3DKUA

Crystal structure of nudix hydrolase orf153, ymfb, from escherichia coli k-1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
MFKPHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAARELWEETGISAQPQHFIRMHQWIAPDKTPFLRFLFAIELEQICPTQPHDSDIDCCRWVSAEEILQASNLRSPLVAESIRCYQSGQRYPLEMIGDFNWPFTKGVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Nudix hydrolase Orf153, ymfB, from Escherichia coli K-1.
rcsb
molecule keywords Putative phosphohydrolase
molecule tags Hydrolase
source organism Escherichia coli apec o1
total genus 39
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3dkuA00
3F13A 2I6KA 2G73A 2O5WA 2DSCA 1Q27A 4C9WA 3R03A 1VK6A 1NQYA 1V8TA 2B2KA 3GRNA 2VNPA 5HZXA 5ISYA 3F6AA 3Q1PA 2A8QA 2J8QA 4ZG0A 3X0LA 1R67A 4V14A 5ANVA 3X0PA 1V8MA 3GZ6A 5DPKA 1KTGA 4IJXA 3Q91A 4KTBA 3L85A 4JZSA 3EEUA 3I9XA 2YYHA 1V8YA 1NFSA 3MDGA 3Q93A 3SONA 2GB5A 3CNGA 3X0SA 2PQVA 2YVMA 1KHZA 1MUTA 1Q54A 4N1UA 5DD4A 4C9XA 2DSBA 3X0MA 3O61A 2B06A 1SZ3A 2A8TA 2A8RA 2ICKA 3MGMA 2KDWA 4MPOA 2DHOA 3X0KA 1PPVA 3FJYA 1PPWA 1GA7A 1SJYA 2VNQA 1NFZA 1NQZA 3I7UA 3Q4IA 5GHMA 1F3YA 1VCDA 2KDVA 4YPHA 2A6TA 1G0SA 1HZTA 2QKMB 2W4EA 1PUNA 3DKUA 3EF5A 3X0NA 3X0IA 1V8LA 5IW4A 4ILQA 4YOQA 3O6ZA 1RYAA 4HVYA 3J7Ye 2G74A 1RRSA 3HYQA 1X83A 3GG6A 3N77A 1PUSA 1V8SA 2DSDA 1V8UA 3BAPA 4NFXA 1K26A 2Q9PA 3P6YA 3SMDA 1V8IA 1VHZA 3QSJA 3A6TA 2RRKA 1VIQA 3GWYA 4HFQA 4S2VA 1X51A 4ICKA 5BS6A 3FK9A 1I9AA 4S2XA 3N9UA 2GT4A 3GZ5A 1VRLA 3AC9A 1VHGA 3O52A 5GHIA 1V8NA 1K2EA 3X0OA 5CFJA 5ANUA 1V8RA 4KG3A 2YVPA 5GHOA 1SU2A 2AZWA 1MQEA 2QJOA 1VIUA 1V8WA 2I8UA 3MCFA 2JVBA 1SOIA 3FFUA 5DEQA 5ANTA 1X84A 3ACAA 3EESA 4KYXA 3Q2SA 5GHJA 5DDGA 3ZR0A 3RH7A 3E57A 1MQWA 1XSCA 3H95A 1XSBA 5GHQA 4NFWA 2R5WA 1VC9A 5ANWA 5C8LA 2GT2A 1QVJA 5I8UA 5LPGA 5C7TA 4K6EA 5GHPA 4JZTA 1V8VA 2ICJA 2PNYA 3OGAA 3O69A 3SHDA 3X0QA 3EXQA 3BHOA 4KG4A 2YVNA 3HHJA 3I7VA 2I8TA 3U53A 5BONA 1VC8A 4JZVA 1PVFA 2DUKA 5FSNA 3FCMA 4S2YA 4JZUA 5GHNA 1OW2A 1Q33A 1JKNA 5ANSA 5CFIA 