3DKXA

Crystal structure of the replication initiator protein encoded on plasmid pmv158 (repb), trigonal form, to 2.7 ang resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
202
structure length
202
Chain Sequence
KEKARYFTFLLYPESIPSDWELKLETLGVPMAISPLHDKDKSSIKGQKYKKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLTHESKDAIAKKKHVYDKADIKLINNFDIDRYVTLDVEEKTELFNVVVSLIRAYTLQNIFDLYDFIDENGETYGLTINLVNEVIAGKTGFMKLLFDGAYQRSKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plasmid replication initiator RepB forms a hexamer reminiscent of ring helicases and has mobile nuclease domains
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Replication
molecule keywords Replication protein repB
total genus 52
structure length 202
sequence length 202
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01719 Rep_2 Plasmid replication protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dkxA02
3.40.1310.30 Alpha Beta 3-Layer(aba) Sandwich Replication Protein E1; Chain: A, Replication Protein E1; Chain: A, 3dkxA01
4U87A 3DKYA 3DKXA
chains in the Genus database with same CATH superfamily
4RB1A 4G8XA 2DODA 3HKZA 3RKQA 1IN7A 1SFKA 3QPLA 1FOWA 1D0ZA 1W5CC 2BY0A 5IT3A 4C3HJ 2XASA 4KT6A 1MBHA 1R6RA 2XV4S 2QZ8A 2PJRA 4JX6A 1X4OA 3KE2A 4IRIA 1QPMA 1FOYA 3L9FA 4A0YA 3WU2C 1WHUA 5B66C 1FT9A 3I4MJ 3K2ZA 5IPAA 2EIJH 2E2HJ 2PLYA 1V4RA 2FUG2 5IYCJ 4C2TA 2LREA 4Y3OA 3HPHA 3RDIA 4KN7X 2L7ZA 1E3HA 3GXOA 2CUZA 3LSKA 1ETXA 5J1RA 2AQFA 1GXQA 4U0WA 3CCEI 3DEUA 3HOUJ 3A01A 2WTEA 3L1PA 1P92A 5HS9A 4D5CA 2E7XA 3N05A 2WB1N 5DD8A 4M73A 2R5ZB 1BC8C 3F8NA 2VT3A 3EUAA 3HRTA 3GVAA 2MC3A 2DTRA 5J8FA 2E1NA 2JA7J 3H5AA 5L3DA 4H4KC 2DK8A 1BW6A 2OD5A 1R4NB 2V4JC 2NVTJ 3V8JA 2X6OA 1W7PA 1X3ZB 1F1ZA 3KP4A 3V7RA 3VFZA 2W25A 1WJBA 4P9UA 3F22A 1O3QA 2BEOA 2HU9A 3HTSB 4HF2A 2Y30A 1JXSA 4RM2A 1JUPA 4ZYAA 3WODF 5E1WA 1S9HA 1ZLJA 2WY7Q 2IGMA 4IOAF 4EQQA 2DT6A 1UZCA 3GLXA 3G2BA 5FFZA 1BW5A 4YELA 1BIBA 3B02A 2WAQN 2KRHA 1PUFB 1MMNA 1V3FA 2I5UA 2TRTA 4TV7A 2R7XA 1YJWI 1R4MB 1P7JA 1WPKA 2PMZN 1YW7A 2DJNA 2XIGA 3DV8A 3QFQA 4OIPF 1R49A 3MCZA 3WTTC 1EV7A 3A0BC 3BG3A 1FIPA 2XRLA 1B59A 5LBQA 3R0JA 4CZCA 1MDMA 3F72A 1U6GA 3F21A 1T95A 3PFIA 3OYLA 5CYVA 1F4KA 4DNCA 4KN4X 2MGQA 2RN7A 3QP6A 2ZSHB 4UV8A 4EGYA 4FE7A 1WZ2A 5FD6A 4DOZA 2L0KA 3ABLH 1J9IA 4XM3A 1KU3A 3WU1B 3AKZA 1VQNI 2UZKA 3J80Z 3H35A 1YOVB 4ESFA 1X1PA 3BJOA 3EUHA 4HF0A 1FJLA 4AM3A 3JREA 4QSHA 2DT7B 1SD7A 2OA4A 2OAZA 2VJIA 4N9HA 3ABUA 4CICA 2EILH 2W24A 2RVCA 1ZH5A 2G7HA 3HBLA 2GXGA 4IOCF 1MIJA 2JPCA 3GFMA 5E3OA 2O61A 5HOOA 2O5RA 3I3LA 1DGWY 1WVRA 4JX4A 3H36A 3TW7A 5IY5H 3OR2C 3AL0C 2OQGA 2D1HA 1U0JA 1MJAA 2FNAA 2FUFA 2JQ7A 1IRZA 1DU0A 2PBIA 3FISA 1Z7LA 5FKOA 2Y31A 4Q4ZF 2Y0MA 3BPXA 3GWZA 4JQFA 2CWEA 2Z99A 2A6EF 1LE8B 2DMTA 1QA6A 2R7TA 3GUDA 3HUGA 5CYNA 3P9CA 1SAUA 3DP7A 5CVUA 4NDLA 3W2AA 3S2DJ 3DTKA 2YPRA 1M55A 1B9MA 3K6GA 3KEYA 2EH3A 2DOFA 4HSRA 2KJBA 4JK1X 1ZG5A 4WXHA 3HC7A 5HDNA 1CQTA 3M1EA 2CV1A 3KIOA 3JRBA 1IXRC 1BC7C 4CCKA 2VC1A 4A3GJ 3K4JA 2GOXB 1ITYA 3CO6C 2D45A 2EFQA 1AU7A 3KX2A 4IO9F 4N0BA 1FEXA 2JMWA 5D5UB 1O7LA 5F0CA 4CCMA 3U9GA 2E2IJ 4C2UA 2VXZA 1KU7A 1ZARA 3T8RA 1OYWA 2KIUA 5HDKA 3WG7H 2XAUA 5M5WJ 2M87A 2EA2A 3K4BA 2EA4A 4FASD 5E17F 1TZLA 5GPCA 3C18A 3LQRA 3G3ZA 2FEZA 3K4LA 3SHFA 3W6JB 2C6YA 3H9QA 4E7KA 1MNMC 4A0XA 2HR3A 4Z6YA 4HRIA 4AU7A 2L3DA 5FKKA 1MBEA 3HPGA 4MGRA 4LIVA 3QN2A 2E19A 2JPBA 3WU0A 1UG0A 3M9AA 1Y1VJ 3OV8A 1SFXA 3Q0WA 3WTWC 1RZ9A 3S2HJ 1W0UA 1NG7A 2MLGA 2KHMA 1YHQI 3CCUI 5KNLA 2HXIA 1F5TA 2ZFWA 3CMEI 3WTZA 2M2EA 1UB9A 2V79A 2P7CB 2VQGA 3DU6A 5EGOA 3QYBA 2VBYA 2ICWG 3SZTA 3BR6A 4I98B 4KW3A 5IT9Z 2KZGA 4RAFA 3SEZA 3MZHA 1LE8A 3H9GA 2IS4A 2ITLA 2DQLA 2R7SA 1Z0XA 3CD6I 2FE3A 2FNPA 2W7NA 2ISZA 3F8BA 2R5YB 1QU3A 3I53A 4K2EA 2LC2A 2LR8A 3ESWB 2OTLI 1RESA 3S3MA 3HYIA 2K5CA 2QQBA 2X1CA 2XF5A 4PK4A 3PQKA 1FOKA 3CP2A 3G1MA 1WH5A 2K9MA 1A6QA 2HTSA 4XLFA 4IPAA 1B1BA 4II3A 1ZKGA 2KRCA 2L4AA 2LDUA 3AG3H 4LG0A 2XB5A 5FRNA 1ODDA 4ESJA 4PSXA 2LNBA 3ZRGA 1YFHA 4HSTA 3ZMTA 1FSEA 2NYXA 3KZYA 1D5YA 4IF4A 4AD9A 3RPQA 3A03A 1X1BA 4OINF 3CJNA 3M7GA 5JLXA 1BJZA 3JCUC 2BVMA 4ENKA 2CUEA 2CS3A 1T39A 1TW2A 3CJRB 1R5HA 1W36C 4QIWN 2IXSA 2P8TA 1B8IA 1TW3A 2VOOA 3DLLF 3O2PE 4KFCA 1RKWA 4E70A 2MABA 3IKTA 1DGRM 3RI4A 4M9XA 1IRGA 3VYSB 3FF5A 3IHUA 4EVIA 1ZELA 3MMYB 2R7WA 2FJ1A 2DMPA 3LNQA 2DTZA 2BXYA 3KEOA 4IQ4A 2V6EA 1QPIA 1APLC 2HI3A 1R36A 1FBUA 1K4TA 2D2WA 2HYFA 2IF9A 3MVPA 1IN5A 1YW8A 4LG3A 3LL7A 1NG6A 3MKZA 2OF7A 1RPWA 1JJ6C 3S17J 3CJQB 4AYBA 4ZDOA 2X1EA 3J7YJ 4ZZLA 1UJ8A 3WG9A 1XX5A 2CUJA 5M5XJ 2JT1A 4Y7NJ 4X1EA 1BI0A 2ID3A 2NVQJ 5BNGA 1Z3XA 3GCMA 3OYAA 4LFUA 5L3FA 2CW0F 1U9OA 4D0PA 3DBHB 1TWFJ 1X1AA 3E6BA 3HTUA 3MZYA 3LSHA 3FBNB 1POGA 2YS9A 2JVHA 3DFGA 3CMAI 4IHXA 4LJZF 4U0VA 3GYHX 1ZG3A 5A2QZ 2F5VA 5KCMA 2KIMA 2WA0A 1XSDA 1EF4A 2VJ5A 1O4XA 2IA2A 4HDUA 2KQRA 2L02A 3ML6A 1MKMA 2IA1A 3KPHA 1X2MA 2GBYA 1KZHA 2HDCA 2VONA 1BI3A 3IUOA 2H27A 1MH4A 1RUOA 2EIKH 4Q47A 2LH9A 3DCFA 5TISC 2YR2A 1U9NA 4LK0F 2H09A 4PUSA 4UVCA 4EJWA 3AG4H 3JSPA 2ECCA 1QQIA 1ZR4A 1Z6RA 1YIJI 5LHGA 5D5XB 4XKVA 3V4GA 2R7QA 1HF0A 3DWLE 1ETVA 3KYDB 3RSNA 4Y17A 4G6QA 4QLCU 2V1UA 2KL4A 5J1YA 4CUGA 2LF7A 1XSXA 3KP7A 4BQOA 3OYHA 2CV0A 3ABKH 3ZQQA 4BS9A 3CC4I 3HG9A 4G94A 5DUIA 3VOEA 2KJCA 3HJEA 1JTYA 4CCOA 1OCZH 4P55A 2F5FA 2O6GE 3DKXA 1HCRA 4OMZA 4C2MJ 2F4OB 4PFPA 2VPLA 3UNGC 3OOUA 2CFXA 2ZJPF 4AVPA 5EJCA 3GFIA 4FE4A 4MFEA 3CO7C 4KYWA 1X58A 5FJ8J 2FRHA 5FFXA 1FTZA 3FBIB 2P6TA 3OWTA 1A35A 2DMQA 1S8NA 3TO9A 4F52A 3CCSI 1H9GA 1D0YA 4CCJA 4RMNA 4BJ6C 2ZMEA 4KT5C 3MKYB 4LGWA 3HXLA 1S7AA 1X3UA 1KU2A 4XRMA 1NK3P 2LK2A 3VSKA 1JGSA 2QSFX 4D7NA 3N97A 1I39A 3K0LA 3P5JA 1MSEC 4N4NB 1EH8A 3E5QA 1FPQA 2ZB9A 3ZXSA 4BY1J 2QF7A 1VQ6I 4CXFA 3S1NJ 3BG6A 2DPDA 1T2KA 4IJAA 3H1CA 2IS6A 1O7FA 2LRDA 4U7BA 3TP3A 1STZA 5HDGA 1F9NA 2M7BA 2P4WA 3EQLF 2FU4A 1LDJA 2CO5A 3BDDA 4I01A 4P1WA 4EGZA 5BMZA 3M07A 5K7FA 3S3OA 1FZPB 1A5JA 5HNFA 1LFPA 3BOQA 1P2FA 5DV5A 1PVEA 5LRSA 2VC0A 5J1UA 2DN0A 3LSTA 1TT0A 4B3XA 2VJ4A 4LITA 2DMUA 4O3MA 3CUQB 3EPZA 1I27A 2BHZA 4YIFA 3OYEA 2E5ZA 1T8IA 3BZ6A 4LG0B 4I6ZA 3SQNA 2ACJA 3KP5A 2WAQA 1SAXA 2FMLA 3BTCA 4BBSJ 1K79A 1EH7A 3T0YA 4OAYA 2HDDA 5LHIA 3S1MJ 4XSZF 3G1LA 3LSJA 1LDKB 4XLPF 5E8GA 5IYBJ 4LLGF 2WC2A 1QHHD 4IHVA 4PJJA 4ZYEA 2EFOA 2L01A 2CFOA 2LLKA 4IHWA 2ID6A 4IZZA 1VQPI 4M9ZA 2HXOA 4B43A 1IDYA 2F4MB 1W7PB 3RQ4A 2NRAC 4BJ5C 4BBRJ 5B5EC 4ENMA 2HVSA 2K4BA 3TOBA 2E71A 1KSXA 1YS7A 1YO5C 4BUPA 3HSRA 3ONQA 1S7OA 2PMHA 2YU3A 1R71A 2GOMA 1YTYA 4ZZDA 2Y0SN 4L9NA 3FXRA 3W6VA 1TQIA 2XSJC 3BTJA 3BT9A 4N9IA 5B1BH 3BG7A 4ESBA 1F43A 3CDIA 1ZGAA 1YLFA 2WV0A 5HLHA 4XN0A 5EYRA 1LQ1A 1OCOH 3ECHA 1R58A 4J00A 1EJ9A 2BOLA 2BV6A 2ISYA 3FMRA 1UCRA 2DMNA 1P9QC 1ZK8A 2KRFA 3OIQA 3TDZC 3JAMK 4LMYA 2W4SA 3BTLA 2J5PA 2M8GX 2NS0A 2DFIA 2PG4A 1IO2A 2STWA 2R7VA 1IAWA 1I3QJ 1HQCA 5D5VB 2E35A 3FIWA 1BN5A 3V8KA 3I64A 2B0LA 1FSHA 1QVUA 1OYYA 3L2VA 2XC7A 2DA3A 2X6WA 5F64A 4BHPA 3A0HC 1U5TC 2OTJI 3HRUA 4S04A 1G3TA 4X6AJ 5FD5A 4I09A 2R3SA 1MW7A 2R93J 3E1SA 2DA6A 3KFWX 5TRDA 5ED4A 3D5RC 2JJ7A 2R7OA 4XOTA 2QSGX 1U5TB 3HKZN 2LY1A 3G4SI 1XPXA 2HQ5A 1Y0UA 1MD0A 5LRRA 4UNOA 1LVKA 2V1XA 4D7MA 2K9LA 2KKOA 2JTVA 1MBGA 2E1OA 3RZDJ 3F0CA 1OCPA 3BC8A 2E7WA 4RAZA 3V42A 1ZLKA 3ELKA 1J0RA 2XAGA 3D1NI 3I59A 4C3IJ 4UY8I 1IF1A 2KDOA 2QM3A 3O8GA 2Y75A 3ULQB 2W00A 5BPDA 4ZDPA 3U2RA 4EATA 2EINH 2Q2EA 5JLWA 4FQGA 4I99C 1SEUA 2XPUA 4BGDA 5ICGA 1O3SA 1ZREA 4RAGA 3LSGA 3ZN0A 4A3LJ 2M4GA 5ERIA 3I5UA 4A3DJ 3FXQA 2DFHA 5LLQA 1T56A 1JHHA 5LEJA 1SFOJ 1IN4A 1MZBA 2LY9A 1Z1DB 2CV2A 1Z3YA 