3DKPA

Human dead-box rna-helicase ddx52, conserved domain i in complex with adp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
242
structure length
240
Chain Sequence
SMKINFLRNKHKIHVQGTDLPDPIATFQQLDQEYKINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKISEGTGFRIHMIHKAAVAAKKFGPKSSKKFDILVTTPNRLIYLLKQDPPGIDLASVEWLVVDESDKLFEDGGFRDQLASIFLACTSHKVRRAMFSATFAYDVEQWCKLNLDNVISVSIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Probable ATP-dependent RNA helicase DDX52
total genus 85
structure length 240
sequence length 242
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dkpA00
5DO9A 4B48A 5JJIA 4OJQA 3LX5A 1G7RA 2BMDA 4OL0A 1G9XA 2RB4A 3N2IA 1HE1C 2F43A 4O0MA 3EWSA 1MO6A 3QF7A 4Q4JA 3U3JA 4DXAA 4ZIRA 4G01B 1FTSA 3CKLA 4JLKA 1TX4B 4LGMA 1ZIOA 3TUIC 4JVLA 1KMHB 1TQ2A 3RAPR 1EFUA 3SBDA 2X19A 2ZIAA 2Q9CA 4EJSC 1D6JA 3LLMA 2GA8A 2AWOA 1Z2CA 3SHFA 1ESNA 3BWDD 3KQLA 3DHWC 2IS6A 2VHQA 4V02A 4E07A 1TUIA 2AFHE 4XJXA 4A0GA 3HU2A 3LXXA 3HYTA 1E2HA 1S2MA 1U98A 3CNLA 4WVFA 4Q02A 3CX7A 3ND8A 2R44A 1LTQA 2IYWA 3KFXA 5FPTA 3UG7A 1G5RA 1MV5A 1YR6A 3U7GA 4EKDA 3QXSA 3KFVA 3I8XA 3H4MA 1Q1ZA 3X2SA 1YZUA 1R2QA 4M1MA 1SULA 3PUVA 4NHOA 4BFYA 2ZRDA 4GSYA 4CEHA 3ADDA 3NBFA 2BOVA 4RZ3A 2VA8A 3FKSD 4WA7A 3RSOA 4AKIA 1KSGA 1Z47A 3H84A 4JT2A 4ZDWA 1TEXA 1E0SA 4UKDA 1F5NA 3N70A 2QORA 3WBJA 1JXOA 2P5TB 1M7HA 1MO3A 4EFLA 1IBRA 1OKKA 1P72A 2OCYC 5KUTA 2ZRNA 2GF9A 4IXNA 5CIWA 4B73A 3QVVA 1Y63A 2IF0A 3KKPA 4L4UA 2YJTD 1YZGA 2ZJAA 1X1RA 3HU3A 1VCIA 1ONBA 4EFNA 5BWMA 2C2HA 4JLJA 3PITA 3SN6A 1BIFA 1A1VA 1NBME 2WM9B 5G41A 1R5BA 2WZQA 1IY1A 2ZRJA 4PR0A 1IN5A 1QHHA 2C98A 2HJGA 3W3AA 4TYPA 5K8IA 3BBPA 1P9NA 2GHIA 1VMAA 1W5SA 5FPKA 1KNXA 5JWRA 1OFUX 1VCOA 5TV2A 4NH0A 1XU4A 121PA 1TPZA 1ODFA 5DI9A 2AD5A 5FFMA 3ZYCA 4F92B 5FBQB 4YXWA 2OO7A 2OBLA 1JALA 3AF3A 4H1UA 4LY6A 2R6AA 4BQSA 2VH5R 3CUEF 4G5RA 4GNKA 4CIDA 2J0UA 5KNBA 4BLOA 2GETA 3U3MA 4S2EA 1EFHA 1SVWA 1A5TA 4Q48A 4KO8A 3QPVA 2ZI4A 1R6BX 1XEWY 2G77B 3B9QA 3A1VA 2BKUA 4MRPA 4OHXA 4NTZA 4D0LB 2D2FA 3JVVA 1FX0A 1H65A 2QEQA 2FSFA 4JLNA 3THWA 1IXRC 4HSEA 1D8TA 4QM6A 5BN5A 2CHGA 3GLFB 4QHTA 4C0BA 1KO1A 1U8ZA 2Y8EA 3DZ8A 4G5QA 2KB0A 4N3NA 1PLKA 1O3YA 4AIIA 1P9WA 3EIEA 2ZETA 5CDFE 3DZDA 5JI3E 1AGRA 4ZDIA 2PX3A 4JT4A 1E9SA 4OQFA 2AN9A 5L3VA 2ZRBA 2ODEA 3EA5A 3EPKA 2CCGA 3ZIAD 4US0R 5FUXA 4KODA 4B2LA 2FFHA 3NEYA 2H16A 3WP0A 3G0HA 4BEJA 3TIFA 2YWGA 1JEEA 2J87A 5HTKA 1JR3A 1KKLA 1A4RA 1KJWA 3QXCA 5AUQA 3K0AA 1VCMA 1IXZA 4PHFA 2VHCA 4QG7A 2AXPA 3LLUA 4KVAA 1DG1G 5EJEA 1ZUNB 1UFQA 5G3YA 2QM7A 3VHXA 2CVHA 3OHMA 2XOKA 5FOSA 1AJEA 2OT3B 3E5HA 1UM8A 2HF8A 1J7KA 2QRNA 2QENA 3TSZA 3L8YA 3DEFA 4ACBA 4DUGD 4C3ZA 2WSSA 1TF5A 4LCBA 2G9NA 4DCVA 2ZVQX 2OE2A 3FOZA 1JPNA 1X1SA 2QP3A 1XCGB 4OK6A 2IC5A 5KDDA 1R7RA 3WRYC 4C2UA 2QTHA 1U99A 4OQLA 1QDEA 4PHGA 4B3DA 1AIPA 2JLRA 4A82A 4JS0A 2DB3A 2GZDA 1PLJA 1U9IC 4GOKA 4JLDA 4YC7A 5FL7D 1W36B 1DAMA 1KI1A 1BMFD 1I4DD 1SVSA 2DWOA 2YINC 4CEIB 2YC2C 2QQ0A 1RIFA 2JGNA 3LFUA 3V4FA 3BAFA 4A15A 3R8FA 4EPYA 4YMVA 4KAXA 3V9PA 4XIGS 3SC3A 5FBLB 4OK3A 4PX9A 1KY2A 1SKYB 4DIDA 2QMUA 4M9XA 2ORWA 5IDVA 5H8WA 2HXYA 1Z29A 4C30A 2G3YA 2IEZA 2DPXA 3GD7A 4Q1CA 5KSZA 3GLIB 4HAVA 1CR2A 5UKDA 2H18A 1Q3HA 5K8UA 1LW7A 2C77A 3RS5A 2CE7A 4D0NA 4DIEA 2REBA 4A0HA 4ABYA 4LC1A 3NC0C 4KCGA 2BWJA 1MR3F 1G64A 3A1UA 3KUDA 2ZYVX 5GVRA 4P0TA 1FMLA 4YQFA 1DOAA 2P2LA 2VYFA 3GMTA 1P75A 4M9ZA 5G40A 4AG6A 1XCPA 3SYLA 4KXFB 4UXJA 3REFA 2FSHA 3T5DA 4Q1AA 1CU1A 2AKYA 2RGBA 4B6EA 1WB9A 2A5YB 2RGEA 2Z83A 4QXAA 1OT3A 1E9RA 1XZPA 3UIEA 1QHSA 1NN3A 2XTNA 4XWAA 1W36D 4BZPA 1JJ7A 3EZ7A 2GWHA 3TAHA 2QNRA 1QVRA 1GWNA 2PJZA 3BS4A 4WZAE 3IHLA 2ZJYA 1X8JA 2ZREA 1I2DA 1NVVR 1TUEA 4R98A 1G291 5AJZA 3L43A 2GZHA 2WBLC 2QSYA 1BO6A 5K8TA 2Z43A 3THWB 1JAIA 1XJ0A 4TMWA 4B3XA 3LX8A 3GJ5A 1G7TA 4HB0A 3DL0A 4BRWA 4PC2A 1AGPA 2DY1A 1XTRA 2PT5A 1L7VC 3BXZA 1LF5A 1G17A 2X8AA 3VNUA 2MSCB 1B0UA 1LVGA 1XF9A 4TT3A 4NZYA 5AJWA 2VP5A 3NDBB 3RVBA 1QHGA 2LKCA 1YR7A 1OF1A 2FFQA 3OFND 4C4PA 1E0AA 1D2EA 1IXSB 5CLQA 4EAQA 1SZPA 4KFRA 1IN8A 5JFGA 2KI5A 2GRJA 1ZMXA 3DMNA 3NG1A 4P4SA 3BRWD 1AM4D 1S96A 2GCOA 3RANA 3VU9B 1E2EA 1AKEA 3WNCA 2KBEA 3OFNA 1DG3A 4ZPXA 2X2EA 3FE2A 2FDCA 2ATXA 2CMKA 4AI6A 1W2GA 1L4YA 2GXSA 2DWPA 1NP6A 4U00A 4PQRA 4E03A 4XOIA 1AS2A 5B58C 3GJ4A 3L2OB 3PEYA 2F6RA 5FH9A 2A7QA 4B2PA 3LVQE 3AF0A 5LBIA 2QN6A 1FQJA 1PUJA 2HCJB 2OEPA 3ZD6A 5DIFA 1OYWA 3OESA 3TW4A 5FL3A 4UNPA 2VSXA 2GCNA 4DLVA 4ZCMA 4LHYA 3T34A 2JEOA 1DBSA 4LSGA 4F4JA 3W34A 4TLBA 2A78A 4FMDB 4C0SA 2P0EA 3QBVA 4NP6A 2H92A 4RD3A 3SE0A 1EFRD 1HV8A 4CRWB 4JL5A 1Z2AA 3AV0B 5LB4A 4LWZA 1KO8A 2ZUBA 5FTLA 4FCTA 3DPUA 4YDSA 4JLBA 3PCRB 4DLUA 1JPJA 3SJAA 5D3MB 1U2RA 2FX3A 1E6CA 4P4TA 4RKFA 1Z22A 2OCAA 2ZJZA 3TW8B 3GLHA 4HB2A 5J4KA 1AQYA 3FFAA 2E1RA 1N5JA 2JJ1A 3CRQA 5CK4A 2ZVPX 2XJ4A 1E2LA 4R9UC 5HR5A 3K0FB 3KB2A 4YDHB 2XGJA 4ILEA 2C96A 4XH9B 4BZXA 1OV4A 3FMFA 3ICQB 1R0WA 1AN0A 1VDZA 3C16C 5J4HA 3IKJA 1IY2A 3CRVA 4DCSA 1NG1A 2W0MA 1ZINA 5J4YA 4M0LA 1G18A 4DSNA 1H8ED 1E79D 1M34E 4L15A 3LW7A 5KSOA 3BFXA 4DLRA 3HDTA 