3DKUA

Crystal structure of nudix hydrolase orf153, ymfb, from escherichia coli k-1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
MFKPHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAARELWEETGISAQPQHFIRMHQWIAPDKTPFLRFLFAIELEQICPTQPHDSDIDCCRWVSAEEILQASNLRSPLVAESIRCYQSGQRYPLEMIGDFNWPFTKGVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative phosphohydrolase
publication title Crystal structure of Nudix hydrolase Orf153, ymfB, from Escherichia coli K-1.
rcsb
source organism Escherichia coli apec o1
molecule tags Hydrolase
total genus 39
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3dkuA00
3GRNA 1PUQA 1Q54A 1VIQA 3DUPA 5I8UA 5GHMA 1NFZA 2A8QA 4YPRA 4MPOA 1V8YA 5BONA 4IJXA 1HX3A 1PVFA 2O1CA 5GHNA 3FK9A 5GHQA 3P5TA 1VK6A 2I8UA 4JZUA 3X0NA 1KTGA 2DSBA 4K6EA 2AZWA 2FMLA 4S2WA 3X0QA 2I6KA 3QSJA 5DEQA 2A8SA 2DUKA 1G9QA 2RRKA 3WHWA 2DHOA 2B0VA 4C9WA 2R5WA 2YYHA 5FSLA 4S2YA 3A6UA 5ANTA 1V8RA 3X0RA 4N1TA 2A8RA 1V8SA 3ID9A 1V8LA 3GG6A 5FSIA 3Q2SA 4HFQA 5ANWA 5DPKA 1SZ3A 4NFXA 3O8SA 3A6SA 4KYXA 1MK1A 1MP2A 3SMDA 3U53A 2GT2A 5DDGA 1R67A 1PPVA 1I9AA 3EF5A 3F13A 5IW4A 5ISYA 3FSPA 3MDIA 2I8TA 3HHJA 2YVMA 3GZ6A 5FSMA 2O5FA 1MQEA 1V8VA 3X0OA 3Q93A 4DYWA 3EEUA 4S2VA 1QVJA 3DKUA 5FSOA 1MR2A 1Q33A 5C7TA 3GZ5A 3GZ8A 3ZR1A 2GT4A 3MCFA 4ICKA 3J7Ye 3KVHA 4ILQA 1V8NA 1MUTA 3ZR0A 3AC9A 1V8TA 2ICJA 3BHOA 1F3YA 3MGMA 3I7VA 3SHDA 2J8QA 2YVOA 3A6VA 2B06A 3Q1PA 3BM4A 1NQYA 4JZVA 3X0IA 1V8MA 2PNYA 3SONA 3F6AA 1XSCA 1PPXA 2ICKA 3COUA 5GHJA 3I9XA 1PUNA 3P6YA 4YOQA 2G74A 3FFUA 5ANVA 1NQZA 2FKBA 2A6TA 5ANUA 3Q2TA 1Q27A 1V8WA 4NFWA 1MQWA 2DSDA 2PQVA 5FSNA 1X84A 5GHOA 2VNQA 1VRLA 4JZSA 1XSBA 3CNGA 2XSQA 1OW2A 2GB5A 5DD4A 2A8PA 1XSAA 3L85A 3X0MA 4KTBA 3GWYA 1GA7A 1TUMA 5LPGA 1KT9A 5ANSA 3O69A 1X83A 1K26A 1VC9A 2QJOA 4JZTA 3X0PA 3A6TA 1HZTA 5HZXA 3H95A 3FJYA 3N9UA 3O6ZA 3G0QA 3X0LA 3O52A 1JKNA 2G73A 3HYQA 1K2EA 2QJTA 3O61A 1SJYA 3ACAA 5GHIA 3EESA 1PUSA 3BAPA 3FCMA 1SOIA 3OGAA 2VNPA 5GHPA 4ZG0A 1X51A 