1RNLA 2R92J 2W48A 5IP9J 4EM1A 2FMYA 2QQ8A 4OIQF 2WY8Q 4UUVA 2DYRH 1TWGJ 2I8DA 5DUKA 2VQLA 3KZZA 3FWEA 3H0GJ 3WTSC 4G6DA 3LA3A 2DA5A 3PIPF 2PN6A 2VBXA 1GUUA 3IRRA 2UXXA 2OBPA 3JRCA 2Z33A 1WJAA 2R7FA 2W82A 1RKTA 1KQ8A 5LHHA 2GA2A 3B73A 4HG2A 3PJRA 2E60A 4XBFA 1LFUP 3E5UA 1N75A 2COMA 3I59B 4LOCA 3OSFA 3FKIJ 4M6XA 3EUKL 1VQ4I 2XF6A 1WSUA 2F5CA 1BL0A 4IEJA 5EG0B 4RGSA 1WH7A 4KISA 2TBDA 2L9RA 2ZJQF 4UV9A 4AUXA 1QGPA 2MA3A 2R4GA 1SD6A 4A5NA 3AG2H 4I2OA 3S15J 4CHUA 1ERDA 2R7RA 3FK7A 3H0DA 4FX0A 1U5TA 4UB6C 1MDMB 5JI6A 3VYRB 5F08A 4BAYA 3O3KA 3W6KB 2ZNZA 3NEUA 4B8XA 2X48A 4MO7A 2AHQA 3E7LA 4ZTFA 3HOWJ 5E79C 1FYMA 1F08A 1KGSA 4NC8A 2XROA 3GZ6A 1PDNC 1TQPA 5AIQA 3PM1A 3NWSA 4XKCA 4QPQA 3E0JB 2ADUA 1I1SA 5K5OA 1D1AA 3L2QA 3GFLA 1R1UA 1Y56A 3HDDA 1Y1WJ 4FB3A 2K4JA 2JZYA 2CQNA 2P81A 3BQZA 4XSXF 1E17A 2R7UA 1X4PA 5FO5A 3S8PA 3H3UA 4M72A 4XL9A 3U21A 4F92B 5JR3A 4EV0A 4A3KJ 1B72A 4CYCB 2VT2A 5DCFA 4XK4A 1Z1DA 3HGGA 2UXNA 1XG1A 3PUFA 3J80K 1A04A 4CDGA 3KYLA 2M4KA 1BBYA 4S05A 1WJ5A 3AG1H 3QPSA 3OR1C 2MYSA 3TEDA 3F9KA 2V9KA 2RDPA 1ZQ3P 3ZN1A 3MAJA 4DYCA 1FYLA 3HUGB 2JRMA 3FDYA 4A69C 1OMIA 4GFBA 3DPUA 1PUEE 3Q0UA 3M8JA 2IJLA 4AWXB 2X1DA 2QA4I 2X9DA 1ACIA 3V7SA 4ZO0A 1SVMA 1R5ID 3DTIA 2LTPA 1GT0C 1AA7A 4KNYA 3ZQHA 4UVBA 4A3BJ 3OS1A 3MN2A 1L2MA 4F91B 4I76A 2MW8A 4RB2C 4OMYA 2K85A 3O8HA 1VQ8I 3HRSA 3DPLC 1IN8A 4QPOA 4D9JA 4BE0A 3TMOA 4JX5A 3CJTB 5BPIA 1ZGJA 3QAHA 4EMSA 1HLVA 2W85A 3R60A 2HOEA 5IYDJ 2GM4A 2NL8A 1R5GA 4UUTA 1T0FA 5J40A 3K69A 4XQFA 1A36A 4HA8A 3E3VA 3LFUA 2IVMA 4NC6A 2NXNB 3TQNA 4G7ZF 2OUMA 1W1WE 1JI8A 4ZC3A 1U8BA 2IGOA 3EDPA 3TDUC 3L2RA 1B9NA 3ISPA 5C4JJ 4BQQA 2ZXHA 1AKHB 3KLNA 3PNTA 1LJ9A 3ABTA 2RQPA 3L2WA 3HL2A 1YJNI 3OS0A 2RV8A 4QTRA 4GO1A 4A3EJ 3JRFA 1DDNA 1G4DA 2AXLA 5FRMA 4M3FA 5EGOB 3CLOA 4OAZA 2R5ZA 2TCTA 1WI3A 3T5XA 2M0CA 3CCMI 1P4XA 3JR9A 1BR2A 2BBYA 2P5VA 3BJAA 1LB2A 3JW4A 3FX3A 3DKWA 2Q1ZB 3GW2A 1HKQA 2A05A 2ZBKA 4DZPA 2O9LA 3OYBA 1QZZA 1RI7A 1UAAA 3SEQA 1H88C 4W97A 4WF2A 2JRTA 2QQ9A 2V6CA 1N25A 2L7FP 2Z9OA 2PMZA 3CZ6A 3PUBA 5D6FA 1NK2P 5ICEA 4KJZA 4IL6C 3GTGJ 3O6BB 4NUBA 3C1DA 2EZLA 1Z77A 1TBXA 2L9NA 4MEYF 2OZ6A 3GX4X 2VXDA 2V1NA 3RPUA 3C2BA 2QKLB 2X0LA 3U1KA 3OS2A 2RC4A 5IP6A 1P6RA 4HQEA 4NBQA 3EUHC 1ZGWA 2QEXI 3H5RA 5LGUA 1AKHA 1T08B 1OCTC 3M8EA 5GAEJ 1BOBA 3REOA 4BACA 1K78B 1ZAOA 2HQAA 1IRFA 4F3QA 1SVOA 2EJRA 3HSEA 3GO5A 3IH4A 3R6SA 3GTQJ 1FBSA 5F27A 5E3LA 5CVIA 1JKPC 4A3JJ 1G3WA 2XSDC 2VPRA 2CQXA 3Q9VA 3DF8A 3QOEA 3F8MA 5M3MJ 4M3DA 3IKVA 4BEHA 3J81Z 5J4YA 1B8IB 3FXKA 4CA0A 4IRHA 2DYSH 1XMAA 4U87A 1Y8RB 2QWWA 2LMDA 4DIQA 5GAHJ 1EA3A 2K40A 2PEXA 2HDWA 5HS7A 4A93J 2UWMA 3FXLA 3K1MA 2K3FA 1H0MA 2PQ8A 2WB1A 4RBOA 2VE9A 2EB7A 2KMUA 3TOAA 3WTXC 5IOYA 1TNSA 3HOTA 1RR8C 3MZ8A 1S6LA 4HLXA 2XAJA 1PYVA 1RC9A 3S93A 1D8JA 2L4MA 4BEHB 3WTYC 2VBWA 1OKRA 4L0ZB 3QOPA 1GHCA 6PAXA 2GA1A 4B44A 3OYDA 4U7DA 4IHSA 3DPTA 2DLLA 3BP8A 3TO7A 4YEJA 2HQNA 1FMWA 4XMYA 4CZZA 1B4AA 5CVVA 1ZHFA 3FXOA 1S3JA 3DLAA 4MNUA 3ZQIA 2DA7A 1Y0NA 3VDXA 4Y52J 1WRJA 2W84A 1OPCA 1BI2A 2YX4A 3FXUA 1QO0D 3BJ6A 5B3SH 1L0OC 2FX0A 1SD5A 2ZXIA 5C4XJ 3FZVA 2JA2A 2IW5A 5K5RA 4A3IJ 2DA1A 2B7EA 3OYNA 5FGMA 3TKYA 1H9TA 3BROA 1PP7U 1QNTA 2QCOA 2BVLA 5DS9A 5DEQA 4L5JA 4IHYA 1UUTA 2CW7A 2XDVA 5F0HA 3KCCA 5L3BA 2VOPA 4NNJA 4S0HB 2DFEA 2F48A 3HIFA 2IEKA 4L5EA 3WE2A 1HSTA 3QODA 2R0QC 3KYCB 1IRXA 3NAUA 5JVTA 3J81K 2R7ZJ 2H6CA 2N8GA 2Z1DA 3BQYA 5BS6A 2O8XA 2FBHA 2CQKA 2NNYA 2XPWA 1ETWA 3LA2A 4E4HA 1X1CA 2F2EA 2VKDA 5J6XA 1QVTA 1ZR2A 3PIOF 3K70D 4PJNA 9ANTA 1R1VA 1WWXA 2CH0A 2VB6A 3LA7A 3CUQC 4P5OA 3CUQA 4WXCA 4GRIA 5E1ZB 5C44J 1FX7A 5EG0A 3B6CA 2RNGA 4ETSA 3FXMA 2YU9J 2EZHA 4HYEA 4JOMA 5DDGA 3HZJA 3M3YJ 3PSIA 2MFZA 1ETQA 1VNDA 3K7AJ 4H0EA 2TDXA 5AONA 2XUBA 4RS8A 4AIHA 3HOSA 3N4MA 5DD4A 2DDBA 4WWCA 1USSA 4NBPA 4BXFA 1IV8A 2M1BA 3C2GA 2MH9A 5GADJ 2ZKZA 1VQLI 1WJFA 2O0YA 2X6YA 1I6HJ 4BQAA 1V54H 2VKVA 4XIDA 1EH6A 4C9YA 5HS8A 1WJDA 1L5IA 1A6IA 2GWRA 3IP4B 3A4CA 2DCEA 2Z16A 3PNYA 1IC8A 5FKLA 3SZGA 3SZPA 3H5NA 1JKOC 2VQCA 4OIOF 3PFYA 1TLHB 1Z91A 1KA8A 3H3ZA 4ZH4F 2DDAA 4A2UA 2BW3A 2QSHX 1VTNC 2V26A 4RGXA 5E8IA 5ILVA 2F5EA 4GCVA 4QWQA 1WI9A 1JE8A 2IS2A 5FLXZ 2OC6A 3RJPA 2LVSA 2KLOA 4RGRA 3ZQ7A 3CCVI 3NARA 1WJCA 2E1MC 3MKLA 3BR5A 2JA6J 2E1CA 2Y0SA 2VL8A 3BPVA 1FMVA 5F1RA 4XLAA 2YUSA 2ELKA 2ZCWA 2KDZA 2BGCA 1PP8F 2A69F 4FHTA 3OOPA 5D6EA 2MC4A 4LB6B 2HQRA 2XKPA 3M4OJ 3IWZA 1JKRC 2JA5J 2XPVA 3IAS2 1GDTA 2HOSA 1KQ9A 1JTXA 5B1AH 2ME0A 1TWAJ 3KETA 4P9FA 5JFRA 2NVXJ 3EYYA 1XMXA 2GQQA 3ASOH 3DQVC 3OY9A 5H6QA 5EF6A 5DM7F 3A1YA 2Q0OA 3VEPA 1IUYA 4I0BA 2DA4A 2VODA 3SYTA 3GTJJ 2NS8A 2BE5F 3V8LA 3GEZA 2GXAA 1MJBA 2BXZA 5F6FA 1DU6A 1XC5A 3K1NA 5ICFA 2X6XA 4Y13A 1ZN2A 2JVGA 3SJMA 3DBLB 1X2NA 3GFJA 3HB9A 2EBIA 4RA2A 2Z3YA 3E6CC 2BW3B 5JHFA 2DPUA 3I4PA 3OYJA 5C3EJ 1MBFA 5H20A 4C30A 3OYKA 1K4SA 3QP5A 3P7NA 3C2HA 1VQOI 3J7AO 3Q0VA 4BNCA 5JHUA 5K7ZA 1IZ1A 2VN2A 1WJEA 5CLSA 4M9SA 2ZMEC 1V55H 2CMPA 4RDUA 4LLNA 5CPRB 3E97A 1OQYA 1VQ5I 2JN6A 2KPMA 4CCLA 3AAFA 1RRJA 1T6SA 1OYIA 1XDSA 2DAOA 2NVUB 1QZYA 3GTLJ 3LSIA 3ROUA 3GTKJ 1X1DA 2RGVA 1ZRDA 4YG2F 3IH2A 2HS5A 2Q8KA 1BOAA 2DQRA 2LYCA 3TBIA 4AIKA 2AS5F 1FTTA 2LSOA 3S2WA 1PJRA 3R4KA 3G6EI 2A5YB 3JAMZ 4YFKF 2E2JJ 1Z7UA 2XGDA 1M1EB 2R7DA 2ZFUA 2IPRA 2FXAA 4RGUA 1IW7F 4I02A 1O3RA 1SFUA 1U8RA 3CMMA 2X51A 3ASNH 1HOMA 1RR7A 2Y48A 1TP4A 5HLIA 3OYMA 4CYDA 1KONA 4XLHA 3VSLA 1HA8A 5HODA 4F7ZA 3NQOA 1K61A 3QPTA 3KP6A 4G7HF 1TL8A 4DQ2A 3LSRA 1J09A 1YG2A 1OR7C 5D8KB 2ZJRF 4RLFA 3H92A 4IQJA 4XLEA 4NQWB 5FLMJ 4XR6A 3KP2A 5D9IA 1W4MA 3P9KA 2L54A 2DJIA 2LOOA 3RQIA 3A01B 1YW9A 3S1QJ 2HPIA 4W1UA 4U88A 3PQJA 1YI2I 1KU9A 2OJED 1G6NA 4B47A 2P6SA 1W36D 4AIDA 3MD2A 1TT5B 2YSRA 1B72B 2XVCA 1W5TA 3FM3A 1K6OA 1YRNA 4IKFA 4KITB 4M3GA 1FC3A 1JKQC 2HOTA 1GV5A 1WGXA 2CU7A 1NHAA 2MD5A 2DW4A 1SFEA 1RUNA 4PJLA 3IC7A 1I50J 3E6DA 4DBQA 2QUFA 1VF9A 2CJJA 3JTHA 3RZOJ 1RZ4A 2VQHA 4MTDA 1HDPA 3S16J 1ZG1A 2L5QA 1OCCH 2CRGA 3CP8A 1T33A 4CH7A 1Z6TA 2H1LA 4YRVA 4AIJA 3Q5FA 4MEXF 1J2XA 4A3FJ 2GZWA 4I0AA 1GXPA 2NVYJ 2E1MB 5ICCA 2CSOA 4L5IA 1XGOA 1FBQA 4KIFA 3RKWA 3HSFA 2AO9A 1XCBA 3LAPA 2A07F 2A6TA 3RKYA 2VE8A 2M3AA 3QWLA 4Q48A 1XGNA 4ANJA 2EQRA 2GIZA 4M6YA 1O57A 1FP1D 1WFXA 5EDNA 1TQMA 1GLNA 2DO7A 1YQAA 5E1XA 4GYGA 3RKXA 2ZXJA 3KEQA 3RCOA 2IT0A 3OMYA 3VB2A 1R00A 2K02A 4L9TA 5DYMA 3RPUD 1XCVA 3B6AA 3ABMH 3IAM2 1J75A 3A2KA 3F3XA 2RREA 1ZRFA 2G0EA 3LAJA 3GLLA 3L2CA 3S32A 1I5ZA 2WAEA 1ETOA 4KMUX 4L9JA 5EEGA 3SXYA 3UR3C 5DTDA 2GLOA 2FQ3A 4ITVA 4ZDLA 1G3YA 4YFNF 4ZYDA 4N4OB 5FKNA 4PGHA 4MHGA 5CVRA 1D8KA 2KZVA 3DKYA 4Q5SF 4DJAA 5IOZA 3QU3A 4UUSB 1DQUA 2XHKA 5LGNA 1UHMA 2XGCA 5DCXA 4WK8F 2A5WA 4WX9A 2M0MA 2K9QA 2LG4A 2MH2A 3PNVA 3ZMZA 1R22A 3BCAA 1YS6A 1IV6A 2BZTA 4XOPA 1TNTA 3K2AA 1JT6A 5D8LB 2STTA 4KMFA 2MLKA 1DP7P 2QVOA 4G6TB 4DGWB 1Z05A 1BR4A 4UUSA 2HTJA 4DW6A 5A2QK 2J5OA 3CF2A 1KYZA 2P5LC 2XRNA 3F23A 1MNDA 3IWFA 2HYJA 4HQMA 3L00A 3OYFA 2E34A 1VZ0A 2MSYA 2Y69H 1ZTRA 3G73A 2K9NA 5GPAA 4IRGA 1D0XA 4UXNA 3SDBA 1FOXA 2QGUA 4XN3A 4M3BA 3GZ5A 2P0WA 3K4CA 3S14J 4BXUA 2VIXA 3GF2A 2XAQA 4WXDA 5EZHA 2IBDA 1OLTA 3G71I 2GIVA 5CKTA 4JBAA 3LWFA 1BIAA 4HX8A 3ERED 2CG4A 4R8HA 2VASA 2L7MP 1L3LA 2X4HA 2HPMA 3CDHA 2WBMA 4B48A 5GTIC 3JRDA 1HKSA 1MBKA 5BYGA 5CQEA 4ZJZA 4R79A 2JUCA 1BR1A 1YX5A 5EZGA 2LKSA 5E3MA 3TO6A 1DP3A 1LDDA 2RNJA 3RYPA 1VQKI 3PO2J 1ORKA 1AOYA 4HNTA 4HNVA 1LFBA 5JVGF 3R61A 1IUFA 5LEKA 3Q9SA 3JRGA 3FXJA 2QYOA 3VWBA 2DA2A 5HLGA 4BYYA 3HGYA 4YIRX 4MLOA 1ENHA 1K78A 1Y6IA 2Y9ZA 2HZDA 2E36A 2EFNA 3WGGA 4CO8A 4ZQ9A 3GMEA 1YX3A 2QENA 4JP0A 1YITI 1WQ2A 4DYRA 3JRAA 3MFKA 4OWRB 4NHJA 2FSWA 