4HDCA 4Q1BA 2CVFA 2ZI3A 4UNSA 4WBSA 5HE8A 4DEXA 5JBQA 2IS2A 4JLMA 4JKIA 4BLPA 3KTAB 3PV0A 2JLUA 2J46A 5JSZB 2ZR0A 5CYPA 3DDCA 1W4CA 1GDDA 4DBLC 1W36C 2QUZA 2E87A 3P32A 5HPYB 3EPHA 1DPFA 2ZR9A 3EC2A 4FMCF 2DHRA 1BMFA 2BM0A 2V8OA 3ZVNA 4QNRA 3I8SA 2GBLA 4RZ2A 3TSOA 1W2HA 1FUUA 3LDAA 4EPRA 2XITA 3HJNA 3HYRA 5HE9A 1OLOA 1NIPA 3K9GA 4KYUA 4WAUA 3M6AA 4W7SA 4HUQB 1YRAA 2W6IA 1D2MA 4H9GA 3BB3A 4G3XA 421PA 3FHOA 4XVRA 3GFTA 5LPNA 1NI3A 4F38A 1GG2A 5L3QB 5LD2B 3UMSA 1FL9A 1I4LD 1FNNA 2A5GA 2ZS8A 3U5ZB 2VF8A 3GEEA 2VLIA 4IDQA 1ZC3A 1A2KC 4JVSB 4HUQA 3TBKA 1DELA 1XTIA 4KJZA 2CXXA 3Q7PA 1UEJA 4MYTA 5ELXA 3THYB 1DAFA 3D31A 4DVGA 3ADBA 1GITA 2WVJA 2Q3HA 2JLQA 3AF1A 3C41J 3KUCA 1OXUA 4Z1MA 2F7SA 1LFDB 3K53A 1VG1A 1XXHB 1KI2A 5CYOA 3OF5A 1GILA 1NSFA 1RJ9A 3OEHA 4Q7MB 4DCNA 3W5JA 3MSXA 2YVUA 2WWYA 1YZQA 3THYA 4PTLA 4MRVA 3PEUA 3AKDA 5FUVA 4W9MC 4QJ5A 1BH2A 4Y0AA 1Z6GA 2JLSA 2VSOA 4BWYA 5D3QA 3FVQA 4HYYA 2W2TA 1E1RA 4RZUA 3A4MA 3T61A 3QKRA 1P3JA 2EFGA 3H1TA 4M1TA 1GOTA 3A4LA 3PR1A 5KO2A 4IDHA 1T5LA 4TYQA 3EA0A 1HT2E 2RGGA 3I1FA 4BFSA 3C15C 2YNMA 3B1ZA 5FUYA 5CJ2A 2FEOA 2BEJA 1EFCA 4NL4H 1Z8FA 1VHTA 3GFPA 1YZLA 4PPNA 1M7GA 5DGXA 2IYQA 2A5DA 4HZUA 2H1LA 1R10A 1KI9A 2OAP1 2VHJA 2XB4A 3OIUA 4EPVA 2OFOA 4Q03A 4HAYA 3KX2A 4V0ME 2C95A 2ZYUX 2ZAMA 5F98A 5AJYA 2O8BA 2OESA 3TQFA 3H2YA 5TARA 1F60A 3AUYA 3LW8A 3CWZA 2C5LA 2J5XA 4DSUA 1BOFA 2D7DA 1A2BA 3I73A 2ZE5A 1DARA 1M74A 3VR4A 3NKVA 3W6OA 4NE2A 5FOVA 4YXWD 4F93B 4HAXA 4IEIA 2O8DB 4OKSA 2NO0A 2OM2A 4LRWA 1TF2A 1KDRA 4IW3B 3EX7C 1ESMA 1E98A 3I62A 3GJ7A 4NDZA 4B34A 2IT1A 3WY9A 4ZKEA 5JS8A 2OCBA 3ASYA 1KO4A 4GMXA 4B74A 1OH5A 5AJVB 2PJRA 2JLXA 2J7PD 3CPHA 1FP7A 2QPAA 4GI7A 1MRNA 2GK7A 1E2JA 2CLSA 1U0HC 1U8YA 1XEWX 3B7GA 3EZ2A 2R6GA 3HP1A 5EE9A 4CT5A 2J7PA 4TLDA 3RDPA 2P6UA 2QPOA 4CEJB 5BN3A 3AF2A 4Q19A 1OKKD 3N2EA 4ASUA 2ANBA 2BKEA 3V00A 4KBGA 5GJVC 4RCZA 2VP0A 2CNWD 3LAWA 2Z6VA 4JBXA 1S4QA 3ZQ6A 4TL8A 2VSFA 5DLQC 1N6RA 4A4DA 4FWTA 3P26A 4O3MA 1RRPA 2VP4A 3EZ6A 5EE3A 3RC3A 3P1JA 4DHEA 4JLPA 2HV8A 3CBQA 2J45A 4P4UA 5CJPA 1Z0DA 4MDFA 2GXAA 1QHYA 2VHUA 1PVOA 2WWHA 3FMOB 5KSPA 1KDOA 2I4IA 2WJYA 4W5HA 4PC3A 3IPYA 1G20E 2REOA 1T3HA 3AM1A 2OZEA 2ZSFA 3DM5A 1N5IA 2WJVA 1IONA 2CLCX 5TVKA 1SQ5A 1CJTC 4PC1A 3VNVA 1AQUA 1AA9A 1P2VA 4AC9A 2IS1A 1N3BA 1RE0A 4Q66C 4JL6A 2V55B 1LV7A 5SZJA 4TTPA 3R9IA 1SHKA 1UBCA 2JJ2A 2A5JA 1XD8A 4OI2A 4M9SA 1HT1E 4Q9LA 5KYKA 4JJKA 2X1VA 4OQMA 3OZXA 1T0JB 4URVR 4R2HA 2V7QD 2ZJ8A 2QM8A 4MRRA 4QBGB 2H57A 4JSTA 4O2RA 2D2EA 2JLVA 1CXZA 1VYTA 2GDJA 2WOJA 5L3RA 3UATA 4QGFA 6Q21A 1KI6A 2Z0MA 4LK2A 2OLJA 1N0UA 4QC2A 1TQ6A 2C8VA 2LCFA 2CL0X 2IYVA 4GZMA 1IN6A 2JCSA 3BIFA 4RD0A 2OFWA 3GCGA 4XTRA 5JEEA 1NRJB 3W8NA 2VO1A 1NVXQ 3AP3A 1RFLA 2PEZA 1CIPA 4QRHA 2UZIR 3WXMA 4GDFA 3SJZA 2NO7A 2GJSA 4PAOA 4ZCIA 4HLCA 2QE7A 1TNDA 5C46F 1GL9B 4RD1A 1XTQA 4JVMA 3QKSB 4XD7A 3TR0A 2BDTA 1GKYA 2ZRHA 4A92A 2P67A 1KOFA 2EW1A 1R0ZA 2R65A 3ND9A 2RKOA 5EP1A 3TVTA 1W0JA 4IJMA 3CW2A 2Q3FA 1XRJA 1DVRA 4QHSA 1EWRA 5EZ5A 2JLYA 5EZ6B 3U7HB 2O8DA 4WZ6A 4CDGA 4C2TA 2QY9A 4M53A 4BFUA 2HLDA 4Q4JB 2BCGY 2ZS7A 3K0EA 1A7JA 1E2GA 4D6PA 1FOEB 4LHXA 1KSHA 1XJQA 4GP7A 4B3CA 2OILA 5DYGA 1R8SA 4ZCLA 4LJYA 8OHMA 5CITA 2W6ID 1GL7A 1P60A 2EFCB 4IVPA 4LC0A 3THXB 1Q22A 1K5GA 2O8BB 1QHNA 2GILA 3VR2A 3VR3A 4DZZA 1CS4C 1DADA 2W58A 4N0DA 4FI3C 1G3MA 1T91A 1G19A 3LQRA 1GFIA 1TL7C 2GF0A 5J4LA 3T1QA 1FUKA 2F1RA 3WMEA 2PMKA 1N6OA 2QU8A 4IDOA 1RYHA 2K5UA 3MWYW 621PA 2QG6A 3L0OA 4Q7LA 4AKEA 1ZJ6A 2VRWA 2V3CC 1UDWA 2EYQA 1E79A 1G3IA 1H8EA 1XJCA 2FG5A 3AB3A 4PQFA 1CTQA 2B6HA 4Q00A 3M4YA 4RZXA 3D6TB 4BUJA 1E2KA 1WBDA 4GL2A 2FZLA 2J59A 2G1JA 4BFXA 1G3QA 2BMJA 1J90A 2FSIA 2WIAA 3VMFA 3S1AA 1ZBDA 5TXGA 2C9OA 5HCNA 2OG2A 1KO5A 1NF3A 3I4LA 4P31A 4ITRC 3IO3A 1QRAA 3E1SA 3FMIA 3B78A 5KHOC 1SVOA 3OEED 1JXMA 1KK2A 4PSAA 4C9BA 2F1JA 2GXQA 3SS8A 1NG9A 2ONJA 2WKQA 3HU1A 3QE0A 3NDPA 2UVQA 5C4GB 1ZAKA 1KK0A 3B1XA 3EC1A 3BC1A 4BGDA 1WP9A 3LRPA 2ZI6A 1G7CA 2GESA 4FINA 4QGGA 2FOLA 3T15A 4F91B 4PO9A 4BFWA 1W49A 4A6PA 4MRNA 1RRCA 2HUPA 2WPDD 5BXQC 2J0UB 3OIYA 2VIIA 5J4VA 1DEKA 3AP2A 1OE0A 2W6JD 4Q4AA 2IWHA 4LJ4A 4FN5A 1OXSC 3GQBA 1U90A 1DE0A 4XSHA 3C8UA 3NVAA 3TMKA 3W5IA 2MSEB 1VTKA 2Z4SA 2D4HA 3KB1A 5HKKD 2ZE7A 3BJIC 1Z07A 2DFKB 1CR0A 3O47A 1UBEA 2IW3A 2WTUA 4MKGA 5KNDA 2WAXA 1NY5A 3OIWA 4HDQB 1NMXA 1Z06A 4QOSA 2BBTA 1E2FA 4KHZA 4BLSA 3K09C 4UNQA 3QOFA 1HTWA 2N46A 2QGZA 2MSDB 4DDTA 3GJXC 1G8FA 1ZCAA 3GJ0A 1GSIA 3QKSA 2O5VA 4UQOA 2YHSA 5CB6A 1G41A 4Y0VA 2GK6A 1QF9A 1G4UR 1SXJD 2GEUA 4LBWA 4PFSA 1P73A 2GJKA 1XD2B 3EPLA 2NGRA 4CVNA 5DN6D 1D5CA 1F2TA 1TU3A 2A9KA 5A0FA 5KPJA 1E9FA 3FB4A 3EPJA 2QP4A 1G1MA 4JJZA 4BFTA 2ORIA 4M1YA 4XWKA 2ODWA 1ZUIA 3U44B 1QHIA 4EIWA 2C9YA 5HZKA 4RJLA 1II8A 2YC4C 1RC8A 1N6IA 3U3KA 3CF6R 3GEHA 4Q21A 2ANCA 2A2ZA 3CM0A 3Q3JB 3CRMA 3G82C 1W4RA 2YV5A 1NN0A 1XMJA 2WICA 1CRQA 2ZROA 3AF4A 1RJ9B 3LNCA 2QMEA 2QAJA 2ZYTX 1LB1B 2HCBA 1PUIA 3GLIA 4BE7B 1HY3A 1P4SA 1ZU4A 2IYXA 3TRFA 4IHQA 3WYAA 1U8AA 2NPFA 1CR1A 1RVDA 2VHTA 4DDVA 4KLNA 4AY2A 2PL3A 4ACAA 2C04A 2QAGA 4KFTA 