3DKXA

Crystal structure of the replication initiator protein encoded on plasmid pmv158 (repb), trigonal form, to 2.7 ang resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
202
structure length
202
Chain Sequence
KEKARYFTFLLYPESIPSDWELKLETLGVPMAISPLHDKDKSSIKGQKYKKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLTHESKDAIAKKKHVYDKADIKLINNFDIDRYVTLDVEEKTELFNVVVSLIRAYTLQNIFDLYDFIDENGETYGLTINLVNEVIAGKTGFMKLLFDGAYQRSKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein repB
publication title Plasmid replication initiator RepB forms a hexamer reminiscent of ring helicases and has mobile nuclease domains
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Replication
total genus 52
structure length 202
sequence length 202
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01719 Rep_2 Plasmid replication protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dkxA02
3.40.1310.30 Alpha Beta 3-Layer(aba) Sandwich Replication Protein E1; Chain: A, Replication Protein E1; Chain: A, 3dkxA01
3DKXA 4U87A 3DKYA
chains in the Genus database with same CATH superfamily
3S32A 3ZQIA 3E1SA 1GUUA 2IGMA 1MBHA 2RC4A 3EUAA 3IAM2 2VJIA 4HSRA 4E7HA 1S7EA 2VJJA 2R7OA 1FT9A 2XAHA 4W97A 1UG2A 3HPGA 5FKKA 4HNVA 4EM1A 3Q0UA 4IHSA 4IPAA 1Z6TA 2JSCA 2ZXJA 4NUBA 4WX9A 3CQZJ 3S3OA 1R4MB 5CYVA 3JAMK 1L0OC 4RGUA 4UXNA 5LEJA 2L5QA 3ABUA 2A68F 3QPSA 4OU0A 4YFKF 4L18B 2LNBA 1F1ZA 3JSOA 1H88C 2E7WA 4EJWA 2ID3A 4IZZA 2X9DA 3BJ6A 3ZQLA 4IRHA 3L1PA 4B09A 1JTXA 1ULYA 2KDOA 1A36A 2ISZA 3BPVA 1QPMA 2NOJB 4XM3A 5FLMJ 2QGUA 3P9CA 4ZTJA 4XN0A 4UUSA 4L5IA 4BAYA 5FLVA 3BJOA 2IEKA 4EJVA 3PIPF 1RETA 5DS9A 1OCRH 1I39A 3C3WA 4KJZA 4RAGA 1FSHA 9ANTA 1REPC 3I58A 4EM2A 4P5OA 3F72A 