3DKXA

Crystal structure of the replication initiator protein encoded on plasmid pmv158 (repb), trigonal form, to 2.7 ang resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
202
structure length
202
Chain Sequence
KEKARYFTFLLYPESIPSDWELKLETLGVPMAISPLHDKDKSSIKGQKYKKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLTHESKDAIAKKKHVYDKADIKLINNFDIDRYVTLDVEEKTELFNVVVSLIRAYTLQNIFDLYDFIDENGETYGLTINLVNEVIAGKTGFMKLLFDGAYQRSKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plasmid replication initiator RepB forms a hexamer reminiscent of ring helicases and has mobile nuclease domains
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Replication
molecule keywords Replication protein repB
total genus 52
structure length 202
sequence length 202
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01719 Rep_2 Plasmid replication protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dkxA02
3.40.1310.30 Alpha Beta 3-Layer(aba) Sandwich Replication Protein E1; Chain: A, Replication Protein E1; Chain: A, 3dkxA01
3DKXA 4U87A 3DKYA
chains in the Genus database with same CATH superfamily
2Y0MA 3AG2H 3QPLA 2DA6A 5CJ9A 1FC3A 5E8GA 5D6FA 2MC4A 2P5KA 4MHGA 4HF2A 5LEKA 2XAQA 2XB5A 3D5RC 3T0YA 2PG4A 2EZHA 3NRVA 2NXNB 4XBFA 3PL8A 2QWWA 2X1EA 2CV1A 3CDIA 2DA3A 4UUSB 1HW5A 1RUOA 3V8JA 2LDUA 2CQQA 3BR0A 1ETOA 2AQEA 4WF2A 3OYMA 1FX7A 3QAHA 2YX4A 4NQWA 4M72A 5FGMA 2E5ZA 2W57A 4HOBA 4W1UA 5IYDJ 4RM3A 3F0CA 1KGSA 3K4KA 3EQLF 3EUAA 5E3MA 3Q9VA 4Q47A 4HNUA 2Z2SB 4I02A 4FX4A 2MW8A 1MJ9A 4XKVA 2ZC2A 3A2KA 1XB4A 2L9SA 1Y39A 1I1GA 3J81Z 1SD5A 4KISA 4W97A 3GTJJ 1DGWY 2XAUA 3E0JB 4NNJA 3S16J 3G1OA 3VYSB 1T95A 1HKTA 3MEXA 3W6KB 2HZTA 4EM2A 1TP4A 2DBBA 3J7AY 2LY9A 2A3SA 4ZZLA 2O9LA 3GO5A 2PJPA 4F52A 1WH5A 3BG3A 4GCVA 2H8RA 2O8KA 1YFHA 2GIZA 4Q48A 1XS9A 5CVUA 1PUFB 1ETQA 1XD7A 1L5IA 4OU0A 4BE0A 3UKGA 1BL0A 4FHTA 3ECOA 3OIOA 3GTPJ 4BU2A 4F92B 5LRRA 3HSEA 3H35A 4ANJA 2KRCA 4M73A 1LDKB 2VJ5A 1XTAA 2ID6A 1H0MA 2JVGA 4DBQA 1IDYA 3KZYA 5ICFA 2IPRA 4EQQA 3BJAA 5BQTA 4LLNA 5CLSA 3UNGC 2BVMA 3VYRB 1J2XA 4J19A 4XLHA 2Z5UA 4N9IA 3HTSB 1Z0XA 1V54H 3U9GA 4DBRA 2LVSA 1Z21A 2XAGA 2XPWA 3A0BC 3GW2A 2EIKH 3ZMUA 1I39A 4RBOA 1Z6TA 5DCXA 4EV0A 3CLQA 2I10A 3DEWA 1GVDA 2IEKA 3CP2A 3HOVJ 1W0UA 1P4AA 4M6YA 3TMOA 3H5NA 4PGHA 4WXDA 2CU7A 2JTVA 2RKHA 2PQ8A 2N8GA 4BHBA 2WY7Q 3I58A 4BQOA 1OYIA 1FP1D 5L3CA 2BEOA 3PIPF 4IZZA 4GXOA 1UFMA 2XF6A 1UCRA 2OAZA 3MAJA 2CV2A 3GTQJ 3A03A 1E3HA 4UUVA 4GO1A 2K9QA 4UHTA 1UMQA 2CUFA 3IP4B 4V2GA 2GOMA 2D45A 2EZIA 3FM3A 1YITI 1YS7A 3C18A 3KP3A 3P9IA 4K2EA 4XN3A 1CGPA 1F4KA 1XSVA 1FYMA 4U0WA 4M9SA 2B63J 3L00A 1ZG5A 1O3TA 2HTSA 3LAJA 1EA3A 1IZ1A 4RGXA 2VE9A 1XX5A 3FMRA 4EGZA 1P4XA 3WTXC 3CCJI 2EV5A 5L3BA 3CQZJ 1WGXA 5EEGA 2JA5J 3A01A 1JI8A 1RKTA 2H8WA 2ACJA 2DYRH 3I54A 2MD0A 1ZLJA 1Y1VJ 2JN6A 5LEJA 4ZTFA 5CKTA 1TNTA 3HUGA 3OYJA 2HFHA 3HSFA 3GFLA 2DFIA 2LMDA 1KZHA 3RIRA 3K1MA 2HDDA 2HDWA 4YIFA 3KE2A 2CQXA 4EATA 1S7AA 1R36A 3T5XA 5D5UB 5DUIA 3DPTA 1WJCA 4CZCA 4EJOA 2ZMEC 1X2NA 1EH6A 4PFPA 3BY6A 1AU7A 3F8FA 2A5YB 5EG0B 1K6YA 2HU9A 3VWBA 1ORKA 4M3EA 2HKXA 3VSKA 1OCZH 1QHGA 2D2WA 3HRTA 1BOBA 3PM1A 5BMZA 3H5AA 2ZMEB 1O3SA 2A61A 1J09A 1V55H 5L3FA 3M8EA 1YJ9I 4C2MJ 1U5TA 2X9DA 3SHFA 3OL3A 5CVRA 4ZYDA 2R0QC 3GTOJ 2QQ9A 2COBA 2EZLA 1B72A 2WWYA 1K83J 3AFHA 3ZR8X 1IXSB 2DT5A 1Z91A 3TEDA 1ZHFA 4RGSA 3BLYA 3P7NA 3TL4X 4YIRX 3ASNH 4BY7J 2ELHA 2WB1N 3T8RA 1R5GA 3ZMZA 4G6DA 1DP3A 3DWLE 1BC8C 2DJNA 3S2WA 1FIPA 5D6EA 3J7ZI 2F5CA 3I59A 2PJRA 5E8IA 4Q4ZF 2DMUA 3N05A 1V5FA 1W1WE 3JRFA 2EZKA 1JKOC 1HW2A 1IG7A 1X2MA 1QQIA 3CCMI 1U8BA 4NC8A 1FBUA 3F8MA 2HKOA 2Z3YA 3LSTA 3LFKA 4XIDA 3FXUA 1U3EM 4OIRF 1S3JA 2GXGA 3KIOA 3PNTA 4ENNA 2ECBA 2ZJRF 3VB2A 4C3HJ 3K69A 2MA3A 4BEHA 1ZG1A 4BDZA 1SVMA 3GMEA 4IHVA 5IT3A 3GFIA 3BZCA 1H9GA 3TP3A 2PJRB 3ZN1A 4BE2A 3KEQA 4G94A 5ICGA 1W0TA 2BVLA 2V1NA 3QWLA 1K7AA 4R79A 3QPTA 2KP6A 1AKHB 5BPDA 4F93B 2XGEA 4B09A 2KL4A 4OOIA 3VDXA 1XGMA 3M3YJ 1R1TA 1Z1DB 4I09A 1N77A 3H0GJ 3EETA 1FIAA 5JFRA 2KZGA 4A93J 2XROA 2CFXA 4IX7A 3IWFA 4DYCA 3V42A 2X51A 2K9MA 3LNQA 3L09A 4A69C 1M55A 3GTLJ 3KP2A 5LLQA 3EUHC 2JRMA 3E7LA 5EG0A 2P7CB 5F1RA 4XORA 2MBFA 4ZYGA 3ZQCA 5E20A 1XGSA 3K70D 3HKZA 1RZ4A 5FKOA 2LLKA 3LQQA 2HWVA 3KYCB 3ZMVA 2HNHA 1KQ9A 1I3AA 2PFBA 4C3JJ 1GT0C 2ZMEA 1R49A 3V8LA 4D1QA 3M07A 1XMXA 2BY0A 2O6GE 2K7LA 2WAQA 1P6RA 4XM3A 1JJ6C 1F9NA 4N0BA 1K4SA 5KCMA 1WJFA 3IRRA 4EM0B 5CYVA 1JHFA 2ZJPF 3U1DA 1NHAA 1QPMA 3H92A 2DLLA 1HCRA 3RZOJ 4WCGA 2VKDA 2R5YB 1P7IA 2BHYA 3ERMA 4E7IA 1OYWA 1BI3A 3CUQC 4B48A 3GX4X 1BW6A 3QYBA 4NHJA 1UZCA 1V5EA 4UVAA 1BR2A 4XLFA 1Y1WJ 5E79C 2DDAA 2AXLA 4UNOA 2O03A 3S3NA 1T0FC 3DTEA 3BJ6A 1WPKA 1HDPA 2NOGA 1TWCJ 3PQKA 2QENA 3SZTA 3N97A 2IVMA 3K4BA 3I55I 4YFKF 1ZR2A 2HOTA 3S32A 3V8KA 2VJ4A 1TT0A 1OR7A 1S6LA 4P55A 4CCMA 2PI0A 1WJ5A 1IC8A 4N4OB 2IA2A 4G9YA 3EUHA 2CUEA 4HV5A 3M1EA 3IL2A 2PMHA 2DA2A 1ZG3A 1VQ9I 2MYSA 1R6RA 4GYGA 1X3WB 5JVGF 2L7MP 3GF2A 2Z99A 4I76A 1GLNA 1CQTA 3CLOA 1NG6A 4PJ0C 4XQFA 4A6DA 4Y7NJ 4Y3OA 5B3SH 2O61A 1G2HA 3QQAA 2DA1A 1JUSA 1XMAA 2I8DA 4LIFA 4KA4A 2BOLA 2F5VA 2R7VA 2XSJC 5CVJA 5KNLA 1J5YA 1X1DA 1TWHJ 1HSJA 1WJBA 4C30A 3FHNA 4XL9A 3VEPA 2LD5A 1XSXA 4RGRA 1JKQC 1E17A 3D0SA 1XMKA 2YU9J 3O2PE 1TW3A 2HZDA 3BTIA 4DQ2A 2ITLA 2LC2A 3ZP5A 1FEXA 2VBYA 1UELB 2E1CA 3EYIA 4X0GA 1BBYA 3K70C 2ADUA 3FKIJ 1WRJA 4MGRA 1HQCA 5GAGJ 4A3GJ 1A35A 2ZXJA 3JR9A 1NH3A 3QPHA 1QA6A 3KYDB 4OAYA 1NK3P 3ZN0A 3RKYA 3G6EI 1OCRH 3HHGA 2LRDA 3RDIA 5GAEJ 4IRIA 2E34A 3ASOH 2VBWA 1WWXA 4KIFA 1OFCX 4Z6YA 1LE8B 1T56A 3F8BA 5M5WJ 3FZVA 4JQFA 1Z05A 1ETYA 4HSTA 5HDKA 1JUMA 5DM6F 3CJTB 1S7EA 4NB5A 5CPRB 2DOEA 2DMPA 2KPMA 2NAZA 2GZWA 5B1BH 1T98A 1BM9A 2LBFA 1MSEC 1XGOA 3RYRA 3WU1B 3WTTC 3DLAA 5CQGA 2BW3A 3AL0C 1LKXA 2DK8A 3GUDA 1P2FA 2AXTC 3VYUB 2QYOA 1O7LA 3W3CA 3S14J 2OZUA 2EFNA 2LK2A 1KU3A 1ERDA 1RUNA 3LFUA 3S17J 3F8CA 4UY8I 4OMZA 4CCLA 1UJ8A 3JSOA 3JRGA 3TBIA 4ZQ9A 3WTWC 1TWFJ 4OMYA 1VTNC 3CC7I 2V7FA 2R7SA 4GRIA 2H1KA 3S1MJ 2Q2EA 1K61A 4XRSA 2K02A 1B9MA 2DPDA 3AG1H 1FOYA 3OIQA 2MSYA 3M8JA 4A0XA 5K1YA 3OYGA 1B8IB 3BTCA 2V79A 4AYBN 5ED4A 1YTYA 3FXJA 3IUOA 3OOUA 2WV1A 1FSEA 1U9OA 3DPLC 3KP7A 4JX5A 3HGGA 4PSWA 1RIOH 3NQOA 1WSUA 2HDCA 4IF4A 3BG9A 5EJCA 2OCEA 3NWTA 3ELKA 3OL4A 1DPUA 4IHWA 4AU7A 3KP6A 2ZXIA 5J47A 4MIMA 2H1LA 1A04A 3C7JA 4FISA 1OISA 2M5WA 3X2QH 3IWZA 3I53A 2OD5A 2DJIA 4AC0A 2G9WA 2OBPA 4YIIA 3HL2A 3LSJA 1RI7A 2CYYA 4AIJA 2JUGA 2G7UA 4ZDOA 3W2VA 4FQGA 4D0PA 2ZNYA 4RA2A 1SFEA 4BS9A 2L02A 4HLXA 2M0CA 5J1UA 2O8XA 1BC7C 2ELKA 1BR4A 3H5RA 1ZREA 4ETSA 3ECHA 4FB3A 1QVTA 2JVHA 1WJAA 3CF2A 2JA2A 4KT5C 4YFXF 2FF4A 3QN2A 1LFBA 3ZQFA 5FD6A 1JGSA 2CG4A 3TKYA 4CA0A 5GAHJ 1B9NA 1D1BA 2ZBKA 1SFXA 4ZDLA 5B1AH 2Y9ZA 4O5VA 3BG5A 1VQOI 2RREA 2O5RA 1S72I 3FK7A 3OYLA 1MZBA 2V4JC 3EDPA 3C3WA 3UR3C 5IP7J 2A6HF 4KMFA 1R5ID 2VOPA 1J0RA 1JTXA 2EA2A 4B3XA 1D5YA 1H9TA 3CMMA 5HS8A 1Y6IA 4P5OA 3DP7A 3ISPA 2RN7A 3LSPA 2Y0SN 4M9XA 1FJLA 1Y8RB 1FP2A 1G59A 1WCMJ 1I27A 2ME6A 4M71A 4Z2YA 3W2WA 3BDDA 2CUJA 2VQCA 1ZGWA 1SVLA 1ZYRF 2CW7A 2NNNA 5D8LB 5F6FA 1JJ8C 2P5VA 2OZ6A 4HNTA 3CP8A 2IA1A 4BACA 4IHTA 3U1KA 4M3DA 1IJWC 3CD6I 2P81A 2VKVA 3HG9A 3F9KA 5DCMB 2FNPA 3CC2I 3DCFA 3P9KA 3LSRA 1LQ1A 4XNFA 1QO0D 5FFZA 2F2EA 1YRNA 2ZXHA 1KYZA 2KJBA 4XRMA 4WK8F 4XRSG 2HI3A 3V7SA 3QOEA 2BBYA 2GM4A 4GYIA 5E1XA 3OYEA 4MLOA 1TBDA 2PX9A 5TGTA 1BI0A 1FMVA 3BT9A 1KONA 2HEOA 2Y31A 5C4XJ 3DEEA 3GVAA 1GUUA 2LNBA 5CYNA 4C2UA 2QQBA 3BPVA 3MWMA 3HDDA 5GTHC 2STWA 4QTRA 1VNDA 1WVRA 3GCMA 2WBMA 2RNGA 5JI6A 3E6BA 4AUXA 2KJCA 4EM1A 2G7HA 2LREA 4WWCA 2R5ZA 1Z3YA 1KA8A 2FSWA 