1GL6A 4B76A 1F48A 4DKXA 5KU1A 2YOHA 4LJ7A 3CZPA 2IF2A 4KLZA 1G21E 1F2UB 2VF7A 2V6IA 1YJ5A 2ZRIA 2GJ8A 3E70C 3I72A 1Z0JA 3WP1B 3S1AB 2F9MA 4ZI2A 4AKHA 4I99A 1E99A 4QBIA 3A1WA 3CPJB 1MRSA 2BMEA 4HAZA 2QE7D 1NBMD 1FZQA 3I92A 4A8JC 2OCPA 4CZ2A 1C1YA 3NH6A 4RD6A 4BEBA 1EG7A 4V0OA 3EZFA 3SQWA 3PUWA 4EDHA 4M2LA 5KTYA 1OIXA 3AP1A 4F7WA 4QKQA 2F1HA 1DS6A 3A4NA 4NYMQ 4TYNA 5JJLA 2DBYA 2XAUA 4OI4A 2IYYA 3K09A 2IUUA 2OBNA 4NCKA 3NXSA 3RSLA 1N0VC 4PAMA 1OH7A 5E3HA 5B2ZA 5AUOB 3MJHA 4CEHB 2PCLA 2V7QA 4JVNA 3EG5A 4BECA 4A1FA 3M0EA 3IBGA 4LI0A 3ZH9B 5BQ5A 2HYIC 1W0KA 3C5CA 4HB4A 4HATA 1ZU5A 4MYCA 2JJ2D 2I1QA 1ZUHA 3I61A 3A58B 4URWR 1XD9A 4Q9KA 1GTVA 3D7MA 3B1YA 1NLYA 1JI0A 3B13B 4UXHA 4EPXA 3QVUA 2FEMA 3LY5A 2OSBA 2GAOA 1EESA 3NBYC 5P21A 3CR7A 5TDHA 4K81B 1OXXK 1UPTA 1EX7A 5FL7A 3ZVRA 5FOUA 3X1DA 1UADA 5E4FA 2BIFA 4P32A 2ZS9A 4QM7A 5H1YA 1UAAA 3VR1A 3LQQA 2WHXA 4IEEA 2ZR7A 2CBZA 2XTMA 4DLTA 2GBLC 4JZKA 1EGAA 2V1UA 1HE8B 5JI2E 4LOAA 4NCJA 2NZJA 1NSTA 3W3ZB 2D74A 2AFIE 4Z51A 1YE8A 4DT1B 4LHZA 1ZM9A 1KI4A 1JB1A 4MUBA 2RHMA 2EFHB 2NTYC 4UNNA 3SYKA 3SU8A 3GLGA 2HXSA 2O0JA 4Q9IA 4EJSA 3VQTA 4POAA 4EQ6B 4NYJQ 4FD2A 1C9KA 4NYIR 3X1YA 4QJ4A 1M6NA 3VX3A 1XP8A 3TAUA 3FWYA 4HLDA 5C4MA 3ZD7A 3U6KA 1KYIA 3TH5A 3QG5A 4A2WA 4TL9A 5FOXA 3K70D 5LD2C 3U4QA 3RWMB 1UKYA 5H68A 2QGNA 4A2QA 1XEXB 4II7A 1AS0A 1G3UA 3QI2A 1JR3D 4C0KA 5L8VA 5KPDA 2B21A 5L3SA 5AUPB 2A5FA 2WWWA 5EXTA 2P6RA 3EZ9A 3B8HA 4URZR 4LBZA 5CK5A 3ZIAA 1ZC4A 2FPKA 4JLVA 5DHFA 4FCWA 1N2CE 2FN4A 4OQNA 1HQCA 2PZFA 2WKRA 3KKNA 2HT1A 4IOJA 3NBXX 1RZ3A 3ZGXA 3LBNA 1KDTA 1Q1EA 2CHQA 3BH6A 3L8ZA 5KNCA 2KSQA 1FNMA 4U02A 2I3BA 3L82B 5F2EA 4E5UA 1XB2A 3CIOA 5EE5B 4ARZB 4C7OA 4C0QC 4TL6A 3RWOA 2D3WA 2QMOA 1BYUA 2ZE8A 1KHTA 4TQUS 1NMZA 821PA 2EYUA 1WMSA 3RABA 3RRZA 2F43B 1KJZA 2AHOA 3KJEA 4KFSA 1P7CA 2KBFA 3R7WB 3RS7A 1N6KA 3B82A 3WNDA 2PCJA 3SBEA 4NBSA 4D82A 3BERA 3KXKA 3FFBA 1XPUA 1KAGA 3MFYA 3PUXA 1E2QA 4HAUA 3B6EA 3B1VA 4O2LA 3TSWA 1IHUA 1U81A 2R6CA 3AGPA 4D25A 1E1RD 1K5DA 4PO1A 3R7WA 4QHYA 5TMPA 2FNAA 3O8DA 2FGKA 3CNNA 2BHRA 4XSGA 1IY0A 2IL1A 1HUQA 1IJFA 5J47A 2VP2A 3GJ3A 1AS3A 4R71A 2BEKA 3K9HA 4RVCA 5AUNB 1AZTA 1TMKA 2EFEB 2NO1A 4HEJA 4I1SA 4KU4A 3SI7A 1X6VA 2H17A 4CT4B 1VG9B 1H8HA 3LWNA 3T1VA 1MH1A 1G8GA 2F9LA 1OIVA 3AVPA 3K70C 3QQ5A 1DTSA 2NO6A 2WIBA 3AKEA 2WJGA 1I4TD 1VYVA 1M8PA 5C18A 3EARA 4LYFA 1KJYA 3KKMA 1NIJA 3RLFA 1Z28A 3SHWA 2XX3A 3CF2A 3NHAA 4US1R 1ZP6A 1Z5ZA 2IUTA 3BORA 2IXEA 2ZJ5A 1ELOA 4RFSB 2IUSA 2WOOA 4OBEA 5E7IA 3GLHB 1GZSA 4D4LA 2J0SA 1Q12A 5CDFA 2XZPA 2NPIA 4W5JA 2GZAA 2ZSDA 4JLAA 2R6DA 1U9IA 4KSBA 1SVMA 4A0RA 1XMIA 2DFLA 1C4OA 4LHVA 2R6FA 3I32A 1US8B 2ZM5A 2UZ3A 1L2TA 3SFZA 3GFOA 3SJCA 1COWA 3U7EB 4KFUA 3IGFA 4GRAA 1XCMA 5FTKA 2D62A 3O8CA 2W2VA 2QTVB 5G3ZA 1WF3A 2QROA 4JSYA 1E9BA 5GJBA 3Q72A 1IM2A 4OHWA 2VL7A 1JR3E 2XZOA 3I5YA 1TU4A 1EK0A 1X3SA 5GADl 3IIKA 3KXLA 1L8QA 1XPOA 3IO5A 1E0KA 1GRQA 3AKYA 2OXCA 2B8TA 1G16A 1S1CA 5EUQB 3DMDA 4MRSA 4Q5IA 5FI0B 4DLWA 2BC9A 1OXVA 4FMCB 1HQYE 4ZI3A 1DAIA 2HDNB 4XTCS 1GNPA 2AL7A 3ZQJA 2O8CA 4LJAA 2IA5A 2WKPA 4D4MA 3HWSA 4TLEA 1DAKA 1TQDA 1T3LA 1NLFA 3LV8A 1LS6A 1MABA 1YZNA 3QKTA 2RGDA 2NMVA 2CJWB 3R20A 4QNMA 3QNUA 3VAAA 5EP4A 2WMOB 5CIQA 1SXJB 2OBMA 3V4RA 2N1BA 2QZ4A 2R9VA 4FWIB 3VU9A 1P2UA 4YONB 1UBFA 2OHFA 1T6NA 1KO7A 5KDLA 3U61B 4TL7A 5E7MA 3D3QA 3RRMA 5L3SB 3IDQA 3MRSA 5M04A 2ZRPA 1P5ZB 2QBYB 1GP2A 2ERYA 2O8EB 2QAGC 3KJGA 2J41A 4D26A 2HT6A 2CDNA 3SNHA 3TUJC 1BKDR 2NQ2C 2F3TA 3KXIA 4B44A 1W1WA 3NBZC 4I1VA 1E2IA 1G8YA 1SVIA 1EFRA 1OFIA 3AQ4A 5CM9C 1A82A 2RGAA 4PHTA 5F3WB 1IN4A 2JIZD 1XXHA 2KE5A 2BMFA 5JCZA 4TMXA 2G0TA 3MG9A 4WZBE 4QFMA 3ADCA 1D9ZA 1UKEA 2PLRA 4BLRA 2PX0A 2GXUA 4D4JA 3B85A 2BM1A 3I3SR 2P3SA 1JECA 3M1IA 1MO4A 3LBHA 1WRBA 1ZM2A 2QL6A 4HLQB 2ERXA 4OQXA 4CW7A 2VQSA 1Z0IA 3QY0A 4FMDF 3TQCA 1Q20A 1RYFA 4JIMA 5ANRB 1UDXA 1Z08A 3Q5EA 3J81k 4CEJA 2F55A 4JL8A 4OK5A 1T3SA 4TMTA 4HDOB 2R62A 4V0KA 1VCNA 3F0TA 4MH0R 4NU0A 4DRZA 2PLFA 2YZ2A 2JLWA 3KKQA 5TB5A 4G5GA 1W4AA 2MMCA 3CLVA 1JQLB 2NG1A 3KJIA 1J70A 4Q4AB 4IKEA 4LJ6A 4CEIA 2J7KA 4QBFA 5FBVB 5DI3B 3AVYA 4LZZA 4M4SA 5DN6A 4Q9HA 1W4BA 5IK2D 1NY6A 1QVAA 3TUZC 3AH8A 1XEFA 1YR8A 3WMGA 1CJKC 5TY0A 1T4GA 4DDWA 2RH5A 3P27A 2IK8A 2ONKA 3QXJA 2IYZA 1OPXA 1CP2A 3B5JA 4MGIR 5G53C 1MT0A 2J3EA 2C99A 2RCNA 5F9HA 4OI1A 3IIMA 3ZVMA 4OYHA 4RFVA 4HUTA 1S3GA 5JZVA 2FA9A 3C4JA 3IIJA 3HR7A 1EFTA 2WJIA 3U3RA 5HKKA 1CJUC 3K0FA 3LD9A 4G5OA 2WWXA 1E2NA 2AX4A 4XVUA 3K9LA 4LBVA 4EFMA 3BB1A 1OH6A 4NCHA 4UNRA 2C9CA 2W6JA 1XMVA 1JR6A 5F9FA 3H86A 1JAHA 5FOWA 4TQ9A 1GAJA 2WPDA 2Z4RA 3BH7A 2ZRFA 4US2R 3KQKA 3VR6A 5AK0A 1ZNZA 3A1TA 3UMRA 4BLQA 2GAAA 4C0JA 4PZZA 4BPBA 4C0AC 4GOXA 2MMGA 5JWHA 1J2JA 1GNQA 1KI8A 3GLGE 2ZPTX 3AGQA 4DT1A 3ZLJA 3ECCA 5CLLA 3SJBA 1KNQA 5K8LA 2CJWA 2ZUCA 3KTAA 5DH9A 4DCTA 1EWQA 1G7SA 3T12A 1NJFA 2WAYA 3GLFE 1M2OB 3CH5A 4BASA 2DCUA 2JDIA 1BS1A 4I81A 4IOMA 4TQAA 1E94E 3FDIA 5E95A 1FTNA 2EWVA 3K70B 1P2SA 3PUYA 4OHVA 1HURA 2ZSEA 5C1BA 1TEVA 2ATVA 4GBMA 4TYYA 3F3YA 4B33A 1P62B 4G0NA 1KGDA 2EWWA 1SVLA 2O8FA 2VP6A 