 2RAFA 1E3MA 4KI7A 5F52A 4CVNA 2PXAA 3LK6A 2XZLA 3GLFA 1G42A 2Q9BA 5IVKA 1T5IA 2XRMA 5J3JA 1FPQA 3LKBA 2WAAA 3RTEA 4CBVA 4LV8B 4YDQA 1KPHA 1EM8A 4CMEA 1DOHA 5BRNA 3RSZA 1EVYA 2XDQB 3ZU2A 4CKBB 3QVUA 1IG3A 5HZKA 4OM7A 4YAEA 1SU8A 4Y7DA 2GI4A 1N2GA 4AQDA 3U3KA 5EMHA 4YYEA 5T3UA 2WD9A 2O0HA 1CY8A 1Z9BA 3KSUA 2OAEA 4LJYA 1ISPA 1O3YA 3AF2A 1DB3A 3DZJA 3DMTA 2IE0A 4L74A 4NENA 4C01A 4I9FA 1TM1E 3U1VA 1FP2A 3ZPXA 1PGQA 4G2TA 4YJGA 1GUDA 4ENQA 3C2QA 2HJGA 3H8SA 5CLLA 2PUEA 2YZ2A 4HRAA 3ZXXA 2ODTX 1GSHA 1E9VA 3JQFC 1FFDA 3RFUA 3VPFA 4AJLA 3O1LA 1MHTA 2L42A 1O4WA 2KMLA 3UHFA 1C80A 3F67A 3I5AA 2DULA 3OZAA 5GGYA 3G2OA 3HB0A 3R0QA 4X91A 1LBEA 3O47A 4ZT2A 3DCIA 4PFKA 3MSXA 5HGXA 4HXEB 4DW8A 1T43A 3ZV5A 2TRSB 4LJKA 1TQDA 4PZEA 4YDSA 1K4MA 1S96A 5I4CA 4C04A 1N78A 3JQ9C 5D01A 3AY7A 2AN9A 2CL5A 2CMGA 1PDWA 3V6MA 4B3CA 2H06A 4MV3A 2W8BA 3U4IA 3TIIA 4ZI7F 4C2AA 2CNLA 3ER6A 1MV5A 4N3AA 3UGKA 1XJ0A 1QYIA 3SIRA 3UKOA 3WKEA 1GR0A 5I45A 1E6UA 3KQWA 3LLMA 4FE3A 3AY3A 1T8RA 3G0OA 621PA 5JCZA 3ND8A 1UPXA 4PSCA 2ZU0C 3GZTB 3GFPA 2QPLA 3BWXA 4FPXA 4U0JA 4YBZA 3MTJA 1CP2A 1Y98A 3MN1A 2WSLA 1HBJA 2V6GA 3T1NA 3KFLA 4YT4A 3ND5A 2KQUA 4JLOA 2NVBA 2Z1NA 3DYVA 5NULA 2LNDA 3KYDB 1NJ2A 2IDKA 3SC2B 2ZLBA 2H3HA 4JQSA 5LA6B 4IGEA 1K1EA 1FSGA 2DFDA 3CUTA 4AZ0A 4YJGB 3IHTA 2IYAA 2FSFA 4P2BA 3OF3A 1AKTA 3HUEA 2D00A 3NOVA 3UOWA 3H9EO 3LY5A 1Q1BA 2CJWB 3LC7O 3N5CA 4C1NA 3R75A 5EMLA 2AN4A 2Y0DA 3EA0A 1YBVA 1UWCA 4B3BA 3A05A 1ORVA 2X5OA 1IY1A 3EAGA 1R6BX 5AKGA 4RA6B 2WIJA 4WESB 2YJ5A 4EMSA 4UTPA 3OP1A 4FFOA 4E46A 2OKCA 3K9WA 4Q37A 1XN1A 5ER6A 1U81A 4P7JA 5TX7A 2ZQ5A 4WGGA 1GAEO 2W4MA 2EERA 4P6VF 3QVLA 4O4IA 1GNLA 1NW3A 1B00A 2PKWA 4TMZA 4AXXA 4CCWA 1JQKA 3U6KA 1O94D 1VXRA 3I39X 2FW7A 4ISCA 3GJXC 1X9GA 1W5EA 4KW7A 4B6GA 1ZUIA 3AI2A 1YCHA 4G1BA 4INPA 1YC5A 3QFTA 2V7TA 3PE4A 4HHEA 3FAKA 4IIJB 4DXDA 1Z47A 3EPPA 1LY1A 2GCPA 2V96A 3WXMA 3DWGA 1QIIA 1HURA 4MKXA 4MWDA 1AQJA 3LX6A 4OJKA 5CJJA 2XWJI 3AGQA 2VDQB 1P7CA 4FP9A 5B57C 3C48A 2YCBA 2I4TA 2ZVPX 1DX9A 2W48A 4ZAGA 3CZMA 4C2UA 3AHJA 1DWUA 1LPAB 3VO1A 2VDVE 4Q6WA 5FQNA 1S8AA 4OJYA 5DLYA 2QN1A 1FS6A 2L17A 2E4AA 1CU1A 4RQUA 4S2UA 4C4TA 1ZK2A 3AFNA 