2ZCWA 4FT8A 3WE2A 2WA0A 1B6AA 3SYTA 3F21A 2OTJI 1J7KA 5FKLA 4HSRA 1ULYA 3LA7A 1T39A 3B73A 5DM7F 1ZK8A 3NARA 1T38A 1IF1A 3ULQB 4JYKA 5E17F 3S1NJ 2HXOA 4E6KG 3MD2A 4O3MA 2PEXA 1A6IA 3C2HA 4BXFA 3Q3SA 4IEJA 3K4LA 4PUSA 5K5QA 1WI3A 2CGPA 4IJAA 4EJVA 4HLYA 1CF7B 1MJBA 5DYMA 1HKSA 3EYYA 2FX0A 2K3FA 3QRFF 3C2GA 1WJEA 2A6EF 3LMMA 5IP6A 1O7FA 3IV5A 1R71A 4HQMA 2FRHA 3CZ6A 4XOPA 4A3IJ 5FLMJ 3W6VA 1UG0A 3BTJA 3CJNA 3DTIA 3FBIB 2CW8A 4ZH4F 1RC9A 3ABKH 5EZHA 2VLAA 3CUQB 4UVBA 1JGGA 1VQLI 1YHQI 1MDMA 3ESWB 3PFYA 2VXDA 4XONA 4CCOA 4D7MA 4F7ZA 3V4GA 4HBLA 2NS7A 1GV2A 4KJZA 2AQFA 2YS9A 1BIAA 5M3MJ 3DPUA 4DNCA 1I5ZA 2M34A 1KU9A 4ZTJA 4DYRA 3P5JA 3HGYA 1XGNA 3PUBA 4DIQA 4D9JA 2FUFA 3LQRA 1A31A 4U7DA 2GBYA 4AD9A 1GHCA 4BXXJ 3Q5FA 5DD8A 1MGTA 3QFQA 2EBIA 2ESNA 3QYFA 2XC7A 2J5OA 4KT6A 2FBIA 3HRMA 4HG2A 3JSPA 2JQ7A 5IT9Z 4MNUA 1LUJB 1F43A 2OQGA 1NK2P 2LF8A 2OQRA 5HDNA 3CO6C 2XRLA 5FLXK 5FROA 4A5NA 4S0HB 2BHZA 2MG4A 4X1EA 3OSFA 2AHQA 3D1NI 5F08A 5J4YA 3I56I 2RQQA 2HTJA 2LKPA 2L4MA 5HDGA 2IPQX 1N78A 2EA4A 2DFEA 5IP9J 5EZGA 1EKEA 3HZJA 2Z9OA 4RB1A 2I5UA 3I59B 3PO2J 2IJLA 5FRMA 4YFNF 4BHCA 1ZARA 3R0AA 2F5EA 3R0JA 2DMTA 1PUFA 2IAIA 4AIHA 5K7FA 2HQRA 2LYCA 4IXAA 4MQVA 4N9HA 2VPRA 2IS6A 5IT9K 1MBEA 3BPXA 2GA1A 2IS4A 2X85A 2F5FA 1R00A 1U6GA 3CUQA 1QVUA 2A07F 5J8CA 4IPAA 1YW8A 2DYSH 3FKJA 2HPIA 3SEZA 2YR2A 3OYAA 1QZZA 2VQGA 1Z9CA 2FQ4A 1PJRA 2LH9A 2XKOA 4JP0A 5FO5A 3OYFA 2LY1A 2YUSA 4S05A 2ETHA 1RESA 4A12A 1VQMI 3BTLA 4XICA 3ABTA 1X1CA 1HOMA 1KQ0A 5HNFA 1TWAJ 1W7PD 5FKKA 5H6QA 1HC8A 1G3SA 4MQ9F 2XGXA 3CJQB 4E7SA 3CCUI 1R1UA 3ZPLA 4FE4A 2TDXA 2B0LA 2MABA 5F0HA 4RAFA 3W2AA 2P6SA 2V1UA 4EJUA 4HPQA 3KZIC 1APLC 1L2MA 1HDDC 2FD5A 1UG2A 5HVQC 1W4MA 2IGKA 3F6VA 4CO8A 1A6QA 2QSHX 3RJPA 2WC2A 1VQ7I 1MW7A 1LVKA 3ZQGA 2QLZA 4YRVA 4F91B 4ITVA 4ESJA 2B9SA 2ZSIB 2COMA 2R5ZB 4JBAA 5DDGA 3Q0VA 2XF7A 5LGUA 3HPGA 2FU4A 5EF6A 2L9VA 2EFWA 2K9NA 3L2RA 1W5SA 3KLNA 4A3FJ 1X58A 3MFKA 2NYXA 4M74A 4B1RA 1B59A 2TRTA 1QZEA 5DCMA 4KFCA 2E1OA 3H9JA 4L5EA 1KU7A 3CC4I 1TLHB 3HBLA 5DD4A 2FE3A 2FMYA 2ZO4A 2UXXA 3QP6A 3ZMTA 5K7ZA 3ABLH 4GFBA 4CYCA 1AHDP 4KDPA 2EWNA 3DKYA 2ITJA 2DW4A 1MKMA 2FBHA 5E1ZB 5EYRA 4I7HA 3DEUA 3BR3A 2HOEA 1YX3A 1U5TB 2CRGA 3K0LA 2XAHA 3CESA 3IH4A 2IS1A 5HLIA 3SDGA 3H9GA 4XLCA 3G71I 2ZFWA 3D5LA 3KX2A 4WXCA 3RSNA 2IGMA 1ETKA 4RB2C 2VASA 4HAMA 1SFUA 4C3IJ 3H9QA 3G1LA 3RZDJ 3BQZA 1W36C 1WQ2A 4E7LA 1FY7A 2NNYA 4IQ4A 3KZZA 1IRXA 3D5SC 2Y30A 3JRDA 3FM5A 1BIBA 4RMNA 3LSMA 4Y52J 5H2FC 3HOYJ 5HS9A 3EUKL 4EEFG 4B3AA 3T1BA 1REPC 5C44J 3KLOA 3JW4A 2ZJQF 3WU0A 3DF8A 2DCEA 2XDVA 3M7GA 3JAMZ 2HVSA 3AG4H 5K5OA 2VODA 5H6RA 4QPQA 2FEZA 3KP4A 4AIDA 4BBRJ 1MNMC 3BWGA 4CCJA 1TQPA 4IHXA 3L2QA 3FMSA 1W7PB 2A69F 3GWZA 2FMLA 1NTCA 3ZRGA 1X1AA 1D1CA 2KKOA 4KW3A 1ZH5A 5CVVA 2X6XA 4XSXF 3WGHA 3WTYC 4BL0B 4IKFA 4D5CA 5AIQA 4E4HA 3MQ0A 2F6CA 3K10A 2VKHA 4IOCF 3FK6A 2H27A 2DTRA 1I6XA 3R4KA 4CUGA 4LMYA 4U0YA 2CSOA 4P9UA 3Q0UA 1FYKA 5D8KB 1P4WA 1Z1DA 2CS3A 5L3DA 2O0YA 3GLLA 2BZTA 2ICWG 2O3FA 2OJED 2QKLB 2AO9A 3M1CA 4QWQA 4CZZA 1YOVB 3S3OA 1FT9A 2RQPA 4UV8A 2BYVE 2RV8A 4ZJZA 3F72A 2Q0OA 5DS9A 3WU2C 3L2VA 4CICA 2L5QA 5IYCJ 3LSHA 3REOA 4IHYA 2OC6A 1SFKA 3IRQA 1ON1A 1OPCA 3HOSA 2DODA 4UVCA 3CCVI 2IT0A 1WFXA 4CHUA 2JK3A 3O6BB 2LR8A 1RR7A 2UWMA 3H1CA 5FD5A 1YG2A 3ZOBA 2QZ8A 4FTHA 2PMUA 2JT1A 1XCBA 4AWXB 2A05A 1P9QC 5E3LA 1FTZA 3CCYA 5J6XA 2AS5F 3PSIA 4HNVA 3DQVC 3O3KA 1SANA 3TW7A 3HRUA 4ZO0A 4PJJA 2HYJA 3HOUJ 2VL8A 4LLLA 2LSOA 3DBHB 3S1QJ 3HOZJ 5ERIA 4B8XA 5DV5A 1XPXA 1MMSA 2W4SA 4H4KC 2OTLI 1W5TA 2X6WA 2CQKA 2VN2A 1X4PA 1MDMB 2XUBA 1K4TA 3CMEI 3ZXSA 5FLVA 3ZCOA 1ZR4A 4A0YA 1DUXC 4N4NB 2V9PA 5GTIC 2DMQA 2STTA 4HYEA 1LE8A 4BAYA 2L4AA 2KMUA 2YU3A 2UZKA 3QYEA 2VOOA 2EK5A 3K2ZA 1ZLKA 2OCCH 4BGDA 3HRSA 2ME0A 2YSRA 4L5JA 2LBFB 3I4MJ 1IRZA 2KLOA 3ABMH 1IV6A 3VSLA 3CDHA 4IVNA 4L9VA 4EJWA 1H8AC 3FXMA 4QIWN 2MH9A 1MSFC 2DOAA 2ZXWH 1K79A 3GTGJ 3K4CA 1E2XA 3RKXA 3AL0B 3GEZA 4G8XA 3QU3A 4M9ZA 1IN8A 5DEQA 4CYDA 2O7OA 2HOSA 4HEA2 2VJIA 4PJLA 4L0ZB 3K4JA 4LLGF 2ESHA 2LTPA 3DFGA 3K1PA 3PSFA 1ZN2A 2IGNA 4R1HA 3F8NA 1ZGAA 2QSFX 1IN7A 1OR7C 2L54A 1N25A 3TDUC 5LFAA 1R7JA 3LSGA 2E36A 4XOTA 2RGVA 1MBFA 5HOOA 3LOCA 1UAAA 2QEXI 4DJAA 4XKBA 4I0BA 3J81K 2K9LA 3DBRB 3ZQ7A 2ISZA 1TQMA 3MVPA 4RS8A 5TRDA 3FF5A 1GV5A 5KAFC 3NEUA 2MH2A 1MMAA 1Z6RA 1IV8A 3I0TA 5A2QZ 3JREA 3DXJF 1G8XA 2EJRA 1W5CC 1XC5A 1YLFA 3GXOA 5D5VB 2F4MB 2E1MC 3E1SA 4RB3C 1JKRC 3HPHA 5K5RA 3L2CA 1TZLA 4E7JA 2W00A 1X3UA 4JK1X 3BG7A 2KZVA 2KQRA 1GXPA 3LA3A 1F08A 2MLKA 4M6XA 4BQNA 3JRBA 1SD4A 4J00A 1SD7A 1YQAA 1SMYF 4HA8A 4ZZDA 1IGNA 4LG0A 2XF5A 1RETA 5BS6A 3FX3A 2F5DA 3NWSA 4BHPA 1BW5A 2QQ8A 1D8KA 1PP8F 1QPIA 5E18F 1XDSA 2V1XA 1JKPC 5FRNA 3FHZA 5AIPA 3IC7A 1B4AA 3DKXA 1VQ5I 9ANTA 2FBKA 2CJJA 2KRFA 2CW0F 2XASA 2H6BA 2B7EA 4M3FA 1ETXA 1PUEE 2DI3A 3PFIA 1R23A 2V26A 1TL8A 1MNDA 1XG1A 3CF5F 4CGZA 1YO5C 1XSDA 2Y0SA 3FXKA 2IBDA 3TOBA 4M6VA 2NTCA 3SFZA 2R4GA 4HX7A 1UHWA 4DZPA 3I4PA 5H20A 5LD2C 2EINH 5KVRA 3SFIA 1STZA 1UHMA 2JSCA 3OR2C 1LDJA 5BNGA 2OU2A 4G7ZF 4LITA 4H0EA 1LPQA 1MH4A 2QF7A 5EEHA 1T6SA 3J80Z 3CMAI 2ECCA 4RAGA 1HSTA 5M5YJ 2M30A 4LK1F 5ILVA 5LGTA 1QU3A 3LL7A 5B66C 3AKZA 2H6CA 4A0ZA 3H3UA 2FXAA 3G73A 2EV0A 3IAS2 2XV4S 3MCZA 2Q8KA 4AVZA 3RKWA 2XHKA 1VI0A 4BUPA 2L9NA 1IO2A 1FOKA 1VQNI 2E71A 3JRHA 1IUYA 3KETA 3CTAA 2JUCA 3TOAA 3CCSI 2NS0A 2QA4I 3SXYA 1QZYA 5D5XB 1DGRM 2K86A 2XPUA 3MKLA 4OIQF 1TNSA 4G6QA 2JPBA 3RQ4A 3VODA 2J5PA 3WG9A 3L1PA 1D0YA 2R7RA 1W36D 4OIOF 1B1BA 2QQAA 3R6SA 5TISC 3NAUA 3V7CA 2EFPA 1HW1A 3DU6A 3WGIA 3S15J 3K4NA 3LWFA 3KYLA 1J75A 3SDBA 1WH7A 1O4XA 2VXZA 3MZ8A 4KN7X 2XGCA 2JZYA 2XKPA 3T8TA 2R7ZJ 4NQWB 3GTMJ 3VYTB 2DO7A 5LHHA 3B6CA 1YE9A 2M45A 3L9FA 4A5MA 4BH9A 2QBYA 2M7AA 5EGOB 1WJDA 2IP2A 4HQEA 2R7UA 1D1AA 4XLPF 4XSZF 4HW0A 3DV8A 4IRHA 4G7HF 2KFDA 2A6TA 4M3GA 3BROA 1ZKGA 3RPUA 4CCKA 2WV0A 2LOOA 1DQUA 2IS2A 1MNEA 4RB0A 2MGQA 4U7BA 4LG3A 4HF0A 4GDFA 1KSXA 1ZRDA 3BOQA 3J80K 3TW6A 3CCEI 5HLGA 4KNYA 2FA5A 2X0LA 1FWZA 2ZFUA 1OQYA 2BV6A 3DKWA 3E5XA 4LGWA 4MEYF 1DDNA 3M8FA 4NDLA 3CJRB 2W84A 2Y48A 1N75A 2E2IJ 2ZKZA 5GPCA 1UUTA 1JTYA 2KISA 3FBNB 1S29A 2H94A 3L2UA 1QGPA 3HIFA 2WAEA 2VI6A 5FKNA 1R5HA 4BJ5C 1MMGA 3K1NA 1IN4A 3HEFA 2MD5A 1G3WA 3C1DA 1Z67A 3OS0A 3V7RA 3G3ZA 4C2TA 2VIXA 2NVUB 1T8IA 3FISA 2D1HA 3E3VA 1B72B 2X1CA 4BY1J 2L3DA 2VT2A 1KSYA 2L7KA 4IOAF 2CUZA 1YI2I 5ILUA 4A3EJ 1IRGA 2GWRA 1Y0NA 4BBSJ 1Y56A 2ZB9A 3I5UA 2LKXA 3AG3H 3IHUA 2Z16A 4BQAA 3GLXA 1K6OA 1E0EA 2JJ7A 3Q9SA 1QHHD 1T0FA 1LEAA 2FOKA 3HUGB 4MFDA 2DPUA 3BR6A 3VOEA 4XLNF 5IYBJ 5EDNA 4ABZA 5K7HA 1Z77A 3FXOA 1K78A 4HX4A 2PMZA 2QVOA 4V19K 2BGCA 3KEYA 3L2WA 4B43A 1WHUA 3ZQQA 1BJAA 2HQAA 4IL6C 2VQLA 2BXYA 2OV7A 2VONA 2ISYA 3R60A 1JXSA 2NL8A 4RAZA 3ZMSA 1JUPA 5EEAA 1VZ0A 2XSDC 1HF0A 3J7AO 3GZ5A 2W48A 5TJJA 1BJZA 2KHMA 4BJ6C 2DQLA 3HOXJ 1R9TJ 1FNNA 3HOTA 1YRNB 1ZGJA 4BE1A 3ONQA 1AWCA 1T08B 2QBYB 2WAFA 5HLTA 5BYGA 3ZQIA 4B44A 2CH0A 3GYHX 4II2A 3BR1A 4P9FA 3SJMA 5J1RA 1QNTA 2E60A 3GFJA 1ITYA 4G12A 3A0HC 2F4IA 4UXNA 3ROUA 2BXZA 4PJNA 1R58A 2M8EA 2FQ3A 4CCNA 1PVEA 2E19A 1U2WA 1X19A 3DLLF 2K40A 3BR2A 2NVYJ 3FWEA 3KPHA 2IGOA 1U8RA 2LFBA 2DTZA 2UXNA 3I71A 1I3QJ 4QPOA 1ODDA 2V6EA 2DU9A 3KEOA 3TQNA 4XMYA 4G6TB 3A1YA 3BG6A 4L9TA 3E6CC 3H3VK 1I1SA 3IAM2 2M4GA 4I2OA 4LMDA 4ZDPA 4Y15A 4PK4A 3QK2A 4MFEA 2VQHA 3PNYA 4NC6A 3OSGA 4MEXF 3WHCA 1OCTC 2A68F 3FMQA 3OMYA 4LJZF 1LFPA 2GAUA 2YX7A 1BR1A 1ETWA 2M87A 1HA8A 3OS1A 2ZJ2A 2X4HA 1CF7A 2F48A 5J8FA 1FOXA 3I64A 1J59A 2E1MB 1IN6A 2IF9A 1OMIA 2E5NA 1FBQA 2DA7A 2GA2A 2WTEA 2YPRA 2Q1ZB 2IA0A 4IO9F 3VPRA 1Q1HA 3QU6A 1K78B 3OY9A 3JRIA 