4C7OB 1KI3A 1II9A 1N5KA 2GEDA 2KWIA 3U2QA 5HZHA 1P2TA 4Q47A 1OHHA 1OYYA 3U60B 2O8CB 3BB4A 3QXXA 3KQNA 1E9CA 4E09A 4Z54A 4DB4A 3B2EA 4LJ5A 1X8LA 1YRBA 2UKDA 2QT1A 1GKUB 1PLLA 1SHZA 4P3YA 3IILA 1R4AA 3E2IA 2DWQA 4J0QA 2W00A 4G5SA 3A1SA 2HJVA 4YMUA 1Z6TA 1R5NA 2VPPA 3P20A 4JMPA 2GJAA 1MKYA 1OHHD 1S0UA 4FW9A 5JHHB 3KDSE 1JJVA 3ZS9A 2O52A 1K8RA 1N6NA 2Z5FA 5KOYA 3IHWA 4KVGA 3GLGB 4NPHA 2GKSA 2VBCA 1KMHA 2WWFA 3VFDA 1VYUA 2XTZA 2V6JA 1VKJA 4AYXA 3AVOA 1G3RA 1G5PA 5IRCD 4TZ0A 4NYJR 2JDID 2CK3A 4HB3A 2QQEA 1KZGB 4RKEA 1KK1A 5CB8A 3ZS8A 3IEVA 2GVZC 4IRUB 3EIHA 4K8OA 3QF4A 5EQTA 3MWLA 2HLDD 4D0GA 4KV9A 1OSNA 1VECA 3B1WA 2WSSD 4DUGA 5LDDC 3R8CA 3EIQA 3GEIA 4L16A 2G88A 3X1WA 2PH1A 3RC8A 3CRW1 2XXAB 3CX8A 4LYHA 5GJCA 5H70A 1LY1A 1KZ7B 3REGA 1WDTA 3MCAA 2IS4A 1M1YE 4UJ5A 4GP6A 5FPHA 2FGJA 2CHVA 1MOZA 3EXAA 4MGYR 1K6MA 2J0VA 4PPQA 3RS4A 3UKDA 1OXTA 5FPSA 1R8QA 2QT0A 2ZU0C 1ANKA 3NTUA 3VX4A 2V54A 4BFVA 1VPLA 1Y3AA 1CJVC 3BFKA 1ZRHA 3TVDA 3MJRA 4DEYA 4RD4A 4MQBA 3U6BA 1TF7A 5D3MA 5JHGB 5FBWB 1TADA 1HYQA 2BJWA 4G1UC 3VHLB 4ESHA 3PEVA 3QIAA 3LO5A 4CF7A 2ORVA 1NN5A 1GRNA 3B60A 1V43A 1XMSA 3AVQA 3DOEA 4HZIA 5IK2A 3X1ZA 2ZJBA 4A8JB 3TE6A 4U7DA 2FJUA 3AVWA 1CEEA 3IBYA 1Z0AA 1KMQA 3PENA 4R2IA 1J8YF 4B32A 5E7JA 4B2IA 3CO5A 3RHFA 2FF7A 3AEZA 1S1MA 2ZAOA 1YHNA 1PJRA 1I2MA 4Q7JB 1E0JA 2Q21A 1DAGA 4KI0A 4AWXA 4O25A 1Q1QA 2RHDA 2YYZA 2V1XA 1TAGA 2NOAA 3LA6A 3T35A 2PZEA 2O8FB 3MWJA 4RD2A 1SKQA 1WBBA 2WMNB 1VIYA 2W0SA 1NLZA 1KKMA 1OFHA 3DVLA 3UXMA 5HCIA 1XDBA 3G5UA 1FQKA 1MABB 3SFVA 2ZSBA 1Z3IX 4PANA 4RY2A 1YVDA 4FMBB 4MUAA 4NYMR 5EXPA 2GJ9A 4MKIA 1XD2A 4Q1FA 1GM5A 1F6BA 2ZTSA 5SZIA 4YLGA 4I1UA 3MLEA 3K0AB 5C2JB 5GVSA 2QSZA 3HR8A 1Z63A 4B71A 1EX6A 3WHLA 2E9SA 3FTQA 4IFBA 3SDZA 2NZ8A 2O0HA 2CNWA 3JVUA 3SOPA 2GCOB 4YMSA 1Q1BA 1UKZA 2ZANA 2C78A 2D06A 2ZJ2A 1LNZA 3PXGA 3VKGA 3U44A 3K0CA 4ASUD 2X77A 2ZJOA 3F5FA 4Q01A 5IHPA 2EQBA 1QG4A 3ZZ0A 3U3OA 4Q4LA 5EP3A 2OUKA 4JYBA 2V9PA 3OIVA 1HA3A 2GEVA 1IOZA 2YWEA 4D2IA 4D4KA 3MAAC 2IWRA 2IXFA 3QKRB 4JBWA 1G6OA 3CB4A 1OW3B 2PMDA 2BCJQ 1YZTA 5EXSA 2TMKA 1CR4A 2XZLA 1WCV1 4ON9A 4EJSB 3ZJYA 3IQXA 3LH5A 1VG0B 3PG5A 4HAWA 2DR3A 1E4YA 2F3RA 1N0WA 2PEYA 4GPTA 3UK6A 5KSYA 4GZLA 1F3OA 4LYAA 3IEUA 1T8TA 3BH0A 5J40A 3A37A 1N5LA 2RGCA 3DO6A 4W5WA 3PEWA 3F8TA 4ERNA 1GIAA 1G6HA 3GJ8A 4MKFA 2DFNA 2EVWX 1FPMA 2AXNA 2PBRA 3C14C 5IT5A 5AR1A 4FIDA 3A6PC 3MD0A 3WBKA 4WOPA 5DISB 4N0EA 3WHKA 2ZEJA 2A3RA 4PQYA 4QJ3A 1O87A 3C7KA 1IAQA 4PSKA 2XB2A 4PZYA 4LUCA 5EE0A 5JCPA 1R0XA 3EW9A 4C0LA 1COWD 1GVNB 1X86B 5JMTA 4WIAA 3R9WA 2CL6X 4E22A 4PSVA 4M8NE 3KQUA 1CJMA 4X8OA 1ZNYA 2XNDD 5BN4A 5JRJA 1UEIA 3SEAA 2NO9A 4LHWA 5FI1B 4ARZA 1QG2A 1Z83A 4AK9A 5DNYB 1ZD8A 2ZRGA 4A8JA 1II8B 1YKSA 3ZDQA 3K8YA 5DI3A 1Q3TA 1US8A 4IDNA 5DSZA 4EUNA 1E69A 3MWKA 2Q9BA 1GKIA 4TMZA 5BYKA 5KDOA 221PA 4LJ8A 1GUAA 2QI9C 3WRXC 1AKYA 2IBMA 4URXR 2R2AA 2YWFA 3CWQA 1DO0A 2FPMA 2REXB 3MMPA 4V03A 3GLFA 3OEHD 2C03A 2G1KA 5JECA 4RFSA 2GCPA 1ZM7A 1H8HD 2G83A 3NIBA 2SHKA 4X8MA 1ZNWA 4M1OA 3ZVLA 4KSCA 3IPXA 1P61B 2JA1A 2QPTA 3TLXA 4Z1MD 1UBGA 1RRGA 4OHZA 4MITA 3QUSA 3K0SA 3KQHA 2AD1A 1S9DA 4DB2A 2ZRAA 1NL3A 2XSZD 4GT1A 4IFEA 1ZYUA 4RSGA 5FUWA 1R5OA 3FKQA 4URUR 4KBFA 1NN1A 3DM9B 2ZRLA 4P33A 4DWJA 5A4JA 1OB2A 1XWIA 3T06B 2ZRMA 2DFTA 1G8PA 3BGWA 3W6NA 3P4XA 4JBYA 1UF9A 4NONA 2IX3A 3VKWA 4TLAA 1QHHB 4NMMA 3BK7A 2XNDA 3T1OA 4B75A 1V5WA 1IQPA 1HH4A 4BZQA 4D80A 5AJXA 1E9DA 3PIRA 4P4SB 1AK2A 3W90A 1NJGA 1DAEA 3DOFA 4K46A 3CRRA 3W9YA 1N6HA 4I1OA 4LBYA 3PVSA 4PPGA 3ZZTA 4DLZA 2B92A 2J1LA 4F4CA 3QPUA 4MYHA 4MDEA 3HPQA 4GOJA 4EPWA 2IHYA 1E9AA 3C5HA 3R9XA 3WMFA 3VTKA 3OE7A 4ZDKA 4B3FX 2FSGA 4IOKA 2IYTA 4Z8XA 4B43A 5CM8B 4F4IA 3QEOA 4UJ3A 4LJ9A 1OH8A 3CX6A 3K9NA 1WQ1R 4TWZA 3EASA 1SVKA 2BBWA 4OI0A 4GMDA 4LX0A 2G0NA 4DLXA 3PUZA 3LXRA 3NH9A 4LPKA 3CR8A 1TTTA 1XTJA 3DKPA 2L0XA 1IN7A 3QF4B 1ETUA 2Q0HA 2IHBA 4QBHA 4WW0A 3TJZA 4B6FA 4WXPA 3QSYA 2QMHA 4MGZR 4D81A 2FFBA 4HLUC 1W7AA 1L4UA 3WNBA 2A30A 1E2PA 4X8HA 1S3SA 3U7FB 5JLJA 1E9EA 2AWNA 1Q21A 2JJ1D 1TQ4A 2H8KA 1SKYE 2ZI7A 1KI6B 5EE1A 1PZNA 3QBTA 2FFAA 2FV8A 1FW6A 3GLIE 3Q9LA 3ONWA 1UJ2A 4KYIB 4PC7A 1FX0B 4DSOA 3CZQA 2ZQ5A 4KITB 2W2XA 4Q1DA 1J8MF 3OAAA 1CBUA 1SXJC 5EP2A 4V0MA 1E1QD 2ZRCA 1F2TB 2FU5C 3QPWA 3TKLA 1NVVQ 2ODBA 2OXRA 1XTKA 1Z6AA 2QAGB 3THOA 3AVUA 5BW8A 4XWOA 2IYUA 1ZNXA 1RW4A 1DAHA 4NKRA 5FPYA 4LV8B 3T5GA 3L0PA 4X8LA 4LV5B 4M22A 2IEYA 1SXJE 4M1WA 4H1VA 1YZKA 3MUFA 2HEIA 2RGXA 3AVVA 1HEIA 3GP8A 1AZSC 3A8TA 4XVQA 2BJVA 4PPFA 5DE3A 1XFAA 2BBOA 3DKVA 1Q57A 2X2FA 1SGWA 1QBKC 2OV2A 2WJHA 4IOLA 4V0NA 1JNYA 3UWOA 3X1XA 3FHCB 5JEDA 1W0KD 4ESVA 1WXQA 1YU9A 4DLSA 1T0HB 3O8RA 4IDPA 2YOFA 4AYTA 4PAQA 3I5XA 2CCKA 2ZSAA 3WYFA 2ZXUA 2BBSA 3UPUA 1CKEA 2FH5B 5FTMA 4M1KA 4C0HA 4DCUA 5A5GA 2JAQA 3AUXA 4CYMA 3RYTC 4AYWA 1FFHA 3K1JA 5FTNA 4L9WA 2XXAA 4TT3D 2J9RA 2D7CA 3FHTA 1KTVA 3FMPB 1G5TA 4Q4HB 4RCYA 3CH4B 4LYJA 4A0FA 1N6LA 2IYSA 4YMWA 2QTFA 3QEJA 4NCIA 1XPRA 4JLOA 4M9QA 2WWIA 3FGNA 1ZVQA 4BFZA 1OIWA 1NNEA 4PZLA 1NBMA 2AK3A 1XBTA 3IQWA 1ZM4A 2PZGA 1WA5A 2JATA 2LKDA 4LV6A 4A9AA 