2HHLA 4QQKA 4HB2A 1GNTA 4M7RA 4FGWA 5CBPB 1P4HA 2HPHA 2MTBA 3HV2A 2PMFA 2X9NA 4Q9HA 3C8DA 4RJJA 3ZR4B 3ZOZA 2AW5A 3QKUA 5FBHA 2AOXA 2HMUA 1USUA 2YVUA 3ROMA 2YWDA 1MOPA 1ZJ5A 1QGUB 3UMJA 5A3JA 2V6BA 3AG5A 3U61B 3KJZA 1JDPA 2RBGA 3LWBA 3V97A 1XLTA 3SEQA 1YHZA 1SWVA 3HGQA 1QHNA 1GTL1 1GPKA 3UXEA 3P52A 2A3RA 1MJGM 2RGWA 4RAQA 1O1YA 3B9BA 2EX4A 2OOSA 2EBUA 2XVXA 2NG1A 2VP2A 2GEVA 5IH7A 1B6RA 4CMCA 4PBTA 5EZQA 3WDLA 2DQKA 4RPJA 2FMXA 2OFOA 4A2QA 3R6LA 3MUNA 1RYEA 1JJ7A 4OHVA 3I4LA 3GA0A 121PA 1YULA 2P0EA 2VYQA 2WF9A 1EFPA 4FGZA 4R1UA 1X80B 2CL7X 3TBFA 5K9ZA 5A0TA 4WSOA 3JQ8B 1GPLA 3S28A 4P08A 3HDHA 2Y3IA 3CT4A 3DE7X 4MPJA 3VAYA 5JALA 1AUVA 3RNLA 3N2GA 4NPHA 4D45A 4QGBA 3S5UA 4MI1A 2ZPAA 3P2MA 3ESDA 3W5IA 4B6JA 5IT5A 5L51A 3NORA 4PICA 5DNYB 1PYGA 1A0OA 3LE8A 4QOJA 3B82A 4F84A 2PLNA 1X9HA 3PFCA 3ZHCA 4GSKA 4DC9A 1GZVA 5CFQA 4RW0A 4O4IF 3R8FA 4ZIRB 5MF6A 5JO9A 1SHJA 5AVSA 2CUZA 4GMDA 2EX0A 2V7WA 2H4JA 3WSTA 1E9FA 1Q22A 3C74A 3K9LA 2WG0A 2JS7A 2AA3A 4JP3A 4Q93A 4DLLA 2JLWA 1JJVA 5E4YA 1JSLA 4H77A 1QBGA 2EFJA 5BSTA 2HSEA 5IC5A 4MP3A 1LDGA 3ZN2A 1NRWA 4GKAA 4JR1A 1DCFA 3CN7A 4PBRA 4ZO9A 1U2ZA 5DNWA 3IPLA 1GPUA 2OOKA 4ZV4A 4JA2A 3J7TA 2F8MA 3BWVA 3P9ZA 3C16C 3GLGA 4AUMA 4F2PA 1WXHA 2HTEA 3RH0A 3GPLA 1J1ZA 1B8VA 2DBQA 4H2DA 5JTUA 4LTNA 2FN8A 3W9SA 4G86A 2IU0A 1VL1A 2C97A 5KWSA 2VHWA 1QJ4A 1OAKA 2VDWB 4WMLA 3SF0A 4R51A 1AH2A 3H5NA 5KNBD 4RDHA 3V4VB 4A73A 4EI9A 5L3QA 3T5BA 3QITA 3VU8A 3SE7A 4CQNA 3AP3A 2CHGA 1SOMA 3N2GB 5AK0A 4CMBA 3RUHA 4J75A 3F8WA 3PCTA 2CHUA 1RC0A 1JX6A 3C7TA 2HOQA 1T35A 3BGOS 2SCUB 2RE8A 3WLPA 4F8EA 4YCCA 3NYQA 4JQYA 3AHEA 1QF7A 5JSKA 3DAHA 4HNAA 1NVFA 4ZYXA 3CX4A 1OLUB 3DGFC 4RFSA 3OT5A 4HOYA 4RCYA 4AJJA 3I2KA 1Q3TA 2AK2A 4IGFA 2C5FA 3STUA 4JYAB 1PJBA 3GWZA 1O6ZA 1M9NA 2ZBUA 3VYTB 3ZLUA 3L01A 1JPNA 4G1VA 3WWCA 3QVGA 1Z6AA 3TI7A 1CQPA 3CGGA 5DYYA 4B48A 3NJ8A 1E66A 1E7SA 1T2NA 4WFQA 1TD9A 2JAWA 4FIZA 5KCMA 3JTMA 2Q07A 2ALJA 4FJ1A 1W0KA 1QB8A 5BYAA 3AKDA 1SBIA 3PFGA 3RFFA 3HB5X 2HA6A 4N82A 4EUSA 3BYZA 4FWTA 1KEWA 3NOOA 5TPZD 1TVKA 3REQB 4DLYA 3FI0A 3KEMA 1NAIA 5JMOA 4AM8A 3IDQA 1E9BA 1XEAA 3EF1A 1AG9A 3QVKA 4LE1A 1Z6QA 3ZH9B 3ZK9A 1N1MA 