3FKIJ 3DTIA 1SFEA 4S0HB 4DOZA 2A05A 2O8XA 3RKXA 1V4RA 2XAQA 4XQFA 2FE3A 1SVLA 2VXDA 3KEOA 2W48A 2EH3A 5B3SH 1TWFJ 4CCOA 1P9QC 5GAGJ 3CJTB 3U21A 1QQIA 1RC9A 1XCBA 2JZYA 5F64A 1U78A 5CYNA 2W85A 3C2BA 2HQRA 2Y30A 1YI2I 2VQLA 3H1CA 4LG0A 3WGIA 1Y8RB 3QPTA 1G3TA 5DCMB 4H4KC 1S72I 1SD5A 1W36D 1T0FC 3N05A 4M3BA 4GCVA 1DP7P 2LC2A 3ZQFA 3A01A 4M3FA 1JKOC 3KFWX 1QZEA 4U88A 2HPMA 3CO6C 1R9WA 3W6VA 4AYBN 1OR7C 3F21A 5KK1A 2LKSA 1TL8A 3J7ZI 3KP5A 5C4XJ 2F5FA 3OSFA 1Z1DB 3HHHA 4KMUX 4BDZA 1BI3A 2LOOA 1DPUA 4XRMA 2HDDA 4ZDPA 3VSKA 1XDUA 3QODA 4DZPA 4Y7NJ 3TOAA 1R1TA 3KYLA 4M6VA 1OYWA 3H5RA 3KP7A 3G73A 3E6BA 2CYYA 3A0BC 1MZBA 5H20A 2X1EA 4NHJA 3MKZA 4D5FA 2EFQA 2L3DA 2NYXA 2E19A 4I0BA 1F5TA 4JYKA 4ZYHA 2HVSA 2WWYA 2JK3A 2LKPA 1AHDP 1WH5A 5HLGA 2FD5A 3D5RC 1XSDA 2F5CA 4KIFA 1P4AA 5HDKA 5D8KB 2PMZA 3GXOA 2OCEA 4NQWB 4L9NA 4WXCA 1APLC 1MGTA 1JI8A 1X1CA 1CQTA 4D0PA 3FKJA 1YYVA 2HW0A 3PL8A 2XAGA 3BLYA 5KHDA 1ERDA 5L3EA 3M3YJ 5FKMA 5FLXK 4FE4A 2NS7A 4KYWA 4ZO0A 3LQRA 4B8XA 1B72B 2OUMA 1QZZA 1I1SA 1RRJA 1ENHA 2EJRA 2YX4A 3PM1A 4CCKA 2H6CA 1V54H 2W24A 4BE2A 2RDPA 3CP8A 2DFEA 1FEXA 3BR6A 2EIKH 4IQ4A 2BBYA 2OTLI 3HL2A 1VQ4I 1SD4A 2IGOA 4U0YA 1XTAA 5BS6A 2L2OA 3R61A 2ZSIB 2IAIA 1X1AA 1WHUA 2ZXIA 3HC7A 4FX0A 4AUXA 1OCOH 4D7MA 5ILVA 4GXOA 3VYTB 2X1DA 2WB1N 1BR2A 1TWGJ 2L54A 4N4NB 3BG9A 3M8EA 3CDHA 4EJTA 1KONA 2PI0A 1IXCA 2A6HF 2NNNA 4M9SA 1P4XA 1F36A 1T98A 2HKXA 2QSHX 1UELB 3DFGA 1IV8A 5M5XJ 2UXXA 3HRSA 4MIMA 3RPUD 5EGOB 2R7RA 4E7LA 2ZMEC 2R7XA 2YX7A 3G2BA 3LA3A 4BY7J 4MTDA 4A5MA 3M1EA 3S2DJ 2ISYA 4L5EA 4S04A 5L3CA 2P5VA 3WG9A 2KZGA 3CMAI 2H6BA 3IUOA 1ZYRF 3CTAA 5C3EJ 3BTCA 5LHGA 1ZRCA 4A3IJ 3V8LA 4RBOA 1J2XA 3CCLI 1YIOA 3RI4A 1YIJI 3LA7A 1MD0A 2FU4A 1GV2A 4V2FA 