3GLHE 3Q8XB 4PHHA 4IVRA 1Q0UA 3K0CC 5FR2A 1E2MA 4OHYA 1CLUA 1KIMA 2P6NA 2DYKA 2WJJA 1II0A 4TSFA 1U0LA 2IXGA 5GJWC 4U5XA 3NWJA 4TSFD 4DSTA 4Q9JA 4ZV4A 1ZIPA 2KJQA 2ZU6A 4TMVA 1XX6A 2NIPA 5SZKB 3H0KA 3W6PA 4AD8A 4A2PA 2FWRA 2IYRA 3SR0A 1PV4A 3RRYA 4YMTA 4MGKR 5DYIA 3ETLA 2CK3D 2WSMA 2B7BA 2W83A 3A36A 2QBYA 1RRFA 4JYCA 1U94A 3L0IB 2FPLA 3IUYA 4HLUA 4WXRA 4A36A 3T1TA 4IXMA 521PA 2XNSA 1GNRA 1D2NA 1XXHE 2JJ8A 2QA5A 4MYUA 1KK3A 4B3BA 1EXMA 5JRZA 3PQCA 4B35A 4AKGA 1S9HA 2PT7A 1Z0FA 2F1IA 2RGNA 2ECKA 2G6BA 2H7VA 2ZI9A 4GFDA 4QGHA 2ZE6A 1IJEA 1KSFX 1S8FA 2YOGA 4QL3A 1KAOA 1JQJC 1N6PA 1NMYA 5JWOA 2JLZA 1T9HA 4JKYA 1J99A 3BE4A 4A6XA 4V0LA 2YKGA 3PJRA 1N25A 2FE4A 4Z8YA 1G4AE 2WWGA 1KSJA 1E2DA 3BD9A 4Q1EA 1FP6A 1SXJA 5SZHB 3EWAA 1WE2A 2ZUDA 4EQ6A 4CGZA 3GPLA 1JEDA 2OAQ1 3D8BA 4LPSA 3THXA 3RNLA 3CPEA 2AKAB 4UXIA 4M1SA 1P9RA 4PO8A 2IYLD 2OLKA 4L8GA 4ZIRB 3ICEA 3U4QB 5EXXA 2LWIA 1QHXA 3Q7QA 1XEXA 3BFVA 3UG6A 3NEJA 1CRPA 1YQTA 1CF4A 4DDUA 1MO5A 1VHLA 3EAQA 3PFIA 1E3MA 5FBRB 3TK1A 1B23P 3QKUA 1VG8A 3QENA 3L0SA 3KZ1E 1Q44A 4MKHA 3CF0A 4DJTA 1W47A 5FOTA 3AVTA 2I1VB 1E1QA 4TTQA 2CE2X 3OAAD 4TLCA 2EU8A 4NYIQ 3Q5DA 1BYIA 4HI0E 4Q7KA 2XOKD 3NC1C 4AG5A 3FYHA 1D9XA 3LVRE 1E4VA 4PC6A 2HF9A 5FTJA 5JJKA 2B7CA 4Q4HA 1ZD9A 1U0JA 1W46A 2HYDA 4OJKA 3MGCA 1OFTA 1F2UA 3OEEA 2Q9AA 3RS0A 3KJHA 3AVXA 1CULC 1VIAA 1RKBA 1W44A 1X8KA 2AR7A 3AKCA 4FCVA 5EUMA 2V4ZA 2ODNA 3WYGA 1ZW6A 1ZCBA 1NVWQ 2RGNC 2JASA 4Q18A 2CEAA 1LS1A 2ZYWX 1YR9A 1QZXA 2BVNA 2GTPA 3UWKA 2R8RA 1DO2A 3UMFA 4EPTA 5B64A 2QRZA 3QJYA 5FR1A 5B30A 2RMKA 2RAPA 1E96A 1NKSA 4B3GA 1G8HA 3JZMA 3O8BA 5DHAA 3W8RA 1UKVY 5JS7A 2P65A 4L5BA 2N42A 3TGPA 1E32A 1NKTA 4ZDJA 1Z6XA 1M7BA 3OE7D 2ASEA 5AWFC 5BYJA 2CLDX 2ZRKA 2P5SA 4ZKDA 1W48A 3HPRA 4LDJA 4MA4A 3RRNA 1OB5A 3SYNA 1ZM3A 4BRUA 2ZI5A 3B9PA 4DC9A 4ZO4A 3RS2A 3FPAA 2QP9X 3SZRA 3BOSA 2FMXA 4PXAA 4R7ZA 2H5EA 1XZQA 1OJLA 5J5CA 3KKOA 4TN1A 1Z6YA 4TMKA 4URYR 3JZAA 2WV9A 2JIZA 2ZITA 4AURA 1R0YA 1KI7A 2XEXA 4B47A 1T8UA 1W0JD 1JBKA 5B57C 2FZ4A 4TZ6A 2XSZA 4S35A 3ADKA 3P4YA 4HZUB 1RPZA 2XJ9A 1T5IA 4QGAA 3CONA 4DLYA 4TYWA 721PA 3GJ6A 4IVQA 1NVUQ 3UANA 4XD7D 3VKHA 2VEDA 2AK2A 3ASZA 1XTSA 3TNFA 5LB2A 2GNOA 5L3QA 2BV3A 3TR5A 3CNOA 1P6XA 3Q85A 2O0KA 5JSZA 1Z0KA 1ZD1A 1FMJA 2GVDC 2CCJA 4NCNA 4TTRA 2VTKA 3RS3A 2VP9A 3NHBA 2EFDB 4L9SA 3N5CA 4N1AA 3ZZUA 3SQXA 4BLTA 3KL4A 2CL7X 2Q3MA 5IF9A 1KY3A 4I4LA 2O8EA 3LBIA 2Q6TA 3FKSA 4FXPA 4M21A 3QXHA 2YWHA 1GRRA 1LF0A 1XNJA 1W5TA 3QG1A 3VR5A 1KDPA 2J0QA 2OFXA 2B8WA
chains in the Genus database with same CATH superfamily
2G76A 5DO9A 4FT4A 1VJGA 3GC6A 3OC0A 1G7RA 2G67A 3AOGA 1G9XA 2RB4A 3AMVA 3N2IA 1T2EA 3EWSA 3WLPA 2LP4Y 1ZGHA 4L4ZA 4Q4JA 4DXAA 2G63A 4J43A 3SZLA 4B82A 4B3TB 3V6LA 4LGMA 1TX4B 3OBIA 1N77A 1VJ5A 2XNHA 2YXBA 1EFUA 3PXCX 4QXQA 2VKQA 2ZIAA 4JYZA 3LLMA 2GA8A 1AUVA 1MJFA 2YBDA 2WYHA 1I3KA 2YQ5A 1ESNA 1K27A 1EXVA 4NATA 3DXXA 2IS6A 3AJRA 5J23A 4A0GA 2D1QA 1TZMA 3HYTA 3L0DA 3KAPA 3CNLA 3HTXA 4WH0A 4WECA 3V8VA 3NHMA 3ND8A 3A6LA 3FDZA 2IYWA 3LK7A 1BWSA 5B12A 1MV5A 3CVJA 3MXOA 4F56A 3U7GA 3IPRA 3V3TA 3VBCA 5EERA 5A0TA 4UHEA 1GGFA 1EM8A 2HBZA 1YZUA 1R2QA 2IW1A 1CQZA 5IAGA 4EMBA 3DFZA 3BRCA 3PUVA 4NHOA 4WV3A 4Y3UA 3TR6A 4EMTA 3ADDA 3M5CA 1XYYA 3NBFA 2BOVA 3NKFA 4R01A 4R7TA 4W5RA 2FQ1A 4AU1A 1B42A 2XBLA 3GRRA 1Z4MA 3GGGA 3ZDFA 3SS7X 1SWWA 3G85A 3AZOA 1KSGA 5A2GA 4DHWA 4LYDA 3LKVA 2H2GA 3OHSX 1TEXA 3IPCA 2B69A 2B1GA 4UKDA 4XQ0A 1LK5A 3RYHA 2QORA 1Z13A 4ZQIA 3S2FA 5BNWA 1JXOA 4TMYA 2L18A 2JFHA 1M7HA 2R6HA 2WZDA 1IBRA 3OOSA 4UU8A 4EFLA 2OCYC 2X0NA 2J3MA 4IXNA 5HGJA 2A9VA 4L4UA 1JPUA 2F3UA 4HXFB 2YJTD 4DV4B 3KWJA 3PA8A 3HU3A 1Z4OA 1VCIA 4MEBA 1ONBA 1YNSA 2P6PA 3PITA 4QGBA 2VJMB 1RDFA 2I76A 2WM9B 3GGCA 3JRNA 1LVUA 3QBJA 4U0JA 1R5BA 4U63A 4FIZA 3E9RA 2C8JA 4KJXA 1I2ZA 1J24A 1U3GA 4RLQA 1IN5A 4ZGGA 2BZ1A 4CR7A 4MYRA 4LNUB 1NKVA 2P1RA 4L7QA 5K3FB 5K8IA 3BBPA 3C4QA 4P54A 5AIBA 2PU7A 2GHIA 3H99A 1W5SA 4MCHA 2PSSA 2UAGA 1EJ0A 2C97A 3K30A 1SRQA 3L01A 1I2CA 1W35A 2DBVO 1ODFA 5DI9A 2AD5A 3UJHA 5SICE 4F92B 1JQKA 2BFDA 4QFDA 1SK8A 2OBLA 2QGFA 3AF3A 5F12A 5B53A 4BQSA 4PG6A 3PLNA 1WDWB 4BKPA 1FA9A 5EVCA 3QEBZ 3F7MA 1XAGA 4GNKA 2W9XA 3U3MA 1PBNA 2IU4A 1EFHA 1UZAA 1PI3A 1NW5A 4KO8A 5JR3A 2ZI4A 3A31A 1R6BX 3Q2OA 2G77B 4WESA 4WOBA 3SSAA 3EH1A 5JZSA 3A1VA 2DQSA 1KU6A 2A4MA 4MIEA 2E4ZA 3PHLA 4MRPA 3Q3VA 2WDPA 4D0LB 3JVVA 3WJ7A 3JQPA 5EJ8A 4K8RB 4DV5B 4JLNA 5J2UB 2YJ3A 3CLUD 4JBNA 1V16B 4HSEA 1D8TA 2AOTB 3H16A 1GDHA 3GU3A 1ULUA 5ALDA 1K92A 2Q7OE 5BN5A 3QZUA 5H9VA 1ZLXA 2IHUA 4C0BA 5CCDA 4DMRA 3GLFB 5LMNB 5GIPE 1MXFA 2AV6A 1O3YA 3HL0A 3I3OA 3CNQS 3QVKA 1P9WA 2YNMD 1RCFA 2ZETA 3D54D 3DZDA 3ZD9A 1AGRA 1EUZA 2YDYA 3DXYA 4N8EA 4TXHA 4XWTA 4JT4A 4EVRA 5L40A 2YV2A 1JDTA 1TLFA 5EJAA 1DCMA 2TECE 5ALTA 1MT3A 1RHUA 3OE1A 4GOMD 5TPZD 3UTCA 3VTAA 4EATA 2CCGA 4Q1VA 2Z2IA 1A72A 3IS3A 4US0R 3ZIAD 3WIEA 3PQ4A 1EIZA 4MP6A 3H9EO 3NEYA 4DS3A 2H16A 3C6BA 1F8YA 2HIMA 2CDBA 1PJZA 1PL0A 5K45A 2DT5A 1B1CA 3A6HA 5ED0A 4YASA 3BJMA 2K7FA 4U1RA 3P2IA 1JIVA 2ZUFA 3Q15C 1TKAA 4IIDA 2FEAA 4UMFA 5FD8A 