5A5GA 1IPEA 4D9BA 4RE5A 2YJ6A 1JTFA 2FZCA 2BGUA 2R8YA 3LVRE 3BE6A 3QV2A 3AUUA 1FDUA 4HDRA 1N5LA 4XM1A 4HGRA 4QYWA 4YRPA 1NRIA 4R71A 2FPWA 4B7AA 2VHXA 1OLOA 5IZ4A 4K05A 1ETUA 2CHEA 3W3ZB 4L57A 3CLRC 1PG2A 1C0LA 4W5WA 4B32A 3E6AA 5KWIA 1HEIA 2R8EA 2HW8A 1LWNA 3GAAA 1C0IA 1NF8A 1PNVA 2AYYA 2QT0A 1MO6A 2XNDA 2HSWA 2ODWA 3EGDA 2QS9A 3ES9A 3G0CA 4GVLA 1VHTA 2HY7A 4X85A 4MJLA 3OZTA 4KXNA 4EFKA 4UEWA 4CMIA 1BMFA 1CUSA 1UKYA 1Z74A 1U8XX 2R6HA 1FJHA 3JV7A 2EFEB 4YA6A 2B92A 3MNFA 4HYEA 1B8NA 4ARIA 1E4OA 5K8IA 3BZBA 3HM2A 1KK0A 4QBFA 4M6WB 1VE9A 5HG0A 4YJ3B 3AB7A 1ECPA 1TEZA 3CN9A 4KI0A 3ZCQA 3P0FA 4AIRA 3UGTA 4CODB 4YMVA 5I7UA 3V34A 1PNTA 3DVLA 5DXAA 1FP4B 3W9BA 2P75A 2GEDA 3L07A 3PLNA 4GM1A 1D1PA 1JN0A 3X2EA 4L73A 4WNCA 4W9NA 4AN4A 3L0PA 2H11A 1ZUNB 2DWCA 3IMKA 16PKA 1X1CA 2DQZA 1GZ6A 3UIEA 2EZUA 3T9FA 4O4HB 1E1CB 1IMOA 2OGTA 4MB6A 2COEA 4RJ2A 3OAAA 4FZRA 5ILOA 1PVDA 2UZ1A 2GYWA 4N5HX 5G40A 3TB4A 2G1AA 5IWCA 2IOYA 1GVHA 2OG1A 4I9HA 4PAQA 3LXMA 4O1MA 5DM2A 5TPZA 4PZAA 4UUMA 3O0TA 4UPEA 1BX0A 3LC1O 4UCXA 4U7HA 1JILA 4BP3A 2IP4A 3MWDB 1IHUA 1X8JA 1KXZA 5DWQA 3EC1A 4ZC1A 4BRZA 1G5RA 5FTLA 5JNWA 1C8KA 3KTOA 3HRKA 4FMCB 4CLEA 5KO2A 1ISFA 5LIRA 5FLEX 4X62B 1KDRA 3TR5A 4LSZA 3U3OA 2XQJA 3HU3A 4Z0PA 1R0WA 1RI3A 4ALMA 3WDKA 4ZALA 2YOHA 4BKRA 2M9MA 3M7IA 1WF6A 4FI3F 2XYGA 3PNVA 3RVJA 4DYDA 3T3IA 2VNJA 5JSFA 3JQAB 5LZ9A 1BHQ1 1JG6A 2O8BA 4LWOA 4G0QA 3GLSA 3Q6NA 3A27A 1VLQA 3BG5A 3F8SA 4J9UE 4TTQA 4TV9B 2WDZA 3VYRB 2W6IA 3ZWQA 3A3NA 1XTPA 2Q8PA 1P3DA 3EA4A 3HB4X 1GVNB 2RGCA 3LUKA 5IC6A 5JI2E 4BO3A 4D43A 3OJOA 1TU3A 1MRNA 1FK8A 2KBFA 4HNGA 4JGBA 3U7QA 1JXAA 3F3MA 1F20A 3LRTA 1XMOB 3D7SA 4R1LA 2H2GA 2PH7A 3I1JA 4LNUA 1B8OA 2PRJA 2D2IA 1IBCA 2O52A 3GPBA 5L8VA 4XM2A 2JGRA 3FOBA 4KNWA 1GPNA 5K09A 2QRKA 4M0KA 2JF0A 3QOXA 4TV8B 4HVCA 1TADA 4LZJA 2CFRA 1GL6A 3VPCA 5EHXA 4IYJA 5K0EA 3SY8A 3R4VA 5J5CA 3NPAA 3RJMA 4EHAA 4D6PA 1GA4A 1ZJZA 1SUEA 4GX2A 4RV9A 2GD0A 1KPGA 2WOJA 2RH8A 4ND2A 4KR2A 1WMAA 4I7EA 4Q3AA 4AL4A 4C2TA 2QQFA 4A8JB 5ED0A 1EM8B 3D8NA 3IAM6 4ZDWA 4GRAA 4QL3A 4F3YA 3VC3A 2VWPA 4GPBA 3RBAA 3UPUA 5F4ZA 5FUBA 3CH5A 1T8TA 4LZNA 4RVOA 4AJHA 3PT9A 2EHJA 3IBYA 5BQ3A 