3EQLF 1U5TB 1BC8C 4M6YA 1XC5A 2EZIA 4CHUA 2QWWA 1TBDA 1G3YA 1VQ9I 2VI6A 3O8GA 3CUOA 2VLAA 3WTSC 1JUSA 5TISC 3VSLA 1G2HA 5GTIC 2DA5A 4II3A 3WE3A 1LQ1A 3Q9SA 5HDGA 1PUFB 2H8RA 1IN7A 2Y9YA 4XMYA 3RCOA 2MABA 5JR3A 2E1CA 1AWCA 1R58A 3BZCA 2P4WA 1O7FA 4HPQA 4I76A 3E97A 3TDZC 3TP3A 3WG7H 4PSXA 3FISA 3DWLE 1YLFA 5JLWA 3UKGA 2CQXA 2VUMJ 1U2WA 1QGPA 2QQ8A 2DMNA 1YO5C 1FJLA 2IGKA 3F0CA 3KE2A 2KDZA 5BNGA 5F6FA 1PDNC 4HV5A 2FNPA 2O7OA 3PUFA 2OJED 4MEYF 2DLLA 4WK8F 1P7JA 4LB6B 1G6NA 5J3LA 1L3LA 4FETA 4N9HA 2BW3B 3GTPJ 2CGPA 4KW3A 3TP0A 1DU0A 1T56A 1ZAOA 2ZJQF 4QTRA 3R0AA 1XB4A 1GXQA 1T38A 4DYCA 5FB2A 2YU3A 4KA4A 2DCEA 1GVJA 4C30A 2DXIA 2O0YA 2KP6A 3TO9A 2D5VA 3PFIA 3RKQA 4X1EA 3C18A 2R7WA 2UUZA 2GOXB 3LSJA 1R00A 2DFFA 1KU9A 3CCSI 1FBSA 4ESBA 4BHPA 5D5VB 2LD5A 4LIUA 2E35A 3QP5A 1ZG3A 3MZHA 1UMQA 2DMQA 4P9FA 2CG4A 3OYHA 1U6GA 4BH9A 2WY8Q 1I50J 1RNLA 2ID6A 4S05A 3TEDA 3QPLA 5B66C 1W7PB 3QU6A 3V7RA 1FOWA 4I2OA 2GQQA 1A6QA 1MW7A 4ENNA 2WV1A 5CJ9A 1UJ8A 3OS2A 3S17J 4GFBA 2OQGA 3VYSB 2HI3A 3JCUC 3TOBA 3FDYA 2X0LA 3S2HJ 3OYCA 2O3FA 3HSFA 2EQRA 2LTPA 5IYBJ 5M3MJ 5ILUA 2VOOA 4I02A 5FO5A 2MLGA 3MKLA 4U0VA 2BY3A 4UUVA 3PNYA 2XKOA 5DCMA 1MBGA 4BY1J 1SD7A 1KQ9A 3RIRA 3I4MJ 1VI0A 3SZTA 2A3SA 2MH9A 2DMPA 3BY6A 1D3YA 3RSNA 5HS9A 5JVTA 5BPIA 5JFRA 2IJLA 4LLLA 3SDGA 2JA6J 1IW7F 2XDVA 3OYKA 4RB2C 5DDGA 4XLFA 1N75A 1XSXA 5L3DA 2K9SA 3MN2A 3ZMTA 1WSUA 2DAOA 2AXTC 3CJQB 1VQPI 1Z1DA 4MTEA 3I59B 4A3JJ 2EA4A 2UV1A 1BN5A 3PNTA 3MWMA 1X1BA 5FROA 3I3LA 1FLIA 2XSJC 3HOTA 4WF2A 3TW6A 4YG2F 3X2QH 2J5PA 4HF0A 2NOGA 2KIMA 3W6JB 5L3GA 2DO7A 2FQ4A 3C2HA 1IXRC 2ZXWH 1U8RA 1E0EA 2JA8J 3DU5A 2IS2A 4BEHB 2TDXA 3OIOA 2XPWA 5IPAA 3RYPA 3K69A 2R92J 1LFBA 4KMFA 4ZYAA 2K9LA 4BGDA 3OYAA 4XLEA 4KNYA 