1HW5A 3JRIA 4FISA 3RYRA 3ZMSA 2IAIA 2K3PA 4F55A 2LKXA 1G8XA 1RETA 2DI3A 4LIUA 2EFWA 5H6RA 5FROA 1YYVA 3EETA 4PFOA 4V2FA 1HXDA 2IS1A 4XORA 3BLYA 4PZJA 1E3PA 4Z2YA 4MQVA 3J7ZI 1LKXA 3DEWA 5HNHA 4I7HA 3ZP5A 5KK1A 3GZNB 3BZCA 1TTYA 4M3EA 4XKWA 3F8FA 1S72I 3ZMVA 3ZPLA 1H8AC 1MMSA 1HC8A 3X2QH 4BXXJ 1HKTA 3K4NA 2HKXA 4KIGA 4ON0A 3ZMUA 2VLAA 1I3AA 2KFDA 5CVJA 1TWCJ 4CSWA 4PSWA 2B9SA 2EIMH 4HEA2 2HEOA 5IT9K 4M71A 1D5VA 1XDUA 4DZJA 3RTRA 4BQNA 2ESNA 1V5EA 2OCEA 2DBBA 4EM2A 2NS7A 4LD5A 1Y8QB 3T8TA 3V7CA 4ZYHA 5BQTA 4LIFA 4L0YB 1IN6A 3K70C 1P4AA 1IXCA 1U2WA 2F5DA 2XGEA 3NRVA 2LY2A 1UMQA 4EM0B 1LEAA 3CCYA 2ELJA 2HYGD 4BJTA 3L2UA 3F6VA 4HNUA 3UKGA 5J4VA 3DXJF 4PCQA 2XGXA 4L9VA 1R9WA 3JRHA 3J7AY 2CUFA 3OIOA 2XAHA 4IVNA 3KP3A 3OSGA 2BYVE 4B09A 1HBXG 4RM3A 2PJRB 3D5LA 3WE3A 4MQ9F 3I71A 3IL2A 1MH3A 3SFZA 3WTVC 3OYGA 3CLQA 1O3TA 1XGMA 1MGTA 1JUSA 4PDKA 4EJUA 1OISA 2XAFA 2F4IA 3RIRA 1IJWC 4NQWA 1WKMA 1W0TA 1JUMA 4HV5A 2ME6A 1VFCA 2H6BA 1FYKA 4A5MA 4L18B 2PX9A 2EFPA 4MIMA 3BCBA 1P7IA 2QLZA 2IRFG 4EJVA 5ILUA 2BHYA 2LBFA 5FKMA 4HV6A 1ETKA 4UHTA 2PI0A 3ERMA 3S1RJ 4X0GA 2NAZA 4XNFA 3P9IA 2D1VA 4AC0A 3QQAA 4LB5A 2A68F 2KIFA 4FTHA 3HHHA 3JTGA 4E7SA 1A31A 1UHSA 3L09A 1DPRA 4Y15A 2WWYA 2O3FA 2QBYB 2Q2EB 2FOWA 4MTEA 2O8KA 3CC7I 3K4KA 4JYKA 2CYYA 4A12A 1C0WA 1FY7A 2FBIA 4HLYA 2P7VB 1UG2A 3R0AA 4B4CA 4NB5A 2LF8A 1U78A 2W1OA 1QZEA 4UB8C 5DM6F 1UHWA 3I58A 4ENNA 1MSFC 1S5LC 4HAMA 1JHFA 1IGNA 1UELB 2HKOA 2H8RA 4ABZA 3K9TA 1T98A 3SFIA 2JA8J 2HZTA 1VQMI 4FT8A 3TP0A 2K27A 1R23A 2MBFA 4KICA 2ELHA 2KP6A 2X85A 1D3YA 3F8CA 2OPTA 2XF7A 4NC7A 3CESA 4E6KG 1Y39A 2HVRA 1GVDA 4HPQA 5E20A 1E0EA 5IP7J 2RAEA 3JSOA 1JJ8C 2KT0A 3MEXA 4BH9A 5BOXA 4B1RA 3CCJI 5H2FC 1SMYF 3GTOJ 2PMUA 5L3GA 3E6MA 1I1GA 5J8CA 2PFBA 3HHGA 3MKWB 5EEAA 2M8EA 4RLQA 2E5NA 2IPQX 2M5WA 1FWZA 1Q1HA 1E2XA 4G9YA 4II2A 3ZQFA 2A3SA 1W7PD 4BHCA 2LFBA 1G2HA 2FD5A 4M6VA 3NWTA 4GYIA 2MD0A 3I9V2 1MMAA 1G59A 2DXIA 2D5VA 4EEFG 4B3AA 1B6AA 2FA5A 2GXBA 5LGTA 3HEFA 1OR7A 1LVAA 3LSPA 3DEEA 2WADA 3HM5A 3QRFF 2B63J 1N77A 3ZOBA 1XGSA 4LK1F 5AIPA 2OQRA 1QHGA 3U1DA 1FNNA 3FKJA 1QBJA 4XICA 1I6XA 1DUXC 5KVRA 4XLCA 2IGKA 3LSMA 3OL4A 1XSVA 3K4MA 3CCRI 2JSPA 1S7EA 2EV6A 3CMYA 5CQGA 3BR2A 3ZMDA 4O6JA 5E18F 4CYCA 4GXOA 2FBKA 2CW8A 2W57A 2LP0A 4EJTA 2F6CA 2RQQA 4PJMA 4XRSG 5F1JA 1BM9A 4WCGA 3CC2I 4E7LA 1Z9CA 1NTCA 3K10A 5F0FA 1WCMJ 2Z2SB 5KAIC 3ZCOA 2EV5A 2KISA 3DTEA 2ETHA 5K1YA 1MMGA 5GP9A 4F93B 3OYIA 1Z67A 2VJJA 4XKBA 3ZQCA 4KUMA 1VQ7I 1PUFA 4KA4A 4HOBA 2JUGA 3TL4X 3FHNA 5KHDA 4HX7A 1ZYRF 4HDVA 2K7LA 5J47A 4CGZA 3QK2A 3C3WA 2ZJ2A 4BY7J 3ZR8X 4A3CJ 1DPUA 5DCMB 4GDFA 2GAUA 1YIOA 5TGTA 4DBRA 4MFDA 2O03A 3VODA 2KIQA 3WGHA 3GBGA 2I10A 3AFHA 2ECBA 4GGGA 1RIOH 3WGIA 4A0ZA 1MJ9A 1ETYA 2BY3A 2ESHA 5M5YJ 3PSFA 1V5FA 4E7JA 3CUOA 4LMDA 3I56I 4ASNA 2A6HF 3DU5A 4IXAA 3D0SA 4YFXF 3ECOA 3F6OA 2H1KA 3T1BA 1SMTA 2EV0A 1LUJB 2FOKA 4OU0A 2HWVA 1V5GA 2R5YA 2ZC2A 3CCQI 5M3FJ 4E7HA 2DFFA 1IG7A 1ON2A 2V7FA 2Y2ZA 5EEHA 4BE2A 1AWCA 2HFHA 3BG9A 3WHBA 1XB4A 1QRYA 5K7HA 4J01A 1R7JA 3IV5A 1BI1A 5GTHC 3BR0A 3HRMA 2LKPA 1FLIA 4HW0A 2OCCH 4HX4A 3TGNA 2XKOA 1JT0A 4OIRF 1N78A 1TBDA 3WTUC 1K7AA 1YRNB 3LFKA 2A61A 4XRFA 1YJ9I 2ZXWH 1HW1A 1SD4A 2Z5UA 4AVZA 1XMKA 2VBZA 4Y33A 4FETA 3CQZJ 1XS9A 2VUMJ 3MWMA 4AYBN 3HOXJ 1ZRCA 1ULYA 1GV2A 4XLNF 1EKEA 2QQAA 4G7OF 2ZO4A 5DCMA 5HVQC 1J59A 1LNWA 2UV1A 4BL0B 4OOIA 1HW2A 1K6YA 3C7JA 1NH3A 2L9SA 4C3JJ 3E5XA 2M34A 2OV7A 4PJ0C 1IDZA 4ZYGA 5CJ9A 3VYTB 2DU9A 1LPQA 2P5KA 2HNHA 3IRQA 3BWGA 5L3EA 3FHZA 2FQ4A 2DT5A 2H8WA 3TW6A 2UUZA 4A3MJ 1HDDC 2VI6A 3K1PA 3BY6A 2NOGA 4A6DA 5HLTA 4FX4A 4E7IA 2ZMEB 2QBYA 4CCNA 2L9VA 4KIBA 4ENJA 1H89C 1R9TJ 2M9HA 4D5FA 1TC3C 3WHCA 2QKMB 3FMQA 2WV1A 1AHDP 4M74A 3W3CA 2DOAA 2YX7A 3QYFA 4IX7A 1R1TA 2L2OA 3L7WA 3GTPJ 1X19A 4V2GA 1YE9A 3VPRA 1FIAA 4XRSA 2DOEA 4BE1A 2CGPA 1U3EM 3FM5A 3BTIA 1USTA 3SDGA 4RB0A 1SANA 2BY2A 2HVQA 1GVJA 2IP2A 3IH3A 4BU2A 4R1HA 4ZTJA 2VKHA 2EZKA 3LQQA 1T0FC 4YIIA 3OYCA 3OIPA 1XTAA 1REPC 4UVAA 4E7ZA 2HW0A 3W2VA 2L7KA 5L3CA 2BY1A 1OJLA 2WAFA 5D4SA 3AL0B 2CQ7A 1G3SA 3PO3J 1BA5A 2RKHA 5E3NA 2LD5A 3EYIA 4RB3C 1OFCX 1P4WA 3BZKA 5GAGJ 2NOJB 1ON1A 4KDPA 1ONVA 3I54A 5KAFC 2COBA 3FMSA 3G1OA 3I0TA 3HOVJ 3GTMJ 3KZIC 2IGNA 2M30A 3KLOA 3H9JA 4G12A 3I55I 2EZIA 5TJJA 2VKEA 2LBFB 3LMMA 5LFAA 2CQQA 1E3OC 4BDZA 1CF7B 3HOYJ 2HGCA 4FCYA 1MBJA 3QPHA 5J3LA 2Y9YA 1Z21A 2O7OA 3Q3SA 2DK5A 1T38A 3PL8A 1W5SA 4PGGA 5FLVA 2AQEA 1Q1VA 2MG4A 3BR1A 3VYUB 4U0YA 3H3VK 5FB2A 1TWHJ 5FLXK 2OZUA 1LEBA 4DYQA 1VI0A 2H94A 2K86A 2HOAA 3OL3A 3MQ0A 5LD2C 3BG5A 2G9WA 1BJAA 5D4RA 4EJOA 1UFMA 2NNNA 2V9PA 4J19A 3FK6A 3QU6A 3QYEA 3W2WA 2AXTC 1IXSB 4A6EA 3I4NJ 1XN7A 1F36A 2M7AA 1VQ9I 4HF1A 3M1CA 2IA0A 2V1DA 2ZNYA 1HSJA 3ZGKA 3CDLA 5K5QA 1KQ0A 3DBRB 1XD7A 4V19K 3ZQLA 4BKXA 2EWNA 4HBLA 1D1CA 1SVLA 4RAYA 5F04A 4HZFA 4BDYA 1J5YA 1FP2A 2ZSIB 4BHBA 4LLLA 1MNEA 2EPFA 3CF5F 2EK5A 1D1BA 1K83J 2JWTA 1CF7A 2V9VA 3CTAA 2JSCA 1SC7A 4P96A 3BR3A 4O5VA 2XB0X 2PJPA 2OU2A 3HOZJ 3D5SC 1S29A 2M45A 3COAC 4FGNA 3M8FA 1KYWA 3LOCA 4Y4RA 1J7KA 1OCRH 3S3NA 4XONA 3CCLI 2FF4A 2G7UA 4IHTA 1CGPA 2JK3A 2NTCA 5ILSA 1JGGA 1KSYA 3A02A 2K9SA 3ZQGA 1X3WB 5D5WB 4D1QA 2ITJA 1MMDA
chains in the Genus database with same CATH topology
2BVLA 2M7BA 3HKZA 1UUTA 2CW7A 1SFKA 2XDVA 4P1WA 4LIFA 1D0ZA 3S3OA 3K70C 5HNFA 1LFPA 4NNJA 4KT6A 1R6RA 2PJRA 4B3XA 1TT0A 2LY2A 2VJ4A 3QODA 4LITA 1IRXA 1X4OA 3EPZA 3OYEA 2Z1DA 2E5ZA 2ELJA 4BJTA 3L2UA 4E4HA 4HNUA 1X1CA 2VKDA 2WAQA 3K70D 1R9WA 2FUG2 4PJNA 4OAYA 2CH0A 3J7AY 2VB6A 4P5OA 4C2TA 1LDKB 4GRIA 2LREA 4Y3OA 4RM3A 1QHHD 3HPHA 4PJJA 2PJRB 3D5LA 2CUZA 2CFOA 2RNGA 3LSKA 3OYGA 2AQFA 4IZZA 4B43A 4JOMA 2F4IA 3N05A 3PSIA 2MFZA 3RQ4A 4BJ5C 2HVSA 3EUAA 1KSXA 3HOSA 4BUPA 3BCBA 3ONQA 4NBPA 2GOMA 3H5AA 4H4KC 4BXFA 2V4JC 3C2GA 2LBFA 1WJFA 2X6YA 2XSJC 3BG7A 4C9YA 1WJDA 4X0GA 1L5IA 1WJBA 4XNFA 4XN0A 3IP4B 2HU9A 2DCEA 3A4CA 2Z16A 3PNYA 4RM2A 3SZGA 4J00A 4ZYAA 2BOLA 3H5NA 2VQCA 3PFYA 1P9QC 1S9HA 4E7SA 2WY7Q 3OIQA 2W4SA 2BW3A 2IGMA 2V26A 2R7VA 2DT6A 2Q2EB 3G2BA 3K4KA 2IS2A 2OC6A 4YELA 2KRHA 2KLOA 1MMNA 2R7XA 1WJCA 2E1MC 3L2VA 2XC7A 2X6WA 2W1OA 3QFQA 2Y0SA 2VL8A 1FMVA 4XLAA 1MW7A 3E1SA 1UELB 2MC4A 3D5RC 4CZCA 2R7OA 4XOTA 2LY1A 3IAS2 1T95A 3OYLA 2KP6A 2X85A 1LVKA 2K9LA 3DQVC 2ZSHB 3OY9A 2XF7A 3BC8A 4NC7A 3CESA 3V42A 4DOZA 4E6KG 3A1YA 4XM3A 2HVRA 4HPQA 2KDOA 3SYTA 3AKZA 1E0EA 3H35A 2W00A 4ZDPA 4EATA 2X6XA 2JVGA 3MKWB 2DT7B 2VJIA 2BW3B 4BGDA 4RLQA 5JHFA 3LSGA 2E5NA 3OYJA 2M4GA 4C30A 3OYKA 5HOOA 2O5RA 3C2HA 3I3LA 1DGWY 4II2A 3OR2C 1Z1DB 3AL0C 1U0JA 2CV2A 1WJEA 1Z3YA 2CMPA 5CPRB 3NWTA 2FUFA 2MD0A 2KPMA 1MMAA 3I9V2 2WY8Q 4CCLA 1Z7LA 1G59A 2DXIA 2I8DA 2VQLA 3LSIA 4JQFA 1X1DA 2R7TA 3DEEA 2WADA 3TBIA 2LYCA 5CYNA 1SAUA 1N77A 1PJRA 3W2AA 3DTKA 1M55A 3K6GA 1QHGA 3KEYA 1WJAA 2W82A 3FKJA 2ZFUA 4HSRA 2IPRA 4HG2A 3HC7A 3PJRA 2E60A 4XLCA 1N75A 2IGKA 3LSMA 3CMMA 2X51A 3OL4A 2CV1A 3EUKL 3K4MA 2XF6A 2JSPA 4CCKA 5CQGA 3OYMA 3K4JA 2GOXB 1KONA 4XLHA 3VSLA 4KISA 2TBDA 2CW8A 1HA8A 2R4GA 3KX2A 2F6CA 2RQQA 1J09A 4PJMA 1OR7C 4CCMA 4RLFA 4C2UA 2VXZA 1ERDA 2R7RA 3H0DA 4E7LA 4XLEA 4IQJA 4NQWB 2XAUA 3K10A 4XR6A 5D9IA 2Z2SB 3VYRB 2DJIA 2LOOA 3ZCOA 3DTEA 1MMGA 3K4BA 2HPIA 4F93B 3OYIA 4FASD 4XKBA 2VJJA 1TZLA 4B47A 4ZTFA 2JUGA 1F08A 1W36D 3TL4X 3FHNA 5KHDA 3MD2A 4NC8A 3K4LA 3H9QA 4IKFA 4KITB 4E7KA 4XKCA 3NWSA 3QK2A 3ZR8X 4HRIA 4QPQA 4AU7A 3E0JB 4GDFA 1D1AA 5TGTA 4DBRA 3HPGA 3L2QA 1Y56A 4LIVA 4PJLA 3QN2A 1UG0A 4DBQA 3GBGA 4FB3A 3AFHA 2VQHA 2R7UA 1RZ9A 1X4PA 3PSFA 1V5FA 3S8PA 4XL9A 3U21A 4F92B 4E7JA 2L5QA 1NG7A 4LMDA 2KHMA 3DU5A 3CP8A 4CH7A 5KNLA 4YRVA 3KYLA 2M4KA 2E1MB 