2CXSA 2QSJA 3VU9A 4B4UA 4CMEC 4GR5A 2QIPA 1PX2A 3SX0A 1TYAE 4AYTA 5JVDB 3TTSA 4BZQA 4BECA 3EFOB 1H0RA 3N87A 3QMVA 2FMHA 4OB7A 1M2WA 3WMEA 1E1DA 3H1BA 3EISA 1G21E 2BFDB 2Z2IA 1VPDA 2BH2A 4AQYB 3U80A 1U0TA 2B8JA 2R47A 3NHBA 3W5SA 1GUAA 5L3VA 5LDDC 2NYVA 5FUVA 3M83A 2D6FA 1HF3A 4BGEA 3LCJA 3NCHA 1J1UA 5CX1B 3NOXA 4BKQA 1DQPA 3F5SA 3PDWA 1A8SA 3T9DA 4QTYA 2OBFA 4H18A 1S3IA 3LMKA 1IZ8A 1W36B 1XKTA 1A4IA 1CUCA 2JHAA 3FDZB 5CAEB 2WM9B 2WUFA 2WIBA 4RVDA 4B31A 4CM9D 4P7FA 2G1UA 2QP3A 3PGA1 5IYZB 5IAOA 1SQFA 2WAMA 4E5KA 3E27A 4CXMA 1TM3E 4GAEA 2IHVA 3L8GA 2VKTA 1L1QA 3G8BA 2PE5A 4JUCA 4TLEA 1J9EA 4RSRA 4YH1A 1SVMA 1SR8A 1DJNA 1TFRA 3P4UA 4KQ2A 4ZCQA 1KTIA 4QUEA 2X2EA 4BQPA 2WYIA 5LP6A 3MK31 3DFZA 5DX0A 4LHEA 4F8YA 4FFRA 3OWOA 4BDSA 3RFVA 3HJRA 4AF6A 1ABBA 3IPCA 2AJLI 4QUAA 2G76A 5FORA 4LYGA 3T7IA 1O0BA 4L02A 3NUQA 3UJ3X 5KSZA 3O2SB 4NFYA 4F6LA 1FDOA 3W6UA 1JTEA 3H05A 2Z0MA 4RS4A 2RHLA 2F8TA 4C87A 2IIBA 4M8KA 4BV2A 2X9QA 3R24A 4OO3A 1QDUA 1F8UA 2CK3A 1PJ3A 1CZNA 2XA2A 5LMUB 3JQDA 4R6XA 2WU0A 4PFQA 5CTJA 1Z83A 3LL4A 1KI6A 1P5JA 4NBVA 3AU8A 4ND8A 1JLSA 2CDRA 1PKXA 3LUFA 4L9SA 2W2LD 2AXPA 2A8YA 2X8LA 2QY9A 1TD1A 4WESA 1UFQA 3LCRA 3MD0A 3GD7A 2HCJB 2P79A 3DHVA 3VTZA 1TT7A 2APJA 1DS6A 4P3PA 4RACA 3MQ4A 2IXTA 4OHMA 2H7XA 3UWOA 1WPQA 4YHBA 1GUBA 4UHHA 5DP2A 4ENPA 1AXRA 4OGWA 2ORVA 5AKXA 4CHTA 2QN6A 5C7IO 4YGYA 1EFDN 3K71B 2WJWA 4NAUA 1E89A 4B3MB 4HFNA 2C9BA 5EWMA 4E15A 1XE3A 4ZYLA 4DRZA 4ZZ1A 4NXNB 2YHIA 4C07A 5T67A 1U0NA 1BCSA 4AZWA 2IEBA 2W2MA 1BD4A 1JR2A 3TZLA 2H7CA 2CBXA 3T1HB 1GG8A 2FI1A 2CD7A 1YR8A 1E9CA 2YFYA 4XJVA 4TTRA 1E3IA 4IS2A 2UYHA 3EGXB 2OR3A 1YQUA 2V8BA 4X64B 3ROGA 4PZ9A 4BNLA 2YWBA 1XXHA 4ME6A 3SZUA 5J59A 3SM3A 2YUTA 1UIRA 3Q0TA 4XGKA 4C6TB 1JEQA 1DIBA 4NS4A 5I9BA 2ANCA 3WGOA 2A7XA 4A2CA 1KORA 4DMCA 5BYBA 1XPRA 1CUZA 3HZHA 3RS8A 5HCUA 2I2CA 3I61A 1FXWF 4F93B 5J4HA 1SBCA 2GM5A 1JFSA 4DQUA 5B36A 2GD2A 2R4UA 4IXMA 1ORHA 2ZPUA 1FFEA 5ARDA 5IDYA 4HUQB 4UD6A 4BZPA 3TOSA 3LNCA 2QN8A 3T7EA 4N9QA 1U8EA 3KPWA 3UB2A 1PJ4A 4MO9A 1OX4B 1UDAA 3RJ5A 2E9SA 3HUTA 4UAVA 1VMIA 4QDZA 4OI1A 3L5OA 4LXHA 4Q9AA 4QTTB 3WK9A 2G04A 4DEYA 2RHOA 2BIFA 4OLFA 5ITZB 1NUTA 