2BOLA 3KEYA 2VBYA 3V7SA 4IHXA 1BW5A 1WRJA 1VQKI 2JRTA 2WA0A 3CDLA 2WTEA 2HOEA 5E8GA 2VKHA 2DA4A 1ORKA 2XGDA 4XRSA 4NQWA 3JW4A 1W5SA 2F5VA 3GBGA 3DBHB 3GW2A 1PYVA 1HSTA 2F4MB 3GFLA 4A3KJ 2FA5A 3G71I 1MDMB 4AIDA 1SVMA 4LMDA 1DGRM 2CUZA 3K4MA 4PJ0C 1HW2A 3C7JA 1XX5A 3D5SC 1DUXC 3S1NJ 2QQAA 2JUCA 3ML6A 1R22A 3OYJA 4FQGA 3G1OA 3DBLB 5EZGA 1UAAA 5K7HA 2BYVE 1LDKB 4LK0F 2IW5A 2R3SA 2IS1A 4GO1A 2HPIA 1K78B 1D8JA 3WGGA 4HDUA 2O8KA 1FBUA 2AO9A 4ENJA 3B73A 1HLVA 2FNAA 4IRIA 3J7AY 2DI3A 2HQ5A 4A0XA 3GFIA 1ZKGA 1RZ4A 3M9AA 2LR8A 2AXLA 5IOZA 4WWCA 5KNLA 3Q0VA 3PSFA 2NVYJ 3PNVA 3BG5A 2OV7A 5F0CA 5EGOA 3O8HA 4Y52J 1XGSA 4G9YA 1PP8F 1PJRA 1K4SA 3K4KA 4WXDA 2KRCA 3K0LA 3SDBA 4ZYEA 4EQQA 2L9VA 5IYDJ 3CCJI 2JN6A 3EPZA 1Z7LA 2FBIA 2VT3A 1ZRDA 2PQ8A 1K6OA 2G7HA 1T33A 3SXYA 4JX4A 3ZQGA 2R7FA 1OJLA 3ELKA 4MQ9F 1W36C 2K9MA 2W82A 1I1GA 2HS5A 4M3DA 3HXLA 2PX9A 1LJ9A 5D6EA 1M55A 5LGUA 2V1UA 1MMNA 3MZYA 3OYNA 2NXNB 3OIPA 2ZJ2A 2RNGA 3HSRA 2E71A 1S29A 3F3XA 2XRNA 3MKWB 1PP7U 1PUFA 4CO8A 4CGZA 2E1NA 1OLTA 4BNCA 1Z0XA 1P4WA 2C6YA 2ZMEB 2RN7A 4B44A 1R9TJ 3KEQA 2VPLA 2HWVA 3IH2A 5GPCA 3CC7I 3LFKA 4LG3A 5DM7F 3M8FA 2L02A 1VF9A 2JWTA 1NK3P 3L2CA 2A61A 4DYQA 4OAZA 3MKYB 4CCLA 3FMSA 4F91B 2LY2A 1Z9CA 1Y6IA 3CMMA 4YRVA 4LK1F 2O9LA 2BW3A 3RKWA 1HOMA 3ZMSA 1BW6A 2A5YB 5DTDA 2CQ7A 3HUGB 2H1KA 2XGCA 2P7VB 1MMAA 4I98B 2FJ1A 2DJNA 3WHCA 3F22A 2K4JA 3BTLA 2M9HA 3FK7A 3NAUA 4XLNF 1D5VA 1I6XA 4R1HA 4KIBA 5DYMA 1MBFA 3BJAA 2L9RA 1MSFC 3M07A 1WJFA 1W7PA 1E2XA 5K7ZA 1R5ID 1YRNB 2M1BA 2EFPA 2RAEA 3EUKL 1QO0D 2XF5A 2YU9J 2O61A 2VASA 1IC8A 3LA2A 2L4AA 4XOTA 5F1JA 4AWXB 3GTGJ 1ON2A 2Q1ZB 3LSTA 3GX4X 2XGEA 2BY1A 2K4BA 2DODA 3N4MA 2QSFX 2P0WA 3LSRA 4N0BA 3PUBA 2ME0A 4HX4A 4ZZDA 1Y8QB 3OS1A 