4LIUA 1BA5A 3G2BA 4PGGA 2V9VA 3BP8A 4Q5SF 1YJWI 4OWRB 2VBZA 2XB0X 4DW6A 1VQ6I 2E1NA 1TBXA 3TO6A 1MH3A 3OIPA 5F0CA 2DOFA 3B6AA 1KYWA 3SZGA 4PDKA 2VJJA 4UB8C 1S8NA 2L01A 2PN6A 4NUBA 1WKMA 1SD6A 2L0KA 4XLAA 4ON0A 5L3EA 2XAFA 1G3YA 2NS8A 3OS2A 2HOAA 2RAEA 1L3LA 2M2EA 5E1WA 2NRAC 4V2FA 1SFOJ 1MBKA 1FZPB 2QUFA 1OCPA 3OYDA 1MIJA 4FX0A 1HKQA 5F1JA 2Y69H 1PP7U 4I98B 3KP5A 1HBXG 3BR5A 3OYHA 4YEJA 1VQ8I 3K2AA 1B8IA 1TTYA 3LSKA 5M5XJ 4BXUA 2W7NA 1ZQ3P 5B5EC 1H88C 1C0WA 3I9V2 1G4DA 2M4KA 1IXRC 1TT5B 1U9NA 1XN7A 1WZ2A 2XGDA 3N4MA 5IOZA 3K6GA 5E3NA 1U5TC 3BQYA 2ZSHB 2GXAA 4DYQA 1ENHA 4O6JA 1BI1A 1J9IA 3GZ6A 1OYYA 2PMZN 3K7AJ 4A3BJ 1E3OC 3JRCA 2BE5F 4UV9A 1H89C 2LG4A 3BZKA 2Z1DA 3TDZC 5GADJ 3FIWA 4Y13A 2M0MA 5M3FJ 4G7OF 2EFQA 1IRFA 1FPQA 5GP9A 2DA5A 3MZYA 4RGUA 4A3MJ 4HF1A 2KDZA 2CFOA 4BDYA 1A5JA 3CCLI 4KIBA 2QCOA 2BY1A 2V9KA 2HVRA 5D5WB 3CMYA 1SEUA 2HW0A 4IRGA 3TGNA 1IW7F 1R22A 2H09A 2VC0A 4I0AA 3SQNA 4CH7A 2BY3A 3IKTA 4HDUA 3S8PA 1FSHA 1SVOA 1VF9A 4A6EA 1Z7UA 4F55A 1GXQA 4HRIA 2BW3B 4L9JA 3E5QA 1ZELA 3ML6A 4FE7A 3S93A 1T2KA 2VT3A 1U78A 4A3LJ 4KYWA 3BC8A 1D5VA 3E5UA 1ACIA 4GGGA 4HDVA 4LB5A 3RPUD 2R92J 5FFXA 4ZYAA 5JR3A 3CCQI 4FGNA 2ID3A 5JVTA 2RDPA 5ILSA 4EGYA 4MTEA 1W7PA 4AIKA 1FOWA 2M1BA 4RAYA 4ZYEA 4ESBA 4MO7A 2R7DA 3OWTA 3G4SI 1LVAA 2DFFA 3U21A 3HTUA 3RYPA 1ZTRA 2C6YA 2XVCA 3HC7A 2JA8J 2EB7A 2Q2EB 3IKVA 1P92A 1YJNI 4DZJA 1DPRA 2UUZA 4BQQA 1MBHA 2IW5A 3P9CA 2A5WA 1D0XA 4I6ZA 1Q1VA 2MLGA 3QPSA 3A02A 3L7WA 2M3AA 3WG7H 1V5GA 3HJEA 1OLTA 1MBGA 3PUFA 4BNCA 2HYGD 2Y75A 3E6MA 4A2UA 2CQ7A 4XN0A 3OR1C 2OUMA 3BCBA 4OINF 1L0OC 1VQKI 1HXDA 4UUSA 1O57A 4LB6B 2GXBA 3MKYB 1USTA 4PJMA 3PNVA 1WI9A 2JA6J 5IOYA 1IXCA 3S2DJ 3HXLA 4LFUA 1FMWA 2EFOA 2VE8A 4E70A 2DXIA 5JHFA 4E7HA 2JPCA 1IAWA 2K85A 2KRHA 1BN5A 3AAFA 2HS5A 4ZC3A 1I6HJ 4M3BA 3PQJA 4TV7A 1YYVA 2X48A 3C2BA 3E97A 1DU6A 2K27A 4CYCB 3DBLB 2JA7J 1LEBA 3WGGA 4NBQA 2IRFG 4KIGA 2X6OA 1SAUA 3U2RA 5CVIA 1JT0A 1RRJA 3BZ6A 3O8HA 2JSPA 2CMPA 2OPTA 2R7QA 4BYYA 2E2JJ 4PSXA 5HODA 3RQIA 5F0FA 2HVQA 2HXIA 4EMSA 1R4NB 2HGCA 1GDTA 1OCOH 4NC7A 1TQIA 5DTDA 3DTKA 3SZPA 1VFCA 4LD5A 3WTSC 5J4VA 2DK5A 3S3MA 4NBPA 2K3PA 1EJ9A 5D4RA 1FLIA 3R61A 4D7NA 2X1DA 3HOWJ 3QODA 4B4CA 2GIVA 2WADA 3F6OA 3JCUC 3IH3A 3GTKJ 2KIUA 4UUTA 3HYIA 2P4WA 4PFOA 4XRFA 3ERED 1LFUP 2JWTA 1MMNA 2DDBA 2VUMJ 1TC3C 4II3A 1MMDA 1RKWA 1YS6A 1Z3XA 2HQNA 5BPIA 3CCRI 1JE8A 5ICEA 3JTGA 1IN5A 3OYIA 2W85A 1P7JA 1DU0A 1D0ZA 1QRYA 3OYCA 1YIJI 5FLXZ 2Z33A 5JLXA 2KT0A 1UB9A 4XKCA 4A3KJ 5BOXA 2CQNA 3EPZA 2VBXA 2GOXB 5FKMA 1O3QA 2QSGX 5LHGA 2DAOA 5LRSA 2NOJB 4PZJA 4J01A 2EV6A 2JRTA 3KFWX 4U88A 1BI2A 1YX5A 4XKWA 4F3QA 4JX6A 1S5LC 2WB1A 4FASD 4YG2F 5ICCA 3RI4A 2FNAA 5D9IA 2D5VA 4BEHB 4PCQA 5F04A 4C9YA 2EIMH 1YIOA 1XCVA 4E7ZA 4OAZA 3GZNB 3A4CA 1ON2A 3MMYB 2RC4A 4RLQA 2VB6A 4L18B 4S04A 3TO9A 2DT6A 2HQ5A 5C3EJ 4Y33A 2XIGA 3VFZA 1JHHA 1EH8A 1GVJA 1MD0A 3MKWB 2F4OB 5IPAA 3BCAA 5J40A 3GBGA 4AYBA 4WX9A 4UB6C 3ZQLA 3QOPA 3O8GA 4XLEA 1A36A 3WTUC 2M8GX 3LSIA 5J3LA 2CWEA 6PAXA 2VPLA 4LOCA 3HSRA 3E6DA 2KIQA 4U0VA 2HYFA 5AONA 2EH3A 3WHBA 4KMUX 2UV1A 1MBJA 3IH2A 3LA2A 1IDZA 2V6CA 4YELA 3PJRA 2TBDA 3J7YJ 2R7XA 3FXQA 2W1OA 2ZNZA 2E35A 3CO7C 1F36A 2K4JA 2M7BA 4RDUA 1PDNC 5FJ8J 2K5CA 1T33A 3WE3A 3CDLA 1FBSA 2HPMA 3FXRA 2K4BA 1OCCH 4IHSA 1HLVA 5J1YA 3ZQHA 4DGWB 3JRAA 2XAJA 3RPQA 2VKEA 4KICA 4CDGA 2P6TA 1RPWA 2EQRA 2KIFA 5KHDA 1BOAA 1I50J 1U0JA 1S7OA 2L2OA 4E7KA 3B02A 3GFMA 5F64A 3OYNA 4JX4A 1LJ9A 2D1VA 3H36A 5DCFA 4X6AJ 1NG7A 2L9RA 3I3LA 4FCYA 1O3RA 2LF7A 3HHHA 4HV6A 2W82A 1DP7P 2GQQA 1POGA 2JMWA 2Y9YA 4ENMA 1OJLA 3G1MA 4I01A 4ENKA 1EV7A 5DUKA 4A3DJ 5F27A 3OV8A 1R9WA 1V3FA 5HS7A 1TW2A 3F22A 2KDOA 2P0WA 4WXHA 1D8JA 4P96A 1R4MB 1VQPI 1AKHA 1D3YA 5LHIA 1AOYA 3K4MA 2DMNA 1RNLA 5IY5H 4ESFA 2DT7B 2DQRA 1G6NA 4CXFA 3KCCA 1FTTA 2WY8Q 2X6YA 3RCOA 3TO7A 2Y2ZA 4L0YB 4XR6A 4A3CJ 3RKQA 2NVTJ 2LP0A 1G3TA 2IXSA 4I99C 2P5LC 1F1ZA 1TWGJ 3MZHA 4IQJA 4ZYHA 2CO5A 4BKXA 4OIPF 3W6JB 1AA7A 3WTZA 5JHUA 2LY2A 1EF4A 5EGOA 1S9HA 1SAXA 4LIVA 4RLFA 5HLHA 2ELJA 4KITB 2R7WA 2DN0A 1RR8C 1EH7A 3OYKA 3I4NJ 1FYLA 3F3XA 2HR3A 4Y4RA 2E2HJ 4XK4A 3Q0WA 2OA4A 3CUOA 1Y8QB 4KN4X 1V4RA 1QBJA 2L7ZA 2CV0A 2MFZA 2P8TA 3K9TA 2DFHA 4KUMA 4ENJA 2BY2A 2R7OA 1YW7A 4L9NA 3ZMDA 3LAPA 2G0EA 4LG0B 4AVPA 1ZAOA 2EILH 2R5YA 3WTVC 2LKSA 2FJ1A 1UHSA 2FOWA 2V1DA 3HB9A 1PYVA 3JTHA 1YW9A 5A2QK 4B47A 1KQ8A 4A3JJ 1ZRFA 4R8HA 1Y0UA 4EVIA 1ETVA 3S1RJ 4P1WA 2XRNA 4HX8A 2EPFA 2RNJA 3TP0A 1E3PA 1USSA 4HZFA 4EJTA 5JLWA 1R1VA 1ZRCA 3HM5A 3RTRA 2R7TA 2NVQJ 4QSHA 4LK0F 3ZGKA 4D5FA 2OF7A 4DOZA 1Z7LA 2W25A 3M4OJ 2K9SA 3WODF 3PIOF 4CSWA 3PO3J 1LNWA 2TCTA 4Y17A 4RM2A 3MN2A 1X1PA 1IUFA 3SEQA 2M9HA 2E7XA 1KU2A 2VC1A 5L3GA 5LBQA 3A01B 2DA4A 2WAQN 2GLOA 1OKRA 2PBIA 3H0DA 4JOMA 1VQ4I 3OOPA 3FXLA 1X1BA 5CQEA 2W24A 4FETA 2QM3A 1F5TA 2FUG2 3F23A 4QLCU 3H3ZA 5C4JJ 3QP5A 2L7FP 2QKMB 2R3SA 2P7VB 2KIMA 4U87A 3HKZN 2R7FA 1LDDA 1RZ9A 2EIJH 1LB2A 3COAC 2R93J 2MC3A 2QGUA 3ABUA 1M1EB 1X3ZB 3BJOA 5KK1A 5E3OA 1XDUA 4ASNA 1MJAA 3FDYA 3JAMK 1JT6A 5D4SA 2PLYA 2XPVA 1X4OA 4BJTA 4L5IA 5KAIC 5HNHA 4AM3A 3S2HJ 1ONVA 1SMTA 5GPAA 2RVCA 3OYBA 5FB2A 3MKZA 4MTDA 1SC7A 5LGNA 3DU5A 2NVXJ 3M9AA 2E7WA
chains in the Genus database with same CATH topology
2MC4A 2UWMA 3I9V2 2M4KA 3D5RC 4CCLA 3TBIA 4ZQ9A 3K6GA 3PL8A 2ZSHB 2V7FA 2R7SA 2X1EA 4GRIA 2CV1A 1P9QC 3PSIA 2AQEA 3OYMA 3DQVC 2LG4A 2E5ZA 4ZO0A 4PJJA 3OIQA 2Z1DA 4RM3A 2VL8A 3M8JA 2M0MA 3OYGA 3K4KA 3EUAA 3IUOA 3OOUA 2W4SA 3DPLC 4H4KC 2CFOA 4BDYA 4HNUA 2X6WA 2Z2SB 1X4PA 4XKVA 2V9KA 4PSWA 3A2KA 2HVRA 2L9SA 3ZXSA 3ZCOA 3NWTA 4KISA 2HW0A 1DGWY 2XAUA 3OL4A 4N4NB 3E0JB 4NNJA 4CH7A 3VYSB 4AU7A 1T95A 3S8PA 2KMUA 2ZXIA 3QYEA 4F55A 3J7AY 4HRIA 2BW3B 4BGDA 1ZELA 3S93A 2LBFB 4F52A 2KLOA 3BC8A 3VSLA 2DJIA 3HL2A 2DOAA 3RPUD 2JUGA 3K4CA 1L5IA 4BE0A 3AL0B 4ZYAA 4ZDOA 3W2VA 4FGNA 4BS9A 4BU2A 4F92B 4HEA2 2VJIA 4PJLA 3H35A 3K4JA 3PSFA 4ANJA 2KRCA 1BR4A 1LDKB 2IGNA 2VJ5A 3H5RA 2JVGA 4DBQA 2IPRA 1OR7C 4FB3A 5LFAA 3LSGA 4XOTA 2JVHA 3OWTA 1WJAA 3CF2A 2JA2A 3UNGC 2BVMA 3VYRB 5HOOA 3U21A 4XLHA 3QN2A 1UAAA 4DJAA 4XKBA 4DBRA 2K9LA 4CA0A 1D1BA 1Z21A 3HC7A 4ZDLA 2Q2EB 1MMAA 5DCXA 2RREA 2UUZA 4BQQA 2O5RA 3OYLA 2A5WA 1D0XA 3CP2A 2V4JC 1G8XA 3UR3C 4B3XA 3TMOA 2M3AA 3CMMA 3H5NA 1V5GA 1OLTA 1Y6IA 4P5OA 2E1MC 3E1SA 4XN0A 3OR1C 3HPHA 2OUMA 3BCBA 1TZLA 2WY7Q 4E7JA 4BQOA 2W00A 1G59A 3BG7A 2KZVA 2KQRA 3W2WA 2CUJA 2VQCA 3MKYB 2CW7A 4PJMA 4IZZA 3PNVA 2XF6A 1F08A 2CV2A 3HXLA 4BQNA 4HNTA 1FMWA 3CP8A 2DXIA 4BACA 4J00A 5JHFA 3HG9A 3F9KA 4E7HA 3IP4B 2GOMA 2XF5A 2KRHA 3NWSA 4XNFA 2ZXHA 4ZC3A 4XN3A 5FRNA 3QOEA 3DKXA 3OYEA 4MLOA 1TBDA 5TGTA 1EA3A 1FMVA 1KONA 3DEEA 1SAUA 5CYNA 2V26A 4C2UA 1MNDA 2JSPA 2CMPA 2R7QA 4PSXA 1JI8A 2Y0SA 2HVQA 2MD0A 2RNGA 2WBMA 2NTCA 4ZTFA 2R4GA 2LREA 4NC7A 1Z3YA 5CKTA 3DTKA 3OYJA 5LD2C 2WA0A 3SYTA 3S3MA 4NBPA 2HDWA 2K3PA 4HSRA 3OR2C 2X1DA 3QODA 4EATA 3DPTA 1WJCA 2WADA 4LITA 4CZCA 4PFPA 3MD2A 4E6KG 4BXFA 3C2HA 4PUSA 3K4LA 4PFOA 3VWBA 1K6YA 2HU9A 1MMNA 1QU3A 3VSKA 1QHGA 3LL7A 3AKZA 4II3A 1BOBA 1MMDA 1Z3XA 3H5AA 3IAS2 3C2GA 1WJEA 3OYIA 1J09A 3LMMA 1D0ZA 3OYCA 4AVZA 3OL3A 4BUPA 2L9NA 4XKCA 3CZ6A 4XOPA 3EPZA 1UG0A 3DTIA 2GOXB 3FBIB 2CW8A 1DGRM 4J01A 2NOJB 2VLAA 3AFHA 3ZR8X 3PFYA 3RQ4A 2VXDA 1YX5A 4XONA 4CCOA 4XKWA 4F3QA 1D0YA 4FASD 2WB1A 2R7RA 1W36D 5D9IA 4KJZA 4BEHB 3DU6A 2AQFA 3BLYA 3K4NA 3TL4X 3KYLA 4E7ZA 3DPUA 4OAZA 3SDBA 3A4CA 2VXZA 3MMYB 1DP3A 4ZTJA 4RLQA 3DWLE 3PUBA 2VB6A 4DIQA 4D9JA 2DT6A 2FUFA 4NQWB 3VYTB 2PJRA 4Y33A 3N05A 1V5FA 1YE9A 3MKWB 3QFQA 3BCAA 3QYFA 3GBGA 2M7AA 4AYBA 2XC7A 1WJDA 4KT6A 4NC8A 2R7UA 4XLEA 1D1AA 4HG2A 3LSIA 