1N8NA 3OU6A 4EITA 1ULUA 2XTAA 4I3FA 5LP6F 1RAEA 1OZFA 4J0GA 1ODFA 1TW3A 1EX6A 2J4DA 1DWQA 3FVRA 3K16A 2R11A 3GJYA 4JBNA 3TCXB 1EK6A 3THRA 4CYMA 4DJFC 1L6IA 1JLKA 3C4VA 4R41A 4ZVOA 5BR8B 4AY6A 1PEDA 4I2VA 1BKDR 2FFHA 4WACA 5EFZA 4BJ3A 1YK0A 3B52X 1CP3A 4FHDA 3AB8A 3H2SA 1KDTA 1ADBA 1CJCA 1UPTA 1VE3A 1YRLA 3P2EA 1LDEA 4LGCA 4M83A 4IZ6A 4F5YA 3WOHA 1UOPA 1DOAA 4H0FA 3BK2A 3N1UA 3AUSA 2JLZA 3LT1A 5FA6A 2CF6A 3CLHA 3IMCA 3JWGA 1W59A 1I3MA 1SBHA 4PZ0A 3PLRA 5EKDA 3S0JA 3K0HA 3MBOA 2EKPA 3U40A 1WXIA 2ISSD 5F7ZA 5SYNA 4PVCA 3GT3A 4RKRA 1QR2A 4YGXB 1JT9A 2JIRA 4LNAA 4MVYA 5ECDA 3RYCA 3FWNA 4GU5A 2JCYA 1T6YA 1U3GA 4AW9A 4Y6LA 1RRPA 1VIVA 1QH8B 3FVVA 3DDCA 5EEHA 5BVGB 1SOWA 2X6TA 1NY5A 3BXFA 1RJWA 2C4TA 2NO7A 2QRMA 3E70C 4JVOA 2ZZKA 1PUJA 4CQJA 4HT3B 2QD5A 5LU8A 3LBHA 1UMCA 3CUSA 4OXRA 4TMKA 5ELXA 1YS1X 3G8DA 4AZ0B 4ZICA 3OEHD 2YV4A 3D8TA 1TTTA 2HWWA 4PO3X 3GX1A 3MCUA 3RUCA 4D02A 5LJIA 1U0JA 3TAXA 2R0QC 3LT0A 3M0EA 1WUYA 4NHEA 2WFAA 4PG7A 4M7WA 1RZUA 3LLSA 2K5UA 3A1DA 2HUPA 3E9MA 3U9SA 5FLYA 1AHIA 1KI8A 6AT1A 2ZBRA 3LG2A 6LDHA 1BWSA 3KDSE 1JDTA 1G21B 2XZDA 3VM6A 3K9NA 2FWJA 4ZOLF 1UJ5A 3BXOA 3BT7A 1NGSA 3SEAA 1QHHB 1VLJA 2OZKA 1B6TA 1HE2A 3PSHA 1IK6A 1ZK1A 2B4KA 2N1BA 2VXCA 3TKLA 2SHKA 2FPPB 2JI8A 4OPMA 5FAXA 2Z83A 3KR2A 3T0FA 1N6RA 1ST2A 5DLDA 1IY0A 4K6FA 3ICEA 4HNSA 1O9HA 3F7TA 3SJUA 2JEYA 2OCPA 4DMFA 2A9QA 1RDFA 2XJ9A 5LFAA 4MUAA 2XCRB 3RSFA 5FLXA 2VVTA 1DG9A 1Y3IA 3L92A 3L7DA 3PIIA 5HBGA 3IP7A 4BNDA 3C4JA 3JQAA 3SFVA 1Z63A 4DR7B 4D9EA 2FDRA 3MJCA 2PYZA 2PX0A 3DNMA 3SNKA 3V4SA 4JIMA 2NLOA 2V7UA 3OCJA 4KGZA 5AIAA 1CPYA 3JQFA 3BZWA 1J23A 3E7FA 4O4JF 4JI0B 4WD3A 2X58A 1KA9H 4FS3A 2VAPA 3BRQA 5GONB 1EXDA 1UMKA 2MR5A 2ZJ0A 1UP6A 5A5FA 4Y1GA 2RGAA 3MLBA 2G1PA 1A9SA 1QWSA 4N47A 1PWEA 2PZLA 3SIPA 5DBOA 4B47A 1VP9A 1JEJA 5JEEA 1K75A 3G0HA 4G25A 1NQWA 3HP1A 3SHQA 2JGDB 3AL2A 3OY7A 4MKIA 2WFLB 2J0UA 3OETA 3PENA 4KTTE 2EV9A 3BFKA 2HWYA 1ONOA 1QYCA 2EFDB 3OPVA 2PVPA 3OEED 4TWIA 1DCMA 3UK1A 3I5MA 2M98A 2R8OA 4MR7A 3A14A 3RAGA 2NAPA 2WE7A 1MQ8B 1CEEA 3V5NA 4RQBA 2VAVA 5E6SA 1N2IA 3P0JA 3GHYA 3BXEA 5HF9A 4ZCMA 1ZOLA 5KYKA 2X4DA 5LMZA 3LZDA 2HCBA 3MTAA 4OXIA 2OXRA 