1WJ5A 2VQGA 3DU6A 1V5GA 3OR1C 3QYBA 4E7HA 2MYSA 3F9KA 2V7FA 2V9KA 4KW3A 4BE2A 3SEZA 2IS4A 2ITLA 3H9GA 4J01A 2R7SA 3HUGB 2W7NA 2A6TA 3FDYA 3DPUA 1QU3A 3M8JA 2LC2A 2M3AA 2X1DA 4ANJA 1N78A 1TBDA 1WFXA 3S3MA 4ZO0A 1GLNA 2K5CA 2X1CA 3DTIA 4AVZA 2XF5A 4Y33A 4FETA 1AA7A 3RCOA 4PK4A 3CP2A 3OMYA 2K9MA 3OS1A 5HVQC 1L2MA 2UV1A 4BL0B 1K6YA 4II3A 4XLFA 4F91B 2KRCA 2L9SA 3RPUD 5FRNA 2OV7A 4PSXA 3IAM2 3VYTB 3ZRGA 3DPLC 4QPOA 4D9JA 4HSTA 4BE0A 3A2KA 2HNHA 3TMOA 2RREA 1X1BA 2UUZA 3S32A 2BVMA 2WAEA 2CS3A 3CJRB 3UR3C 1W36C 4ITVA 2NL8A 2IXSA 4ZDLA 5HLTA 4E7IA 4N4OB 4XQFA 2KZVA 4CCNA 3DKYA 4DJAA 1DQUA 3LFUA 2QKMB 2MABA 5DCXA 1DGRM 2OUMA 3W3CA 2DOAA 4IX7A 3QYFA 1JI8A 4ZC3A 3VYSB 2IGOA 2A5WA 2L2OA 2M0MA 1X19A 1ZELA 3MMYB 1YE9A 3L2RA 2LG4A 2R7WA 3PNVA 3BCAA 4XOPA 4BE1A 4IQ4A 4BQQA 2ZXHA 2V6EA 3PNTA 2IF9A 4G6TB 4DGWB 3L2WA 2HVQA 1BR4A 3HL2A 3OS0A 4BU2A 4LG3A 3LL7A 2VKHA 4ZTJA 1NG6A 1T0FC 3MKZA 3CF2A 3OYCA 3CJQB 4AYBA 5FRMA 2X1EA 3OIPA 4ZDOA 4OAZA 4E7ZA 1MNDA 2HW0A 3W2VA 2L7KA 2CUJA 2WAFA 3AL0B 3OYFA 1BR2A 1VZ0A 3SDBA 1D0XA 1Z3XA 3OYAA 2Q1ZB 4XN3A 2NOJB 3OYBA 1X1AA 2P0WA 3K4CA 3SEQA 1UAAA 2IGNA 3H9JA 3LSHA 3FBNB 2PMZA 2VIXA 3CZ6A 2JVHA 3PUBA 1OLTA 2LBFB 5CKTA 3LMMA 4KJZA 5LFAA 4BDZA 2F5VA 5KCMA 2WA0A 4NUBA 2VJ5A 2VASA 2L9NA 1Z21A 2KQRA 2VXDA 2V1NA 2QKLB 2HPMA 2WBMA 3OS2A 4B48A 3PL8A 5BYGA 3IUOA 3EUHC 5CQEA 4ZJZA 2AQEA 3H5RA 1BR1A 4R79A 2LH9A 1YX5A 3VYUB 4PUSA 1DP3A 1BOBA 4BACA 2HQAA 4F3QA 3OL3A 4XKVA 4HNTA 5LD2C 2R7QA 3DWLE 3VWBA 3RSNA 3QYEA 3W2WA 2KL4A 2M7AA 3QOEA 4CUGA 4MLOA 3M1CA 4BEHA 1Y6IA 2HZDA 4BQOA 4CA0A 3OYHA 2CV0A 4ZQ9A 4U87A 3ZGKA 1YX3A 3ZQQA 4BS9A 4DIQA 3HG9A 1EA3A 2HDWA 4OWRB 2UWMA 4CCOA 2K3PA 2WB1A 4F55A 3DKXA 2KMUA 1G8XA 1D1CA 4LIUA 4BDYA 4PFPA 2VPLA 3HOTA 3UNGC 5FROA 3OOUA 2ZSIB 1MNEA 1PYVA 4PFOA 3S93A 2IS1A 4XORA 1D1BA 3BLYA 4BEHB 3FBIB 3OWTA 4F52A 4B44A 3OYDA 1D0YA 1LKXA 3D5SC 3DPTA 4RMNA 4CCJA 4BJ6C 4YEJA 5HNHA 4FGNA 1FMWA 3MKYB 4XMYA 4XKWA 4Y4RA 3HXLA 3DLAA 3VDXA 3S3NA 4XONA 3VSKA 2NTCA 4N4NB 3ZXSA 3K4NA 1KSYA 2VLAA 2ZXIA 4CSWA 4PSWA 2JA2A 3BG6A 4HEA2 2IS6A 3RTRA 2LRDA 3OYNA 4D1QA 4BQNA 4U7BA 2ITJA 1V5EA 1MMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U87 A;  3DKY A;  3DKX A; 
#chains in the Genus database with same CATH topology
 4RB1 A;  4G8X A;  2DOD A;  3HKZ A;  3RKQ A;  1IN7 A;  1SFK A;  3QPL A;  1FOW A;  1D0Z A;  1W5C C;  2BY0 A;  5IT3 A;  4C3H J;  2XAS A;  4KT6 A;  1MBH A;  1R6R A;  2XV4 S;  2QZ8 A;  2PJR A;  4JX6 A;  1X4O A;  3KE2 A;  4IRI A;  1QPM A;  1FOY A;  3L9F A;  4A0Y A;  3WU2 C;  1WHU A;  5B66 C;  1FT9 A;  3I4M J;  3K2Z A;  5IPA A;  2EIJ H;  2E2H J;  2PLY A;  1V4R A;  2FUG 2;  5IYC J;  4C2T A;  2LRE A;  4Y3O A;  3HPH A;  3RDI A;  4KN7 X;  2L7Z A;  1E3H A;  3GXO A;  2CUZ A;  3LSK A;  1ETX A;  5J1R A;  2AQF A;  1GXQ A;  4U0W A;  3CCE I;  3DEU A;  3HOU J;  3A01 A;  2WTE A;  3L1P A;  1P92 A;  5HS9 A;  4D5C A;  2E7X A;  3N05 A;  2WB1 N;  5DD8 A;  4M73 A;  2R5Z B;  1BC8 C;  3F8N A;  2VT3 A;  3EUA A;  3HRT A;  3GVA A;  2MC3 A;  2DTR A;  5J8F A;  2E1N A;  2JA7 J;  3H5A A;  5L3D A;  4H4K C;  2DK8 A;  1BW6 A;  2OD5 A;  1R4N B;  2V4J C;  2NVT J;  3V8J A;  2X6O A;  1W7P A;  1X3Z B;  1F1Z A;  3KP4 A;  3V7R A;  3VFZ A;  2W25 A;  1WJB A;  4P9U A;  3F22 A;  1O3Q A;  2BEO A;  2HU9 A;  3HTS B;  4HF2 A;  2Y30 A;  1JXS A;  4RM2 A;  1JUP A;  4ZYA A;  3WOD F;  5E1W A;  1S9H A;  1ZLJ A;  2WY7 Q;  2IGM A;  4IOA F;  4EQQ A;  2DT6 A;  1UZC A;  3GLX A;  3G2B A;  5FFZ A;  1BW5 A;  4YEL A;  1BIB A;  3B02 A;  2WAQ N;  2KRH A;  1PUF B;  1MMN A;  1V3F A;  2I5U A;  2TRT A;  4TV7 A;  2R7X A;  1YJW I;  1R4M B;  1P7J A;  1WPK A;  2PMZ N;  1YW7 A;  2DJN A;  2XIG A;  3DV8 A;  3QFQ A;  4OIP F;  1R49 A;  3MCZ A;  3WTT C;  1EV7 A;  3A0B C;  3BG3 A;  1FIP A;  2XRL A;  1B59 A;  5LBQ A;  3R0J A;  4CZC A;  1MDM A;  3F72 A;  1U6G A;  3F21 A;  1T95 A;  3PFI A;  3OYL A;  5CYV A;  1F4K A;  4DNC A;  4KN4 X;  2MGQ A;  2RN7 A;  3QP6 A;  2ZSH B;  4UV8 A;  4EGY A;  4FE7 A;  1WZ2 A;  5FD6 A;  4DOZ A;  2L0K A;  3ABL H;  1J9I A;  4XM3 A;  1KU3 A;  3WU1 B;  3AKZ A;  1VQN I;  2UZK A;  3J80 Z;  3H35 A;  1YOV B;  4ESF A;  1X1P A;  3BJO A;  3EUH A;  4HF0 A;  1FJL A;  4AM3 A;  3JRE A;  4QSH A;  2DT7 B;  1SD7 A;  2OA4 A;  2OAZ A;  2VJI A;  4N9H A;  3ABU A;  4CIC A;  2EIL H;  2W24 A;  2RVC A;  1ZH5 A;  2G7H A;  3HBL A;  2GXG A;  4IOC F;  1MIJ A;  2JPC A;  3GFM A;  5E3O A;  2O61 A;  5HOO A;  2O5R A;  3I3L A;  1DGW Y;  1WVR A;  4JX4 A;  3H36 A;  3TW7 A;  5IY5 H;  3OR2 C;  3AL0 C;  2OQG A;  2D1H A;  1U0J A;  1MJA A;  2FNA A;  2FUF A;  2JQ7 A;  1IRZ A;  1DU0 A;  2PBI A;  3FIS A;  1Z7L A;  5FKO A;  2Y31 A;  4Q4Z F;  2Y0M A;  3BPX A;  3GWZ A;  4JQF A;  2CWE A;  2Z99 A;  2A6E F;  1LE8 B;  2DMT A;  1QA6 A;  2R7T A;  3GUD A;  3HUG A;  5CYN A;  3P9C A;  1SAU A;  3DP7 A;  5CVU A;  4NDL A;  3W2A A;  3S2D J;  3DTK A;  2YPR A;  1M55 A;  1B9M A;  3K6G A;  3KEY A;  2EH3 A;  2DOF A;  4HSR A;  2KJB A;  4JK1 X;  1ZG5 A;  4WXH A;  3HC7 A;  5HDN A;  1CQT A;  3M1E A;  2CV1 A;  3KIO A;  3JRB A;  1IXR C;  1BC7 C;  4CCK A;  2VC1 A;  4A3G J;  3K4J A;  2GOX B;  1ITY A;  3CO6 C;  2D45 A;  2EFQ A;  1AU7 A;  3KX2 A;  4IO9 F;  4N0B A;  1FEX A;  2JMW A;  5D5U B;  1O7L A;  5F0C A;  4CCM A;  3U9G A;  2E2I J;  4C2U A;  2VXZ A;  1KU7 A;  1ZAR A;  3T8R A;  1OYW A;  2KIU A;  5HDK A;  3WG7 H;  2XAU A;  5M5W J;  2M87 A;  2EA2 A;  3K4B A;  2EA4 A;  4FAS D;  5E17 F;  1TZL A;  5GPC A;  3C18 A;  3LQR A;  3G3Z A;  2FEZ A;  3K4L A;  3SHF A;  3W6J B;  2C6Y A;  3H9Q A;  4E7K A;  1MNM C;  4A0X A;  2HR3 A;  4Z6Y A;  4HRI A;  4AU7 A;  2L3D A;  5FKK A;  1MBE A;  3HPG A;  4MGR A;  4LIV A;  3QN2 A;  2E19 A;  2JPB A;  3WU0 A;  1UG0 A;  3M9A A;  1Y1V J;  3OV8 A;  1SFX A;  3Q0W A;  3WTW C;  1RZ9 A;  3S2H J;  1W0U A;  1NG7 A;  2MLG A;  2KHM A;  1YHQ I;  3CCU I;  5KNL A;  2HXI A;  1F5T A;  2ZFW A;  3CME I;  3WTZ A;  2M2E A;  1UB9 A;  2V79 A;  2P7C B;  2VQG A;  3DU6 A;  5EGO A;  3QYB A;  2VBY A;  2ICW G;  3SZT A;  3BR6 A;  4I98 B;  4KW3 A;  5IT9 Z;  2KZG A;  4RAF A;  3SEZ A;  3MZH A;  1LE8 A;  3H9G A;  2IS4 A;  2ITL A;  2DQL A;  2R7S A;  1Z0X A;  3CD6 I;  2FE3 A;  2FNP A;  2W7N A;  2ISZ A;  3F8B A;  2R5Y B;  1QU3 A;  3I53 A;  4K2E A;  2LC2 A;  2LR8 A;  3ESW B;  2OTL I;  1RES A;  3S3M A;  3HYI A;  2K5C A;  2QQB A;  2X1C A;  2XF5 A;  4PK4 A;  3PQK A;  1FOK A;  3CP2 A;  3G1M A;  1WH5 A;  2K9M A;  1A6Q A;  2HTS A;  4XLF A;  4IPA A;  1B1B A;  4II3 A;  1ZKG A;  2KRC A;  2L4A A;  2LDU A;  3AG3 H;  4LG0 A;  2XB5 A;  5FRN A;  1ODD A;  4ESJ A;  4PSX A;  2LNB A;  3ZRG A;  1YFH A;  4HST A;  3ZMT A;  1FSE A;  2NYX A;  3KZY A;  1D5Y A;  4IF4 A;  4AD9 A;  3RPQ A;  3A03 A;  1X1B A;  4OIN F;  3CJN A;  3M7G A;  5JLX A;  1BJZ A;  3JCU C;  2BVM A;  4ENK A;  2CUE A;  2CS3 A;  1T39 A;  1TW2 A;  3CJR B;  1R5H A;  1W36 C;  4QIW N;  2IXS A;  2P8T A;  1B8I A;  1TW3 A;  2VOO A;  3DLL F;  3O2P E;  4KFC A;  1RKW A;  4E70 A;  2MAB A;  3IKT A;  1DGR M;  3RI4 A;  4M9X A;  1IRG A;  3VYS B;  3FF5 A;  3IHU A;  4EVI A;  1ZEL A;  3MMY B;  2R7W A;  2FJ1 A;  2DMP A;  3LNQ A;  2DTZ A;  2BXY A;  3KEO A;  4IQ4 A;  2V6E A;  1QPI A;  1APL C;  2HI3 A;  1R36 A;  1FBU A;  1K4T A;  2D2W A;  2HYF A;  2IF9 A;  3MVP A;  1IN5 A;  1YW8 A;  4LG3 A;  3LL7 A;  1NG6 A;  3MKZ A;  2OF7 A;  1RPW A;  1JJ6 C;  3S17 J;  3CJQ B;  4AYB A;  4ZDO A;  2X1E A;  3J7Y J;  4ZZL A;  1UJ8 A;  3WG9 A;  1XX5 A;  2CUJ A;  5M5X J;  2JT1 A;  4Y7N J;  4X1E A;  1BI0 A;  2ID3 A;  2NVQ J;  5BNG A;  1Z3X A;  3GCM A;  3OYA A;  4LFU A;  5L3F A;  2CW0 F;  1U9O A;  4D0P A;  