2VPLA 2A6TA 3PNTA 5FROA 4CCKA 2LOOA 1DQUA 2UV1A 2IS2A 1MNEA 4U7BA 4LG3A 4BEHA 4GDFA 1KSXA 4BDZA 2RQQA 3PJRA 4YELA 1N78A 2TBDA 2R7XA 2W1OA 2ZFUA 2M7BA 2PJRB 2K5CA 4BE2A 2HPMA 3CJRB 5FRMA 1N75A 2BVLA 2V1NA 4DGWB 4R79A 2KP6A 4F93B 1UUTA 3FBNB 2LYCA 2KL4A 3L2UA 3VDXA 2WAEA 1Z1DB 1N77A 4BJ5C 5KHDA 1MMGA 2IS6A 3OS0A 4IX7A 2IS4A 1U0JA 2X85A 3V42A 4C2TA 2VIXA 2L2OA 4E7KA 2X51A 2K9MA 1M55A 1ERDA 2X1CA 3OYNA 1KSYA 3FKJA 2L7KA 3EUHC 2HPIA 3SEZA 1NG7A 3OYAA 2VQGA 2CUZA 3I3LA 4XORA 3OYFA 1PJRA 2LH9A 3K70D 3HKZA 2LY1A 2W82A 2HNHA 1Y56A 1X1CA 5HNFA 1R9WA 4D1QA 2Z16A 1E0EA 2KDOA 1QHHD 2P0WA 3HUGB 3CJQB 4E7SA 3K4MA 2MABA 3W2AA 2WAQA 4HPQA 4XM3A 1L2MA 2DT7B 2PMZA 5HVQC 5KCMA 1WJFA 2IGKA 2WY8Q 2X6YA 3KEYA 3L2WA 4B43A 3RCOA 3ZQQA 2HQAA 1MW7A 1LVKA 4XR6A 2VQLA 4YRVA 4F91B 2OV7A 4ITVA 2IXSA 2NL8A 2VKDA 2ZSIB 1VZ0A 4E7IA 4IQJA 4B48A 3QYBA 4XLFA 1V5EA 1BR2A 2KHMA 4BJ6C 2XF7A 3HPGA 3HOTA 1AA7A 4BE1A 2LY2A 3S3NA 3L2RA 1T0FC 3ONQA 1S9HA 3DTEA 2WAFA 4LIVA 4RLFA 5HLTA 5BYGA 4B44A 2CH0A 2ELJA 4II2A 4KITB 2R7WA 3H9JA 2E60A 3OYKA 3K4BA 4Y4RA 3S32A 2F4IA 2VJ4A 3DKYA 1TT0A 4PJNA 2ITJA 4CCMA 1WJ5A 4CCNA 4N4OB 1X19A 2CV0A 1YX3A 2MFZA 3CESA 2IS1A 2IGOA 2MYSA 2R7OA 1R6RA 3H9GA 4XLCA 3D5LA 4QPOA 3KX2A 3RSNA 1GLNA 2IGMA 1NG6A 4XQFA 2VASA 2V6EA 4XMYA 1PYVA 3H9QA 4G6TB 4B47A 3A1YA 4Y3OA 1W36C 3BG6A 4E7LA 4IQ4A 3IAM2 2M4GA 1IRXA 4P1WA 4LMDA 3D5SC 4ZDPA 2I8DA 4PK4A 3QK2A 4LIFA 4RMNA 3LSMA 2VQHA 3PNYA 2BOLA 2F5VA 3EUKL 2R7VA 2XSJC 3OMYA 3RTRA 5KNLA 2R7TA 1LFPA 3ZGKA 1X1DA 2HVSA 2XDVA 1WJBA 2DCEA 4DOZA 1Z7LA 1BR1A 4C30A 3FHNA 4CSWA 4XL9A 3OS1A 1HA8A 4QPQA 4CCJA 3L2QA 4RM2A 3ZRGA 2E1MB 2IF9A 2E5NA 1X1AA 2HZDA 3SEQA 1D1CA 2ITLA 2LC2A 2Q1ZB 4KW3A 3H0DA 4JOMA 2X6XA 1UELB 1X1BA 4BL0B 5CQEA 4X0GA 3K70C 4FETA 3OY9A 4IKFA 4LIUA 2FUG2 4E4HA 3G2BA 2F6CA 3K10A 2VKHA 4OWRB 2QKMB 4OAYA 4CUGA 3OIPA 4U87A 2LRDA 3SZGA 2CS3A 1RZ9A 2VJJA 3M1CA 2QKLB 4NUBA 4XLAA 3S3OA 4JQFA 4HSTA 4ZJZA 5CPRB 3OS2A 3L2VA 2KPMA 2L5QA 3LSHA 3FDYA 2LBFA 1SFKA 2OC6A 3OYDA 3DLAA 5CQGA 1X4OA 2BW3A 4BJTA 1LKXA 3HOSA 3AL0C 5HNHA 3VYUB 3OYBA 3MKZA 3OYHA 4YEJA 3W3CA 3LSKA 3DU5A 1WFXA 4C9YA 2W7NA 3LFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKX A;  4U87 A;  3DKY A; 
#chains in the Genus database with same CATH topology
 2Y0M A;  3AG2 H;  3QPL A;  2DA6 A;  5CJ9 A;  1FC3 A;  5E8G A;  5D6F A;  2MC4 A;  2P5K A;  4MHG A;  4HF2 A;  5LEK A;  2XAQ A;  2XB5 A;  3D5R C;  3T0Y A;  2PG4 A;  2EZH A;  3NRV A;  2NXN B;  4XBF A;  3PL8 A;  2QWW A;  2X1E A;  2CV1 A;  3CDI A;  2DA3 A;  4UUS B;  1HW5 A;  1RUO A;  3V8J A;  2LDU A;  2CQQ A;  3BR0 A;  1ETO A;  2AQE A;  4WF2 A;  3OYM A;  1FX7 A;  3QAH A;  2YX4 A;  4NQW A;  4M72 A;  5FGM A;  2E5Z A;  2W57 A;  4HOB A;  4W1U A;  5IYD J;  4RM3 A;  3F0C A;  1KGS A;  3K4K A;  3EQL F;  3EUA A;  5E3M A;  3Q9V A;  4Q47 A;  4HNU A;  2Z2S B;  4I02 A;  4FX4 A;  2MW8 A;  1MJ9 A;  4XKV A;  2ZC2 A;  3A2K A;  1XB4 A;  2L9S A;  1Y39 A;  1I1G A;  3J81 Z;  1SD5 A;  4KIS A;  4W97 A;  3GTJ J;  1DGW Y;  2XAU A;  3E0J B;  4NNJ A;  3S16 J;  3G1O A;  3VYS B;  1T95 A;  1HKT A;  3MEX A;  3W6K B;  2HZT A;  4EM2 A;  1TP4 A;  2DBB A;  3J7A Y;  2LY9 A;  2A3S A;  4ZZL A;  2O9L A;  3GO5 A;  2PJP A;  4F52 A;  1WH5 A;  3BG3 A;  4GCV A;  2H8R A;  2O8K A;  1YFH A;  2GIZ A;  4Q48 A;  1XS9 A;  5CVU A;  1PUF B;  1ETQ A;  1XD7 A;  1L5I A;  4OU0 A;  4BE0 A;  3UKG A;  1BL0 A;  4FHT A;  3ECO A;  3OIO A;  3GTP J;  4BU2 A;  4F92 B;  5LRR A;  3HSE A;  3H35 A;  4ANJ A;  2KRC A;  4M73 A;  1LDK B;  2VJ5 A;  1XTA A;  2ID6 A;  1H0M A;  2JVG A;  4DBQ A;  1IDY A;  3KZY A;  5ICF A;  2IPR A;  4EQQ A;  3BJA A;  5BQT A;  4LLN A;  5CLS A;  3UNG C;  2BVM A;  3VYR B;  1J2X A;  4J19 A;  4XLH A;  2Z5U A;  4N9I A;  3HTS B;  1Z0X A;  1V54 H;  3U9G A;  4DBR A;  2LVS A;  1Z21 A;  2XAG A;  2XPW A;  3A0B C;  3GW2 A;  2EIK H;  3ZMU A;  1I39 A;  4RBO A;  1Z6T A;  5DCX A;  4EV0 A;  3CLQ A;  2I10 A;  3DEW A;  1GVD A;  2IEK A;  3CP2 A;  3HOV J;  1W0U A;  1P4A A;  4M6Y A;  3TMO A;  3H5N A;  4PGH A;  4WXD A;  2CU7 A;  2JTV A;  2RKH A;  2PQ8 A;  2N8G A;  4BHB A;  2WY7 Q;  3I58 A;  4BQO A;  1OYI A;  1FP1 D;  5L3C A;  2BEO A;  3PIP F;  4IZZ A;  4GXO A;  1UFM A;  2XF6 A;  1UCR A;  2OAZ A;  3MAJ A;  2CV2 A;  3GTQ J;  3A03 A;  1E3H A;  4UUV A;  4GO1 A;  2K9Q A;  4UHT A;  1UMQ A;  2CUF A;  3IP4 B;  4V2G A;  2GOM A;  2D45 A;  2EZI A;  3FM3 A;  1YIT I;  1YS7 A;  3C18 A;  3KP3 A;  3P9I A;  4K2E A;  4XN3 A;  1CGP A;  1F4K A;  1XSV A;  1FYM A;  4U0W A;  4M9S A;  2B63 J;  3L00 A;  1ZG5 A;  1O3T A;  2HTS A;  3LAJ A;  1EA3 A;  1IZ1 A;  4RGX A;  2VE9 A;  1XX5 A;  3FMR A;  4EGZ A;  1P4X A;  3WTX C;  3CCJ I;  2EV5 A;  5L3B A;  3CQZ J;  1WGX A;  5EEG A;  2JA5 J;  3A01 A;  1JI8 A;  1RKT A;  2H8W A;  2ACJ A;  2DYR H;  3I54 A;  2MD0 A;  1ZLJ A;  1Y1V J;  2JN6 A;  5LEJ A;  4ZTF A;  5CKT A;  1TNT A;  3HUG A;  3OYJ A;  2HFH A;  3HSF A;  3GFL A;  2DFI A;  2LMD A;  1KZH A;  3RIR A;  3K1M A;  2HDD A;  2HDW A;  4YIF A;  3KE2 A;  2CQX A;  4EAT A;  1S7A A;  1R36 A;  3T5X A;  5D5U B;  5DUI A;  3DPT A;  1WJC A;  4CZC A;  4EJO A;  2ZME C;  1X2N A;  1EH6 A;  4PFP A;  3BY6 A;  1AU7 A;  3F8F A;  2A5Y B;  5EG0 B;  1K6Y A;  2HU9 A;  3VWB A;  1ORK A;  4M3E A;  2HKX A;  3VSK A;  1OCZ H;  1QHG A;  2D2W A;  3HRT A;  1BOB A;  3PM1 A;  5BMZ A;  3H5A A;  2ZME B;  1O3S A;  2A61 A;  1J09 A;  1V55 H;  5L3F A;  3M8E A;  1YJ9 I;  4C2M J;  1U5T A;  2X9D A;  3SHF A;  3OL3 A;  5CVR A;  4ZYD A;  2R0Q C;  3GTO J;  2QQ9 A;  2COB A;  2EZL A;  1B72 A;  2WWY A;  1K83 J;  3AFH A;  3ZR8 X;  1IXS B;  2DT5 A;  1Z91 A;  3TED A;  1ZHF A;  4RGS A;  3BLY A;  3P7N A;  3TL4 X;  4YIR X;  3ASN H;  4BY7 J;  2ELH A;  2WB1 N;  3T8R A;  1R5G A;  3ZMZ A;  4G6D A;  1DP3 A;  3DWL E;  1BC8 C;  2DJN A;  3S2W A;  1FIP A;  5D6E A;  3J7Z I;  2F5C A;  3I59 A;  2PJR A;  5E8I A;  4Q4Z F;  2DMU A;  3N05 A;  1V5F A;  1W1W E;  3JRF A;  2EZK A;  1JKO C;  1HW2 A;  1IG7 A;  1X2M A;  1QQI A;  3CCM I;  1U8B A;  4NC8 A;  1FBU A;  3F8M A;  2HKO A;  2Z3Y A;  3LST A;  3LFK A;  4XID A;  3FXU A;  1U3E M;  4OIR F;  1S3J A;  2GXG A;  3KIO A;  3PNT A;  4ENN A;  2ECB A;  2ZJR F;  3VB2 A;  4C3H J;  3K69 A;  2MA3 A;  4BEH A;  1ZG1 A;  4BDZ A;  1SVM A;  3GME A;  4IHV A;  5IT3 A;  3GFI A;  3BZC A;  1H9G A;  3TP3 A;  2PJR B;  3ZN1 A;  4BE2 A;  3KEQ A;  4G94 A;  5ICG A;  1W0T A;  2BVL A;  2V1N A;  3QWL A;  1K7A A;  4R79 A;  3QPT A;  2KP6 A;  1AKH B;  5BPD A;  4F93 B;  2XGE A;  4B09 A;  2KL4 A;  4OOI A;  3VDX A;  1XGM A;  3M3Y J;  1R1T A;  1Z1D B;  4I09 A;  1N77 A;  3H0G J;  3EET A;  1FIA A;  5JFR A;  2KZG A;  4A93 J;  2XRO A;  2CFX A;  4IX7 A;  3IWF A;  4DYC A;  3V42 A;  2X51 A;  2K9M A;  3LNQ A;  3L09 A;  4A69 C;  1M55 A;  3GTL J;  3KP2 A;  5LLQ A;  3EUH C;  2JRM A;  3E7L A;  5EG0 A;  2P7C B;  5F1R A;  4XOR A;  2MBF A;  4ZYG A;  3ZQC A;  5E20 A;  1XGS A;  3K70 D;  3HKZ A;  1RZ4 A;  5FKO A;  2LLK A;  3LQQ A;  2HWV A;  3KYC B;  3ZMV A;  2HNH A;  1KQ9 A;  1I3A A;  2PFB A;  4C3J J;  1GT0 C;  2ZME A;  1R49 A;  3V8L A;  4D1Q A;  3M07 A;  1XMX A;  2BY0 A;  2O6G E;  2K7L A;  2WAQ A;  1P6R A;  4XM3 A;  1JJ6 C;  1F9N A;  4N0B A;  1K4S A;  5KCM A;  1WJF A;  3IRR A;  4EM0 B;  5CYV A;  1JHF A;  2ZJP F;  3U1D A;  1NHA A;  1QPM A;  3H92 A;  2DLL A;  1HCR A;  3RZO J;  4WCG A;  2VKD A;  2R5Y B;  1P7I A;  2BHY A;  3ERM A;  4E7I A;  1OYW A;  1BI3 A;  3CUQ C;  4B48 A;  3GX4 X;  1BW6 A;  3QYB A;  4NHJ A;  1UZC A;  1V5E A;  4UVA A;  1BR2 A;  4XLF A;  1Y1W J;  5E79 C;  2DDA A;  2AXL A;  4UNO A;  2O03 A;  3S3N A;  1T0F C;  3DTE A;  3BJ6 A;  1WPK A;  