1WJCA 2VOPA 4KFCA 2DA6A 2FBHA 1R4NB 2LG4A 1TQIA 1VQ6I 2R7QA 1NH3A 4OAYA 4ON0A 4B47A 2E1MC 5DEQA 1RI7A 2ZFWA 3Q0WA 2Q8KA 1QBJA 1UCRA 5EJCA 4C3HJ 2MGQA 5DUIA 3K1MA 4G6TB 3GCMA 3GFJA 3IRQA 2FX0A 3OYDA 4PCQA 2FQ3A 1IN6A 4BQAA 4HX7A 1V55H 2LF7A 2JMWA 4CXFA 1LEAA 4C2UA 3DPTA 4EGYA 1XMXA 2QQ9A 4XLHA 2MG4A 3H3UA 1D8KA 2QUFA 3HGYA 3O3KA 3OYBA 2DMUA 3GO5A 3I59A 4DBQA 2DMTA 5TRDA 4Y13A 1ZELA 2KKOA 5HNFA 4IRGA 2FXAA 2EILH 5IY5H 1LUJB 4A6EA 2MFZA 4PSWA 2Z5UA 3FF5A 3JREA 4M73A 3K4JA 3N97A 2QCOA 1B9NA 3FHZA 4QPQA 4IOCF 4Y15A 2WV0A 2DT7B 2H1LA 4FE7A 4ANJA 3S93A 3QPHA 3U9GA 4Y4RA 1I6HJ 2X6XA 2R5ZA 4X6AJ 3GMEA 4PJMA 1R49A 2CFOA 4BEHA 4OMYA 1RKTA 1VZ0A 2PFBA 5F08A 1W4MA 3EYIA 3R0JA 1E3PA 2K3PA 3CZ6A 1T0FA 3QQAA 3JRDA 1LVAA 4DNCA 3M1CA 4A0YA 2M0MA 5KAIC 1MMDA 2B0LA 4EJUA 4D7NA 2Q2EB 4J00A 1MNDA 1Z6RA 1EH8A 2LKXA 3BC8A 4ZC3A 3KYDB 2Y0SN 1ZK8A 3CUQB 3DEEA 5H2FC 5C4JJ 4RLFA 4HSTA 1JE8A 1J59A 5E79C 5ED4A 2CFXA 2ELKA 4PFPA 1TWAJ 1QNTA 2VODA 3IH3A 4PJNA 1MDMA 2HTSA 3HSEA 1JT6A 2VKDA 3NWSA 4RGXA 3DPUA 4BQNA 4BBSJ 1WZ2A 3DBRB 5LEKA 2VQCA 3GFMA 3I71A 3K4CA 2TCTA 3C1DA 3W3CA 4A3FJ 2EZLA 2GAUA 4M3GA 1DDNA 3H9QA 4RGSA 4UY8I 3DLAA 1VQ8I 4Q5SF 4BS9A 2W4SA 4LIFA 2B7EA 3RKYA 1K78A 1B59A 3BWGA 5EEGA 3I56I 2JA5J 1IZ1A 4LLGF 2IA2A 2H09A 1A5JA 1CGPA 2P6SA 2IA1A 3W2VA 2HVRA 5GAHJ 2L7KA 4Z2YA 4PGGA 5DCFA 3P9IA 3PJRA 4QLCU 2Z3YA 2K02A 1FYMA 4U0WA 4ITVA 1KQ8A 2LP0A 1MBKA 2ZSHB 4LITA 2DOAA 4XRFA 1UUTA 3IP4B 1Z91A 4QWQA 1SVOA 2QQBA 1EV7A 2DJIA 4MFEA 2Z16A 2QA4I 1F43A 1RZ9A 1J9IA 3FXQA 2EBIA 4UVBA 5TJJA 2BVMA 3L7WA 2LBFB 4CZZA 4EMSA 2L9SA 2COBA 1U3EM 4MEXF 1QU3A 4G7OF 2FSWA 4ETSA 2B63J 4A3CJ 3Q3SA 4UUTA 3OYEA 1K61A 3FXUA 3S3MA 4FTHA 5EG0B 3IKVA 1FOYA 3V8KA 4ENMA 3QOEA 3E6CC 1ETKA 5CQEA 