3DBH B;  1TWF J;  1X1A A;  3E6B A;  3HTU A;  3MZY A;  3LSH A;  3FBN B;  1POG A;  2YS9 A;  2JVH A;  3DFG A;  3CMA I;  4IHX A;  4LJZ F;  4U0V A;  3GYH X;  1ZG3 A;  5A2Q Z;  2F5V A;  5KCM A;  2KIM A;  2WA0 A;  1XSD A;  1EF4 A;  2VJ5 A;  1O4X A;  2IA2 A;  4HDU A;  2KQR A;  2L02 A;  3ML6 A;  1MKM A;  2IA1 A;  3KPH A;  1X2M A;  2GBY A;  1KZH A;  2HDC A;  2VON A;  1BI3 A;  3IUO A;  2H27 A;  1MH4 A;  1RUO A;  2EIK H;  4Q47 A;  2LH9 A;  3DCF A;  5TIS C;  2YR2 A;  1U9N A;  4LK0 F;  2H09 A;  4PUS A;  4UVC A;  4EJW A;  3AG4 H;  3JSP A;  2ECC A;  1QQI A;  1ZR4 A;  1Z6R A;  1YIJ I;  5LHG A;  5D5X B;  4XKV A;  3V4G A;  2R7Q A;  1HF0 A;  3DWL E;  1ETV A;  3KYD B;  3RSN A;  4Y17 A;  4G6Q A;  4QLC U;  2V1U A;  2KL4 A;  5J1Y A;  4CUG A;  2LF7 A;  1XSX A;  3KP7 A;  4BQO A;  3OYH A;  2CV0 A;  3ABK H;  3ZQQ A;  4BS9 A;  3CC4 I;  3HG9 A;  4G94 A;  5DUI A;  3VOE A;  2KJC A;  3HJE A;  1JTY A;  4CCO A;  1OCZ H;  4P55 A;  2F5F A;  2O6G E;  3DKX A;  1HCR A;  4OMZ A;  4C2M J;  2F4O B;  4PFP A;  2VPL A;  3UNG C;  3OOU A;  2CFX A;  2ZJP F;  4AVP A;  5EJC A;  3GFI A;  4FE4 A;  4MFE A;  3CO7 C;  4KYW A;  1X58 A;  5FJ8 J;  2FRH A;  5FFX A;  1FTZ A;  3FBI B;  2P6T A;  3OWT A;  1A35 A;  2DMQ A;  1S8N A;  3TO9 A;  4F52 A;  3CCS I;  1H9G A;  1D0Y A;  4CCJ A;  4RMN A;  4BJ6 C;  2ZME A;  4KT5 C;  3MKY B;  4LGW A;  3HXL A;  1S7A A;  1X3U A;  1KU2 A;  4XRM A;  1NK3 P;  2LK2 A;  3VSK A;  1JGS A;  2QSF X;  4D7N A;  3N97 A;  1I39 A;  3K0L A;  3P5J A;  1MSE C;  4N4N B;  1EH8 A;  3E5Q A;  1FPQ A;  2ZB9 A;  3ZXS A;  4BY1 J;  2QF7 A;  1VQ6 I;  4CXF A;  3S1N J;  3BG6 A;  2DPD A;  1T2K A;  4IJA A;  3H1C A;  2IS6 A;  1O7F A;  2LRD A;  4U7B A;  3TP3 A;  1STZ A;  5HDG A;  1F9N A;  2M7B A;  2P4W A;  3EQL F;  2FU4 A;  1LDJ A;  2CO5 A;  3BDD A;  4I01 A;  4P1W A;  4EGZ A;  5BMZ A;  3M07 A;  5K7F A;  3S3O A;  1FZP B;  1A5J A;  5HNF A;  1LFP A;  3BOQ A;  1P2F A;  5DV5 A;  1PVE A;  5LRS A;  2VC0 A;  5J1U A;  2DN0 A;  3LST A;  1TT0 A;  4B3X A;  2VJ4 A;  4LIT A;  2DMU A;  4O3M A;  3CUQ B;  3EPZ A;  1I27 A;  2BHZ A;  4YIF A;  3OYE A;  2E5Z A;  1T8I A;  3BZ6 A;  4LG0 B;  4I6Z A;  3SQN A;  2ACJ A;  3KP5 A;  2WAQ A;  1SAX A;  2FML A;  3BTC A;  4BBS J;  1K79 A;  1EH7 A;  3T0Y A;  4OAY A;  2HDD A;  5LHI A;  3S1M J;  4XSZ F;  3G1L A;  3LSJ A;  1LDK B;  4XLP F;  5E8G A;  5IYB J;  4LLG F;  2WC2 A;  1QHH D;  4IHV A;  4PJJ A;  4ZYE A;  2EFO A;  2L01 A;  2CFO A;  2LLK A;  4IHW A;  2ID6 A;  4IZZ A;  1VQP I;  4M9Z A;  2HXO A;  4B43 A;  1IDY A;  2F4M B;  1W7P B;  3RQ4 A;  2NRA C;  4BJ5 C;  4BBR J;  5B5E C;  4ENM A;  2HVS A;  2K4B A;  3TOB A;  2E71 A;  1KSX A;  1YS7 A;  1YO5 C;  4BUP A;  3HSR A;  3ONQ A;  1S7O A;  2PMH A;  2YU3 A;  1R71 A;  2GOM A;  1YTY A;  4ZZD A;  2Y0S N;  4L9N A;  3FXR A;  3W6V A;  1TQI A;  2XSJ C;  3BTJ A;  3BT9 A;  4N9I A;  5B1B H;  3BG7 A;  4ESB A;  1F43 A;  3CDI A;  1ZGA A;  1YLF A;  2WV0 A;  5HLH A;  4XN0 A;  5EYR A;  1LQ1 A;  1OCO H;  3ECH A;  1R58 A;  4J00 A;  1EJ9 A;  2BOL A;  2BV6 A;  2ISY A;  3FMR A;  1UCR A;  2DMN A;  1P9Q C;  1ZK8 A;  2KRF A;  3OIQ A;  3TDZ C;  3JAM K;  4LMY A;  2W4S A;  3BTL A;  2J5P A;  2M8G X;  2NS0 A;  2DFI A;  2PG4 A;  1IO2 A;  2STW A;  2R7V A;  1IAW A;  1I3Q J;  1HQC A;  5D5V B;  2E35 A;  3FIW A;  1BN5 A;  3V8K A;  3I64 A;  2B0L A;  1FSH A;  1QVU A;  1OYY A;  3L2V A;  2XC7 A;  2DA3 A;  2X6W A;  5F64 A;  4BHP A;  3A0H C;  1U5T C;  2OTJ I;  3HRU A;  4S04 A;  1G3T A;  4X6A J;  5FD5 A;  4I09 A;  2R3S A;  1MW7 A;  2R93 J;  3E1S A;  2DA6 A;  3KFW X;  5TRD A;  5ED4 A;  3D5R C;  2JJ7 A;  2R7O A;  4XOT A;  2QSG X;  1U5T B;  3HKZ N;  2LY1 A;  3G4S I;  1XPX A;  2HQ5 A;  1Y0U A;  1MD0 A;  5LRR A;  4UNO A;  1LVK A;  2V1X A;  4D7M A;  2K9L A;  2KKO A;  2JTV A;  1MBG A;  2E1O A;  3RZD J;  3F0C A;  1OCP A;  3BC8 A;  2E7W A;  4RAZ A;  3V42 A;  1ZLK A;  3ELK A;  1J0R A;  2XAG A;  3D1N I;  3I59 A;  4C3I J;  4UY8 I;  1IF1 A;  2KDO A;  2QM3 A;  3O8G A;  2Y75 A;  3ULQ B;  2W00 A;  5BPD A;  4ZDP A;  3U2R A;  4EAT A;  2EIN H;  2Q2E A;  5JLW A;  4FQG A;  4I99 C;  1SEU A;  2XPU A;  4BGD A;  5ICG A;  1O3S A;  1ZRE A;  4RAG A;  3LSG A;  3ZN0 A;  4A3L J;  2M4G A;  5ERI A;  3I5U A;  4A3D J;  3FXQ A;  2DFH A;  5LLQ A;  1T56 A;  1JHH A;  5LEJ A;  1SFO J;  1IN4 A;  1MZB A;  2LY9 A;  1Z1D B;  2CV2 A;  1Z3Y A;  1RNL A;  2R92 J;  2W48 A;  5IP9 J;  4EM1 A;  2FMY A;  2QQ8 A;  4OIQ F;  2WY8 Q;  4UUV A;  2DYR H;  1TWG J;  2I8D A;  5DUK A;  2VQL A;  3KZZ A;  3FWE A;  3H0G J;  3WTS C;  4G6D A;  3LA3 A;  2DA5 A;  3PIP F;  2PN6 A;  2VBX A;  1GUU A;  3IRR A;  2UXX A;  2OBP A;  3JRC A;  2Z33 A;  1WJA A;  2R7F A;  2W82 A;  1RKT A;  1KQ8 A;  5LHH A;  2GA2 A;  3B73 A;  4HG2 A;  3PJR A;  2E60 A;  4XBF A;  1LFU P;  3E5U A;  1N75 A;  2COM A;  3I59 B;  4LOC A;  3OSF A;  3FKI J;  4M6X A;  3EUK L;  1VQ4 I;  2XF6 A;  1WSU A;  2F5C A;  1BL0 A;  4IEJ A;  5EG0 B;  4RGS A;  1WH7 A;  4KIS A;  2TBD A;  2L9R A;  2ZJQ F;  4UV9 A;  4AUX A;  1QGP A;  2MA3 A;  2R4G A;  1SD6 A;  4A5N A;  3AG2 H;  4I2O A;  3S15 J;  4CHU A;  1ERD A;  2R7R A;  3FK7 A;  3H0D A;  4FX0 A;  1U5T A;  4UB6 C;  1MDM B;  5JI6 A;  3VYR B;  5F08 A;  4BAY A;  3O3K A;  3W6K B;  2ZNZ A;  3NEU A;  4B8X A;  2X48 A;  4MO7 A;  2AHQ A;  3E7L A;  4ZTF A;  3HOW J;  5E79 C;  1FYM A;  1F08 A;  1KGS A;  4NC8 A;  2XRO A;  3GZ6 A;  1PDN C;  1TQP A;  5AIQ A;  3PM1 A;  3NWS A;  4XKC A;  4QPQ A;  3E0J B;  2ADU A;  1I1S A;  5K5O A;  1D1A A;  3L2Q A;  3GFL A;  1R1U A;  1Y56 A;  3HDD A;  1Y1W J;  4FB3 A;  2K4J A;  2JZY A;  2CQN A;  2P81 A;  3BQZ A;  4XSX F;  1E17 A;  2R7U A;  1X4P A;  5FO5 A;  3S8P A;  3H3U A;  4M72 A;  4XL9 A;  3U21 A;  4F92 B;  5JR3 A;  4EV0 A;  4A3K J;  1B72 A;  4CYC B;  2VT2 A;  5DCF A;  4XK4 A;  1Z1D A;  3HGG A;  2UXN A;  1XG1 A;  3PUF A;  3J80 K;  1A04 A;  4CDG A;  3KYL A;  2M4K A;  1BBY A;  4S05 A;  1WJ5 A;  3AG1 H;  3QPS A;  3OR1 C;  2MYS A;  3TED A;  3F9K A;  2V9K A;  2RDP A;  1ZQ3 P;  3ZN1 A;  3MAJ A;  4DYC A;  1FYL A;  3HUG B;  2JRM A;  3FDY A;  4A69 C;  1OMI A;  4GFB A;  3DPU A;  1PUE E;  3Q0U A;  3M8J A;  2IJL A;  4AWX B;  2X1D A;  2QA4 I;  2X9D A;  1ACI A;  3V7S A;  4ZO0 A;  1SVM A;  1R5I D;  3DTI A;  2LTP A;  1GT0 C;  1AA7 A;  4KNY A;  3ZQH A;  4UVB A;  4A3B J;  3OS1 A;  3MN2 A;  1L2M A;  4F91 B;  4I76 A;  2MW8 A;  4RB2 C;  4OMY A;  2K85 A;  3O8H A;  1VQ8 I;  3HRS A;  3DPL C;  1IN8 A;  4QPO A;  4D9J A;  4BE0 A;  3TMO A;  4JX5 A;  3CJT B;  5BPI A;  1ZGJ A;  3QAH A;  4EMS A;  1HLV A;  2W85 A;  3R60 A;  2HOE A;  5IYD J;  2GM4 A;  2NL8 A;  1R5G A;  4UUT A;  1T0F A;  5J40 A;  3K69 A;  4XQF A;  1A36 A;  4HA8 A;  3E3V A;  3LFU A;  2IVM A;  4NC6 A;  2NXN B;  3TQN A;  4G7Z F;  2OUM A;  1W1W E;  1JI8 A;  4ZC3 A;  1U8B A;  2IGO A;  3EDP A;  3TDU C;  3L2R A;  1B9N A;  3ISP A;  5C4J J;  4BQQ A;  2ZXH A;  1AKH B;  3KLN A;  3PNT A;  1LJ9 A;  3ABT A;  2RQP A;  3L2W A;  3HL2 A;  1YJN I;  3OS0 A;  2RV8 A;  4QTR A;  4GO1 A;  4A3E J;  3JRF A;  1DDN A;  1G4D A;  2AXL A;  5FRM A;  4M3F A;  5EGO B;  3CLO A;  4OAZ A;  2R5Z A;  2TCT A;  1WI3 A;  3T5X A;  2M0C A;  3CCM I;  1P4X A;  3JR9 A;  1BR2 A;  2BBY A;  2P5V A;  3BJA A;  1LB2 A;  3JW4 A;  3FX3 A;  3DKW A;  2Q1Z B;  3GW2 A;  1HKQ A;  2A05 A;  2ZBK A;  4DZP A;  2O9L A;  3OYB A;  1QZZ A;  1RI7 A;  1UAA A;  3SEQ A;  1H88 C;  4W97 A;  4WF2 A;  2JRT A;  2QQ9 A;  2V6C A;  1N25 A;  2L7F P;  2Z9O A;  2PMZ A;  3CZ6 A;  3PUB A;  5D6F A;  1NK2 P;  5ICE A;  4KJZ A;  4IL6 C;  3GTG J;  3O6B B;  4NUB A;  3C1D A;  2EZL A;  1Z77 A;  1TBX A;  2L9N A;  4MEY F;  2OZ6 A;  3GX4 X;  2VXD