5HF9A 3ZPXA 5KQMA 5JVDA 1IB6A 1KJWA 1EH5A 2GD6A 2VWGA 2WV7A 1VCMA 3N7AA 4B4DA 8GPBA 3N2GB 4QG7A 3K6SB 1KBQA 1SFRA 2EF0A 2XWBF 3A9VA 4IDDA 3W06A 5F21A 1I9GA 3FGZA 2XGSA 4JITA 4JENA 1ZUNB 4KVAA 2FWJA 1CP3A 3AEUB 1O8BA 3S0JA 3WKBA 2WKSA 3HGTA 4U2GA 4FOPA 2IE0A 4JBGA 4MIYA 2CVHA 1SQ0A 2XOKA 4P98A 5FOSA 1NDQA 2OT3B 3AONB 1KIFA 3LNTA 3T4EA 5JOQA 3ZNPA 1F4VA 3GRFA 3H3JA 2QRNA 4GYKA 2XOEA 3FPJA 3ZE7A 1RBMA 4DUGD 4N65A 1D7AA 1XVLA 2HC9A 2G9NA 2O07A 3QLUA 5JCXA 2VSQA 4GSKA 4JI3B 5L7WA 4KLAA 1KQ3A 2O5EA 4X71A 4UMDA 1N2CA 4OK6A 5E4TA 4QYMA 2PLAA 4LYYA 3KYIB 5SYAA 5JQGF 1KARA 1U99A 3PC8A 2QTZA 2CMHA 1BXZA 1VSUA 1AIPA 4B3DA 4G9EA 4ZMSA 1NUSA 2FEPA 4IJQA 1HSOA 2DB3A 3UQYS 2FPRA 1PLJA 4S3MA 2AXEA 1L8XA 1W36B 1X7WB 1JHXA 1PGNA 1SVSA 3G7NA 3GLRA 1E4EA 1ZIXA 3IAM6 4J3FA 2QQ0A 2JGNA 4CE6A 4A15A 4QUKA 3BZUA 1TVEA 4ZXFA 4E11A 4KAXA 1WV1A 3OOHA 3STWA 5FBLB 3V9PA 3ANMA 4AECA 3RTEA 1P9LA 3ZU4A 1CVLA 2MJLA 3HZOA 4PQGA 4DIDA 1LV8A 2ORWA 3L0ZA 2HXYA 3PUIA 5CHYA 2QDXA 2G3YA 5KYVA 4HDMB 3ZWVA 4DMHA 1PT8A 2GCIA 1A27A 4GKBA 4HAVA 1I7QB 2H18A 2CV1A 1Q3HA 3RT7A 2J9YB 3PPVA 1WPGA 3DAOA 3RS5A 4XEHA 4MVJD 1BN7A 4XJSA 3OTWA 2Q3CA 4A0HA 1P81A 3NC0C 3O8OB 4LC1A 4PG7A 4Z2AA 3GBSA 4GR4A 4IGAA 2Q29A 4JCCA 2Z04A 5ALSA 3LDUA 3Q3CA 1FMLA 3T3PB 5H4HA 3ELYA 2VYFA 5GM2A 3V8MA 5BNTA 3L3BA 4M9ZA 3SYLA 1JZSA 4CODB 3T5DA 4Q1AA 1CU1A 2AKYA 3JQAB 1T26A 4TYMA 2Z9DA 2R8OA 2RGEA 2RK4A 3S2YA 1F12A 2AA3A 1OAAA 2R1TA 5CM2Z 5CFZA 5CXUA 1M5TA 3UN1A 1UT6A 2HHAA 3TDMA 3UIEA 2WG1A 5K0GA 2UU9B 4GRDA 7MDHA 3U0VA 4P36A 1L8AA 1QUEA 1W36D 1IEWA 1L7RA 2JHGA 2GWHA 3KR0A 3TAHA 1HDOA 4GLLA 5F23A 4JUDX 2QNRA 4HYQA 5E6UB 4KPEC 1GWNA 2P69A 4RV9A 4KUGA 1YD7A 3BS4A 3IHLA 2AI2A 5TNXA 2J5BA 1QE0A 3K92A 1DRUA 3Q7EA 1MCZA 4UCWA 5FWYB 1OLUA 1M73E 3H8SA 5F35A 1TUEA 4WE3A 1G291 2R8PA 3L43A 3PDJA 4WCFC 2WAOA 1ONNA 2YZMA 5F1KA 4YGXB 3T3GA 2FPGA 2PX6A 1I0ZA 6REQA 1OTYA 4XAQA 3G5TA 2YJZA 2IPOA 3A4TA 4INJA 3CVWA 3ABIA 3LHSA 3B6IA 3KT6A 3PDWA 2HTEA 3DL0A 3CVVA 4KACA 1C9NA 1H69A 1UINA 3ECAA 1RC0A 4PC2A 3ZWXA 3NTQA 1EFVB 1YVUA 3R3UA 2HNAA 3BXZA 2YJ4A 3QMPA 4OAQA 1G17A 2O3QA 2GLXA 3TRDA 2WU8A 3VSBA 3EN0A 2MSCB 1B0UA 1LVGA 1Q84A 1EE2A 1F38A 1RMQA 2FEWB 2Z2JA 2ZJ3A 3BDVA 1YA4A 3GRPA 4NZYA 3O8QA 2Q2VA 3WBFA 3NDBB 1PR9A 4CJXA 1QHGA 1ID1A 3NDJA 2ISCA 3TGWA 4XGRA 3OZIA 4XUEA 3WGVA 4U6QA 1RQNA 2Y4OA 1ORHA 1B43A 1JFVA 1SCUB 2P0AA 3IJEB 3PNBA 2JFYA 3R1IA 3BRWA 2YFQA 4ND6A 5TQ0A 2Q5FA 1WZEA 5CLQA 4ER5A 2VQFB 1IZ0A 4R31A 1IWOA 2G1AA 3HKDB 2KI5A 1MEOA 3DMNA 1NXWA 5GOTA 2LBPA 4N7JA 3RC2A 3HKCA 3A9WA 1ISIA 3JZDA 1E2EA 1HI9A 3LSTA 3RANA 3WNCA 4DFDA 1OFUA 1UMCB 4BS9A 2VRCA 1QTNA 1RYNA 1R6TA 4Y9RA 2X2EA 4AI6A 1W2GA 4HRVA 5EJFA 4IILA 3WLAA 2K2QB 4DMCA 5ULLA 2XB9A 3G2JA 1B3RA 4P38A 4Z53A 4E03A 3F78A 2VJAA 1AS2A 4EGFA 4CT0A 4X64B 4U7JA 3GJ4A 3OZ7A 2WQZA 4H7JA 4Q05A 4MUXA 4P9NA 4ZD6A 4AVYA 3PEYA 1HFEL 1DXQA 3QJ5A 1L3IA 3UOWA 3AINA 3RYHB 2B4AA 4RKWA 5DASA 2AW3A 2V8BA 4RU1A 2AUMA 2P4QA 3R5JA 5K0ZA 1MOQA 2SKCA 1X1QA 3FUCA 4P22A 5KJFA 2ZM6B 1HG1A 1ZXBA 4PLFA 1WJGA 4RHEA 3ZD6A 2B8NA 3KZOA 2Y99A 1OYWA 2NYRA 5H0IA 2VSXA 1ISPA 2GCNA 5BSMA 4DLVA 3ZOKA 1JIQA 5I8WA 3OSZA 4KR2A 4MV4A 3EVAA 3T34A 2VATA 3UM9A 2OC9A 4F4JA 2QJOA 3W34A 2DP4E 1B0AA 2X13A 2A78A 2XTJA 2CFOA 3U3DA 1VSQA 2QUBA 1RVV1 3NPAA 2RBGA 1GPBA 3KQPA 1NOIA 3NHSA 1E89A 1I0IA 4NP6A 4BVHA 5GZ1A 1GAEO 3VRHA 4JL5A 3SF8B 2WUDA 2NU8A 2UZ1B 4LWZA 1FVHA 1KO8A 2C2XA 2RI6A 3BMXA 3NHWA 4Y9DA 4JLBA 2BDUA 2ZJ1A 3HGQA 1JPJA 2MSKA 4P7FA 1HLGA 4FDTA 4G1FA 1V4NA 2Q6KA 3HUDA 1ZI9A 1E6CA 2QUAA 3H9JA 2LNDA 2ZJZA 1HT3A 2OHGA 3KOUA 1WCIB 3JZFA 1AQYA 4DA6A 3ILHA 2E85A 1N5JA 3P2JA 4UFPA 4BJ1A 3CPSA 2ZVPX 3F9CA 2R2GA 3B36A 3PNLA 4MTCA 1LNQA 1E2LA 5C31A 3R74A 4ZCQA 1W2WB 2VYND 3K0FB 3UOAB 5I48A 3FFWA 5KSYA 4WNAA 4ILEA 1X2EA 2C96A 1LZKA 1WXDA 1YQGA 1C7IA 2Q4EA 4WESB 1D2HA 3BMOB 4X5OA 4XH9B 4ZOQI 2OMKA 4BCCA 3K73O 3GMIA 1VDZA 3IAEA 5FQNA 2ZXEA 1NXVA 1JA1A 2B9EA 5KYTA 3AG6A 1C1DA 1NT4A 4RE6A 1IY2A 2VJNA 2H1VA 3CRVA 3ZU5A 2GCEA 1VGRA 4GXTA 2C94A 4WXMA 2EJBA 4CUKA 3ORSA 4YXFA 1E9VA 1FQWA 1L9KA 1QVVA 5EYPB 3TOXA 4Z4QA 2ZIWB 2BSQA 1G18A 4YDQA 5A5VA 3E7FA 4NCBA 1E79D 1NBAA 4L15A 5JRDS 2X2PA 3HCNA 4WBSA 3KT8A 2I67A 4JKIA 2PUCA 3KTAB 2NUAA 2J46A 3K8OE 5FNVF 3M81A 2ZOSA 2OOSA 1GDDA 1I5RA 5I4IA 3K6JA 1LWOA 1W36C 2E87A 1JDNA 4ZV9A 3KHKA 5BV1A 2RE8A 4LOLA 4KXWA 3AG5A 1P2FA 4FGJA 1E60A 1CF2O 3EC2A 3C97A 4FMCF 4YDRA 4BQFA 1BMFA 1MNAA 3IJRA 3OZCA 2GNAA 3PPXA 2CNDA 2HK9A 4RZ2A 1P39A 3LDAA 1FUUA 2QNBA 2FWNA 4NFHA 2RB5A 3TSOA 3VR3D 1EESA 4IXTA 3K9GA 3IT2A 4W7SA 3EGXB 2W6IA 1HZZA 1TO1E 1UKAA 1YQQA 1U2TA 3CE6A 3P52A 1JFTA 5AOBA 5I9NA 1DXOA 1NI3A 2QN2A 3DNPA 4BC1A 3PS9A 4HWGA 1GTSA 2ZB3A 4C03A 1RPJA 1DEXA 1V1MA 3UAWA 4HNRA 3V1MA 1SOUA 3U5ZB 4NFYA 2CV2A 5U4QA 4GKAA 4HUQA 4JVSB 1AY0A 4Y2HA 2DJ5A 2GT1A 1M2OA 1ICEA 3CT6A 3GAZA 1DX4A 3RV3A 3WKAA 1P3DA 2JLAA 4QU0A 1PGJA 2CXXA 1CQIB 5ELXA 1HDCA 3THYB 4MWGA 3ADBA 1CD5A 4RL6A 4G86A 4L4SA 2PUJA 1OXUA 4Z1MA 1YRHA 4YCAA 1H85A 3DV9A 4RVFA 4XPIA 4KQMA 5CYOA 1U28A 1XDSA 3ACCA 2JHAA 2UZ4A 2XHZA 3OZVA 4Q7MB 4I50F 4YHHB 