1HDP A;  2NOG A;  1TWC J;  3PQK A;  2QEN A;  3SZT A;  3N97 A;  2IVM A;  3K4B A;  3I55 I;  4YFK F;  1ZR2 A;  2HOT A;  3S32 A;  3V8K A;  2VJ4 A;  1TT0 A;  1OR7 A;  1S6L A;  4P55 A;  4CCM A;  2PI0 A;  1WJ5 A;  1IC8 A;  4N4O B;  2IA2 A;  4G9Y A;  3EUH A;  2CUE A;  4HV5 A;  3M1E A;  3IL2 A;  2PMH A;  2DA2 A;  1ZG3 A;  1VQ9 I;  2MYS A;  1R6R A;  4GYG A;  1X3W B;  5JVG F;  2L7M P;  3GF2 A;  2Z99 A;  4I76 A;  1GLN A;  1CQT A;  3CLO A;  1NG6 A;  4PJ0 C;  4XQF A;  4A6D A;  4Y7N J;  4Y3O A;  5B3S H;  2O61 A;  1G2H A;  3QQA A;  2DA1 A;  1JUS A;  1XMA A;  2I8D A;  4LIF A;  4KA4 A;  2BOL A;  2F5V A;  2R7V A;  2XSJ C;  5CVJ A;  5KNL A;  1J5Y A;  1X1D A;  1TWH J;  1HSJ A;  1WJB A;  4C30 A;  3FHN A;  4XL9 A;  3VEP A;  2LD5 A;  1XSX A;  4RGR A;  1JKQ C;  1E17 A;  3D0S A;  1XMK A;  2YU9 J;  3O2P E;  1TW3 A;  2HZD A;  3BTI A;  4DQ2 A;  2ITL A;  2LC2 A;  3ZP5 A;  1FEX A;  2VBY A;  1UEL B;  2E1C A;  3EYI A;  4X0G A;  1BBY A;  3K70 C;  2ADU A;  3FKI J;  1WRJ A;  4MGR A;  1HQC A;  5GAG J;  4A3G J;  1A35 A;  2ZXJ A;  3JR9 A;  1NH3 A;  3QPH A;  1QA6 A;  3KYD B;  4OAY A;  1NK3 P;  3ZN0 A;  3RKY A;  3G6E I;  1OCR H;  3HHG A;  2LRD A;  3RDI A;  5GAE J;  4IRI A;  2E34 A;  3ASO H;  2VBW A;  1WWX A;  4KIF A;  1OFC X;  4Z6Y A;  1LE8 B;  1T56 A;  3F8B A;  5M5W J;  3FZV A;  4JQF A;  1Z05 A;  1ETY A;  4HST A;  5HDK A;  1JUM A;  5DM6 F;  3CJT B;  1S7E A;  4NB5 A;  5CPR B;  2DOE A;  2DMP A;  2KPM A;  2NAZ A;  2GZW A;  5B1B H;  1T98 A;  1BM9 A;  2LBF A;  1MSE C;  1XGO A;  3RYR A;  3WU1 B;  3WTT C;  3DLA A;  5CQG A;  2BW3 A;  3AL0 C;  1LKX A;  2DK8 A;  3GUD A;  1P2F A;  2AXT C;  3VYU B;  2QYO A;  1O7L A;  3W3C A;  3S14 J;  2OZU A;  2EFN A;  2LK2 A;  1KU3 A;  1ERD A;  1RUN A;  3LFU A;  3S17 J;  3F8C A;  4UY8 I;  4OMZ A;  4CCL A;  1UJ8 A;  3JSO A;  3JRG A;  3TBI A;  4ZQ9 A;  3WTW C;  1TWF J;  4OMY A;  1VTN C;  3CC7 I;  2V7F A;  2R7S A;  4GRI A;  2H1K A;  3S1M J;  2Q2E A;  1K61 A;  4XRS A;  2K02 A;  1B9M A;  2DPD A;  3AG1 H;  1FOY A;  3OIQ A;  2MSY A;  3M8J A;  4A0X A;  5K1Y A;  3OYG A;  1B8I B;  3BTC A;  2V79 A;  4AYB N;  5ED4 A;  1YTY A;  3FXJ A;  3IUO A;  3OOU A;  2WV1 A;  1FSE A;  1U9O A;  3DPL C;  3KP7 A;  4JX5 A;  3HGG A;  4PSW A;  1RIO H;  3NQO A;  1WSU A;  2HDC A;  4IF4 A;  3BG9 A;  5EJC A;  2OCE A;  3NWT A;  3ELK A;  3OL4 A;  1DPU A;  4IHW A;  4AU7 A;  3KP6 A;  2ZXI A;  5J47 A;  4MIM A;  2H1L A;  1A04 A;  3C7J A;  4FIS A;  1OIS A;  2M5W A;  3X2Q H;  3IWZ A;  3I53 A;  2OD5 A;  2DJI A;  4AC0 A;  2G9W A;  2OBP A;  4YII A;  3HL2 A;  3LSJ A;  1RI7 A;  2CYY A;  4AIJ A;  2JUG A;  2G7U A;  4ZDO A;  3W2V A;  4FQG A;  4D0P A;  2ZNY A;  4RA2 A;  1SFE A;  4BS9 A;  2L02 A;  4HLX A;  2M0C A;  5J1U A;  2O8X A;  1BC7 C;  2ELK A;  1BR4 A;  3H5R A;  1ZRE A;  4ETS A;  3ECH A;  4FB3 A;  1QVT A;  2JVH A;  1WJA A;  3CF2 A;  2JA2 A;  4KT5 C;  4YFX F;  2FF4 A;  3QN2 A;  1LFB A;  3ZQF A;  5FD6 A;  1JGS A;  2CG4 A;  3TKY A;  4CA0 A;  5GAH J;  1B9N A;  1D1B A;  2ZBK A;  1SFX A;  4ZDL A;  5B1A H;  2Y9Z A;  4O5V A;  3BG5 A;  1VQO I;  2RRE A;  2O5R A;  1S72 I;  3FK7 A;  3OYL A;  1MZB A;  2V4J C;  3EDP A;  3C3W A;  3UR3 C;  5IP7 J;  2A6H F;  4KMF A;  1R5I D;  2VOP A;  1J0R A;  1JTX A;  2EA2 A;  4B3X A;  1D5Y A;  1H9T A;  3CMM A;  5HS8 A;  1Y6I A;  4P5O A;  3DP7 A;  3ISP A;  2RN7 A;  3LSP A;  2Y0S N;  4M9X A;  1FJL A;  1Y8R B;  1FP2 A;  1G59 A;  1WCM J;  1I27 A;  2ME6 A;  4M71 A;  4Z2Y A;  3W2W A;  3BDD A;  2CUJ A;  2VQC A;  1ZGW A;  1SVL A;  1ZYR F;  2CW7 A;  2NNN A;  5D8L B;  5F6F A;  1JJ8 C;  2P5V A;  2OZ6 A;  4HNT A;  3CP8 A;  2IA1 A;  4BAC A;  4IHT A;  3U1K A;  4M3D A;  1IJW C;  3CD6 I;  2P81 A;  2VKV A;  3HG9 A;  3F9K A;  5DCM B;  2FNP A;  3CC2 I;  3DCF A;  3P9K A;  3LSR A;  1LQ1 A;  4XNF A;  1QO0 D;  5FFZ A;  2F2E A;  1YRN A;  2ZXH A;  1KYZ A;  2KJB A;  4XRM A;  4WK8 F;  4XRS G;  2HI3 A;  3V7S A;  3QOE A;  2BBY A;  2GM4 A;  4GYI A;  5E1X A;  3OYE A;  4MLO A;  1TBD A;  2PX9 A;  5TGT A;  1BI0 A;  1FMV A;  3BT9 A;  1KON A;  2HEO A;  2Y31 A;  5C4X J;  3DEE A;  3GVA A;  1GUU A;  2LNB A;  5CYN A;  4C2U A;  2QQB A;  3BPV A;  3MWM A;  3HDD A;  5GTH C;  2STW A;  4QTR A;  1VND A;  1WVR A;  3GCM A;  2WBM A;  2RNG A;  5JI6 A;  3E6B A;  4AUX A;  2KJC A;  4EM1 A;  2G7H A;  2LRE A;  4WWC A;  2R5Z A;  1Z3Y A;  1KA8 A;  2FSW A;  2ZCW A;  4FT8 A;  3WE2 A;  2WA0 A;  1B6A A;  3SYT A;  3F21 A;  2OTJ I;  1J7K A;  5FKL A;  4HSR A;  1ULY A;  3LA7 A;  1T39 A;  3B73 A;  5DM7 F;  1ZK8 A;  3NAR A;  1T38 A;  1IF1 A;  3ULQ B;  4JYK A;  5E17 F;  3S1N J;  2HXO A;  4E6K G;  3MD2 A;  4O3M A;  2PEX A;  1A6I A;  3C2H A;  4BXF A;  3Q3S A;  4IEJ A;  3K4L A;  4PUS A;  5K5Q A;  1WI3 A;  2CGP A;  4IJA A;  4EJV A;  4HLY A;  1CF7 B;  1MJB A;  5DYM A;  1HKS A;  3EYY A;  2FX0 A;  2K3F A;  3QRF F;  3C2G A;  1WJE A;  2A6E F;  3LMM A;  5IP6 A;  1O7F A;  3IV5 A;  1R71 A;  4HQM A;  2FRH A;  3CZ6 A;  4XOP A;  4A3I J;  5FLM J;  3W6V A;  1UG0 A;  3BTJ A;  3CJN A;  3DTI A;  3FBI B;  2CW8 A;  4ZH4 F;  1RC9 A;  3ABK H;  5EZH A;  2VLA A;  3CUQ B;  4UVB A;  1JGG A;  1VQL I;  1YHQ I;  1MDM A;  3ESW B;  3PFY A;  2VXD A;  4XON A;  4CCO A;  4D7M A;  4F7Z A;  3V4G A;  4HBL A;  2NS7 A;  1GV2 A;  4KJZ A;  2AQF A;  2YS9 A;  1BIA A;  5M3M J;  3DPU A;  4DNC A;  1I5Z A;  2M34 A;  1KU9 A;  4ZTJ A;  4DYR A;  3P5J A;  3HGY A;  1XGN A;  3PUB A;  4DIQ A;  4D9J A;  2FUF A;  3LQR A;  1A31 A;  4U7D A;  2GBY A;  4AD9 A;  1GHC A;  4BXX J;  3Q5F A;  5DD8 A;  1MGT A;  3QFQ A;  2EBI A;  2ESN A;  3QYF A;  2XC7 A;  2J5O A;  4KT6 A;  2FBI A;  3HRM A;  4HG2 A;  3JSP A;  2JQ7 A;  5IT9 Z;  4MNU A;  1LUJ B;  1F43 A;  2OQG A;  1NK2 P;  2LF8 A;  2OQR A;  5HDN A;  3CO6 C;  2XRL A;  5FLX K;  5FRO A;  4A5N A;  4S0H B;  2BHZ A;  2MG4 A;  4X1E A;  3OSF A;  2AHQ A;  3D1N I;  5F08 A;  5J4Y A;  3I56 I;  2RQQ A;  2HTJ A;  2LKP A;  2L4M A;  5HDG A;  2IPQ X;  1N78 A;  2EA4 A;  2DFE A;  5IP9 J;  5EZG A;  1EKE A;  3HZJ A;  2Z9O A;  4RB1 A;  2I5U A;  3I59 B;  3PO2 J;  2IJL A;  5FRM A;  4YFN F;  4BHC A;  1ZAR A;  3R0A A;  2F5E A;  3R0J A;  2DMT A;  1PUF A;  2IAI A;  4AIH A;  5K7F A;  2HQR A;  2LYC A;  4IXA A;  4MQV A;  4N9H A;  2VPR A;  2IS6 A;  5IT9 K;  1MBE A;  3BPX A;  2GA1 A;  2IS4 A;  2X85 A;  2F5F A;  1R00 A;  1U6G A;  3CUQ A;  1QVU A;  2A07 F;  5J8C A;  4IPA A;  1YW8 A;  2DYS H;  3FKJ A;  2HPI A;  3SEZ A;  2YR2 A;  3OYA A;  1QZZ A;  2VQG A;  1Z9C A;  2FQ4 A;  1PJR A;  2LH9 A;  2XKO A;  4JP0 A;  5FO5 A;  3OYF A;  2LY1 A;  2YUS A;  4S05 A;  2ETH A;  1RES A;  4A12 A;  1VQM I;  3BTL A;  4XIC A;  3ABT A;  1X1C A;  1HOM A;  1KQ0 A;  5HNF A;  1TWA J;  1W7P D;  5FKK A;  5H6Q A;  1HC8 A;  1G3S A;  4MQ9 F;  2XGX A;  3CJQ B;  4E7S A;  3CCU I;  1R1U A;  3ZPL A;  4FE4 A;  2TDX A;  2B0L A;  2MAB A;  5F0H A;  4RAF A;  3W2A A;  2P6S A;  2V1U A;  4EJU A;  4HPQ A;  3KZI C;  1APL C;  1L2M A;  1HDD C;  2FD5 A;  1UG2 A;  5HVQ C;  1W4M A;  2IGK A;  3F6V A;  4CO8 A;  1A6Q A;  2QSH X;  3RJP A;  2WC2 A;  1VQ7 I;  1MW7 A;  1LVK A;  3ZQG A;  2QLZ A;  4YRV A;  4F91 B;  4ITV A;  4ESJ A;  2B9S A;  2ZSI B;  2COM A;  2R5Z B;  4JBA A;  5DDG A;  3Q0V A;  2XF7 A;  5LGU A;  3HPG A;  2FU4 A;  5EF6 A;  2L9V A;  2EFW A;  2K9N A;  3L2R A;  1W5S A;  3KLN A;  4A3F J;  1X58 A;  3MFK A;  2NYX A;  4M74 A;  4B1R A;  1B59 A;  2TRT A;  1QZE A;  5DCM A;  4KFC A;  2E1O A;  3H9J A;  4L5E A;  1KU7 A;  3CC4 I;  1TLH B;  3HBL A;  5DD4 A;  2FE3 A;  2FMY A;  2ZO4 A;  2UXX A;  3QP6 A;  3ZMT A;  5K7Z A;  3ABL H;  4GFB A;  4CYC A;  1AHD P;  4KDP A;  2EWN A;  3DKY A;  2ITJ A;  2DW4 A;  1MKM A;  2FBH A;  