4V14A 5C7QA 5IW5A 1JRKA 1VCDA 5FSKA 1U20A 2DSCA 2KDWA 5C8LA 2KDVA 3N77A 3X0KA 3X0JA 2YVNA 4HVYA 3I7UA 4YPHA 1RRQA 4S2XA 1RRSA 1IRYA 4C9XA 2A8TA 5BS6A 2FVVA 1VHZA 1SU2A 5CFIA 1RYAA 2Q9PA 4N1UA 3R03A 2YVPA 1V8IA 1VIUA 1VC8A 3EXQA 2O5WA 2JVBA 3Q4IA 1KHZA 1NFSA 3X0SA 1G0SA 1V8UA 1VHGA 3E57A 4KG4A 3MDGA 2QKMB 3RH7A 5CFJA 2CL3A 3Q91A 1PPWA 2B2KA 4KG3A 2W4EA
chains in the Genus database with same CATH superfamily
3GRNA 1PUQA 1Q54A 1VIQA 3DUPA 5I8UA 5GHMA 1NFZA 2A8QA 4YPRA 4MPOA 1V8YA 5BONA 4IJXA 1HX3A 1PVFA 2O1CA 5GHNA 3FK9A 5GHQA 3P5TA 1VK6A 2I8UA 4JZUA 3X0NA 1KTGA 2DSBA 4K6EA 2AZWA 2FMLA 4S2WA 3X0QA 2I6KA 3QSJA 5DEQA 2A8SA 2DUKA 1G9QA 2RRKA 3WHWA 2DHOA 2B0VA 4C9WA 2R5WA 2YYHA 5FSLA 4S2YA 3A6UA 5ANTA 1V8RA 3X0RA 4N1TA 2A8RA 1V8SA 3ID9A 1V8LA 3GG6A 5FSIA 3Q2SA 4HFQA 5ANWA 5DPKA 1SZ3A 4NFXA 3O8SA 3A6SA 4KYXA 1MK1A 1MP2A 3SMDA 3U53A 2GT2A 5DDGA 1R67A 1PPVA 1I9AA 3EF5A 3F13A 5IW4A 5ISYA 3FSPA 3MDIA 2I8TA 3HHJA 2YVMA 3GZ6A 5FSMA 2O5FA 1MQEA 1V8VA 3X0OA 3Q93A 4DYWA 3EEUA 4S2VA 1QVJA 3DKUA 5FSOA 1MR2A 4J7GA 1Q33A 5C7TA 3GZ5A 3GZ8A 3ZR1A 2GT4A 3MCFA 4ICKA 3J7Ye 3KVHA 4ILQA 1V8NA 1MUTA 3ZR0A 3AC9A 1V8TA 2ICJA 3BHOA 1F3YA 3MGMA 3I7VA 3SHDA 2J8QA 2YVOA 3A6VA 2B06A 3Q1PA 3BM4A 1NQYA 4JZVA 3X0IA 1V8MA 2PNYA 3SONA 3F6AA 1XSCA 1PPXA 2ICKA 3COUA 5GHJA 3I9XA 1PUNA 3P6YA 4YOQA 2G74A 3FFUA 5ANVA 1NQZA 2FKBA 2A6TA 5ANUA 3Q2TA 1Q27A 1V8WA 4NFWA 1MQWA 2DSDA 4J7HA 2PQVA 5FSNA 1X84A 5GHOA 2VNQA 1VRLA 4JZSA 1XSBA 3CNGA 2XSQA 1OW2A 2GB5A 5DD4A 2A8PA 1XSAA 3L85A 3X0MA 4KTBA 3GWYA 1GA7A 1TUMA 5LPGA 1KT9A 5ANSA 3O69A 1X83A 1K26A 1VC9A 2QJOA 4JZTA 3X0PA 3A6TA 1HZTA 5HZXA 3H95A 3FJYA 3N9UA 3O6ZA 3G0QA 2CZRA 3X0LA 3O52A 1JKNA 2G73A 3HYQA 1K2EA 2QJTA 3O61A 1SJYA 3ACAA 5GHIA 3EESA 1PUSA 3BAPA 3FCMA 1SOIA 3OGAA 2VNPA 5GHPA 4ZG0A 1X51A 4V14A 5C7QA 5IW5A 1JRKA 1VCDA 5FSKA 1U20A 2DSCA 2KDWA 5C8LA 2KDVA 3N77A 3X0KA 3X0JA 2YVNA 4HVYA 3I7UA 4YPHA 1RRQA 4S2XA 1RRSA 1IRYA 4C9XA 2A8TA 5BS6A 2FVVA 1VHZA 1SU2A 5CFIA 1RYAA 2Q9PA 4N1UA 3R03A 2YVPA 1V8IA 1VIUA 1VC8A 3EXQA 2O5WA 2JVBA 3Q4IA 1KHZA 1NFSA 3X0SA 1G0SA 1V8UA 1VHGA 3E57A 4KG4A 3MDGA 2QKMB 3RH7A 5CFJA 2CL3A 3Q91A 1PPWA 2B2KA 4KG3A 2W4EA