4XX0B 1DKUA 1SXJC 3SG0A 1RPTA 1QGAA 2AZDA 1GL7A 5AI9A 5C7OO 1H9BA 2TMYA 3IE0A 5B58T 3GLGE 5HP4A 1KZHA 1SMKA 4K9KA 4BTEA 3GLUA 1JIIA 1L3BA 4DQKA 4KR0A 2XOKA 5AM5A 1V8FA 4LEIA 1L3CA 2BFFA 4L5BA 3MTGA 4Q7QA 1J25A 3QE3A 1G1MA 1SD5A 5K8CA 2Q9CA 3D0KA 3DDHA 3A06A 1VSQA 3CEPB 4B73A 4ZMBA 5DW3A 2DUNA 4BEWA 3HB7A 4GLOA 1FDTA 1SBYA 3OEWA 1IWOA 2GXUA 3OIGA 5C31A 3ZQKA 5IKEA 1B23P 3HSYA 4HLDA 6ADHA 4BYMA 2Z9CA 5JT1A 3OMLA 2Q1TA 4JLUA 4HAOA 1Z7GA 4XVUA 2AJ8A 3BMQA 2OCBA 4YAWA 2ZS9A 1RQ2A 1RJEA 1TU0A 3G5LA 2RB4A 1EH5A 4FGUA 2GERA 3OLXA 3UT5B 3CEMA 3ZXIA 1JAXA 5BT9A 4E1AA 3VNRA 4ES6A 3ZGZA 1KEZA 2JBAA 5BR1A 4XPZA 1SKQA 5AHWA 4JHLA 4B4VA 5K8LA 2B9VA 1E1CA 5G2OA 4RIFA 1Z0UA 1YZLA 1TM7E 1NY6A 4E13A 4IG4A 1L4EA 4RENA 1E3DA 2WWVD 1PT7A 5LCXA 2IHKA 1H8HA 1PJTA 1S2DA 2HA4A 3KZ1E 3Q2OA 4IWNA 3HM9A 1PFGA 1QOQB 4ARZA 4TMVA 4A26A 3A0RB 3L04A 5HCNA 4AG3A 1DQSA 1MAAA 1Q1GA 2VP5A 3NATA 4F5EA 3Q9UA 4EUKA 4JGIA 3AOEC 1NN0A 1NLYA 4TROA 4R8RA 4HB0A 1YONA 2C95A 3DTVB 5FPYA 2OUKA 4DV0B 1YBAA 3QVOA 5CD1A 5EZSA 2X5NA 3A1TA 3PVZA 1XZ8A 1YVDA 4R2WA 4FFNA 3TIVA 4JROA 3IE2A 3GZNB 2WIFA 4IW3B 4JFAA 4AJIA 4C78A 1Q5PA 1TCVA 2EBWA 3GN2A 4J6EA 3M9WA 4IVPA 3W2GA 3ZD8A 3I9NA 4R68A 5FOWA 3O90A 3SVZA 3FUTA 4EDHA 5ITVA 4EX6A 2LR0A 1C3JA 4QA9A 3W9YA 2GTPA 3LX8A 5DHQA 4AZ3B 5L4SA 1GR1A 3M3PA 3ZKAA 4PO9A 4LMPA 1KH3A 1KOLA 3HCAA 3N28A 1TUBB 3MWGA 3WXBA 2N3ZA 1Y9EA 3KUXA 1AMUA 4H3VA 3IV6A 4R9SA 4WCDA 5JCJA 3TR0A 5TQVA 2QUJA 3RRZA 4Z7NB 3ZLJA 2IEAA 3ZVNA 3BIFA 4LMBA 1UIMA 2KX7A 4WLFA 4ZOQI 2GCOB 3WLOA 3UO8B 2WWXA 6GPBA 1CCWA 2VEDA 3KXPA 2G67A 4DLXA 2PRYA 1D0SA 3JSXA 2C57A 1C50A 4R98A 4I55F 3RARA 1A9PA 5E4FA 4D0LB 1HG1A 2YN2A 4OREX 3A7EA 4H6PA 4BNKA 2ZRDA 3AP1A 5GIPE 3AP2A 1J2RA 2ADFA 1F3OA 2GKSA 3B2EA 4S12A 3OTQA 4X7PA 4MS3B 1PSDA 1A7UA 4NCNA 3UENA 2DBZA 4DBZA 4BQFA 3OUUA 4HAXA 3JD3A 4Q9JA 5AESA 3KKNA 5D7NA 3CSSA 1MZVA 3HZRA 3VR6A 3O4GA 4EO9A 1ODCA 1VRWA 3BMOA 3EXFA 4IQ0A 2YW9A 3RV3A 4NONA 3PJRA 5LLDA 3PUZA 2Z2ZA 2BT4A 2YXEA 4MQBA 3S2FA 1IM5A 2PV0A 3PUJA 3CF2A 1J39A 4S1PA 2F4NA 4EF4A 1IC6A 4X6LA 1TUBA 1IE3A 2PXHA 3HJCA 4MX8A 1I9CA 1ZUHA 4MRRA 2I4IA 1QIDA 1E9RA 3E53A 4P35A 5JAOA 2VDKB 1YH3A 4MW0A 