3DUPA 2XSQA 1TUMA 5C7QA 1MP2A 2FVVA 2CL3A 1KT9A 3A6SA 1XSAA 1PPXA 5FSMA 1JRKA 3WHWA 3A6UA 3ZR1A 5FSLA 1G9QA 2FMLA 2O1CA 1MR2A 2A8SA 2YVOA 1HX3A 4S2WA 4DYWA 3COUA 3KVHA 3BM4A 2O5FA 3FSPA 3ID9A 2FKBA 3MDIA 3P5TA 4N1TA 1U20A 2B0VA 1MK1A 2QJTA 5IW5A 1PUQA 3A6VA 1IRYA 3G0QA 1RRQA 3GZ8A 3X0RA 5FSOA 2A8PA 3O8SA 5FSKA 3X0JA 3Q2TA 4YPRA 5FSIA
chains in the Genus database with same CATH superfamily
3F13A 2I6KA 2G73A 2O5WA 2DSCA 4J7GA 1Q27A 4C9WA 3R03A 1VK6A 1NQYA 1V8TA 2B2KA 3GRNA 2VNPA 5HZXA 5ISYA 3F6AA 3Q1PA 2A8QA 2J8QA 4ZG0A 3X0LA 1R67A 4V14A 5ANVA 3X0PA 1V8MA 3GZ6A 5DPKA 1KTGA 4IJXA 3Q91A 4KTBA 3L85A 4JZSA 3EEUA 3I9XA 2YYHA 1V8YA 1NFSA 3MDGA 3Q93A 3SONA 2GB5A 3CNGA 3X0SA 2PQVA 2YVMA 1KHZA 1MUTA 1Q54A 4N1UA 5DD4A 4C9XA 2DSBA 3X0MA 3O61A 2B06A 1SZ3A 2A8TA 2A8RA 2ICKA 3MGMA 2KDWA 4MPOA 2DHOA 3X0KA 1PPVA 3FJYA 1PPWA 1GA7A 1SJYA 2VNQA 1NFZA 1NQZA 3I7UA 3Q4IA 5GHMA 1F3YA 1VCDA 2KDVA 4YPHA 2A6TA 1G0SA 1HZTA 2QKMB 2W4EA 1PUNA 3DKUA 3EF5A 3X0NA 3X0IA 1V8LA 5IW4A 4ILQA 4YOQA 3O6ZA 1RYAA 4HVYA 3J7Ye 2G74A 1RRSA 3HYQA 1X83A 3GG6A 3N77A 1PUSA 1V8SA 2DSDA 1V8UA 3BAPA 4NFXA 1K26A 2Q9PA 3P6YA 3SMDA 1V8IA 1VHZA 3QSJA 3A6TA 2RRKA 1VIQA 3GWYA 4HFQA 4S2VA 1X51A 4ICKA 2CZRA 3FK9A 1I9AA 5BS6A 3N9UA 2GT4A 4S2XA 3GZ5A 4J7HA 1VRLA 3AC9A 1VHGA 3O52A 5GHIA 1V8NA 1K2EA 3X0OA 5CFJA 5ANUA 1V8RA 4KG3A 2YVPA 5GHOA 1SU2A 2AZWA 1MQEA 2QJOA 1VIUA 1V8WA 2I8UA 3MCFA 2JVBA 1SOIA 3FFUA 5DEQA 5ANTA 1X84A 3ACAA 3EESA 4KYXA 3Q2SA 5GHJA 5DDGA 3ZR0A 3RH7A 3E57A 1MQWA 1XSCA 3H95A 1XSBA 5GHQA 4NFWA 2R5WA 1VC9A 5ANWA 5C8LA 2GT2A 1QVJA 5I8UA 5LPGA 5C7TA 4K6EA 5GHPA 4JZTA 1V8VA 2ICJA 2PNYA 3OGAA 3O69A 3SHDA 3X0QA 3EXQA 3BHOA 4KG4A 2YVNA 3HHJA 3I7VA 2I8TA 3U53A 5BONA 1VC8A 4JZVA 1PVFA 2DUKA 5FSNA 3FCMA 4S2YA 4JZUA 5GHNA 1OW2A 1Q33A 1JKNA 5ANSA 5CFIA 3DUPA 2XSQA 1TUMA 5C7QA 1MP2A 2FVVA 2CL3A 1KT9A 3A6SA 1XSAA 1PPXA 5FSMA 1JRKA 3WHWA 3A6UA 3ZR1A 5FSLA 1G9QA 2FMLA 2O1CA 1MR2A 2A8SA 2YVOA 1HX3A 4S2WA 4DYWA 3COUA 3KVHA 3BM4A 2O5FA 3FSPA 3ID9A 2FKBA 3MDIA 3P5TA 4N1TA 1U20A 2B0VA 1MK1A 2QJTA 5IW5A 1PUQA 3A6VA 1IRYA 3G0QA 1RRQA 3GZ8A 3X0RA 5FSOA 2A8PA 3O8SA 5FSKA 3X0JA 3Q2TA 4YPRA 5FSIA