chains in the Genus database with same CATH topology
3GRNA 1PUQA 1Q54A 1VIQA 3DUPA 5I8UA 5GHMA 1NFZA 2A8QA 4YPRA 4MPOA 1V8YA 5BONA 4IJXA 1HX3A 1PVFA 2O1CA 5GHNA 3FK9A 5GHQA 3P5TA 1VK6A 2I8UA 4JZUA 3X0NA 1KTGA 2DSBA 4K6EA 2AZWA 2FMLA 4S2WA 3X0QA 2I6KA 3QSJA 5DEQA 2A8SA 2DUKA 1G9QA 2RRKA 3WHWA 2DHOA 2B0VA 4C9WA 2R5WA 2YYHA 5FSLA 4S2YA 3A6UA 5ANTA 1V8RA 3X0RA 4N1TA 2A8RA 1V8SA 3ID9A 1V8LA 3GG6A 5FSIA 3Q2SA 4HFQA 5ANWA 5DPKA 1SZ3A 4NFXA 3O8SA 3A6SA 4KYXA 1MK1A 1MP2A 3SMDA 3U53A 2GT2A 5DDGA 1R67A 1PPVA 1I9AA 3EF5A 3F13A 5IW4A 5ISYA 3FSPA 3MDIA 2I8TA 3HHJA 2YVMA 3GZ6A 5FSMA 2O5FA 1MQEA 1V8VA 3X0OA 3Q93A 4DYWA 3EEUA 4S2VA 1QVJA 3DKUA 5FSOA 1MR2A 4J7GA 1Q33A 5C7TA 3GZ5A 3GZ8A 3ZR1A 2GT4A 3MCFA 4ICKA 3J7Ye 3KVHA 4ILQA 1V8NA 1MUTA 3ZR0A 3AC9A 1V8TA 2ICJA 3BHOA 1F3YA 3MGMA 3I7VA 3SHDA 2J8QA 2YVOA 3A6VA 2B06A 3Q1PA 3BM4A 1NQYA 4JZVA 3X0IA 1V8MA 2PNYA 3SONA 3F6AA 1XSCA 1PPXA 2ICKA 3COUA 5GHJA 3I9XA 1PUNA 3P6YA 4YOQA 2G74A 3FFUA 5ANVA 1NQZA 2FKBA 2A6TA 5ANUA 3Q2TA 1Q27A 1V8WA 4NFWA 1MQWA 2DSDA 4J7HA 2PQVA 5FSNA 1X84A 5GHOA 2VNQA 1VRLA 4JZSA 1XSBA 3CNGA 2XSQA 1OW2A 2GB5A 5DD4A 2A8PA 1XSAA 3L85A 3X0MA 4KTBA 3GWYA 1GA7A 1TUMA 5LPGA 1KT9A 5ANSA 3O69A 1X83A 1K26A 1VC9A 2QJOA 4JZTA 3X0PA 3A6TA 1HZTA 5HZXA 3H95A 3FJYA 3N9UA 3O6ZA 3G0QA 2CZRA 3X0LA 3O52A 1JKNA 2G73A 3HYQA 1K2EA 2QJTA 3O61A 1SJYA 3ACAA 5GHIA 3EESA 1PUSA 3BAPA 3FCMA 1SOIA 3OGAA 2VNPA 5GHPA 4ZG0A 1X51A 4V14A 5C7QA 5IW5A 1JRKA 1VCDA 5FSKA 1U20A 2DSCA 2KDWA 5C8LA 2KDVA 3N77A 3X0KA 3X0JA 2YVNA 4HVYA 3I7UA 4YPHA 1RRQA 4S2XA 1RRSA 1IRYA 4C9XA 2A8TA 5BS6A 2FVVA 1VHZA 1SU2A 5CFIA 1RYAA 2Q9PA 4N1UA 3R03A 2YVPA 1V8IA 1VIUA 1VC8A 3EXQA 2O5WA 2JVBA 3Q4IA 1KHZA 1NFSA 3X0SA 1G0SA 1V8UA 1VHGA 3E57A 4KG4A 3MDGA 2QKMB 3RH7A 5CFJA 2CL3A 3Q91A 1PPWA 2B2KA 4KG3A 2W4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GRN