2WYUA 3ODGA 3WJ1A 1DWOA 2DP4E 5JOQA 2JBWA 4DUPA 1X42A 4XYGA 5CU7A 4PNEA 3PRYA 4B3TB 2YV1A 3C7AA 5KSWB 1M10A 5BV8A 2VQEB 3A10A 1AUQA 1AF4A 4ZI5A 1TCBA 4WJLA 3FWHA 3PICA 3PQ6A 2I7VA 1RC1A 3KVRA 2ZSHA 4D0RA 1KOFA 4E4YA 1ZHOA 1DXOA 1XQWA 2V5AA 3WLEA 2Z5VA 1BROA 2PKQO 1DI0A 4OP3A 1EHIA 3IUEA 3VKWA 2XNDD 1RS0A 3FDIA 2EKBA 4RGQA 2ZJ6A 1PR2A 3IQDB 4XLZA 3UUWA 4CIXA 4YALA 4WOCA 3L84A 3VOBA 3G9TA 5KOIA 3DMTC 5KYWB 3OQMA 4KRGA 1N36B 1KGDA 2J09A 2ZIXA 3T7TA 3ZCUA 1I13A 1NJGA 1PZEA 5L7WA 2GJ8A 2CV2A 3ZDDA 4YLYA 5FV7A 3C0KA 3DV0B 2P1RA 4PWYA 2YJZA 1QRTA 1RMTA 1M1YB 2PX8A 3AIMA 2I8AA 2GXSA 3PQ8A 5H70A 1EXNA 2IBMA 2Z3WA 4WPGA 3JZMA 3OTIA 2FZKA 3DG9A 3L8CA 4EW6A 5EA2A 1VPVA 1WOMA 3E3MA 1JVNA 3IS3A 4NBRA 1X2EA 2I2FA 1P2VA 4C0WA 1SHKA 5EHZA 1RP7A 4RZHA 1LLUA 4MICA 1XRJA 3IT1A 4HVAA 5DTQA 3RDPA 3WB0A 2JJ1D 4MUIA 4OXKA 5F2OA 3UJBA 4RD0A 1GKYA 5P21A 3PTZA 4BEVA 4CQMB 3SHOA 2QLNA 1A2BA 2GA9A 4JVNA 4MUEA 4BLPA 3NBQA 1UEJA 3SLRA 1PZXA 1SIUA 3GY0A 5JAHA 4G1CA 2X2FA 4LF9B 3PJFA 3WMGA 2PZMA 1Y8RA 4EA7A 1JHPA 3H5AA 5FPTA 3OC0A 4HD8A 1UMBA 1YOVB 2R6CA 4M36A 1W1IA 2UZ0A 1XTSA 1E3TA 1T24A 3I01A 3AKEA 3O8QB 5B1EA 3AUJB 1JLRA 1Z2PX 3EVNA 1V3TA 3V2UA 4H31A 4JSTA 4IFEA 4R0MA 2ZIXB 4GP9A 1RE1A 3AETB 4AZVA 5JV5A 3F9IA 2WNSA 1FDSA 1Y4AE 1VLVA 1KYVA 3IALA 4KXMA 3K0CC 5BNWA 1P18A 4J29A 1ENOA 5HJ5A 5H80A 4HEA6 1UMBB 1YOVA 2HLDD 2Q0XA 2WC1A 1SELA 3HLKA 3WHLA 4UM5A 2WSSD 1LVHA 2A5LA 4ESEA 1N8TA 3O8QA 1K7YA 1JW9B 3EMBA 2D5LA 2I6SA 2PS0A 3BB4A 3GCXA 3ODPA 5CBPA 2FW9A 3WGHA 4EJSA 4YQFA 5A9TA 1NG1A 2H2IA 1DAEA 2C96A 3E2MA 3EFEA 3NOQA 4Y6PA 5GJCA 1KFEB 4O2BA 1XMSA 1YVEI 3NLLA 4NYMR 4H7JA 1ZMOA 3MS7A 4M2LA 5AQ1A 1JIKA 1OGYA 3F2VA 1Q3KA 2FZLA 2AT1A 1J0EA 3UJCA 5DX1A 5K6RA 3MM4A 1FS4A 1C1DB 1Y5IA 4PYIA 2GCGA 4GBGA 2GT1A 4XSHA 3ZE6A 1M7BA 5F51A 2MJLA 2VAXA 2VPWA 4JENA 2B34A 4NZYA 4BFUA 1UBGA 3DFIA 4JS0A 3B5IA 4TT8A 1A9QA 2C7GA 2X0KA 4X1IB 1IULA 5C8YF 4HN2A 4ZTUB 3NWBA 2ZYDA 2YICA 4LOIA 4KO3S 1NVBA 1ZGCA 3NFYA 3WFIA 1WBBA 2QRJA 2XWBF 4KQ9A 2NXWA 2CEKA 3STYA 4P4LA 1A2QA 4GZ5A 3OESA 5AI4A 4NEHB 5FO0A 2Q7DA 3QWIA 1J7KA 1GILA 4ZHQF 5MN4A 4GD3Q 2X4LA 4KWHA 721PA 4PY2A 5LQJA 5BSEA 2RK6A 4J43A 4ARCA 