chains in the Genus database with same CATH topology
3F13A 2I6KA 2G73A 2O5WA 2DSCA 4J7GA 1Q27A 4C9WA 3R03A 1VK6A 1NQYA 1V8TA 2B2KA 3GRNA 2VNPA 5HZXA 5ISYA 3F6AA 3Q1PA 2A8QA 2J8QA 4ZG0A 3X0LA 1R67A 4V14A 5ANVA 3X0PA 1V8MA 3GZ6A 5DPKA 1KTGA 4IJXA 3Q91A 4KTBA 3L85A 4JZSA 3EEUA 3I9XA 2YYHA 1V8YA 1NFSA 3MDGA 3Q93A 3SONA 2GB5A 3CNGA 3X0SA 2PQVA 2YVMA 1KHZA 1MUTA 1Q54A 4N1UA 5DD4A 4C9XA 2DSBA 3X0MA 3O61A 2B06A 1SZ3A 2A8TA 2A8RA 2ICKA 3MGMA 2KDWA 4MPOA 2DHOA 3X0KA 1PPVA 3FJYA 1PPWA 1GA7A 1SJYA 2VNQA 1NFZA 1NQZA 3I7UA 3Q4IA 5GHMA 1F3YA 1VCDA 2KDVA 4YPHA 2A6TA 1G0SA 1HZTA 2QKMB 2W4EA 1PUNA 3DKUA 3EF5A 3X0NA 3X0IA 1V8LA 5IW4A 4ILQA 4YOQA 3O6ZA 1RYAA 4HVYA 3J7Ye 2G74A 1RRSA 3HYQA 1X83A 3GG6A 3N77A 1PUSA 1V8SA 2DSDA 1V8UA 3BAPA 4NFXA 1K26A 2Q9PA 3P6YA 3SMDA 1V8IA 1VHZA 3QSJA 3A6TA 2RRKA 1VIQA 3GWYA 4HFQA 4S2VA 1X51A 4ICKA 2CZRA 3FK9A 1I9AA 5BS6A 3N9UA 2GT4A 4S2XA 3GZ5A 4J7HA 1VRLA 3AC9A 1VHGA 3O52A 5GHIA 1V8NA 1K2EA 3X0OA 5CFJA 5ANUA 1V8RA 4KG3A 2YVPA 5GHOA 1SU2A 2AZWA 1MQEA 2QJOA 1VIUA 1V8WA 2I8UA 3MCFA 2JVBA 1SOIA 3FFUA 5DEQA 5ANTA 1X84A 3ACAA 3EESA 4KYXA 3Q2SA 5GHJA 5DDGA 3ZR0A 3RH7A 3E57A 1MQWA 1XSCA 3H95A 1XSBA 5GHQA 4NFWA 2R5WA 1VC9A 5ANWA 5C8LA 2GT2A 1QVJA 5I8UA 5LPGA 5C7TA 4K6EA 5GHPA 4JZTA 1V8VA 2ICJA 2PNYA 3OGAA 3O69A 3SHDA 3X0QA 3EXQA 3BHOA 4KG4A 2YVNA 3HHJA 3I7VA 2I8TA 3U53A 5BONA 1VC8A 4JZVA 1PVFA 2DUKA 5FSNA 3FCMA 4S2YA 4JZUA 5GHNA 1OW2A 1Q33A 1JKNA 5ANSA 5CFIA 3DUPA 2XSQA 1TUMA 5C7QA 1MP2A 2FVVA 2CL3A 1KT9A 3A6SA 1XSAA 1PPXA 5FSMA 1JRKA 3WHWA 3A6UA 3ZR1A 5FSLA 1G9QA 2FMLA 2O1CA 1MR2A 2A8SA 2YVOA 1HX3A 4S2WA 4DYWA 3COUA 3KVHA 3BM4A 2O5FA 3FSPA 3ID9A 2FKBA 3MDIA 3P5TA 4N1TA 1U20A 2B0VA 1MK1A 2QJTA 5IW5A 1PUQA 3A6VA 1IRYA 3G0QA 1RRQA 3GZ8A 3X0RA 5FSOA 2A8PA 3O8SA 5FSKA 3X0JA 3Q2TA 4YPRA 5FSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F13 