A;  1PUQ A;  1Q54 A;  1VIQ A;  3DUP A;  5I8U A;  5GHM A;  1NFZ A;  2A8Q A;  4YPR A;  4MPO A;  1V8Y A;  5BON A;  4IJX A;  1HX3 A;  1PVF A;  2O1C A;  5GHN A;  3FK9 A;  5GHQ A;  3P5T A;  1VK6 A;  2I8U A;  4JZU A;  3X0N A;  1KTG A;  2DSB A;  4K6E A;  2AZW A;  2FML A;  4S2W A;  3X0Q A;  2I6K A;  3QSJ A;  5DEQ A;  2A8S A;  2DUK A;  1G9Q A;  2RRK A;  3WHW A;  2DHO A;  2B0V A;  4C9W A;  2R5W A;  2YYH A;  5FSL A;  4S2Y A;  3A6U A;  5ANT A;  1V8R A;  3X0R A;  4N1T A;  2A8R A;  1V8S A;  3ID9 A;  1V8L A;  3GG6 A;  5FSI A;  3Q2S A;  4HFQ A;  5ANW A;  5DPK A;  1SZ3 A;  4NFX A;  3O8S A;  3A6S A;  4KYX A;  1MK1 A;  1MP2 A;  3SMD A;  3U53 A;  2GT2 A;  5DDG A;  1R67 A;  1PPV A;  1I9A A;  3EF5 A;  3F13 A;  5IW4 A;  5ISY A;  3FSP A;  3MDI A;  2I8T A;  3HHJ A;  2YVM A;  3GZ6 A;  5FSM A;  2O5F A;  1MQE A;  1V8V A;  3X0O A;  3Q93 A;  4DYW A;  3EEU A;  4S2V A;  1QVJ A;  3DKU A;  5FSO A;  1MR2 A;  1Q33 A;  5C7T A;  3GZ5 A;  3GZ8 A;  3ZR1 A;  2GT4 A;  3MCF A;  4ICK A;  3J7Y e;  3KVH A;  4ILQ A;  1V8N A;  1MUT A;  3ZR0 A;  3AC9 A;  1V8T A;  2ICJ A;  3BHO A;  1F3Y A;  3MGM A;  3I7V A;  3SHD A;  2J8Q A;  2YVO A;  3A6V A;  2B06 A;  3Q1P A;  3BM4 A;  1NQY A;  4JZV A;  3X0I A;  1V8M A;  2PNY A;  3SON A;  3F6A A;  1XSC A;  1PPX A;  2ICK A;  3COU A;  5GHJ A;  3I9X A;  1PUN A;  3P6Y A;  4YOQ A;  2G74 A;  3FFU A;  5ANV A;  1NQZ A;  2FKB A;  2A6T A;  5ANU A;  3Q2T A;  1Q27 A;  1V8W A;  4NFW A;  1MQW A;  2DSD A;  2PQV A;  5FSN A;  1X84 A;  5GHO A;  2VNQ A;  1VRL A;  4JZS A;  1XSB A;  3CNG A;  2XSQ A;  1OW2 A;  2GB5 A;  5DD4 A;  2A8P A;  1XSA A;  3L85 A;  3X0M A;  4KTB A;  3GWY A;  1GA7 A;  1TUM A;  5LPG A;  1KT9 A;  5ANS A;  3O69 A;  1X83 A;  1K26 A;  1VC9 A;  2QJO A;  4JZT A;  3X0P A;  3A6T A;  1HZT A;  5HZX A;  3H95 A;  3FJY A;  3N9U A;  3O6Z A;  3G0Q A;  3X0L A;  3O52 A;  1JKN A;  2G73 A;  3HYQ A;  1K2E A;  2QJT A;  3O61 A;  1SJY A;  3ACA A;  5GHI A;  3EES A;  1PUS A;  3BAP A;  3FCM A;  1SOI