1K8YB 3SLGA 1KKUA 4YPOA 1XVIA 4BTVA 3AC0A 4TWAA 4BLVA 4YUAA 5KYWA 1WXWA 3FFAA 3HLYA 4JN6B 4LRWA 4EQ6A 3ECAA 5ELMA 3WKAA 1JG4A 5DOVA 4ZIRA 2CF5A 4GMFA 1WUTA 5JQGF 1C0KA 4PLFA 4UBJA 3VTKA 4TVBA 4UE3S 3N8KA 2RH4A 5BOSA 3LRPA 2JAOA 1Q7TA 2PH1A 1FSPA 2RAUA 3FG9A 1Q77A 1C8VB 4TTAA 1D6NA 3STTA 5HRUA 2A0FA 5B1IA 2UU9B 4KHPB 3KV3O 5C34B 1U2GC 1WV1A 2YOFA 5CR9A 3ULKA 3ED1A 4ZWNA 2ZRPA 3FPCA 1H85A 2CUKA 1TVCA 2YXNA 3F8TA 4TQAA 4Q1BA 4V0RA 3RTDA 3UJPA 3NHAA 4PYRA 2RCYA 4CEIA 3Q12A 5G53C 2ZSBA 3PXEA 1H8ED 1IZYA 3E5RA 3OJLA 1XKXA 1UBEA 4PWZA 2YJ3A 2GHQA 1V71A 3GNLA 2OV2A 3TDMA 2ID4A 1RP1A 1SVKA 2AD1A 1XWIA 4E1VA 1SXQA 5DGXA 1DL5A 3WGUA 3C5CA 3OBBA 1MG5A 1V6AA 4G5HA 3DKPA 3UV7A 3CG0A 3JQQA 4YMLA 3OWHA 3ECCA 2AQ8A 3LTEA 1VLZA 3HPQA 4JXKA 3UNXA 2GZHA 4ARZB 2ZWAA 3RUFA 2ENUA 3RSGA 4FW9A 2PSEA 4TUYA 1QHHA 3S5JA 2XQFA 2VJKA 1JLHA 1D1TA 3PXAA 1EQ2A 3A26A 2Z98A 1EDEA 1GXSB 2GN9A 2V97A 2ZR0A 2GHRA 1KRHA 3DC7A 3KSDO 4W5OA 1U80A 1XTTA 3LECA 1KJIA 5DBHX 3TXAA 1M5TA 4KQCA 2CD9A 3JVVA 3EEIA 3OT1A 4R69A 1XZDA 1IG0A 2FUCA 1AA6A 4OV6B 1PO7A 5L9AA 1YL6A 4BV3A 4WOJA 2HWUA 1YUNA 1X7ZB 5KTTA 3T3NA 4AJ9A 4ZVRA 3TSZA 2Y0CA 2G8LA 2X7JA 4IXTA 3DUFA 4OQZA 2DLCX 2VLBA 3GRPA 2AH5A 4LSWA 4PNZA 5DHUA 1DMRA 2GPWA 2O0LA 3BXXA 3KKLA 5C8YA 4TXHA 5CEJA 1DG3A 2AG1A 3AEKA 4I6GA 1SEVA 4RK5A 1TAUA 1SG0A 3GGOA 3WB2A 1TZBA 2QM7A 3L0DA 3N76A 4NR0A 3ZDZB 1H4TA 1QPGA 3ESCA 2WW8A 1E4EA 4OK5A 2QLTA 5AHXA 4NHOA 1ND6A 1LVUA 1O2DA 1SCKA 1X14A 3BTOA 3L2OB 2E4YA 2A9VA 1OLXB 3S27A 3L18A 2PMDA 2MOKA 2BMWA 3DL7A 5ABPA 5FI0B 1PR9A 1XVVA 3GVIA 1WXGA 2FWNA 3HPRA 3BAFA 4W5TA 5JE8A 3V9PA 3WGQA 3MQFA 1FTQA 3QUCA 1ZESA 2DR3A 1XNJA 4IIUA 3ND7A 1UP7A 1UEXC 4GOKA 5FV4A 1C7IA 3HCWA 4OGGA 5FL3A 5JQGA 3I9V1 3AR6A 3HP7A 3W90A 1IH8A 1X13A 4GW3A 2HNKA 2OFPA 3EY4A 3NTXA 1U3UA 3WLFA 6Q21A 5BUCA 5HKAA 5CYOA 1XDUA 1IQ0A 1ZNZA 1C1YA 2FSGA 4Q1DA 5LZ5A 2NV6A 3CNHA 4ZVTA 4BFWA 4FFMA 4IO0A 3O3CA 2EWVA 2R60A 3H2HA 2H8GA 3GR6A 4M87A 3WWZA 1IBKB 2B1JA 3OKCA 3EHEA 2VWGA 5DLQC 4YT8A 4DV1B 3FBGA 4KO1S 1S2MA 4WFKA 1YVPA 4L72A 3B20A 3WQHA 2P3LA 1P61B 2NO9A 3TNYA 2JGJA 1VECA 2WJ4A 1I3LA 1DUSA 2ODNA 2XAAA 4S1TA 4XQEA 4Y2PA 4A9AA 1E4EB 5CNKA