A;  2I6K A;  2G73 A;  2O5W A;  2DSC A;  1Q27 A;  4C9W A;  3R03 A;  1VK6 A;  1NQY A;  1V8T A;  2B2K A;  3GRN A;  2VNP A;  5HZX A;  5ISY A;  3F6A A;  3Q1P A;  2A8Q A;  2J8Q A;  4ZG0 A;  3X0L A;  1R67 A;  4V14 A;  5ANV A;  3X0P A;  1V8M A;  3GZ6 A;  5DPK A;  1KTG A;  4IJX A;  3Q91 A;  4KTB A;  3L85 A;  4JZS A;  3EEU A;  3I9X A;  2YYH A;  1V8Y A;  1NFS A;  3MDG A;  3Q93 A;  3SON A;  2GB5 A;  3CNG A;  3X0S A;  2PQV A;  2YVM A;  1KHZ A;  1MUT A;  1Q54 A;  4N1U A;  5DD4 A;  4C9X A;  2DSB A;  3X0M A;  3O61 A;  2B06 A;  1SZ3 A;  2A8T A;  2A8R A;  2ICK A;  3MGM A;  2KDW A;  4MPO A;  2DHO A;  3X0K A;  1PPV A;  3FJY A;  1PPW A;  1GA7 A;  1SJY A;  2VNQ A;  1NFZ A;  1NQZ A;  3I7U A;  3Q4I A;  5GHM A;  1F3Y A;  1VCD A;  2KDV A;  4YPH A;  2A6T A;  1G0S A;  1HZT A;  2QKM B;  2W4E A;  1PUN A;  3DKU A;  3EF5 A;  3X0N A;  3X0I A;  1V8L A;  5IW4 A;  4ILQ A;  4YOQ A;  3O6Z A;  1RYA A;  4HVY A;  3J7Y e;  2G74 A;  1RRS A;  3HYQ A;  1X83 A;  3GG6 A;  3N77 A;  1PUS A;  1V8S A;  2DSD A;  1V8U A;  3BAP A;  4NFX A;  1K26 A;  2Q9P A;  3P6Y A;  3SMD A;  1V8I A;  1VHZ A;  3QSJ A;  3A6T A;  2RRK A;  1VIQ A;  3GWY A;  4HFQ A;  4S2V A;  1X51 A;  4ICK A;  5BS6 A;  3FK9 A;  1I9A A;  4S2X A;  3N9U A;  2GT4 A;  3GZ5 A;  1VRL A;  3AC9 A;  1VHG A;  3O52 A;  5GHI A;  1V8N A;  1K2E A;  3X0O A;  5CFJ A;  5ANU A;  1V8R A;  4KG3 A;  2YVP A;  5GHO A;  1SU2 A;  2AZW A;  1MQE A;  2QJO A;  1VIU A;  1V8W A;  2I8U A;  3MCF A;  2JVB A;  1SOI A;  3FFU A;  5DEQ A;  5ANT A;  1X84 A;  3ACA A;  3EES A;  4KYX A;  3Q2S A;  5GHJ A;  5DDG A;  3ZR0 A;  3RH7 A;  3E57 A;  1MQW A;  1XSC A;  3H95 A;  1XSB A;  5GHQ A;  4NFW A;  2R5W A;  1VC9 A;  5ANW A;  5C8L A;  2GT2 A;  1QVJ A;  5I8U A;  5LPG A;  5C7T A;  4K6E A;  5GHP A;  4JZT A;  1V8V A;  2ICJ A;  2PNY A;  3OGA A;  3O69 A;  3SHD A;  3X0Q A;  3EXQ A;  3BHO A;  4KG4 A;  2YVN A;  3HHJ A;  3I7V A;  2I8T A;  3U53 A;  5BON A;  1VC8 A;  4JZV A;  1PVF A;  2DUK A;  5FSN A;  3FCM A;  4S2Y