A;  2V1N A;  3RPU A;  3C2B A;  2QKL B;  2X0L A;  3U1K A;  3OS2 A;  2RC4 A;  5IP6 A;  1P6R A;  4HQE A;  4NBQ A;  3EUH C;  1ZGW A;  2QEX I;  3H5R A;  5LGU A;  1AKH A;  1T08 B;  1OCT C;  3M8E A;  5GAE J;  1BOB A;  3REO A;  4BAC A;  1K78 B;  1ZAO A;  2HQA A;  1IRF A;  4F3Q A;  1SVO A;  2EJR A;  3HSE A;  3GO5 A;  3IH4 A;  3R6S A;  3GTQ J;  1FBS A;  5F27 A;  5E3L A;  5CVI A;  1JKP C;  4A3J J;  1G3W A;  2XSD C;  2VPR A;  2CQX A;  3Q9V A;  3DF8 A;  3QOE A;  3F8M A;  5M3M J;  4M3D A;  3IKV A;  4BEH A;  3J81 Z;  5J4Y A;  1B8I B;  3FXK A;  4CA0 A;  4IRH A;  2DYS H;  1XMA A;  4U87 A;  1Y8R B;  2QWW A;  2LMD A;  4DIQ A;  5GAH J;  1EA3 A;  2K40 A;  2PEX A;  2HDW A;  5HS7 A;  4A93 J;  2UWM A;  3FXL A;  3K1M A;  2K3F A;  1H0M A;  2PQ8 A;  2WB1 A;  4RBO A;  2VE9 A;  2EB7 A;  2KMU A;  3TOA A;  3WTX C;  5IOY A;  1TNS A;  3HOT A;  1RR8 C;  3MZ8 A;  1S6L A;  4HLX A;  2XAJ A;  1PYV A;  1RC9 A;  3S93 A;  1D8J A;  2L4M A;  4BEH B;  3WTY C;  2VBW A;  1OKR A;  4L0Z B;  3QOP A;  1GHC A;  6PAX A;  2GA1 A;  4B44 A;  3OYD A;  4U7D A;  4IHS A;  3DPT A;  2DLL A;  3BP8 A;  3TO7 A;  4YEJ A;  2HQN A;  1FMW A;  4XMY A;  4CZZ A;  1B4A A;  5CVV A;  1ZHF A;  3FXO A;  1S3J A;  3DLA A;  4MNU A;  3ZQI A;  2DA7 A;  1Y0N A;  3VDX A;  4Y52 J;  1WRJ A;  2W84 A;  1OPC A;  1BI2 A;  2YX4 A;  3FXU A;  1QO0 D;  3BJ6 A;  5B3S H;  1L0O C;  2FX0 A;  1SD5 A;  2ZXI A;  5C4X J;  3FZV A;  2JA2 A;  2IW5 A;  5K5R A;  4A3I J;  2DA1 A;  2B7E A;  3OYN A;  5FGM A;  3TKY A;  1H9T A;  3BRO A;  1PP7 U;  1QNT A;  2QCO A;  2BVL A;  5DS9 A;  5DEQ A;  4L5J A;  4IHY A;  1UUT A;  2CW7 A;  2XDV A;  5F0H A;  3KCC A;  5L3B A;  2VOP A;  4NNJ A;  4S0H B;  2DFE A;  2F48 A;  3HIF A;  2IEK A;  4L5E A;  3WE2 A;  1HST A;  3QOD A;  2R0Q C;  3KYC B;  1IRX A;  3NAU A;  5JVT A;  3J81 K;  2R7Z J;  2H6C A;  2N8G A;  2Z1D A;  3BQY A;  5BS6 A;  2O8X A;  2FBH A;  2CQK A;  2NNY A;  2XPW A;  1ETW A;  3LA2 A;  4E4H A;  1X1C A;  2F2E A;  2VKD A;  5J6X A;  1QVT A;  1ZR2 A;  3PIO F;  3K70 D;  4PJN A;  9ANT A;  1R1V A;  1WWX A;  2CH0 A;  2VB6 A;  3LA7 A;  3CUQ C;  4P5O A;  3CUQ A;  4WXC A;  4GRI A;  5E1Z B;  5C44 J;  1FX7 A;  5EG0 A;  3B6C A;  2RNG A;  4ETS A;  3FXM A;  2YU9 J;  2EZH A;  4HYE A;  4JOM A;  5DDG A;  3HZJ A;  3M3Y J;  3PSI A;  2MFZ A;  1ETQ A;  1VND A;  3K7A J;  4H0E A;  2TDX A;  5AON A;  2XUB A;  4RS8 A;  4AIH A;  3HOS A;  3N4M A;  5DD4 A;  2DDB A;  4WWC A;  1USS A;  4NBP A;  4BXF A;  1IV8 A;  2M1B A;  3C2G A;  2MH9 A;  5GAD J;  2ZKZ A;  1VQL I;  1WJF A;  2O0Y A;  2X6Y A;  1I6H J;  4BQA A;  1V54 H;  2VKV A;  4XID A;  1EH6 A;  4C9Y A;  5HS8 A;  1WJD A;  1L5I A;  1A6I A;  2GWR A;  3IP4 B;  3A4C A;  2DCE A;  2Z16 A;  3PNY A;  1IC8 A;  5FKL A;  3SZG A;  3SZP A;  3H5N A;  1JKO C;  2VQC A;  4OIO F;  3PFY A;  1TLH B;  1Z91 A;  1KA8 A;  3H3Z A;  4ZH4 F;  2DDA A;  4A2U A;  2BW3 A;  2QSH X;  1VTN C;  2V26 A;  4RGX A;  5E8I A;  5ILV A;  2F5E A;  4GCV A;  4QWQ A;  1WI9 A;  1JE8 A;  2IS2 A;  5FLX Z;  2OC6 A;  3RJP A;  2LVS A;  2KLO A;  4RGR A;  3ZQ7 A;  3CCV I;  3NAR A;  1WJC A;  2E1M C;  3MKL A;  3BR5 A;  2JA6 J;  2E1C A;  2Y0S A;  2VL8 A;  3BPV A;  1FMV A;  5F1R A;  4XLA A;  2YUS A;  2ELK A;  2ZCW A;  2KDZ A;  2BGC A;  1PP8 F;  2A69 F;  4FHT A;  3OOP A;  5D6E A;  2MC4 A;  4LB6 B;  2HQR A;  2XKP A;  3M4O J;  3IWZ A;  1JKR C;  2JA5 J;  2XPV A;  3IAS 2;  1GDT A;  2HOS A;  1KQ9 A;  1JTX A;  5B1A H;  2ME0 A;  1TWA J;  3KET A;  4P9F A;  5JFR A;  2NVX J;  3EYY A;  1XMX A;  2GQQ A;  3ASO H;  3DQV C;  3OY9 A;  5H6Q A;  5EF6 A;  5DM7 F;  3A1Y A;  2Q0O A;  3VEP A;  1IUY A;  4I0B A;  2DA4 A;  2VOD A;  3SYT A;  3GTJ J;  2NS8 A;  2BE5 F;  3V8L A;  3GEZ A;  2GXA A;  1MJB A;  2BXZ A;  5F6F A;  1DU6 A;  1XC5 A;  3K1N A;  5ICF A;  2X6X A;  4Y13 A;  1ZN2 A;  2JVG A;  3SJM A;  3DBL B;  1X2N A;  3GFJ A;  3HB9 A;  2EBI A;  4RA2 A;  2Z3Y A;  3E6C C;  2BW3 B;  5JHF A;  2DPU A;  3I4P A;  3OYJ A;  5C3E J;  1MBF A;  5H20 A;  4C30 A;  3OYK A;  1K4S A;  3QP5 A;  3P7N A;  3C2H A;  1VQO I;  3J7A O;  3Q0V A;  4BNC A;  5JHU A;  5K7Z A;  1IZ1 A;  2VN2 A;  1WJE A;  5CLS A;  4M9S A;  2ZME C;  1V55 H;  2CMP A;  4RDU A;  4LLN A;  5CPR B;  3E97 A;  1OQY A;  1VQ5 I;  2JN6 A;  2KPM A;  4CCL A;  3AAF A;  1RRJ A;  1T6S A;  1OYI A;  1XDS A;  2DAO A;  2NVU B;  1QZY A;  3GTL J;  3LSI A;  3ROU A;  3GTK J;  1X1D A;  2RGV A;  1ZRD A;  4YG2 F;  3IH2 A;  2HS5 A;  2Q8K A;  1BOA A;  2DQR A;  2LYC A;  3TBI A;  4AIK A;  2AS5 F;  1FTT A;  2LSO A;  3S2W A;  1PJR A;  3R4K A;  3G6E I;  2A5Y B;  3JAM Z;  4YFK F;  2E2J J;  1Z7U A;  2XGD A;  1M1E B;  2R7D A;  2ZFU A;  2IPR A;  2FXA A;  4RGU A;  1IW7 F;  4I02 A;  1O3R A;  1SFU A;  1U8R A;  3CMM A;  2X51 A;  3ASN H;  1HOM A;  1RR7 A;  2Y48 A;  1TP4 A;  5HLI A;  3OYM A;  4CYD A;  1KON A;  4XLH A;  3VSL A;  1HA8 A;  5HOD A;  4F7Z A;  3NQO A;  1K61 A;  3QPT A;  3KP6 A;  4G7H F;  1TL8 A;  4DQ2 A;  3LSR A;  1J09 A;  1YG2 A;  1OR7 C;  5D8K B;  2ZJR F;  4RLF A;  3H92 A;  4IQJ A;  4XLE A;  4NQW B;  5FLM J;  4XR6 A;  3KP2 A;  5D9I A;  1W4M A;  3P9K A;  2L54 A;  2DJI A;  2LOO A;  3RQI A;  3A01 B;  1YW9 A;  3S1Q J;  2HPI A;  4W1U A;  4U88 A;  3PQJ A;  1YI2 I;  1KU9 A;  2OJE D;  1G6N A;  4B47 A;  2P6S A;  1W36 D;  4AID A;  3MD2 A;  1TT5 B;  2YSR A;  1B72 B;  2XVC A;  1W5T A;  3FM3 A;  1K6O A;  1YRN A;  4IKF A;  4KIT B;  4M3G A;  1FC3 A;  1JKQ C;  2HOT A;  1GV5 A;  1WGX A;  2CU7 A;  1NHA A;  2MD5 A;  2DW4 A;  1SFE A;  1RUN A;  4PJL A;  3IC7 A;  1I50 J;  3E6D A;  4DBQ A;  2QUF A;  1VF9 A;  2CJJ A;  3JTH A;  3RZO J;  1RZ4 A;  2VQH A;  4MTD A;  1HDP A;  3S16 J;  1ZG1 A;  2L5Q A;  1OCC H;  2CRG A;  3CP8 A;  1T33 A;  4CH7 A;  1Z6T A;  2H1L A;  4YRV A;  4AIJ A;  3Q5F A;  4MEX F;  1J2X A;  4A3F J;  2GZW A;  4I0A A;  1GXP A;  2NVY J;  2E1M B;  5ICC A;  2CSO A;  4L5I A;  1XGO A;  1FBQ A;  4KIF A;  3RKW A;  3HSF A;  2AO9 A;  1XCB A;  3LAP A;  2A07 F;  2A6T A;  3RKY A;  2VE8 A;  2M3A A;  3QWL A;  4Q48 A;  1XGN A;  4ANJ A;  2EQR A;  2GIZ A;  4M6Y A;  1O57 A;  1FP1 D;  1WFX A;  5EDN A;  1TQM A;  1GLN A;  2DO7 A;  1YQA A;  5E1X A;  4GYG A;  3RKX A;  2ZXJ A;  3KEQ A;  3RCO A;  2IT0 A;  3OMY A;  3VB2 A;  1R00 A;  2K02 A;  4L9T A;  5DYM A;  3RPU D;  1XCV A;  3B6A A;  3ABM H;  3IAM 2;  1J75 A;  3A2K A;  3F3X A;  2RRE A;  1ZRF A;  2G0E A;  3LAJ A;  3GLL A;  3L2C A;  3S32 A;  1I5Z A;  2WAE A;  1ETO A;  4KMU X;  4L9J A;  5EEG A;  3SXY A;  3UR3 C;  5DTD A;  2GLO A;  2FQ3 A;  4ITV A;  4ZDL A;  1G3Y A;  4YFN F;  4ZYD A;  4N4O B;  5FKN A;  4PGH A;  4MHG A;  5CVR A;  1D8K A;  2KZV A;  3DKY A;  4Q5S F;  4DJA A;  5IOZ A;  3QU3 A;  4UUS B;  1DQU A;  2XHK A;  5LGN A;  1UHM A;  2XGC A;  5DCX A;  4WK8 F;  2A5W A;  4WX9 A;  2M0M A;  2K9Q A;  2LG4 A;  2MH2 A;  3PNV A;  3ZMZ A;  1R22 A;  3BCA A;  1YS6 A;  1IV6 A;  2BZT A;  4XOP A;  1TNT A;  3K2A A;  1JT6 A;  5D8L B;  2STT A;  4KMF A;  2MLK A;  1DP7 P;  2QVO A;  4G6T B;  4DGW B;  1Z05 A;  1BR4 A;  4UUS A;  2HTJ A;  4DW6 A;  5A2Q K;  2J5O A;  3CF2 A;  1KYZ A;  2P5L C;  2XRN A;  3F23 A;  1MND A;  3IWF A;  2HYJ A;  4HQM A;  3L00 A;  3OYF A;  2E34 A;  1VZ0 A;  2MSY A;  2Y69 H;  1ZTR A;  3G73 A;  2K9N A;  5GPA A;  4IRG A;  1D0X A;  4UXN A;  3SDB A;  1FOX A;  2QGU A;  4XN3 A;  4M3B A;  3GZ5 A;  2P0W A;  3K4C A;  3S14 J;  4BXU A;  2VIX A;  3GF2 A;  2XAQ A;  4WXD A;  5EZH A;  2IBD A;  1OLT A;  3G71 I;  2GIV A;  5CKT A;  4JBA A;  3LWF A;  1BIA A;  4HX8 A;  3ERE D;  2CG4 A;  4R8H A;  2VAS A;  2L7M P;  1L3L A;  2X4H A;  2HPM A;  3CDH A;  2WBM A;  4B48 A;  5GTI C;  3JRD A;  1HKS A;  1MBK A;  5BYG A;  5CQE