A;  3OGA A;  2VNP A;  5GHP A;  4ZG0 A;  1X51 A;  4V14 A;  5C7Q A;  5IW5 A;  1JRK A;  1VCD A;  5FSK A;  1U20 A;  2DSC A;  2KDW A;  5C8L A;  2KDV A;  3N77 A;  3X0K A;  3X0J A;  2YVN A;  4HVY A;  3I7U A;  4YPH A;  1RRQ A;  4S2X A;  1RRS A;  1IRY A;  4C9X A;  2A8T A;  5BS6 A;  2FVV A;  1VHZ A;  1SU2 A;  5CFI A;  1RYA A;  2Q9P A;  4N1U A;  3R03 A;  2YVP A;  1V8I A;  1VIU A;  1VC8 A;  3EXQ A;  2O5W A;  2JVB A;  3Q4I A;  1KHZ A;  1NFS A;  3X0S A;  1G0S A;  1V8U A;  1VHG A;  3E57 A;  4KG4 A;  3MDG A;  2QKM B;  3RH7 A;  5CFJ A;  2CL3 A;  3Q91 A;  1PPW A;  2B2K A;  4KG3 A;  2W4E A; 
#chains in the Genus database with same CATH topology
 3GRN A;  1PUQ A;  1Q54 A;  1VIQ A;  3DUP A;  5I8U A;  5GHM A;  1NFZ A;  2A8Q A;  4YPR A;  4MPO A;  1V8Y A;  5BON A;  4IJX A;  1HX3 A;  1PVF A;  2O1C A;  5GHN A;  3FK9 A;  5GHQ A;  3P5T A;  1VK6 A;  2I8U A;  4JZU A;  3X0N A;  1KTG A;  2DSB A;  4K6E A;  2AZW A;  2FML A;  4S2W A;  3X0Q A;  2I6K A;  3QSJ A;  5DEQ A;  2A8S A;  2DUK A;  1G9Q A;  2RRK A;  3WHW A;  2DHO A;  2B0V A;  4C9W A;  2R5W A;  2YYH A;  5FSL A;  4S2Y A;  3A6U A;  5ANT A;  1V8R A;  3X0R A;  4N1T A;  2A8R A;  1V8S A;  3ID9 A;  1V8L A;  3GG6 A;  5FSI A;  3Q2S A;  4HFQ A;  5ANW A;  5DPK A;  1SZ3 A;  4NFX A;  3O8S A;  3A6S A;  4KYX A;  1MK1 A;  1MP2 A;  3SMD A;  3U53 A;  2GT2 A;  5DDG A;  1R67 A;  1PPV A;  1I9A A;  3EF5 A;  3F13 A;  5IW4 A;  5ISY A;  3FSP A;  3MDI A;  2I8T A;  3HHJ A;  2YVM A;  3GZ6 A;  5FSM A;  2O5F A;  1MQE A;  1V8V A;  3X0O A;  3Q93 A;  4DYW A;  3EEU A;  4S2V A;  1QVJ A;  3DKU A;  5FSO A;  1MR2 A;  4J7G A;  1Q33 A;  5C7T A;  3GZ5 A;  3GZ8 A;  3ZR1 A;  2GT4 A;  3MCF A;  4ICK A;  3J7Y e;  3KVH A;  4ILQ A;  1V8N A;  1MUT A;  3ZR0 A;  3AC9 A;  1V8T A;  2ICJ A;  3BHO A;  1F3Y A;  3MGM A;  3I7V A;  3SHD A;  2J8Q A;  2YVO A;  3A6V A;  2B06 A;  3Q1P A;  3BM4 A;  1NQY A;  4JZV A;  3X0I A;  1V8M A;  2PNY A;  3SON A;  3F6A A;  1XSC A;  1PPX A;  2ICK A;  3COU A;  5GHJ A;  3I9X A;  1PUN A;  