5E1Z B;  5EYR A;  4I7H A;  3DEU A;  3BR3 A;  2HOE A;  1YX3 A;  1U5T B;  2CRG A;  3K0L A;  2XAH A;  3CES A;  3IH4 A;  2IS1 A;  5HLI A;  3SDG A;  3H9G A;  4XLC A;  3G71 I;  2ZFW A;  3D5L A;  3KX2 A;  4WXC A;  3RSN A;  2IGM A;  1ETK A;  4RB2 C;  2VAS A;  4HAM A;  1SFU A;  4C3I J;  3H9Q A;  3G1L A;  3RZD J;  3BQZ A;  1W36 C;  1WQ2 A;  4E7L A;  1FY7 A;  2NNY A;  4IQ4 A;  3KZZ A;  1IRX A;  3D5S C;  2Y30 A;  3JRD A;  3FM5 A;  1BIB A;  4RMN A;  3LSM A;  4Y52 J;  5H2F C;  3HOY J;  5HS9 A;  3EUK L;  4EEF G;  4B3A A;  3T1B A;  1REP C;  5C44 J;  3KLO A;  3JW4 A;  2ZJQ F;  3WU0 A;  3DF8 A;  2DCE A;  2XDV A;  3M7G A;  3JAM Z;  2HVS A;  3AG4 H;  5K5O A;  2VOD A;  5H6R A;  4QPQ A;  2FEZ A;  3KP4 A;  4AID A;  4BBR J;  1MNM C;  3BWG A;  4CCJ A;  1TQP A;  4IHX A;  3L2Q A;  3FMS A;  1W7P B;  2A69 F;  3GWZ A;  2FML A;  1NTC A;  3ZRG A;  1X1A A;  1D1C A;  2KKO A;  4KW3 A;  1ZH5 A;  5CVV A;  2X6X A;  4XSX F;  3WGH A;  3WTY C;  4BL0 B;  4IKF A;  4D5C A;  5AIQ A;  4E4H A;  3MQ0 A;  2F6C A;  3K10 A;  2VKH A;  4IOC F;  3FK6 A;  2H27 A;  2DTR A;  1I6X A;  3R4K A;  4CUG A;  4LMY A;  4U0Y A;  2CSO A;  4P9U A;  3Q0U A;  1FYK A;  5D8K B;  1P4W A;  1Z1D A;  2CS3 A;  5L3D A;  2O0Y A;  3GLL A;  2BZT A;  2ICW G;  2O3F A;  2OJE D;  2QKL B;  2AO9 A;  3M1C A;  4QWQ A;  4CZZ A;  1YOV B;  3S3O A;  1FT9 A;  2RQP A;  4UV8 A;  2BYV E;  2RV8 A;  4ZJZ A;  3F72 A;  2Q0O A;  5DS9 A;  3WU2 C;  3L2V A;  4CIC A;  2L5Q A;  5IYC J;  3LSH A;  3REO A;  4IHY A;  2OC6 A;  1SFK A;  3IRQ A;  1ON1 A;  1OPC A;  3HOS A;  2DOD A;  4UVC A;  3CCV I;  2IT0 A;  1WFX A;  4CHU A;  2JK3 A;  3O6B B;  2LR8 A;  1RR7 A;  2UWM A;  3H1C A;  5FD5 A;  1YG2 A;  3ZOB A;  2QZ8 A;  4FTH A;  2PMU A;  2JT1 A;  1XCB A;  4AWX B;  2A05 A;  1P9Q C;  5E3L A;  1FTZ A;  3CCY A;  5J6X A;  2AS5 F;  3PSI A;  4HNV A;  3DQV C;  3O3K A;  1SAN A;  3TW7 A;  3HRU A;  4ZO0 A;  4PJJ A;  2HYJ A;  3HOU J;  2VL8 A;  4LLL A;  2LSO A;  3DBH B;  3S1Q J;  3HOZ J;  5ERI A;  4B8X A;  5DV5 A;  1XPX A;  1MMS A;  2W4S A;  4H4K C;  2OTL I;  1W5T A;  2X6W A;  2CQK A;  2VN2 A;  1X4P A;  1MDM B;  2XUB A;  1K4T A;  3CME I;  3ZXS A;  5FLV A;  3ZCO A;  1ZR4 A;  4A0Y A;  1DUX C;  4N4N B;  2V9P A;  5GTI C;  2DMQ A;  2STT A;  4HYE A;  1LE8 A;  4BAY A;  2L4A A;  2KMU A;  2YU3 A;  2UZK A;  3QYE A;  2VOO A;  2EK5 A;  3K2Z A;  1ZLK A;  2OCC H;  4BGD A;  3HRS A;  2ME0 A;  2YSR A;  4L5J A;  2LBF B;  3I4M J;  1IRZ A;  2KLO A;  3ABM H;  1IV6 A;  3VSL A;  3CDH A;  4IVN A;  4L9V A;  4EJW A;  1H8A C;  3FXM A;  4QIW N;  2MH9 A;  1MSF C;  2DOA A;  2ZXW H;  1K79 A;  3GTG J;  3K4C A;  1E2X A;  3RKX A;  3AL0 B;  3GEZ A;  4G8X A;  3QU3 A;  4M9Z A;  1IN8 A;  5DEQ A;  4CYD A;  2O7O A;  2HOS A;  4HEA 2;  2VJI A;  4PJL A;  4L0Z B;  3K4J A;  4LLG F;  2ESH A;  2LTP A;  3DFG A;  3K1P A;  3PSF A;  1ZN2 A;  2IGN A;  4R1H A;  3F8N A;  1ZGA A;  2QSF X;  1IN7 A;  1OR7 C;  2L54 A;  1N25 A;  3TDU C;  5LFA A;  1R7J A;  3LSG A;  2E36 A;  4XOT A;  2RGV A;  1MBF A;  5HOO A;  3LOC A;  1UAA A;  2QEX I;  4DJA A;  4XKB A;  4I0B A;  3J81 K;  2K9L A;  3DBR B;  3ZQ7 A;  2ISZ A;  1TQM A;  3MVP A;  4RS8 A;  5TRD A;  3FF5 A;  1GV5 A;  5KAF C;  3NEU A;  2MH2 A;  1MMA A;  1Z6R A;  1IV8 A;  3I0T A;  5A2Q Z;  3JRE A;  3DXJ F;  1G8X A;  2EJR A;  1W5C C;  1XC5 A;  1YLF A;  3GXO A;  5D5V B;  2F4M B;  2E1M C;  3E1S A;  4RB3 C;  1JKR C;  3HPH A;  5K5R A;  3L2C A;  1TZL A;  4E7J A;  2W00 A;  1X3U A;  4JK1 X;  3BG7 A;  2KZV A;  2KQR A;  1GXP A;  3LA3 A;  1F08 A;  2MLK A;  4M6X A;  4BQN A;  3JRB A;  1SD4 A;  4J00 A;  1SD7 A;  1YQA A;  1SMY F;  4HA8 A;  4ZZD A;  1IGN A;  4LG0 A;  2XF5 A;  1RET A;  5BS6 A;  3FX3 A;  2F5D A;  3NWS A;  4BHP A;  1BW5 A;  2QQ8 A;  1D8K A;  1PP8 F;  1QPI A;  5E18 F;  1XDS A;  2V1X A;  1JKP C;  5FRN A;  3FHZ A;  5AIP A;  3IC7 A;  1B4A A;  3DKX A;  1VQ5 I;  9ANT A;  2FBK A;  2CJJ A;  2KRF A;  2CW0 F;  2XAS A;  2H6B A;  2B7E A;  4M3F A;  1ETX A;  1PUE E;  2DI3 A;  3PFI A;  1R23 A;  2V26 A;  1TL8 A;  1MND A;  1XG1 A;  3CF5 F;  4CGZ A;  1YO5 C;  1XSD A;  2Y0S A;  3FXK A;  2IBD A;  3TOB A;  4M6V A;  2NTC A;  3SFZ A;  2R4G A;  4HX7 A;  1UHW A;  4DZP A;  3I4P A;  5H20 A;  5LD2 C;  2EIN H;  5KVR A;  3SFI A;  1STZ A;  1UHM A;  2JSC A;  3OR2 C;  1LDJ A;  5BNG A;  2OU2 A;  4G7Z F;  4LIT A;  4H0E A;  1LPQ A;  1MH4 A;  2QF7 A;  5EEH A;  1T6S A;  3J80 Z;  3CMA I;  2ECC A;  4RAG A;  1HST A;  5M5Y J;  2M30 A;  4LK1 F;  5ILV A;  5LGT A;  1QU3 A;  3LL7 A;  5B66 C;  3AKZ A;  2H6C A;  4A0Z A;  3H3U A;  2FXA A;  3G73 A;  2EV0 A;  3IAS 2;  2XV4 S;  3MCZ A;  2Q8K A;  4AVZ A;  3RKW A;  2XHK A;  1VI0 A;  4BUP A;  2L9N A;  1IO2 A;  1FOK A;  1VQN I;  2E71 A;  3JRH A;  1IUY A;  3KET A;  3CTA A;  2JUC A;  3TOA A;  3CCS I;  2NS0 A;  2QA4 I;  3SXY A;  1QZY A;  5D5X B;  1DGR M;  2K86 A;  2XPU A;  3MKL A;  4OIQ F;  1TNS A;  4G6Q A;  2JPB A;  3RQ4 A;  3VOD A;  2J5P A;  3WG9 A;  3L1P A;  1D0Y A;  2R7R A;  1W36 D;  4OIO F;  1B1B A;  2QQA A;  3R6S A;  5TIS C;  3NAU A;  3V7C A;  2EFP A;  1HW1 A;  3DU6 A;  3WGI A;  3S15 J;  3K4N A;  3LWF A;  3KYL A;  1J75 A;  3SDB A;  1WH7 A;  1O4X A;  2VXZ A;  3MZ8 A;  4KN7 X;  2XGC A;  2JZY A;  2XKP A;  3T8T A;  2R7Z J;  4NQW B;  3GTM J;  3VYT B;  2DO7 A;  5LHH A;  3B6C A;  1YE9 A;  2M45 A;  3L9F A;  4A5M A;  4BH9 A;  2QBY A;  2M7A A;  5EGO B;  1WJD A;  2IP2 A;  4HQE A;  2R7U A;  1D1A A;  4XLP F;  4XSZ F;  4HW0 A;  3DV8 A;  4IRH A;  4G7H F;  2KFD A;  2A6T A;  4M3G A;  3BRO A;  1ZKG A;  3RPU A;  4CCK A;  2WV0 A;  2LOO A;  1DQU A;  2IS2 A;  1MNE A;  4RB0 A;  2MGQ A;  4U7B A;  4LG3 A;  4HF0 A;  4GDF A;  1KSX A;  1ZRD A;  3BOQ A;  3J80 K;  3TW6 A;  3CCE I;  5HLG A;  4KNY A;  2FA5 A;  2X0L A;  1FWZ A;  2ZFU A;  1OQY A;  2BV6 A;  3DKW A;  3E5X A;  4LGW A;  4MEY F;  1DDN A;  3M8F A;  4NDL A;  3CJR B;  2W84 A;  2Y48 A;  1N75 A;  2E2I J;  2ZKZ A;  5GPC A;  1UUT A;  1JTY A;  2KIS A;  3FBN B;  1S29 A;  2H94 A;  3L2U A;  1QGP A;  3HIF A;  2WAE A;  2VI6 A;  5FKN A;  1R5H A;  4BJ5 C;  1MMG A;  3K1N A;  1IN4 A;  3HEF A;  2MD5 A;  1G3W A;  3C1D A;  1Z67 A;  3OS0 A;  3V7R A;  3G3Z A;  4C2T A;  2VIX A;  2NVU B;  1T8I A;  3FIS A;  2D1H A;  3E3V A;  1B72 B;  2X1C A;  4BY1 J;  2L3D A;  2VT2 A;  1KSY A;  2L7K A;  4IOA F;  2CUZ A;  1YI2 I;  5ILU A;  4A3E J;  1IRG A;  2GWR A;  1Y0N A;  4BBS J;  1Y56 A;  2ZB9 A;  3I5U A;  2LKX A;  3AG3 H;  3IHU A;  2Z16 A;  4BQA A;  3GLX A;  1K6O A;  1E0E A;  2JJ7 A;  3Q9S A;  1QHH D;  1T0F A;  1LEA A;  2FOK A;  3HUG B;  4MFD A;  2DPU A;  3BR6 A;  3VOE A;  4XLN F;  5IYB J;  5EDN A;  4ABZ A;  5K7H A;  1Z77 A;  3FXO A;  1K78 A;  4HX4 A;  2PMZ A;  2QVO A;  4V19 K;  2BGC A;  3KEY A;  3L2W A;  4B43 A;  1WHU A;  3ZQQ A;  1BJA A;  2HQA A;  4IL6 C;  2VQL A;  2BXY A;  2OV7 A;  2VON A;  2ISY A;  3R60 A;  1JXS A;  2NL8 A;  4RAZ A;  3ZMS A;  1JUP A;  5EEA A;  1VZ0 A;  2XSD C;  1HF0 A;  3J7A O;  3GZ5 A;  2W48 A;  5TJJ A;  1BJZ A;  2KHM A;  4BJ6 C;  2DQL A;  3HOX J;  1R9T J;  1FNN A;  3HOT A;  1YRN B;  1ZGJ A;  4BE1 A;  3ONQ A;  1AWC A;  1T08 B;  2QBY B;  2WAF A;  5HLT A;  5BYG A;  3ZQI A;  4B44 A;  2CH0 A;  3GYH X;  4II2 A;  3BR1 A;  4P9F A;  3SJM A;  5J1R A;  1QNT A;  2E60 A;  3GFJ A;  1ITY A;  4G12 A;  3A0H C;  2F4I A;  4UXN A;  3ROU A;  2BXZ A;  4PJN A;  1R58 A;  2M8E A;  2FQ3 A;  4CCN A;  1PVE A;  2E19 A;  1U2W A;  1X19 A;  3DLL F;  2K40 A;  3BR2 A;  2NVY J;  3FWE A;  3KPH A;  2IGO A;  1U8R A;  2LFB A;  2DTZ A;  2UXN A;  3I71 A;  1I3Q J;  4QPO A;  1ODD A;  2V6E A;  2DU9 A;  3KEO A;  3TQN A;  4XMY A;  4G6T B;  3A1Y A;  3BG6 A;  4L9T A;  3E6C