A;  4ZJZ A;  4R79 A;  2JUC A;  1BR1 A;  1YX5 A;  5EZG A;  2LKS A;  5E3M A;  3TO6 A;  1DP3 A;  1LDD A;  2RNJ A;  3RYP A;  1VQK I;  3PO2 J;  1ORK A;  1AOY A;  4HNT A;  4HNV A;  1LFB A;  5JVG F;  3R61 A;  1IUF A;  5LEK A;  3Q9S A;  3JRG A;  3FXJ A;  2QYO A;  3VWB A;  2DA2 A;  5HLG A;  4BYY A;  3HGY A;  4YIR X;  4MLO A;  1ENH A;  1K78 A;  1Y6I A;  2Y9Z A;  2HZD A;  2E36 A;  2EFN A;  3WGG A;  4CO8 A;  4ZQ9 A;  3GME A;  1YX3 A;  2QEN A;  4JP0 A;  1YIT I;  1WQ2 A;  4DYR A;  3JRA A;  3MFK A;  4OWR B;  4NHJ A;  2FSW A;  1HW5 A;  3JRI A;  4FIS A;  3RYR A;  3ZMS A;  2IAI A;  2K3P A;  4F55 A;  2LKX A;  1G8X A;  1RET A;  2DI3 A;  4LIU A;  2EFW A;  5H6R A;  5FRO A;  1YYV A;  3EET A;  4PFO A;  4V2F A;  1HXD A;  2IS1 A;  4XOR A;  3BLY A;  4PZJ A;  1E3P A;  4Z2Y A;  4MQV A;  3J7Z I;  1LKX A;  3DEW A;  5HNH A;  4I7H A;  3ZP5 A;  5KK1 A;  3GZN B;  3BZC A;  1TTY A;  4M3E A;  4XKW A;  3F8F A;  1S72 I;  3ZMV A;  3ZPL A;  1H8A C;  1MMS A;  1HC8 A;  3X2Q H;  4BXX J;  1HKT A;  3K4N A;  2HKX A;  4KIG A;  4ON0 A;  3ZMU A;  2VLA A;  1I3A A;  2KFD A;  5CVJ A;  1TWC J;  4CSW A;  4PSW A;  2B9S A;  2EIM H;  4HEA 2;  2HEO A;  5IT9 K;  4M71 A;  1D5V A;  1XDU A;  4DZJ A;  3RTR A;  4BQN A;  2ESN A;  1V5E A;  2OCE A;  2DBB A;  4EM2 A;  2NS7 A;  4LD5 A;  1Y8Q B;  3T8T A;  3V7C A;  4ZYH A;  5BQT A;  4LIF A;  4L0Y B;  1IN6 A;  3K70 C;  1P4A A;  1IXC A;  1U2W A;  2F5D A;  2XGE A;  3NRV A;  2LY2 A;  1UMQ A;  4EM0 B;  1LEA A;  3CCY A;  2ELJ A;  2HYG D;  4BJT A;  3L2U A;  3F6V A;  4HNU A;  3UKG A;  5J4V A;  3DXJ F;  4PCQ A;  2XGX A;  4L9V A;  1R9W A;  3JRH A;  3J7A Y;  2CUF A;  3OIO A;  2XAH A;  4IVN A;  3KP3 A;  3OSG A;  2BYV E;  4B09 A;  1HBX G;  4RM3 A;  2PJR B;  3D5L A;  3WE3 A;  4MQ9 F;  3I71 A;  3IL2 A;  1MH3 A;  3SFZ A;  3WTV C;  3OYG A;  3CLQ A;  1O3T A;  1XGM A;  1MGT A;  1JUS A;  4PDK A;  4EJU A;  1OIS A;  2XAF A;  2F4I A;  3RIR A;  1IJW C;  4NQW A;  1WKM A;  1W0T A;  1JUM A;  4HV5 A;  2ME6 A;  1VFC A;  2H6B A;  1FYK A;  4A5M A;  4L18 B;  2PX9 A;  2EFP A;  4MIM A;  3BCB A;  1P7I A;  2QLZ A;  2IRF G;  4EJV A;  5ILU A;  2BHY A;  2LBF A;  5FKM A;  4HV6 A;  1ETK A;  4UHT A;  2PI0 A;  3ERM A;  3S1R J;  4X0G A;  2NAZ A;  4XNF A;  3P9I A;  2D1V A;  4AC0 A;  3QQA A;  4LB5 A;  2A68 F;  2KIF A;  4FTH A;  3HHH A;  3JTG A;  4E7S A;  1A31 A;  1UHS A;  3L09 A;  1DPR A;  4Y15 A;  2WWY A;  2O3F A;  2QBY B;  2Q2E B;  2FOW A;  4MTE A;  2O8K A;  3CC7 I;  3K4K A;  4JYK A;  2CYY A;  4A12 A;  1C0W A;  1FY7 A;  2FBI A;  4HLY A;  2P7V B;  1UG2 A;  3R0A A;  4B4C A;  4NB5 A;  2LF8 A;  1U78 A;  2W1O A;  1QZE A;  4UB8 C;  5DM6 F;  1UHW A;  3I58 A;  4ENN A;  1MSF C;  1S5L C;  4HAM A;  1JHF A;  1IGN A;  1UEL B;  2HKO A;  2H8R A;  4ABZ A;  3K9T A;  1T98 A;  3SFI A;  2JA8 J;  2HZT A;  1VQM I;  4FT8 A;  3TP0 A;  2K27 A;  1R23 A;  2MBF A;  4KIC A;  2ELH A;  2KP6 A;  2X85 A;  1D3Y A;  3F8C A;  2OPT A;  2XF7 A;  4NC7 A;  3CES A;  4E6K G;  1Y39 A;  2HVR A;  1GVD A;  4HPQ A;  5E20 A;  1E0E A;  5IP7 J;  2RAE A;  3JSO A;  1JJ8 C;  2KT0 A;  3MEX A;  4BH9 A;  5BOX A;  4B1R A;  3CCJ I;  5H2F C;  1SMY F;  3GTO J;  2PMU A;  5L3G A;  3E6M A;  1I1G A;  5J8C A;  2PFB A;  3HHG A;  3MKW B;  5EEA A;  2M8E A;  4RLQ A;  2E5N A;  2IPQ X;  2M5W A;  1FWZ A;  1Q1H A;  1E2X A;  4G9Y A;  4II2 A;  3ZQF A;  2A3S A;  1W7P D;  4BHC A;  2LFB A;  1G2H A;  2FD5 A;  4M6V A;  3NWT A;  4GYI A;  2MD0 A;  3I9V 2;  1MMA A;  1G59 A;  2DXI A;  2D5V A;  4EEF G;  4B3A A;  1B6A A;  2FA5 A;  2GXB A;  5LGT A;  3HEF A;  1OR7 A;  1LVA A;  3LSP A;  3DEE A;  2WAD A;  3HM5 A;  3QRF F;  2B63 J;  1N77 A;  3ZOB A;  1XGS A;  4LK1 F;  5AIP A;  2OQR A;  1QHG A;  3U1D A;  1FNN A;  3FKJ A;  1QBJ A;  4XIC A;  1I6X A;  1DUX C;  5KVR A;  4XLC A;  2IGK A;  3LSM A;  3OL4 A;  1XSV A;  3K4M A;  3CCR I;  2JSP A;  1S7E A;  2EV6 A;  3CMY A;  5CQG A;  3BR2 A;  3ZMD A;  4O6J A;  5E18 F;  4CYC A;  4GXO A;  2FBK A;  2CW8 A;  2W57 A;  2LP0 A;  4EJT A;  2F6C A;  2RQQ A;  4PJM A;  4XRS G;  5F1J A;  1BM9 A;  4WCG A;  3CC2 I;  4E7L A;  1Z9C A;  1NTC A;  3K10 A;  5F0F A;  1WCM J;  2Z2S B;  5KAI C;  3ZCO A;  2EV5 A;  2KIS A;  3DTE A;  2ETH A;  5K1Y A;  1MMG A;  5GP9 A;  4F93 B;  3OYI A;  1Z67 A;  2VJJ A;  4XKB A;  3ZQC A;  4KUM A;  1VQ7 I;  1PUF A;  4KA4 A;  4HOB A;  2JUG A;  3TL4 X;  3FHN A;  5KHD A;  4HX7 A;  1ZYR F;  4HDV A;  2K7L A;  5J47 A;  4CGZ A;  3QK2 A;  3C3W A;  2ZJ2 A;  4BY7 J;  3ZR8 X;  4A3C J;  1DPU A;  5DCM B;  4GDF A;  2GAU A;  1YIO A;  5TGT A;  4DBR A;  4MFD A;  2O03 A;  3VOD A;  2KIQ A;  3WGH A;  3GBG A;  2I10 A;  3AFH A;  2ECB A;  4GGG A;  1RIO H;  3WGI A;  4A0Z A;  1MJ9 A;  1ETY A;  2BY3 A;  2ESH A;  5M5Y J;  3PSF A;  1V5F A;  4E7J A;  3CUO A;  4LMD A;  3I56 I;  4ASN A;  2A6H F;  3DU5 A;  4IXA A;  3D0S A;  4YFX F;  3ECO A;  3F6O A;  2H1K A;  3T1B A;  1SMT A;  2EV0 A;  1LUJ B;  2FOK A;  4OU0 A;  2HWV A;  1V5G A;  2R5Y A;  2ZC2 A;  3CCQ I;  5M3F J;  4E7H A;  2DFF A;  1IG7 A;  1ON2 A;  2V7F A;  2Y2Z A;  5EEH A;  4BE2 A;  1AWC A;  2HFH A;  3BG9 A;  3WHB A;  1XB4 A;  1QRY A;  5K7H A;  4J01 A;  1R7J A;  3IV5 A;  1BI1 A;  5GTH C;  3BR0 A;  3HRM A;  2LKP A;  1FLI A;  4HW0 A;  2OCC H;  4HX4 A;  3TGN A;  2XKO A;  1JT0 A;  4OIR F;  1N78 A;  1TBD A;  3WTU C;  1K7A A;  1YRN B;  3LFK A;  2A61 A;  4XRF A;  1YJ9 I;  2ZXW H;  1HW1 A;  1SD4 A;  2Z5U A;  4AVZ A;  1XMK A;  2VBZ A;  4Y33 A;  4FET A;  3CQZ J;  1XS9 A;  2VUM J;  3MWM A;  4AYB N;  3HOX J;  1ZRC A;  1ULY A;  1GV2 A;  4XLN F;  1EKE A;  2QQA A;  4G7O F;  2ZO4 A;  5DCM A;  5HVQ C;  1J59 A;  1LNW A;  2UV1 A;  4BL0 B;  4OOI A;  1HW2 A;  1K6Y A;  3C7J A;  1NH3 A;  2L9S A;  4C3J J;  3E5X A;  2M34 A;  2OV7 A;  4PJ0 C;  1IDZ A;  4ZYG A;  5CJ9 A;  3VYT B;  2DU9 A;  1LPQ A;  2P5K A;  2HNH A;  3IRQ A;  3BWG A;  5L3E A;  3FHZ A;  2FQ4 A;  2DT5 A;  2H8W A;  3TW6 A;  2UUZ A;  4A3M J;  1HDD C;  2VI6 A;  3K1P A;  3BY6 A;  2NOG A;  4A6D A;  5HLT A;  4FX4 A;  4E7I A;  2ZME B;  2QBY A;  4CCN A;  2L9V A;  4KIB A;  4ENJ A;  1H89 C;  1R9T J;  2M9H A;  4D5F A;  1TC3 C;  3WHC A;  2QKM B;  3FMQ A;  2WV1 A;  1AHD P;  4M74 A;  3W3C A;  2DOA A;  2YX7 A;  3QYF A;  4IX7 A;  1R1T A;  2L2O A;  3L7W A;  3GTP J;  1X19 A;  4V2G A;  1YE9 A;  3VPR A;  1FIA A;  4XRS A;  2DOE A;  4BE1 A;  2CGP A;  1U3E M;  3FM5 A;  3BTI A;  1UST A;  3SDG A;  4RB0 A;  1SAN A;  2BY2 A;  2HVQ A;  1GVJ A;  2IP2 A;  3IH3 A;  4BU2 A;  4R1H A;  4ZTJ A;  2VKH A;  2EZK A;  3LQQ A;  1T0F C;  4YII A;  3OYC A;  3OIP A;  1XTA A;  1REP C;  4UVA A;  4E7Z A;  2HW0 A;  3W2V A;  2L7K A;  5L3C A;  2BY1 A;  1OJL A;  2WAF A;  5D4S A;  3AL0 B;  2CQ7 A;  1G3S A;  3PO3 J;  1BA5 A;  2RKH A;  5E3N A;  2LD5 A;  3EYI A;  4RB3 C;  1OFC X;  1P4W A;  3BZK A;  5GAG J;  2NOJ B;  1ON1 A;  4KDP A;  1ONV A;  3I54 A;  5KAF C;  2COB A;  3FMS A;  3G1O A;  3I0T A;  3HOV J;  3GTM J;  3KZI C;  2IGN A;  2M30 A;  3KLO A;  3H9J A;  4G12 A;  3I55 I;  2EZI A;  5TJJ A;  2VKE A;  2LBF B;  3LMM A;  5LFA A;  2CQQ A;  1E3O C;  4BDZ A;  1CF7 B;  3HOY J;  2HGC A;  4FCY A;  1MBJ A;  3QPH A;  5J3L A;  2Y9Y A;  1Z21 A;  2O7O A;  3Q3S A;  2DK5 A;  1T38 A;  3PL8 A;  1W5S A;  4PGG A;  5FLV A;  2AQE A;  1Q1V A;  2MG4 A;  3BR1 A;  3VYU B;  4U0Y A;  3H3V K;  5FB2 A;  1TWH J;  5FLX K;  2OZU A;  1LEB A;  4DYQ A;  1VI0 A;  2H94 A;  2K86 A;  2HOA A;  3OL3 A;  3MQ0 A;  5LD2 C;  3BG5 A;  2G9W A;  1BJA A;  5D4R A;  4EJO A;  1UFM A;  2NNN A;  2V9P A;  4J19 A;  3FK6 A;  3QU6 A;  3QYE A;  3W2W A;  2AXT C;  1IXS B;  4A6E A;  3I4N J;  1XN7 A;  1F36 A;  2M7A A;  1VQ9 I;  4HF1 A;  3M1C A;  2IA0 A;  2V1D A;  2ZNY A;  1HSJ A;  3ZGK A;  3CDL A;  5K5Q A;  1KQ0 A;  3DBR B;  1XD7 A;  4V19 K;  3ZQL A;  4BKX A;  2EWN A;  4HBL A;  1D1C A;  1SVL A;  4RAY A;  5F04 A;  4HZF A;  4BDY A;  1J5Y A;  1FP2 A;  2ZSI B;  4BHB A;  4LLL A;  1MNE A;  2EPF A;  3CF5 F;  2EK5 A;  1D1B A;  1K83 J;  2JWT A;  1CF7 A;  2V9V A;  3CTA A;  2JSC A;  1SC7 A;  4P96 A;  3BR3 A;  4O5V A;  2XB0 X;  2PJP A;  2OU2 A;  3HOZ J;  3D5S C;  1S29 A;  2M45 A;  3COA C;  4FGN A;  3M8F A;  1KYW A;  3LOC A;  4Y4R A;  1J7K A;  1OCR H;  3S3N A;  4XON A;  3CCL I;  2FF4 A;  2G7U A;  4IHT A;  1CGP A;  2JK3 A;  2NTC A;  5ILS A;  1JGG A;  1KSY A;  3A02 A;  2K9S A;  3ZQG A;  1X3W B;  5D5W B;  4D1Q A;  2ITJ A;  1MMD A; 