3P6Y A;  4YOQ A;  2G74 A;  3FFU A;  5ANV A;  1NQZ A;  2FKB A;  2A6T A;  5ANU A;  3Q2T A;  1Q27 A;  1V8W A;  4NFW A;  1MQW A;  2DSD A;  4J7H A;  2PQV A;  5FSN A;  1X84 A;  5GHO A;  2VNQ A;  1VRL A;  4JZS A;  1XSB A;  3CNG A;  2XSQ A;  1OW2 A;  2GB5 A;  5DD4 A;  2A8P A;  1XSA A;  3L85 A;  3X0M A;  4KTB A;  3GWY A;  1GA7 A;  1TUM A;  5LPG A;  1KT9 A;  5ANS A;  3O69 A;  1X83 A;  1K26 A;  1VC9 A;  2QJO A;  4JZT A;  3X0P A;  3A6T A;  1HZT A;  5HZX A;  3H95 A;  3FJY A;  3N9U A;  3O6Z A;  3G0Q A;  2CZR A;  3X0L A;  3O52 A;  1JKN A;  2G73 A;  3HYQ A;  1K2E A;  2QJT A;  3O61 A;  1SJY A;  3ACA A;  5GHI A;  3EES A;  1PUS A;  3BAP A;  3FCM A;  1SOI A;  3OGA A;  2VNP A;  5GHP A;  4ZG0 A;  1X51 A;  4V14 A;  5C7Q A;  5IW5 A;  1JRK A;  1VCD A;  5FSK A;  1U20 A;  2DSC A;  2KDW A;  5C8L A;  2KDV A;  3N77 A;  3X0K A;  3X0J A;  2YVN A;  4HVY A;  3I7U A;  4YPH A;  1RRQ A;  4S2X A;  1RRS A;  1IRY A;  4C9X A;  2A8T A;  5BS6 A;  2FVV A;  1VHZ A;  1SU2 A;  5CFI A;  1RYA A;  2Q9P A;  4N1U A;  3R03 A;  2YVP A;  1V8I A;  1VIU A;  1VC8 A;  3EXQ A;  2O5W A;  2JVB A;  3Q4I A;  1KHZ A;  1NFS A;  3X0S A;  1G0S A;  1V8U A;  1VHG A;  3E57 A;  4KG4 A;  3MDG A;  2QKM B;  3RH7 A;  5CFJ A;  2CL3 A;  3Q91 A;  1PPW A;  2B2K A;  4KG3 A;  2W4E A; 
#chains in the Genus database with same CATH homology
 3GRN A;  1PUQ A;  1Q54 A;  1VIQ A;  3DUP A;  5I8U A;  5GHM A;  1NFZ A;  2A8Q A;  4YPR A;  4MPO A;  1V8Y A;  5BON A;  4IJX A;  1HX3 A;  1PVF A;  2O1C A;  5GHN A;  3FK9 A;  5GHQ A;  3P5T A;  1VK6 A;  2I8U A;  4JZU A;  3X0N A;  1KTG A;  2DSB A;  4K6E A;  2AZW A;  2FML A;  4S2W A;  3X0Q A;  2I6K A;  3QSJ A;  5DEQ A;  2A8S A;  2DUK A;  1G9Q A;  2RRK A;  3WHW A;  2DHO A;  2B0V A;  4C9W A;  2R5W A;  2YYH A;  5FSL A;  4S2Y A;  3A6U A;  5ANT A;  1V8R A;  3X0R A;  4N1T A;  2A8R A;  1V8S A;  3ID9 A;  1V8L A;  3GG6 A;  5FSI A;  3Q2S A;  4HFQ A;  5ANW A;  5DPK A;  1SZ3 A;  4NFX A;  3O8S A;  3A6S A;  4KYX A;  1MK1 A;  1MP2 A;  3SMD A;  3U53 A;  