A;  4JZU A;  5GHN A;  1OW2 A;  1Q33 A;  1JKN A;  5ANS A;  5CFI A;  3DUP A;  2XSQ A;  1TUM A;  5C7Q A;  1MP2 A;  2FVV A;  2CL3 A;  1KT9 A;  3A6S A;  1XSA A;  1PPX A;  5FSM A;  1JRK A;  3WHW A;  3A6U A;  3ZR1 A;  5FSL A;  1G9Q A;  2FML A;  2O1C A;  1MR2 A;  2A8S A;  2YVO A;  1HX3 A;  4S2W A;  4DYW A;  3COU A;  3KVH A;  3BM4 A;  2O5F A;  3FSP A;  3ID9 A;  2FKB A;  3MDI A;  3P5T A;  4N1T A;  1U20 A;  2B0V A;  1MK1 A;  2QJT A;  5IW5 A;  1PUQ A;  3A6V A;  1IRY A;  3G0Q A;  1RRQ A;  3GZ8 A;  3X0R A;  5FSO A;  2A8P A;  3O8S A;  5FSK A;  3X0J A;  3Q2T A;  4YPR A;  5FSI A; 
#chains in the Genus database with same CATH topology
 3F13 A;  2I6K A;  2G73 A;  2O5W A;  2DSC A;  4J7G A;  1Q27 A;  4C9W A;  3R03 A;  1VK6 A;  1NQY A;  1V8T A;  2B2K A;  3GRN A;  2VNP A;  5HZX A;  5ISY A;  3F6A A;  3Q1P A;  2A8Q A;  2J8Q A;  4ZG0 A;  3X0L A;  1R67 A;  4V14 A;  5ANV A;  3X0P A;  1V8M A;  3GZ6 A;  5DPK A;  1KTG A;  4IJX A;  3Q91 A;  4KTB A;  3L85 A;  4JZS A;  3EEU A;  3I9X A;  2YYH A;  1V8Y A;  1NFS A;  3MDG A;  3Q93 A;  3SON A;  2GB5 A;  3CNG A;  3X0S A;  2PQV A;  2YVM A;  1KHZ A;  1MUT A;  1Q54 A;  4N1U A;  5DD4 A;  4C9X A;  2DSB A;  3X0M A;  3O61 A;  2B06 A;  1SZ3 A;  2A8T A;  2A8R A;  2ICK A;  3MGM A;  2KDW A;  4MPO A;  2DHO A;  3X0K A;  1PPV A;  3FJY A;  1PPW A;  1GA7 A;  1SJY A;  2VNQ A;  1NFZ A;  1NQZ A;  3I7U A;  3Q4I A;  5GHM A;  1F3Y A;  1VCD A;  2KDV A;  4YPH A;  2A6T A;  1G0S A;  1HZT A;  2QKM B;  2W4E A;  1PUN A;  3DKU A;  3EF5 A;  3X0N A;  3X0I A;  1V8L A;  5IW4 A;  4ILQ A;  4YOQ A;  3O6Z A;  1RYA A;  4HVY A;  3J7Y e;  2G74 A;  1RRS A;  3HYQ A;  1X83 A;  3GG6 A;  3N77 A;  1PUS A;  1V8S A;  2DSD A;  1V8U A;  3BAP A;  4NFX A;  1K26 A;  2Q9P A;  3P6Y A;  3SMD A;  1V8I A;  1VHZ A;  3QSJ A;  3A6T A;  2RRK A;  1VIQ A;  3GWY A;  4HFQ A;  4S2V A;  1X51 A;  4ICK A;  2CZR A;  3FK9 A;  1I9A A;  5BS6 A;  3N9U A;  2GT4 A;  4S2X A;  3GZ5 A;  4J7H A;  1VRL A;  3AC9 A;  1VHG A;  3O52 A;  5GHI A;  1V8N A;  