C;  3H3V K;  1I1S A;  3IAM 2;  2M4G A;  4I2O A;  4LMD A;  4ZDP A;  4Y15 A;  4PK4 A;  3QK2 A;  4MFE A;  2VQH A;  3PNY A;  4NC6 A;  3OSG A;  4MEX F;  3WHC A;  1OCT C;  2A68 F;  3FMQ A;  3OMY A;  4LJZ F;  1LFP A;  2GAU A;  2YX7 A;  1BR1 A;  1ETW A;  2M87 A;  1HA8 A;  3OS1 A;  2ZJ2 A;  2X4H A;  1CF7 A;  2F48 A;  5J8F A;  1FOX A;  3I64 A;  1J59 A;  2E1M B;  1IN6 A;  2IF9 A;  1OMI A;  2E5N A;  1FBQ A;  2DA7 A;  2GA2 A;  2WTE A;  2YPR A;  2Q1Z B;  2IA0 A;  4IO9 F;  3VPR A;  1Q1H A;  3QU6 A;  1K78 B;  3OY9 A;  3JRI A;  4LIU A;  1BA5 A;  3G2B A;  4PGG A;  2V9V A;  3BP8 A;  4Q5S F;  1YJW I;  4OWR B;  2VBZ A;  2XB0 X;  4DW6 A;  1VQ6 I;  2E1N A;  1TBX A;  3TO6 A;  1MH3 A;  3OIP A;  5F0C A;  2DOF A;  3B6A A;  1KYW A;  3SZG A;  4PDK A;  2VJJ A;  4UB8 C;  1S8N A;  2L01 A;  2PN6 A;  4NUB A;  1WKM A;  1SD6 A;  2L0K A;  4XLA A;  4ON0 A;  5L3E A;  2XAF A;  1G3Y A;  2NS8 A;  3OS2 A;  2HOA A;  2RAE A;  1L3L A;  2M2E A;  5E1W A;  2NRA C;  4V2F A;  1SFO J;  1MBK A;  1FZP B;  2QUF A;  1OCP A;  3OYD A;  1MIJ A;  4FX0 A;  1HKQ A;  5F1J A;  2Y69 H;  1PP7 U;  4I98 B;  3KP5 A;  1HBX G;  3BR5 A;  3OYH A;  4YEJ A;  1VQ8 I;  3K2A A;  1B8I A;  1TTY A;  3LSK A;  5M5X J;  4BXU A;  2W7N A;  1ZQ3 P;  5B5E C;  1H88 C;  1C0W A;  3I9V 2;  1G4D A;  2M4K A;  1IXR C;  1TT5 B;  1U9N A;  1XN7 A;  1WZ2 A;  2XGD A;  3N4M A;  5IOZ A;  3K6G A;  5E3N A;  1U5T C;  3BQY A;  2ZSH B;  2GXA A;  4DYQ A;  1ENH A;  4O6J A;  1BI1 A;  1J9I A;  3GZ6 A;  1OYY A;  2PMZ N;  3K7A J;  4A3B J;  1E3O C;  3JRC A;  2BE5 F;  4UV9 A;  1H89 C;  2LG4 A;  3BZK A;  2Z1D A;  3TDZ C;  5GAD J;  3FIW A;  4Y13 A;  2M0M A;  5M3F J;  4G7O F;  2EFQ A;  1IRF A;  1FPQ A;  5GP9 A;  2DA5 A;  3MZY A;  4RGU A;  4A3M J;  4HF1 A;  2KDZ A;  2CFO A;  4BDY A;  1A5J A;  3CCL I;  4KIB A;  2QCO A;  2BY1 A;  2V9K A;  2HVR A;  5D5W B;  3CMY A;  1SEU A;  2HW0 A;  4IRG A;  3TGN A;  1IW7 F;  1R22 A;  2H09 A;  2VC0 A;  4I0A A;  3SQN A;  4CH7 A;  2BY3 A;  3IKT A;  4HDU A;  3S8P A;  1FSH A;  1SVO A;  1VF9 A;  4A6E A;  1Z7U A;  4F55 A;  1GXQ A;  4HRI A;  2BW3 B;  4L9J A;  3E5Q A;  1ZEL A;  3ML6 A;  4FE7 A;  3S93 A;  1T2K A;  2VT3 A;  1U78 A;  4A3L J;  4KYW A;  3BC8 A;  1D5V A;  3E5U A;  1ACI A;  4GGG A;  4HDV A;  4LB5 A;  3RPU D;  2R92 J;  5FFX A;  4ZYA A;  5JR3 A;  3CCQ I;  4FGN A;  2ID3 A;  5JVT A;  2RDP A;  5ILS A;  4EGY A;  4MTE A;  1W7P A;  4AIK A;  1FOW A;  2M1B A;  4RAY A;  4ZYE A;  4ESB A;  4MO7 A;  2R7D A;  3OWT A;  3G4S I;  1LVA A;  2DFF A;  3U21 A;  3HTU A;  3RYP A;  1ZTR A;  2C6Y A;  2XVC A;  3HC7 A;  2JA8 J;  2EB7 A;  2Q2E B;  3IKV A;  1P92 A;  1YJN I;  4DZJ A;  1DPR A;  2UUZ A;  4BQQ A;  1MBH A;  2IW5 A;  3P9C A;  2A5W A;  1D0X A;  4I6Z A;  1Q1V A;  2MLG A;  3QPS A;  3A02 A;  3L7W A;  2M3A A;  3WG7 H;  1V5G A;  3HJE A;  1OLT A;  1MBG A;  3PUF A;  4BNC A;  2HYG D;  2Y75 A;  3E6M A;  4A2U A;  2CQ7 A;  4XN0 A;  3OR1 C;  2OUM A;  3BCB A;  4OIN F;  1L0O C;  1VQK I;  1HXD A;  4UUS A;  1O57 A;  4LB6 B;  2GXB A;  3MKY B;  1UST A;  4PJM A;  3PNV A;  1WI9 A;  2JA6 J;  5IOY A;  1IXC A;  3S2D J;  3HXL A;  4LFU A;  1FMW A;  2EFO A;  2VE8 A;  4E70 A;  2DXI A;  5JHF A;  4E7H A;  2JPC A;  1IAW A;  2K85 A;  2KRH A;  1BN5 A;  3AAF A;  2HS5 A;  4ZC3 A;  1I6H J;  4M3B A;  3PQJ A;  4TV7 A;  1YYV A;  2X48 A;  3C2B A;  3E97 A;  1DU6 A;  2K27 A;  4CYC B;  3DBL B;  2JA7 J;  1LEB A;  3WGG A;  4NBQ A;  2IRF G;  4KIG A;  2X6O A;  1SAU A;  3U2R A;  5CVI A;  1JT0 A;  1RRJ A;  3BZ6 A;  3O8H A;  2JSP A;  2CMP A;  2OPT A;  2R7Q A;  4BYY A;  2E2J J;  4PSX A;  5HOD A;  3RQI A;  5F0F A;  2HVQ A;  2HXI A;  4EMS A;  1R4N B;  2HGC A;  1GDT A;  1OCO H;  4NC7 A;  1TQI A;  5DTD A;  3DTK A;  3SZP A;  1VFC A;  4LD5 A;  3WTS C;  5J4V A;  2DK5 A;  3S3M A;  4NBP A;  2K3P A;  1EJ9 A;  5D4R A;  1FLI A;  3R61 A;  4D7N A;  2X1D A;  3HOW J;  3QOD A;  4B4C A;  2GIV A;  2WAD A;  3F6O A;  3JCU C;  3IH3 A;  3GTK J;  2KIU A;  4UUT A;  3HYI A;  2P4W A;  4PFO A;  4XRF A;  3ERE D;  1LFU P;  2JWT A;  1MMN A;  2DDB A;  2VUM J;  1TC3 C;  4II3 A;  1MMD A;  1RKW A;  1YS6 A;  1Z3X A;  2HQN A;  5BPI A;  3CCR I;  1JE8 A;  5ICE A;  3JTG A;  1IN5 A;  3OYI A;  2W85 A;  1P7J A;  1DU0 A;  1D0Z A;  1QRY A;  3OYC A;  1YIJ I;  5FLX Z;  2Z33 A;  5JLX A;  2KT0 A;  1UB9 A;  4XKC A;  4A3K J;  5BOX A;  2CQN A;  3EPZ A;  2VBX A;  2GOX B;  5FKM A;  1O3Q A;  2QSG X;  5LHG A;  2DAO A;  5LRS A;  2NOJ B;  4PZJ A;  4J01 A;  2EV6 A;  2JRT A;  3KFW X;  4U88 A;  1BI2 A;  1YX5 A;  4XKW A;  4F3Q A;  4JX6 A;  1S5L C;  2WB1 A;  4FAS D;  4YG2 F;  5ICC A;  3RI4 A;  2FNA A;  5D9I A;  2D5V A;  4BEH B;  4PCQ A;  5F04 A;  4C9Y A;  2EIM H;  1YIO A;  1XCV A;  4E7Z A;  4OAZ A;  3GZN B;  3A4C A;  1ON2 A;  3MMY B;  2RC4 A;  4RLQ A;  2VB6 A;  4L18 B;  4S04 A;  3TO9 A;  2DT6 A;  2HQ5 A;  5C3E J;  4Y33 A;  2XIG A;  3VFZ A;  1JHH A;  1EH8 A;  1GVJ A;  1MD0 A;  3MKW B;  2F4O B;  5IPA A;  3BCA A;  5J40 A;  3GBG A;  4AYB A;  4WX9 A;  4UB6 C;  3ZQL A;  3QOP A;  3O8G A;  4XLE A;  1A36 A;  3WTU C;  2M8G X;  3LSI A;  5J3L A;  2CWE A;  6PAX A;  2VPL A;  4LOC A;  3HSR A;  3E6D A;  2KIQ A;  4U0V A;  2HYF A;  5AON A;  2EH3 A;  3WHB A;  4KMU X;  2UV1 A;  1MBJ A;  3IH2 A;  3LA2 A;  1IDZ A;  2V6C A;  4YEL A;  3PJR A;  2TBD A;  3J7Y J;  2R7X A;  3FXQ A;  2W1O A;  2ZNZ A;  2E35 A;  3CO7 C;  1F36 A;  2K4J A;  2M7B A;  4RDU A;  1PDN C;  5FJ8 J;  2K5C A;  1T33 A;  3WE3 A;  3CDL A;  1FBS A;  2HPM A;  3FXR A;  2K4B A;  1OCC H;  4IHS A;  1HLV A;  5J1Y A;  3ZQH A;  4DGW B;  3JRA A;  2XAJ A;  3RPQ A;  2VKE A;  4KIC A;  4CDG A;  2P6T A;  1RPW A;  2EQR A;  2KIF A;  5KHD A;  1BOA A;  1I50 J;  1U0J A;  1S7O A;  2L2O A;  4E7K A;  3B02 A;  3GFM A;  5F64 A;  3OYN A;  4JX4 A;  1LJ9 A;  2D1V A;  3H36 A;  5DCF A;  4X6A J;  1NG7 A;  2L9R A;  3I3L A;  4FCY A;  1O3R A;  2LF7 A;  3HHH A;  4HV6 A;  2W82 A;  1DP7 P;  2GQQ A;  1POG A;  2JMW A;  2Y9Y A;  4ENM A;  1OJL A;  3G1M A;  4I01 A;  4ENK A;  1EV7 A;  5DUK A;  4A3D J;  5F27 A;  3OV8 A;  1R9W A;  1V3F A;  5HS7 A;  1TW2 A;  3F22 A;  2KDO A;  2P0W A;  4WXH A;  1D8J A;  4P96 A;  1R4M B;  1VQP I;  1AKH A;  1D3Y A;  5LHI A;  1AOY A;  3K4M A;  2DMN A;  1RNL A;  5IY5 H;  4ESF A;  2DT7 B;  2DQR A;  1G6N A;  4CXF A;  3KCC A;  1FTT A;  2WY8 Q;  2X6Y A;  3RCO A;  3TO7 A;  2Y2Z A;  4L0Y B;  4XR6 A;  4A3C J;  3RKQ A;  2NVT J;  2LP0 A;  1G3T A;  2IXS A;  4I99 C;  2P5L C;  1F1Z A;  1TWG J;  3MZH A;  4IQJ A;  4ZYH A;  2CO5 A;  4BKX A;  4OIP F;  3W6J B;  1AA7 A;  3WTZ A;  5JHU A;  2LY2 A;  1EF4 A;  5EGO A;  1S9H A;  1SAX A;  4LIV A;  4RLF A;  5HLH A;  2ELJ A;  4KIT B;  2R7W A;  2DN0 A;  1RR8 C;  1EH7 A;  3OYK A;  3I4N J;  1FYL A;  3F3X A;  2HR3 A;  4Y4R A;  2E2H J;  4XK4 A;  3Q0W A;  2OA4 A;  3CUO A;  1Y8Q B;  4KN4 X;  1V4R A;  1QBJ A;  2L7Z A;  2CV0 A;  2MFZ A;  2P8T A;  3K9T A;  2DFH A;  4KUM A;  4ENJ A;  2BY2 A;  2R7O A;  1YW7 A;  4L9N A;  3ZMD A;  3LAP A;  2G0E A;  4LG0 B;  4AVP A;  1ZAO A;  2EIL H;  2R5Y A;  3WTV C;  2LKS A;  2FJ1 A;  1UHS A;  2FOW A;  2V1D A;  3HB9 A;  1PYV A;  3JTH A;  1YW9 A;  5A2Q K;  4B47 A;  1KQ8 A;  4A3J J;  1ZRF A;  4R8H A;  1Y0U A;  4EVI A;  1ETV A;  3S1R J;  4P1W A;  2XRN A;  4HX8 A;  2EPF A;  2RNJ A;  3TP0 A;  1E3P A;  1USS A;  4HZF A;  4EJT A;  5JLW A;  1R1V A;  1ZRC A;  3HM5 A;  3RTR A;  2R7T A;  2NVQ J;  4QSH A;  4LK0 F;  3ZGK A;  4D5F A;  2OF7 A;  4DOZ A;  1Z7L A;  2W25 A;  3M4O J;  2K9S A;  3WOD F;  3PIO F;  4CSW A;  3PO3 J;  1LNW A;  2TCT A;  4Y17 A;  4RM2 A;  3MN2 A;  1X1P A;  1IUF A;  3SEQ A;  2M9H A;  2E7X A;  1KU2 A;  2VC1 A;  5L3G A;  5LBQ A;  3A01 B;  2DA4 A;  2WAQ N;  2GLO A;  1OKR A;  2PBI A;  3H0D A;  4JOM A;  1VQ4 I;  3OOP A;  3FXL A;  1X1B A;  5CQE A;  2W24 A;  4FET A;  2QM3 A;  1F5T A;  2FUG 2;  3F23 A;  4QLC U;  3H3Z A;  5C4J J;  3QP5 A;  2L7F P;  2QKM B;  2R3S A;  2P7V B;  2KIM A;  4U87 A;  3HKZ N;  2R7F A;  1LDD A;  1RZ9 A;  2EIJ H;  1LB2 A;  3COA C;  2R93 J;  2MC3 A;  2QGU A;  3ABU A;  1M1E B;  1X3Z B;  3BJO A;  5KK1 A;  5E3O A;  1XDU A;  4ASN A;  1MJA A;  3FDY A;  3JAM K;  1JT6 A;  5D4S A;  2PLY A;  2XPV A;  1X4O A;  4BJT A;  4L5I A;  5KAI C;  5HNH A;  4AM3 A;  3S2H J;  1ONV A;  1SMT A;  5GPA A;  2RVC A;  3OYB A;  5FB2 A;  3MKZ A;  4MTD A;  1SC7 A;  5LGN A;  3DU5 A;  2NVX J;  3M9A A;  2E7W A; 