#chains in the Genus database with same CATH homology
 2BVL A;  2M7B A;  3HKZ A;  1UUT A;  2CW7 A;  1SFK A;  2XDV A;  4P1W A;  4LIF A;  1D0Z A;  3S3O A;  3K70 C;  5HNF A;  1LFP A;  4NNJ A;  4KT6 A;  1R6R A;  2PJR A;  4B3X A;  1TT0 A;  2LY2 A;  2VJ4 A;  3QOD A;  4LIT A;  1IRX A;  1X4O A;  3EPZ A;  3OYE A;  2Z1D A;  2E5Z A;  2ELJ A;  4BJT A;  3L2U A;  4E4H A;  4HNU A;  1X1C A;  2VKD A;  2WAQ A;  3K70 D;  1R9W A;  2FUG 2;  4PJN A;  4OAY A;  2CH0 A;  3J7A Y;  2VB6 A;  4P5O A;  4C2T A;  1LDK B;  4GRI A;  2LRE A;  4Y3O A;  4RM3 A;  1QHH D;  3HPH A;  4PJJ A;  2PJR B;  3D5L A;  2CUZ A;  2CFO A;  2RNG A;  3LSK A;  3OYG A;  2AQF A;  4IZZ A;  4B43 A;  4JOM A;  2F4I A;  3N05 A;  3PSI A;  2MFZ A;  3RQ4 A;  4BJ5 C;  2HVS A;  3EUA A;  1KSX A;  3HOS A;  4BUP A;  3BCB A;  3ONQ A;  4NBP A;  2GOM A;  3H5A A;  4H4K C;  4BXF A;  2V4J C;  3C2G A;  2LBF A;  1WJF A;  2X6Y A;  2XSJ C;  3BG7 A;  4C9Y A;  1WJD A;  4X0G A;  1L5I A;  1WJB A;  4XNF A;  4XN0 A;  3IP4 B;  2HU9 A;  2DCE A;  3A4C A;  2Z16 A;  3PNY A;  4RM2 A;  3SZG A;  4J00 A;  4ZYA A;  2BOL A;  3H5N A;  2VQC A;  3PFY A;  1P9Q C;  1S9H A;  4E7S A;  2WY7 Q;  3OIQ A;  2W4S A;  2BW3 A;  2IGM A;  2V26 A;  2R7V A;  2DT6 A;  2Q2E B;  3G2B A;  3K4K A;  2IS2 A;  2OC6 A;  4YEL A;  2KRH A;  2KLO A;  1MMN A;  2R7X A;  1WJC A;  2E1M C;  3L2V A;  2XC7 A;  2X6W A;  2W1O A;  3QFQ A;  2Y0S A;  2VL8 A;  1FMV A;  4XLA A;  1MW7 A;  3E1S A;  1UEL B;  2MC4 A;  3D5R C;  4CZC A;  2R7O A;  4XOT A;  2LY1 A;  3IAS 2;  1T95 A;  3OYL A;  2KP6 A;  2X85 A;  1LVK A;  2K9L A;  3DQV C;  2ZSH B;  3OY9 A;  2XF7 A;  3BC8 A;  4NC7 A;  3CES A;  3V42 A;  4DOZ A;  4E6K G;  3A1Y A;  4XM3 A;  2HVR A;  4HPQ A;  2KDO A;  3SYT A;  3AKZ A;  1E0E A;  3H35 A;  2W00 A;  4ZDP A;  4EAT A;  2X6X A;  2JVG A;  3MKW B;  2DT7 B;  2VJI A;  2BW3 B;  4BGD A;  4RLQ A;  5JHF A;  3LSG A;  2E5N A;  3OYJ A;  2M4G A;  4C30 A;  3OYK A;  5HOO A;  2O5R A;  3C2H A;  3I3L A;  1DGW Y;  4II2 A;  3OR2 C;  1Z1D B;  3AL0 C;  1U0J A;  2CV2 A;  1WJE A;  1Z3Y A;  2CMP A;  5CPR B;  3NWT A;  2FUF A;  2MD0 A;  2KPM A;  1MMA A;  3I9V 2;  2WY8 Q;  4CCL A;  1Z7L A;  1G59 A;  2DXI A;  2I8D A;  2VQL A;  3LSI A;  4JQF A;  1X1D A;  2R7T A;  3DEE A;  2WAD A;  3TBI A;  2LYC A;  5CYN A;  1SAU A;  1N77 A;  1PJR A;  3W2A A;  3DTK A;  1M55 A;  3K6G A;  1QHG A;  3KEY A;  1WJA A;  2W82 A;  3FKJ A;  2ZFU A;  4HSR A;  2IPR A;  4HG2 A;  3HC7 A;  3PJR A;  2E60 A;  4XLC A;  1N75 A;  2IGK A;  3LSM A;  3CMM A;  2X51 A;  3OL4 A;  2CV1 A;  3EUK L;  3K4M A;  2XF6 A;  2JSP A;  4CCK A;  5CQG A;  3OYM A;  3K4J A;  2GOX B;  1KON A;  4XLH A;  3VSL A;  4KIS A;  2TBD A;  2CW8 A;  1HA8 A;  2R4G A;  3KX2 A;  2F6C A;  2RQQ A;  1J09 A;  4PJM A;  1OR7 C;  4CCM A;  4RLF A;  4C2U A;  2VXZ A;  1ERD A;  2R7R A;  3H0D A;  4E7L A;  4XLE A;  4IQJ A;  4NQW B;  2XAU A;  3K10 A;  4XR6 A;  5D9I A;  2Z2S B;  3VYR B;  2DJI A;  2LOO A;  3ZCO A;  3DTE A;  1MMG A;  3K4B A;  2HPI A;  4F93 B;  3OYI A;  4FAS D;  4XKB A;  2VJJ A;  1TZL A;  4B47 A;  4ZTF A;  2JUG A;  1F08 A;  1W36 D;  3TL4 X;  3FHN A;  5KHD A;  3MD2 A;  4NC8 A;  3K4L A;  3H9Q A;  4IKF A;  4KIT B;  4E7K A;  4XKC A;  3NWS A;  3QK2 A;  3ZR8 X;  4HRI A;  4QPQ A;  4AU7 A;  3E0J B;  4GDF A;  1D1A A;  5TGT A;  4DBR A;  3HPG A;  3L2Q A;  1Y56 A;  4LIV A;  4PJL A;  3QN2 A;  1UG0 A;  4DBQ A;  3GBG A;  4FB3 A;  3AFH A;  2VQH A;  2R7U A;  1RZ9 A;  1X4P A;  3PSF A;  1V5F A;  3S8P A;  4XL9 A;  3U21 A;  4F92 B;  4E7J A;  2L5Q A;  1NG7 A;  4LMD A;  2KHM A;  3DU5 A;  3CP8 A;  4CH7 A;  5KNL A;  4YRV A;  3KYL A;  2M4K A;  2E1M B;  1WJ5 A;  2VQG A;  3DU6 A;  1V5G A;  3OR1 C;  3QYB A;  4E7H A;  2MYS A;  3F9K A;  2V7F A;  2V9K A;  4KW3 A;  4BE2 A;  3SEZ A;  2IS4 A;  2ITL A;  3H9G A;  4J01 A;  2R7S A;  3HUG B;  2W7N A;  2A6T A;  3FDY A;  3DPU A;  1QU3 A;  3M8J A;  2LC2 A;  2M3A A;  2X1D A;  4ANJ A;  1N78 A;  1TBD A;  1WFX A;  3S3M A;  4ZO0 A;  1GLN A;  2K5C A;  2X1C A;  3DTI A;  4AVZ A;  2XF5 A;  4Y33 A;  4FET A;  1AA7 A;  3RCO A;  4PK4 A;  3CP2 A;  3OMY A;  2K9M A;  3OS1 A;  5HVQ C;  1L2M A;  2UV1 A;  4BL0 B;  1K6Y A;  4II3 A;  4XLF A;  4F91 B;  2KRC A;  2L9S A;  3RPU D;  5FRN A;  2OV7 A;  4PSX A;  3IAM 2;  3VYT B;  3ZRG A;  3DPL C;  4QPO A;  4D9J A;  4HST A;  4BE0 A;  3A2K A;  2HNH A;  3TMO A;  2RRE A;  1X1B A;  2UUZ A;  3S32 A;  2BVM A;  2WAE A;  2CS3 A;  3CJR B;  3UR3 C;  1W36 C;  4ITV A;  2NL8 A;  2IXS A;  4ZDL A;  5HLT A;  4E7I A;  4N4O B;  4XQF A;  2KZV A;  4CCN A;  3DKY A;  4DJA A;  1DQU A;  3LFU A;  2QKM B;  2MAB A;  5DCX A;  1DGR M;  2OUM A;  3W3C A;  2DOA A;  4IX7 A;  3QYF A;  1JI8 A;  4ZC3 A;  3VYS B;  2IGO A;  2A5W A;  2L2O A;  2M0M A;  1X19 A;  1ZEL A;  3MMY B;  1YE9 A;  3L2R A;  2LG4 A;  2R7W A;  3PNV A;  3BCA A;  4XOP A;  4BE1 A;  4IQ4 A;  4BQQ A;  2ZXH A;  2V6E A;  3PNT A;  2IF9 A;  4G6T B;  4DGW B;  3L2W A;  2HVQ A;  1BR4 A;  3HL2 A;  3OS0 A;  4BU2 A;  4LG3 A;  3LL7 A;  2VKH A;  4ZTJ A;  1NG6 A;  1T0F C;  3MKZ A;  3CF2 A;  3OYC A;  3CJQ B;  4AYB A;  5FRM A;  2X1E A;  3OIP A;  4ZDO A;  4OAZ A;  4E7Z A;  1MND A;  2HW0 A;  3W2V A;  2L7K A;  2CUJ A;  2WAF A;  3AL0 B;  3OYF A;  1BR2 A;  1VZ0 A;  3SDB A;  1D0X A;  1Z3X A;  3OYA A;  2Q1Z B;  4XN3 A;  2NOJ B;  3OYB A;  1X1A A;  2P0W A;  3K4C A;  3SEQ A;  1UAA A;  2IGN A;  3H9J A;  3LSH A;  3FBN B;  2PMZ A;  2VIX A;  3CZ6 A;  2JVH A;  3PUB A;  1OLT A;  2LBF B;  5CKT A;  3LMM A;  4KJZ A;  5LFA A;  4BDZ A;  2F5V A;  5KCM A;  2WA0 A;  4NUB A;  2VJ5 A;  2VAS A;  2L9N A;  1Z21 A;  2KQR A;  2VXD A;  2V1N A;  2QKL B;  2HPM A;  2WBM A;  3OS2 A;  4B48 A;  3PL8 A;  5BYG A;  3IUO A;  3EUH C;  5CQE A;  4ZJZ A;  2AQE A;  3H5R A;  1BR1 A;  4R79 A;  2LH9 A;  1YX5 A;  3VYU B;  4PUS A;  1DP3 A;  1BOB A;  4BAC A;  2HQA A;  4F3Q A;  3OL3 A;  4XKV A;  4HNT A;  5LD2 C;  2R7Q A;  3DWL E;  3VWB A;  3RSN A;  3QYE A;  3W2W A;  2KL4 A;  2M7A A;  3QOE A;  4CUG A;  4MLO A;  3M1C A;  4BEH A;  1Y6I A;  2HZD A;  4BQO A;  4CA0 A;  3OYH A;  2CV0 A;  4ZQ9 A;  4U87 A;  3ZGK A;  1YX3 A;  3ZQQ A;  4BS9 A;  4DIQ A;  3HG9 A;  1EA3 A;  2HDW A;  4OWR B;  2UWM A;  4CCO A;  2K3P A;  2WB1 A;  4F55 A;  3DKX A;  2KMU A;  1G8X A;  1D1C A;  4LIU A;  4BDY A;  4PFP A;  2VPL A;  3HOT A;  3UNG C;  5FRO A;  3OOU A;  2ZSI B;  1MNE A;  1PYV A;  4PFO A;  3S93 A;  2IS1 A;  4XOR A;  1D1B A;  3BLY A;  4BEH B;  3FBI B;  3OWT A;  4F52 A;  4B44 A;  3OYD A;  1D0Y A;  1LKX A;  3D5S C;  3DPT A;  4RMN A;  4CCJ A;  4BJ6 C;  4YEJ A;  5HNH A;  4FGN A;  1FMW A;  3MKY B;  4XMY A;  4XKW A;  4Y4R A;  3HXL A;  3DLA A;  3VDX A;  3S3N A;  4XON A;  3VSK A;  2NTC A;  4N4N B;  3ZXS A;  3K4N A;  1KSY A;  2VLA A;  2ZXI A;  4CSW A;  4PSW A;  2JA2 A;  3BG6 A;  4HEA 2;  2IS6 A;  3RTR A;  2LRD A;  3OYN A;  4D1Q A;  4BQN A;  4U7B A;  2ITJ A;  1V5E A;  1MMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...