1K2E A;  3X0O A;  5CFJ A;  5ANU A;  1V8R A;  4KG3 A;  2YVP A;  5GHO A;  1SU2 A;  2AZW A;  1MQE A;  2QJO A;  1VIU A;  1V8W A;  2I8U A;  3MCF A;  2JVB A;  1SOI A;  3FFU A;  5DEQ A;  5ANT A;  1X84 A;  3ACA A;  3EES A;  4KYX A;  3Q2S A;  5GHJ A;  5DDG A;  3ZR0 A;  3RH7 A;  3E57 A;  1MQW A;  1XSC A;  3H95 A;  1XSB A;  5GHQ A;  4NFW A;  2R5W A;  1VC9 A;  5ANW A;  5C8L A;  2GT2 A;  1QVJ A;  5I8U A;  5LPG A;  5C7T A;  4K6E A;  5GHP A;  4JZT A;  1V8V A;  2ICJ A;  2PNY A;  3OGA A;  3O69 A;  3SHD A;  3X0Q A;  3EXQ A;  3BHO A;  4KG4 A;  2YVN A;  3HHJ A;  3I7V A;  2I8T A;  3U53 A;  5BON A;  1VC8 A;  4JZV A;  1PVF A;  2DUK A;  5FSN A;  3FCM A;  4S2Y A;  4JZU A;  5GHN A;  1OW2 A;  1Q33 A;  1JKN A;  5ANS A;  5CFI A;  3DUP A;  2XSQ A;  1TUM A;  5C7Q A;  1MP2 A;  2FVV A;  2CL3 A;  1KT9 A;  3A6S A;  1XSA A;  1PPX A;  5FSM A;  1JRK A;  3WHW A;  3A6U A;  3ZR1 A;  5FSL A;  1G9Q A;  2FML A;  2O1C A;  1MR2 A;  2A8S A;  2YVO A;  1HX3 A;  4S2W A;  4DYW A;  3COU A;  3KVH A;  3BM4 A;  2O5F A;  3FSP A;  3ID9 A;  2FKB A;  3MDI A;  3P5T A;  4N1T A;  1U20 A;  2B0V A;  1MK1 A;  2QJT A;  5IW5 A;  1PUQ A;  3A6V A;  1IRY A;  3G0Q A;  1RRQ A;  3GZ8 A;  3X0R A;  5FSO A;  2A8P A;  3O8S A;  5FSK A;  3X0J A;  3Q2T A;  4YPR A;  5FSI A; 
#chains in the Genus database with same CATH homology
 3F13 A;  2I6K A;  2G73 A;  2O5W A;  2DSC A;  4J7G A;  1Q27 A;  4C9W A;  3R03 A;  1VK6 A;  1NQY A;  1V8T A;  2B2K A;  3GRN A;  2VNP A;  5HZX A;  5ISY A;  3F6A A;  3Q1P A;  2A8Q A;  2J8Q A;  4ZG0 A;  3X0L A;  1R67 A;  4V14 A;  5ANV A;  3X0P A;  1V8M A;  3GZ6 A;  5DPK A;  1KTG A;  4IJX A;  3Q91 A;  4KTB A;  3L85 A;  4JZS A;  3EEU A;  3I9X A;  2YYH A;  1V8Y A;  1NFS A;  3MDG A;  3Q93 A;  3SON A;  2GB5 A;  3CNG A;  3X0S A;  2PQV A;  2YVM A;  1KHZ A;  1MUT A;  1Q54 A;  4N1U A;  5DD4 A;  4C9X A;  2DSB A;  3X0M A;  3O61 A;  2B06 A;  1SZ3 A;  2A8T A;  2A8R A;  2ICK A;  3MGM A;  2KDW A;  4MPO A;  2DHO A;  3X0K A;  1PPV A;  3FJY A;  1PPW A;  