1PNRA 1DAPA 5JUWA 2QTRA 2XVYA 1OA1A 2FMFA 2D2VA 3R6WA 1BH2A 4Y0AA 3RTGA 4DJEC 3M7IA 4K6HA 2V7VA 3PR2B 2AJ8A 4B6JA 2BEUA 3FCCA 3QX7A 1UMCA 3HV2A 4RZUA 3T61A 4KMOA 2IV3A 1M2NA 3IP3A 3M9XA 3H1TA 2HN9A 4M1TA 1DBIA 4YMIA 1QAMA 5KO2A 4ALLA 1JBEA 2CXOA 3FZQA 4IDHA 4JXXA 5AOCA 2RGGA 3OT4A 3IBFA 5FNVB 4GKVA 5EJGA 5ALHA 3TW0A 2PUAA 3B6KA 3E03A 4Y6GB 2GD0A 5CJ2A 2VWQA 2GAFA 3VKFA 1HNXB 4OLHA 1QHFA 2ZYIA 1M7GA 3IT3A 2IYQA 3ZEAA 3H5OA 3L07A 4NQZA 3BICA 4E7OA 1KI9A 3GEBA 3I83A 5AW1A 3KD3A 4G24A 5FHRA 4ZAXA 4PG8A 2VYVA 3OIUA 3JQ7B 7AT1A 2ZBQA 3L02A 2C95A 1DJQA 3H6HA 4PX3A 2GBGA 4I5EA 5F98A 2F9FA 3VSCA 5BSHA 3FCEA 1CEYA 5TARA 3HJGA 3LBYA 5LQMA 4YRDA 3CWZA 3TTUA 2DH5A 5I47A 1FUIA 1FTYA 3QQPA 1ZUNA 3ZTYA 5AO9A 4DABA 5LZ9A 3UMVA 2ZE5A 5KKCA 3T52A 2Z2ZA 3FBTA 3VR4A 1NU6A 3CU5A 1PR2A 4XUGB 4IEIA 5B37A 1P1HA 4LRWA 2C0PA 3OY2A 4BO5A 1KDRA 1PK7A 1UMBB 4YUVA 3I62A 2UUAB 1PNQA 4KQ2A 4NDZA 8AT1A 3PSAA 5CH5A 4KQIA 3AETB 4KTTE 1G5HA 5ALKA 4ZKEA 5JS8A 3UJ7A 1JDJA 2OCBA 3BIOA 2YVAA 3H2KA 3L8MA 3D8RA 1N8NA 4FYYA 2PDAA 5CFQA 1M6VB 4IJKA 1JEAA 5AJVB 1QTRA 4RVDA 3DOIA 2A35A 4GI7A 1IQ0A 2GK7A 4MIOA 4RY9A 5C8YA 4R8LA 1CUHA 2KYRA 3HP1A 2R6GA 3O94A 1C1DB 3WFJA 4PN7A 4PIPA 1ENZA 1PZEA 3NBMA 2H9AA 1AXGA 3HUUA 2VCHA 3LIPA 2A84A 1CS0A 4LOHA 1DIGA 4UDNA 5WRFA 3ZNOA 2BKEA 3ORFA 4JQSA 4WTOA 1PZGA 3L1VA 4DPKA 2YYAA 3QLTA 2AJBA 2XOXA 3B12A 3NATA 3DCNA 4NEGA 1F8FA 1IM5A 2VP0A 1JZQA 4R7GA 4FWTA 4JBXA 4O3MA 2XUJA 2VSFA 4TL8A 5DLQC 1IMJA 1WVMA 3S2SA 4B45A 1P3Y1 1QZZA 3O4JA 1QF6A 3CIFA 2JC3A 4JLPA 4M8IA 2HV8A 4MYSA 1IIBA 1Z0DA 1BSVA 4WFKA 1J49A 3TJMA 3DR3A 3VOTA 1PVOA 5KSPA 3JD4A 1H93A 4LE0A 3ZK9A 4W5HA 4DCOA 3GLQA 3MS4A 4UQPA 1QRUA 1W581 1DKOA 2REOA 4C43A 4COKA 2VBGA 3KTDA 5GZ3A 3D4IA 2WJVA 3A06A 4R05A 2WZCA 2XMBA 3VNVA 5T3UA 2EV9A 5KTTA 2XT0A 2QLBA 4D56A 4D3YA 2QHXA 2V55B 4OSEA 4PNHA 1T8SA 4H59A 1UBCA 4Y1GA 5BNFA 5SZJA 3REOA 2VS1A 1R1DA 1NMSA 2B94A 2E55A 4X1YA 3VNRA 1XD8A 3NHJA 3I05A 1FEZA 3BSWA 3OFSA 1BC5A 4OI2A 4Q9LA 1XIVA 2IOQA 2X1VA 1FBTA 2XMRA 2C92A 2FG6C 4URVR 1B8NA 4PIVA 3WZMA 5H4GA 1XTBA 3GJZA 4R2HA 1V5GA 1Z7EA 1Z88A 2JBAB 2YZGA 4IICA 1FJHA 2FPPA 4MVJF 4OBWA 3Q8KA 3LOUA 2H57A 4JSTA 4R1LA 4O2RA 2D2EA 2IRWA 3TDKA 1PV1A 2A0FA 2AJLI 2BF7A 2NU7B 1PDVA 3R76A 4W4TA 2W8BB 2WOJA 5C51B 1V48A 3D5TA 4QGFA 4LK2A 4QC2A 2OLJA 4KQFA 5B1YA 2CT8A 1GZ6A 1TQ6A 2XLBA 1CUJA 2IYVA 4Q9NA 1IN6A 2XDQB 3MYYA 3T7SA 1FLDA 1CUFA 4MVCA 2J9XB 3JZIA 2DHCA 1CSEE 3GCGA 3DOHA 4CM8A 4IKPA 2YWXA 5L45A 4Q3BA 2PMEA 2PEZA 4IS3A 1GGHA 1L1QA 3PQ2A 3OLZA 1TA9A 5L3ZA 1BCRB 3G9XA 2GS9A 3ET4A 2ECQA 4D6XA 3Q2KA 1XPJA 3WQSB 4HWKA 4CXMA 2YWBA 5K5EA 2IITA 2QLNA 5C46F 2YN2A 4N12A 3P2MA 2HNBA 2Z6UA 4JVMA 1V3TA 5AM1A 1QDUA 1QE3A 2BDTA 3B51X 4Q12A 1N57A 3E9NA 4YFYA 4OY3A 1BCSA 1R0ZA 3FMGA 4TRJA 4RF3A 2OV8A 4EG5A 1Z8HA 1ZOLA 3L6RA 2X3UA 4E70A 1Y6FA 2EW8A 3D5QA 3N6XA 4MVJG 4FKZA 1M72A 1X1DA 2Q3FA 1U9ZA 1V3VA 1QGUA 2JLYA 2FSUA 4NHEA 4CDGA 1ZW1A 1Y5RA 4FFNA 1QS0B 5C35A 3FTCA 2IU3A 4QECA 1D0VA 3C98A 4LHXA 1XJQA 2GBPA 4B3CA 3FAZA 2DTEA 1P0FA 4ZCLA 1GRVA 2FX5A 3SXPA 4BN5A 2EFCB 4IVPA 2XECA 4LC0A 3GWGA 1Q50A 1Z16A 1AHHA 1P7WA 3ETDA 2GILA 3CZMA 4WFJA 1YZHA 5F77A 1CS4C 4YAEA 2W58A 5SY6A 4B6OA 1G3MA 2CFCA 1WHTA 2FZ5A 1L7XA 2JW5A 1TQ8A 2PUVA 3UZUA 2R5WA 1FUKA 5KHAA 3T1QA 2PMKA 2YJGA 1MG5A 2ZTMA 4DG8A 4QPZA 2QU8A 1QRSA 2J67A 2IDZA 5BVHA 5K0CA 1LPNA 3MWYW 621PA 2VJCA 1SVUA 1Q1AA 1MAUA 1XQXA 3GARA 4AKEA 1ZJ6A 1UDWA 4EW1A 2EYQA 4KWEA 1ZH8A 4PQFA 4TRNA 3OJOA 2EIXA 2P79A 5CUQA 5EIBC 4D9HA 5CB4F 4BBPA 2AJDA 3LP5A 4RF5A 1E2KA 4BUJA 3EMKA 4JZYA 3TB4A 4ZI7B 2NACA 1YTUA 1X14A 3UHJA 1G3QA 2NU6A 3TIIA 1RKXA 2QG4A 1Y4UA 2WIAA 3G2MA 4JC0A 3F73A 3S1AA 3H1EA 1ZBDA 2ZT7A 4F5WA 1RXWA 2ZZMA 5B4VA 3K35A 2OG2A 2PWPA 1NF3A 4XYBA 2I7CA 1WCWA 5I6DA 3I34X 2E18A 2W70A 5KHOC 1SVOA 2GN9A 4XGIA 2GYUA 1KK2A 1ZJJA 1DV1A 3N58A 4B4VA 2PBFA 2GXQA 3ZU2A 1ZVKA 3PQDA 4C9BA 1DOHA 4LWOA 4FHDA 1NVDA 1K9SA 4LRUA 3NDPA 1NC3A 2Q1YA 4IJ5A 5C4GB 3I30X 3PNMA 2DHEA 4W82A 5LKRA 1ZAKA 2A33A 3B1XA 3EC1A 3K2EA 3TNYA 1FDWA 4YRBA 2GYYA 3KLMX 4OHCA 4AXXA 3NNSA 3EGXA 3JS5A 4UBLA 2ZI6A 4ENUA 5MN5A 4FINA 3DNFA 2DFDA 5DNDA 1DRWA 4LRYA 1A9TA 3T15A 4ICIA 4MOWA 2AG0A 4Y8VA 3NUQA 4NK4A 1J8FA 1NYTA 2CWDA 2PUWA 3HLKA 4BFWA 2JFQA 1W49A 4HH3C 4J2TA 4MRNA 3BXEA 4A6PA 2HUPA 4CM1A 2MDTA 3N2KA 4YJHA 2J0UB 3KV1A 1KR2A 1DEKA 1OE0A 3LQ2A 5F7XA 4LJ4A 1I33A 4FN5A 3NORA 1MU0A 1OXSC 1XHEA 3GQBA 2MU1A 1SRRA 4JN6B 3F8WA 3LCUA 2H7CA 3KLOA 4C08A 4WKNA 3H0EA 3KSRA 1QP4A 1PWEA 3R4CA 2MSEB 1IULA 3EHDA 3KB1A 3DD1A 1JJAA 3H7AA 3HB4X 1E61A 3PKZA 5YASA 5B55A 2DFKB 1CR0A 3O47A 1UBEA 2QM0A 3E8MA 1EEHA 5K3FA 5KNDA 2WTUA 1X13A 2WAXA 3OIWA 4HDQB 2ACVA 4K9OA 3URKA 2ONCA 2BBTA 1X38A 5DULA 3A9CA 3LXUX 4DMMA 3ZWQA 4I4IA 3PXUA 1W1IA 4FDVA 4YJGA 3IL2A 3TXXA 2N46A 3FOAA 4DDTA 4U7WA 2WD7B 1SBQA 4C7VA 3LPAA 4LXIA 3QKSA 1UEXC 2E21A 1LBHA 3Q0EA 3GK3A 2MSLA 5D1NA 3PI6A 4UQOA 2YHSA 5HKLA 5A6SB 4S04A 2XA1A 1QF9A 1NRXA 4HNGA 1GUDA 3HB1A 3BJEA 5FA6A 5HQJA 1P73A 1LSSA 1XD2B 3IOYA 3JAKB 4YJDA 4EZEA 3EPLA 3H5AA 5DN6D 5JY1A 5GONF 1D5CA 4DQ0A 2X4GA 4RPKA 