2GT2 A;  5DDG A;  1R67 A;  1PPV A;  1I9A A;  3EF5 A;  3F13 A;  5IW4 A;  5ISY A;  3FSP A;  3MDI A;  2I8T A;  3HHJ A;  2YVM A;  3GZ6 A;  5FSM A;  2O5F A;  1MQE A;  1V8V A;  3X0O A;  3Q93 A;  4DYW A;  3EEU A;  4S2V A;  1QVJ A;  3DKU A;  5FSO A;  1MR2 A;  4J7G A;  1Q33 A;  5C7T A;  3GZ5 A;  3GZ8 A;  3ZR1 A;  2GT4 A;  3MCF A;  4ICK A;  3J7Y e;  3KVH A;  4ILQ A;  1V8N A;  1MUT A;  3ZR0 A;  3AC9 A;  1V8T A;  2ICJ A;  3BHO A;  1F3Y A;  3MGM A;  3I7V A;  3SHD A;  2J8Q A;  2YVO A;  3A6V A;  2B06 A;  3Q1P A;  3BM4 A;  1NQY A;  4JZV A;  3X0I A;  1V8M A;  2PNY A;  3SON A;  3F6A A;  1XSC A;  1PPX A;  2ICK A;  3COU A;  5GHJ A;  3I9X A;  1PUN A;  3P6Y A;  4YOQ A;  2G74 A;  3FFU A;  5ANV A;  1NQZ A;  2FKB A;  2A6T A;  5ANU A;  3Q2T A;  1Q27 A;  1V8W A;  4NFW A;  1MQW A;  2DSD A;  4J7H A;  2PQV A;  5FSN A;  1X84 A;  5GHO A;  2VNQ A;  1VRL A;  4JZS A;  1XSB A;  3CNG A;  2XSQ A;  1OW2 A;  2GB5 A;  5DD4 A;  2A8P A;  1XSA A;  3L85 A;  3X0M A;  4KTB A;  3GWY A;  1GA7 A;  1TUM A;  5LPG A;  1KT9 A;  5ANS A;  3O69 A;  1X83 A;  1K26 A;  1VC9 A;  2QJO A;  4JZT A;  3X0P A;  3A6T A;  1HZT A;  5HZX A;  3H95 A;  3FJY A;  3N9U A;  3O6Z A;  3G0Q A;  2CZR A;  3X0L A;  3O52 A;  1JKN A;  2G73 A;  3HYQ A;  1K2E A;  2QJT A;  3O61 A;  1SJY A;  3ACA A;  5GHI A;  3EES A;  1PUS A;  3BAP A;  3FCM A;  1SOI A;  3OGA A;  2VNP A;  5GHP A;  4ZG0 A;  1X51 A;  4V14 A;  5C7Q A;  5IW5 A;  1JRK A;  1VCD A;  5FSK A;  1U20 A;  2DSC A;  2KDW A;  5C8L A;  2KDV A;  3N77 A;  3X0K A;  3X0J A;  2YVN A;  4HVY A;  3I7U A;  4YPH A;  1RRQ A;  4S2X A;  1RRS A;  1IRY A;  4C9X A;  2A8T A;  5BS6 A;  2FVV A;  1VHZ A;  1SU2 A;  5CFI A;  1RYA A;  2Q9P A;  4N1U A;  3R03 A;  2YVP A;  1V8I A;  1VIU A;  1VC8 A;  3EXQ A;  2O5W A;  2JVB A;  3Q4I A;  1KHZ A;  1NFS A;  3X0S A;  1G0S A;  1V8U A;  1VHG A;  3E57 A;  4KG4 A;  3MDG A;  2QKM B;  3RH7 A;  5CFJ A;  2CL3 A;  3Q91 A;  1PPW A;  2B2K A;  4KG3 A;  2W4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...