1GA7 A;  1SJY A;  2VNQ A;  1NFZ A;  1NQZ A;  3I7U A;  3Q4I A;  5GHM A;  1F3Y A;  1VCD A;  2KDV A;  4YPH A;  2A6T A;  1G0S A;  1HZT A;  2QKM B;  2W4E A;  1PUN A;  3DKU A;  3EF5 A;  3X0N A;  3X0I A;  1V8L A;  5IW4 A;  4ILQ A;  4YOQ A;  3O6Z A;  1RYA A;  4HVY A;  3J7Y e;  2G74 A;  1RRS A;  3HYQ A;  1X83 A;  3GG6 A;  3N77 A;  1PUS A;  1V8S A;  2DSD A;  1V8U A;  3BAP A;  4NFX A;  1K26 A;  2Q9P A;  3P6Y A;  3SMD A;  1V8I A;  1VHZ A;  3QSJ A;  3A6T A;  2RRK A;  1VIQ A;  3GWY A;  4HFQ A;  4S2V A;  1X51 A;  4ICK A;  2CZR A;  3FK9 A;  1I9A A;  5BS6 A;  3N9U A;  2GT4 A;  4S2X A;  3GZ5 A;  4J7H A;  1VRL A;  3AC9 A;  1VHG A;  3O52 A;  5GHI A;  1V8N A;  1K2E A;  3X0O A;  5CFJ A;  5ANU A;  1V8R A;  4KG3 A;  2YVP A;  5GHO A;  1SU2 A;  2AZW A;  1MQE A;  2QJO A;  1VIU A;  1V8W A;  2I8U A;  3MCF A;  2JVB A;  1SOI A;  3FFU A;  5DEQ A;  5ANT A;  1X84 A;  3ACA A;  3EES A;  4KYX A;  3Q2S A;  5GHJ A;  5DDG A;  3ZR0 A;  3RH7 A;  3E57 A;  1MQW A;  1XSC A;  3H95 A;  1XSB A;  5GHQ A;  4NFW A;  2R5W A;  1VC9 A;  5ANW A;  5C8L A;  2GT2 A;  1QVJ A;  5I8U A;  5LPG A;  5C7T A;  4K6E A;  5GHP A;  4JZT A;  1V8V A;  2ICJ A;  2PNY A;  3OGA A;  3O69 A;  3SHD A;  3X0Q A;  3EXQ A;  3BHO A;  4KG4 A;  2YVN A;  3HHJ A;  3I7V A;  2I8T A;  3U53 A;  5BON A;  1VC8 A;  4JZV A;  1PVF A;  2DUK A;  5FSN A;  3FCM A;  4S2Y A;  4JZU A;  5GHN A;  1OW2 A;  1Q33 A;  1JKN A;  5ANS A;  5CFI A;  3DUP A;  2XSQ A;  1TUM A;  5C7Q A;  1MP2 A;  2FVV A;  2CL3 A;  1KT9 A;  3A6S A;  1XSA A;  1PPX A;  5FSM A;  1JRK A;  3WHW A;  3A6U A;  3ZR1 A;  5FSL A;  1G9Q A;  2FML A;  2O1C A;  1MR2 A;  2A8S A;  2YVO A;  1HX3 A;  4S2W A;  4DYW A;  3COU A;  3KVH A;  3BM4 A;  2O5F A;  3FSP A;  3ID9 A;  2FKB A;  3MDI A;  3P5T A;  4N1T A;  1U20 A;  2B0V A;  1MK1 A;  2QJT A;  5IW5 A;  1PUQ A;  3A6V A;  1IRY A;  3G0Q A;  1RRQ A;  3GZ8 A;  3X0R A;  5FSO A;  2A8P A;  3O8S A;  5FSK A;  3X0J A;  3Q2T A;  4YPR A;  5FSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...