4CL3A 5A1TA 4WNCA 3GLVA 5KPJA 5AP9A 4RSRA 2JL1A 2XAAA 4HWPA 3HEBA 4JJZA 5P8WA 3ZLTA 2J4DA 2ORIA 2ZCUA 4P7GA 1CY7A 1VE5A 2ODWA 4YB8A 3U44B 4EIWA 2C9YA 1NUUA 1FXWF 1VFPA 3WDLA 4EX6A 5DLDA 2O9JA 3CUSA 4I14A 3W9SA 1SKBA 1XRPA 3AETA 1XVVA 4RTLA 4P8RA 4KSYA 3CRMA 3L0CA 4XYEA 1I7DA 1CRQA 1M2GA 3LNCA 2P1ZA 3OCVA 3W6ZA 4EJ0A 1LB1B 3VV2A 1PNVA 1AF7A 1IOWA 1FP4A 1YDEA 4N4AA 2AFHB 3SVZA 3GLIA 1IDN1 2O2XA 2P8JA 1M6EX 3NQ41 2QJFA 1IG0A 2YN0A 1T36A 4M6WA 4QO7A 1RRKA 4EJFA 4AY2A 1Z4LA 4DDVA 3VHQA 5TF4A 1A5BB 1KVRA 4TLLB 2QRUA 3F67A 3ZW9A 4D9MA 2JZCA 1F48A 1L5OA 4MPTA 4QBKA 1MQ8B 3HN2A 1C3VA 4LJ7A 3EPPA 5CP8A 1L3CA 4HXEB 4KLZA 4QQRA 4BVGA 1G21E 4B76A 1SB8A 3RC8A 3STUA 4ZI2A 2C1XA 1M0WA 3H2IA 5ENDA 2FMIA 5FCDA 5FJJA 3ISTA 3ISVA 4C4YA 2VPXA 4O4LA 1PX0A 1MRSA 1JF8A 1ZH0A 2FSSA 3I92A 2QTWB 1ABBA 4RACA 4FE7A 3MB5A 5JASA 1MIOB 3EPRA 2NAPA 2ODQA 3NH6A 4GM0A 3NM5A 3IV9A 1FJXA 1VL0A 3R6LA 5AW2A 4KV7A 2QQFA 3D8HA 3QWFA 4MRAA 1SXPA 3EZFA 5EKXA 1EGVB 2B4YA 2H59A 4LIPD 1OIXA 5KTYA 3ZJ4A 2Z98A 2W90A 2Z8YM 5HK8A 3KSBC 3FSJX 3JSAA 4Q3DA 4YJFB 3A4NA 3TLYA 2JGDB 3R09A 1QV7A 3K09A 4OI4A 4RZHA 3ESRA 4S1NA 1B76A 1GNVA 2NSYA 1T1RA 3QWIA 4PIMA 2DGDA 5E9JA 4AJOA 1JA0A 4PN3A 5C8VA 5B2ZA 1VKRA 3CWCA 3BWXA 3EFEA 3DE7X 2V7QA 4GLOA 3WSWA 2WHYA 4KP7A 3EYWA 4A1FA 1NI4B 2I99A 1VIVA 1ZH4A 4RESA 4Z9YA 5D5HA 4LI0A 3A9RA 5BQ5A 1A69A 2RKWA 3ITNA 3K31A 5CT8A 3H97A 2QXYA 3BXGA 4JB0A 4Z4CA 2AUTA 1MN6A 2F8MA 2JJ2D 3DFIA 1ZUHA 3EUWA 4LK3A 2P40A 3G0CA 4RH0A 4REQA 4U39A 4Q9KA 4EHDA 3I61A 4UASA 2ZK7A 4X20B 3FUVA 3A04A 3CW8X 5ALPA 3UJAA 2AG8A 1PQUA 1ZXXA 1ISHA 3LY5A 2OSBA 3SYMA 4DYHA 3MLAA 3IX7A 2AQ8A 3NTXA 3TINA 5TDHA 2D2IA 4BU1A 5HWSA 5DM2A 3G2QA 3N87A 3P2OA 3N3BC 4C1NA 3X1DA 4FPXA 2JGRA 4FE4A 3VZQA 2BRUC 3DKRA 1Q0ZA 5H1YA 1ILWA 3VR1A 3AJ9A 4IEEA 2ZR7A 1DEAA 2ZIEA 3PKJA 5DTEA 4CMCA 2FXIA 2G6TA 4G23A 4BC0A 1G42A 1ZOIA 1JYSA 4CIVA 4DLTA 3AF5A 2EXXA 1M76A 4PRKA 1Q6YA 3IP1A 3KD2A 3P0RA 1HE8B 3NOOA 2QD1A 5H3LA 3VJKA 1EJBA 4X60A 3ZDRA 4CKWA 5JS6A 2NZJA 5IS2A 2HV9A 4HTAA 2D74A 1WMAA 4JYMA 4R3NA 3H1BA 1MX5A 4LHZA 3HLYA 3BD8A 4U9IS 3O21A 1Q5PA 1WSDA 1JKXA 1XWWA 1YULA 2QTBA 4MUBA 5ILQA 4BGVA 4P7JA 1I6KA 1YVRA 3L93A 3BDAA 1Y6QA 3OU7A 4OJNA 3PEEA 2XT9A 4BVJA 3F71A 4AF7A 1JHRA 4PFQA 2O0JA 1JYEA 1WQ4A 2I2BA 4HDNB 3L6CA 2M6RA 3O8NA 1U9CA 4GSLA 5IARA 5CLGA 4QJ4A 4M7OA 1AQJA 2XBUA 4G4SO 3OQ1A 2REQB 4MI1A 3ZD7A 3ESBA 1VL6A 5FOXA 5LQNA 5LD2C 2JH9A 5T4HA 3JQFC 5TVGA 3BTSA 3OJLA 3ZIUA 4E7PA 1S7CA 3CLTC 4LOKA 1UBHS 2LW7A 1FTGA 1JR3D 1SG0A 3O4FA 3P97A 4HEA6 4C0KA 5IVKA 4MI6A 1FFGA 5L3SA 1V8DA 2A5FA 1IBLB 1WDLA 4LTMA 1WVIA 4PZUA 2WWWA 5EXTA 2AYYA 4HN2A 3ZIDA 2Q62A 5K4HA 1S8NA 3HWX1 2W2KA 4PF1A 4ZZ3A 1Y4SA 5DHFA 3UEOA 4RQTA 1T2NA 2XRFA 2CNKA 3CEAA 4OQNA 3WSTA 2Y3IA 1F0KA 2TSYB 1G8AA 5BSKA 3KKNA 3F6YA 4MMYB 4PCVA 3NBXX 3T5AA 3OHPA 2RHOA 3GOQA 4G2NA 4KXQA 5HF8A 5AVKA 5JQWA 1NR5A 4GMFA 4NENB 3OZUA 1PT9A 4RIGA 3K9CA 3E3MA 1D3AA 4BQEA 3T5CA 1Z26A 4AS1A 4MQ4A 4N0PA 5EE5B 3L8GA 1E3WA 1LPAB 2H7XA 3G02A 3I0ZA 3HRHA 2D3WA 3KVOA 3UAGA 5EFOA 1LU9A 1UP7A 2VYVD 1YZYA 2BZGA 2ZE8A 1KHTA 2Y0EA 4RZSA 5BURA 5C8ZA 2VTBB 1NXOA 4DY4A 1T35A 2QR5A 3RABA 5JCOA 5TMBA 1UPXA 1CJCA 2PGXA 1O7JA 1P7CA 2WIKA 2NUPB 3KKEA 4N54A 4E12A 2KBFA 3AIIA 3WHIA 5BP7A 1TT5A 1Q77A 4CCYB 2PCJA 4D82A 4PZAA 3BERA 3KXKA 5AVVA 16PKA 3FFBA 1XPUA 2DERA 4WI1A 1O57A 2I6UA 2B1RA 3PUXA 1A1SA 3CYFA 2ZKLA 4KQ6A 3B1VA 2C1ZA 3DAGA 1ZISA 4OHOA 4EGSA 4D25A 1E1CA 3E4CA 4O1MA 1K5DA 3R7WA 2HQRA 4QHYA 4JNKA 2Q28A 4JJGA 3OPQA 4PTZA 3RSSA 4PNEA 1KEPA 5JTTA 3RBZA 3CNNA 3LUBA 4U0KA 1N4DA 4CMEC 3IDAA 2IL1A 5J47A 1IJFA 3HDJA 4EYKA 2WWRA 3C1TA 1J7JA 1TJYA 2XVXA 3GJ3A 1PJ8A 2H29A 2HLNA 1PFUA 3MT0A 3K9HA 2P9EA 1AZTA 1TMKA 2EFEB 4IGKA 4KU4A 4HX5A 2COUA 3D6FA 3E27A 3MRXA 2H17A 4HP8A 4Z9XA 2F4VB 2W8ZA 1VG9B 4TTVA 1THGA 1FFYA 1MH1A 1G8GA 3CEMA 1LLQA 3BMNB 1UODA 4MQUA 3WO1A 3QQ5A 3GHHA 1ZL2A 2WIBA 3C6KA 2WJGA 2Y4NA 2XKJE 4UVEA 5H80A 3H2SA 2WD9A 2YWRA 3LDGA 4PG5A 4TKUB 1M8PA 2W42A 2V9ZA 4CL8A 3EY4A 3CFYA 3SHWA 3X43A 1P0IA 3NHAA 2Z6QA 3VUFA 4US1R 3FCYA 2IUTA 4U8GA 1EXWA 2GGSA 3PL5A 4JMLA 3CEPB 2VAPA 2I22A 4PSUA 3WZLA 1FXSA 2VRBA 1GZSA 2J0SA 4HYTA 1EMDA 2ZAGA 3KAJA 4WY5A 2M1XA 2XZPA 3WWOA 3HKEB 3KQYA 2IU0A 2VQEB 1BXGA 2G82A 1XELA 1RFGE 1J0EA 1KJIA 3LTEA 4JLAA 2WJ6A 3LQ4A 4PYJA 3S8EA 2NAFA 2QLTA 1U4NA 4LHVA 1E18A 4NC9A 1FLNA 3I32A 4FR2A 3IODA 1WABA 1US8B 3ZY3A 1L2TA 3ZXUB 3GFOA 3A0RB 3IGFA 4UC0A 1RYYA 1XCMA 1LX7A 2D62A 1RPAA 2W2VA 2BE9A 5FTKA 3RYIB 3SSNA 1WXEA 4JXJA 1AT1A 3FDJA 4J0KA 5JSUA 3Q72A 2PRIA 5GJBA 2HU2A 2R1TB 3E9EA 1E3LA 1AXEA 4JSRA 5DCUA 4F45A 1F7VA 3IO5A 1XZLA 4TS4A 5DSTA 1GRQA 1Y8RB 4DM7A 4YV0A 2C4VA 3DMTA 3B3JA 5DM70 3D1LA 1JDZA 1HOTA 3TWOA 1XQWA 3F6RA 1Z12A 4II3A 3TYXA 4EZIA 2Y2UA 2NYVA 2BC9A 1OXVA 1N7GA 1QCCA 4YALA 1GQYA 1GV0A 2HDNB 1SU4A 3KZNA 3RSZA 2AL7A 4D4MA 1CQPA 4GPZA 3OZAA 4QXPA 4BMYA 1N1GA 1DAKA 2OBFA 3HP4A 3VI3B 2BMWA 1BW9B 1NLFA 1YC5A 1LPSA 1LS6A 3LV8A 3N6RA 4UFNA 4UM7A 2YWJA 3AUAA 3QKTA 1M33A 3RIEA 5KTNA 4QNMA 1RU3A 3GPDG 1IY8A 2C31A 3CE9A 2N1BA 4FWIB 5F51A 3RQIA 4BVBA 4CMGA