#chains in the Genus database with same CATH homology
 2MC4 A;  2UWM A;  3I9V 2;  2M4K A;  3D5R C;  4CCL A;  3TBI A;  4ZQ9 A;  3K6G A;  3PL8 A;  2ZSH B;  2V7F A;  2R7S A;  2X1E A;  4GRI A;  2CV1 A;  1P9Q C;  3PSI A;  2AQE A;  3OYM A;  3DQV C;  2LG4 A;  2E5Z A;  4ZO0 A;  4PJJ A;  3OIQ A;  2Z1D A;  4RM3 A;  2VL8 A;  3M8J A;  2M0M A;  3OYG A;  3K4K A;  3EUA A;  3IUO A;  3OOU A;  2W4S A;  3DPL C;  4H4K C;  2CFO A;  4BDY A;  4HNU A;  2X6W A;  2Z2S B;  1X4P A;  4XKV A;  2V9K A;  4PSW A;  3A2K A;  2HVR A;  2L9S A;  3ZXS A;  3ZCO A;  3NWT A;  4KIS A;  2HW0 A;  1DGW Y;  2XAU A;  3OL4 A;  4N4N B;  3E0J B;  4NNJ A;  4CH7 A;  3VYS B;  4AU7 A;  1T95 A;  3S8P A;  2KMU A;  2ZXI A;  3QYE A;  4F55 A;  3J7A Y;  4HRI A;  2BW3 B;  4BGD A;  1ZEL A;  3S93 A;  2LBF B;  4F52 A;  2KLO A;  3BC8 A;  3VSL A;  2DJI A;  3HL2 A;  2DOA A;  3RPU D;  2JUG A;  3K4C A;  1L5I A;  4BE0 A;  3AL0 B;  4ZYA A;  4ZDO A;  3W2V A;  4FGN A;  4BS9 A;  4BU2 A;  4F92 B;  4HEA 2;  2VJI A;  4PJL A;  3H35 A;  3K4J A;  3PSF A;  4ANJ A;  2KRC A;  1BR4 A;  1LDK B;  2IGN A;  2VJ5 A;  3H5R A;  2JVG A;  4DBQ A;  2IPR A;  1OR7 C;  4FB3 A;  5LFA A;  3LSG A;  4XOT A;  2JVH A;  3OWT A;  1WJA A;  3CF2 A;  2JA2 A;  3UNG C;  2BVM A;  3VYR B;  5HOO A;  3U21 A;  4XLH A;  3QN2 A;  1UAA A;  4DJA A;  4XKB A;  4DBR A;  2K9L A;  4CA0 A;  1D1B A;  1Z21 A;  3HC7 A;  4ZDL A;  2Q2E B;  1MMA A;  5DCX A;  2RRE A;  2UUZ A;  4BQQ A;  2O5R A;  3OYL A;  2A5W A;  1D0X A;  3CP2 A;  2V4J C;  1G8X A;  3UR3 C;  4B3X A;  3TMO A;  2M3A A;  3CMM A;  3H5N A;  1V5G A;  1OLT A;  1Y6I A;  4P5O A;  2E1M C;  3E1S A;  4XN0 A;  3OR1 C;  3HPH A;  2OUM A;  3BCB A;  1TZL A;  2WY7 Q;  4E7J A;  4BQO A;  2W00 A;  1G59 A;  3BG7 A;  2KZV A;  2KQR A;  3W2W A;  2CUJ A;  2VQC A;  3MKY B;  2CW7 A;  4PJM A;  4IZZ A;  3PNV A;  2XF6 A;  1F08 A;  2CV2 A;  3HXL A;  4BQN A;  4HNT A;  1FMW A;  3CP8 A;  2DXI A;  4BAC A;  4J00 A;  5JHF A;  3HG9 A;  3F9K A;  4E7H A;  3IP4 B;  2GOM A;  2XF5 A;  2KRH A;  3NWS A;  4XNF A;  2ZXH A;  4ZC3 A;  4XN3 A;  5FRN A;  3QOE A;  3DKX A;  3OYE A;  4MLO A;  1TBD A;  5TGT A;  1EA3 A;  1FMV A;  1KON A;  3DEE A;  1SAU A;  5CYN A;  2V26 A;  4C2U A;  1MND A;  2JSP A;  2CMP A;  2R7Q A;  4PSX A;  1JI8 A;  2Y0S A;  2HVQ A;  2MD0 A;  2RNG A;  2WBM A;  2NTC A;  4ZTF A;  2R4G A;  2LRE A;  4NC7 A;  1Z3Y A;  5CKT A;  3DTK A;  3OYJ A;  5LD2 C;  2WA0 A;  3SYT A;  3S3M A;  4NBP A;  2HDW A;  2K3P A;  4HSR A;  3OR2 C;  2X1D A;  3QOD A;  4EAT A;  3DPT A;  1WJC A;  2WAD A;  4LIT A;  4CZC A;  4PFP A;  3MD2 A;  4E6K G;  4BXF A;  3C2H A;  4PUS A;  3K4L A;  4PFO A;  3VWB A;  1K6Y A;  2HU9 A;  1MMN A;  1QU3 A;  3VSK A;  1QHG A;  3LL7 A;  3AKZ A;  4II3 A;  1BOB A;  1MMD A;  1Z3X A;  3H5A A;  3IAS 2;  3C2G A;  1WJE A;  3OYI A;  1J09 A;  3LMM A;  1D0Z A;  3OYC A;  4AVZ A;  3OL3 A;  4BUP A;  2L9N A;  4XKC A;  3CZ6 A;  4XOP A;  3EPZ A;  1UG0 A;  3DTI A;  2GOX B;  3FBI B;  2CW8 A;  1DGR M;  4J01 A;  2NOJ B;  2VLA A;  3AFH A;  3ZR8 X;  3PFY A;  3RQ4 A;  2VXD A;  1YX5 A;  4XON A;  4CCO A;  4XKW A;  4F3Q A;  1D0Y A;  4FAS D;  2WB1 A;  2R7R A;  1W36 D;  5D9I A;  4KJZ A;  4BEH B;  3DU6 A;  2AQF A;  3BLY A;  3K4N A;  3TL4 X;  3KYL A;  4E7Z A;  3DPU A;  4OAZ A;  3SDB A;  3A4C A;  2VXZ A;  3MMY B;  1DP3 A;  4ZTJ A;  4RLQ A;  3DWL E;  3PUB A;  2VB6 A;  4DIQ A;  4D9J A;  2DT6 A;  2FUF A;  4NQW B;  3VYT B;  2PJR A;  4Y33 A;  3N05 A;  1V5F A;  1YE9 A;  3MKW B;  3QFQ A;  3BCA A;  3QYF A;  3GBG A;  2M7A A;  4AYB A;  2XC7 A;  1WJD A;  4KT6 A;  4NC8 A;  2R7U A;  4XLE A;  1D1A A;  4HG2 A;  3LSI A;  2VPL A;  2A6T A;  3PNT A;  5FRO A;  4CCK A;  2LOO A;  1DQU A;  2UV1 A;  2IS2 A;  1MNE A;  4U7B A;  4LG3 A;  4BEH A;  4GDF A;  1KSX A;  4BDZ A;  2RQQ A;  3PJR A;  4YEL A;  1N78 A;  2TBD A;  2R7X A;  2W1O A;  2ZFU A;  2M7B A;  2PJR B;  2K5C A;  4BE2 A;  2HPM A;  3CJR B;  5FRM A;  1N75 A;  2BVL A;  2V1N A;  4DGW B;  4R79 A;  2KP6 A;  4F93 B;  1UUT A;  3FBN B;  2LYC A;  2KL4 A;  3L2U A;  3VDX A;  2WAE A;  1Z1D B;  1N77 A;  4BJ5 C;  5KHD A;  1MMG A;  2IS6 A;  3OS0 A;  4IX7 A;  2IS4 A;  1U0J A;  2X85 A;  3V42 A;  4C2T A;  2VIX A;  2L2O A;  4E7K A;  2X51 A;  2K9M A;  1M55 A;  1ERD A;  2X1C A;  3OYN A;  1KSY A;  3FKJ A;  2L7K A;  3EUH C;  2HPI A;  3SEZ A;  1NG7 A;  3OYA A;  2VQG A;  2CUZ A;  3I3L A;  4XOR A;  3OYF A;  1PJR A;  2LH9 A;  3K70 D;  3HKZ A;  2LY1 A;  2W82 A;  2HNH A;  1Y56 A;  1X1C A;  5HNF A;  1R9W A;  4D1Q A;  2Z16 A;  1E0E A;  2KDO A;  1QHH D;  2P0W A;  3HUG B;  3CJQ B;  4E7S A;  3K4M A;  2MAB A;  3W2A A;  2WAQ A;  4HPQ A;  4XM3 A;  1L2M A;  2DT7 B;  2PMZ A;  5HVQ C;  5KCM A;  1WJF A;  2IGK A;  2WY8 Q;  2X6Y A;  3KEY A;  3L2W A;  4B43 A;  3RCO A;  3ZQQ A;  2HQA A;  1MW7 A;  1LVK A;  4XR6 A;  2VQL A;  4YRV A;  4F91 B;  2OV7 A;  4ITV A;  2IXS A;  2NL8 A;  2VKD A;  2ZSI B;  1VZ0 A;  4E7I A;  4IQJ A;  4B48 A;  3QYB A;  4XLF A;  1V5E A;  1BR2 A;  2KHM A;  4BJ6 C;  2XF7 A;  3HPG A;  3HOT A;  1AA7 A;  4BE1 A;  2LY2 A;  3S3N A;  3L2R A;  1T0F C;  3ONQ A;  1S9H A;  3DTE A;  2WAF A;  4LIV A;  4RLF A;  5HLT A;  5BYG A;  4B44 A;  2CH0 A;  2ELJ A;  4II2 A;  4KIT B;  2R7W A;  3H9J A;  2E60 A;  3OYK A;  3K4B A;  4Y4R A;  3S32 A;  2F4I A;  2VJ4 A;  3DKY A;  1TT0 A;  4PJN A;  2ITJ A;  4CCM A;  1WJ5 A;  4CCN A;  4N4O B;  1X19 A;  2CV0 A;  1YX3 A;  2MFZ A;  3CES A;  2IS1 A;  2IGO A;  2MYS A;  2R7O A;  1R6R A;  3H9G A;  4XLC A;  3D5L A;  4QPO A;  3KX2 A;  3RSN A;  1GLN A;  2IGM A;  1NG6 A;  4XQF A;  2VAS A;  2V6E A;  4XMY A;  1PYV A;  3H9Q A;  4G6T B;  4B47 A;  3A1Y A;  4Y3O A;  1W36 C;  3BG6 A;  4E7L A;  4IQ4 A;  3IAM 2;  2M4G A;  1IRX A;  4P1W A;  4LMD A;  3D5S C;  4ZDP A;  2I8D A;  4PK4 A;  3QK2 A;  4LIF A;  4RMN A;  3LSM A;  2VQH A;  3PNY A;  2BOL A;  2F5V A;  3EUK L;  2R7V A;  2XSJ C;  3OMY A;  3RTR A;  5KNL A;  2R7T A;  1LFP A;  3ZGK A;  1X1D A;  2HVS A;  2XDV A;  1WJB A;  2DCE A;  4DOZ A;  1Z7L A;  1BR1 A;  4C30 A;  3FHN A;  4CSW A;  4XL9 A;  3OS1 A;  1HA8 A;  4QPQ A;  4CCJ A;  3L2Q A;  4RM2 A;  3ZRG A;  2E1M B;  2IF9 A;  2E5N A;  1X1A A;  2HZD A;  3SEQ A;  1D1C A;  2ITL A;  2LC2 A;  2Q1Z B;  4KW3 A;  3H0D A;  4JOM A;  2X6X A;  1UEL B;  1X1B A;  4BL0 B;  5CQE A;  4X0G A;  3K70 C;  4FET A;  3OY9 A;  4IKF A;  4LIU A;  2FUG 2;  4E4H A;  3G2B A;  2F6C A;  3K10 A;  2VKH A;  4OWR B;  2QKM B;  4OAY A;  4CUG A;  3OIP A;  4U87 A;  2LRD A;  3SZG A;  2CS3 A;  1RZ9 A;  2VJJ A;  3M1C A;  2QKL B;  4NUB A;  4XLA A;  3S3O A;  4JQF A;  4HST A;  4ZJZ A;  5CPR B;  3OS2 A;  3L2V A;  2KPM A;  2L5Q A;  3LSH A;  3FDY A;  2LBF A;  1SFK A;  2OC6 A;  3OYD A;  3DLA A;  5CQG A;  1X4O A;  2BW3 A;  4BJT A;  1LKX A;  3HOS A;  3AL0 C;  5HNH A;  3VYU B;  3OYB A;  3MKZ A;  3OYH A;  4YEJ A;  3W3C A;  3LSK A;  3DU5 A;  1WFX A;  4C9Y A;  2W7N A;  3LFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...