3CCRI 1V5EA 3W2AA 4XOPA 3BT9A 1FP1D 4ZJZA 4N4OB 1LVKA 2OD5A 2R7VA 4A12A 2CSOA 1JUPA 3IV5A 5BPDA 1SAXA 2ZMEA 3A02A 5F04A 2HOTA 2W25A 3NWTA 3VPRA 4KISA 2JPBA 1UHMA 2NS8A 1Y0UA 2PMHA 1S8NA 5EEAA 2K7LA 3FBIB 1UG0A 2I5UA 4LD5A 4D5CA 1WQ2A 2HOAA 1J5YA 3EUHA 5B1BH 4ZYDA 3DKYA 1TZLA 5E17F 1NG7A 4WXHA 1JGGA 3HUGA 1E3HA 2N8GA 1EH6A 2RVCA 3VYUB 2CUEA 3AG1H 2BHYA 2L7MP 4V2GA 3O2PE 2L01A 1IN4A 4WCGA 5D8LB 4HOBA 4P96A 2M4GA 1K4TA 4YELA 2YR2A 1MMSA 2ECBA 1HDDC 1HA8A 4KITB 1MJBA 1A6IA 2GA1A 4E6KG 3E6DA 4Z6YA 5FRNA 1VQ7I 2R93J 3L2WA 1YRNA 1KA8A 1RR8C 3TL4X 1ZLKA 4DIQA 3VOEA 2HZDA 4LIVA 4XLCA 4AD9A 3C2GA 4A0ZA 1JJ8C 5CPRB 1QPIA 4XNFA 1GHCA 1DGWY 1D0ZA 1JGSA 2A6EF 4CH7A 2NVTJ 2WAQN 2QF7A 4A93J 1I3QJ 2ESNA 1FOXA 2FOKA 1VQLI 4IEJA 3CC4I 1R7JA 3DTEA 4HZFA 3ROUA 3V42A 2YSRA 2P8TA 3H5NA 4EEFG 1YS6A 4A2UA 2M87A 2X4HA 4Y33A 1Z7UA 2VC1A 4GYIA 4ESFA 1E17A 4OIRF 1BC7C 2ESHA 2CV2A 1OKRA 3RTRA 1IDYA 4FGNA 3J81K 3LAJA 4BQOA 5LHIA 2VT2A 3WU2C 4M72A 3Q9VA 1ZN2A 3GVAA 2EPFA 3B6CA 1BI2A 4XIDA 1USSA 1JHHA 2K3FA 1MBJA 4PFOA 4Y17A 2ICWG 5E18F 2W00A 3KZYA 1HXDA 5D5UB 3KZZA 4ABZA 1QVTA 1S6LA 5LGNA 4CCNA 4FCYA 2E60A 3F8CA 4AIKA 2PMZN 2K40A 1D1AA 3QYBA 5J1UA 4XSXF 2A5WA 4C2TA 1H8AC 4BHBA 5FKNA 3CCYA 3G4SI 4J19A 4P55A 5AIPA 3ZMUA 2W57A 1L2MA 2EZHA 4G7HF 3FZVA 2UXNA 3LSGA 2LYCA 2DPUA 5E8IA 3ZN1A 2M2EA 1HBXG 3BTJA 2XAJA 3VYRB 5KAFC 4RB1A 2EV6A 2V79A 3L2UA 4BDYA 3RYRA 2L0KA 3B02A 1FWZA 4RAYA 3G1LA 3OOPA 3K1PA 1TWCJ 2OZUA 5D6FA 3P5JA 4A3BJ 2ZNYA 1AKHB 2BZTA 3HM5A 4KUMA 1YE9A 1Y1VJ 2NVXJ 2Q2EA 5LGTA 3HEFA 3PQJA 5K5QA 4B43A 3CUQA 2VBWA 5DM6F 1D0YA 4KN4X 1G3SA 5HS8A 5DD4A 4FX4A 3MQ0A 1TWHJ 3LSKA 3CP2A 1ETVA 3FMRA 5E20A 4EV0A 3S1MJ 1IUYA 1FNNA 4UB6C 2DK5A 2V4JC 2XPUA 3SEZA 4IHYA 4QSHA 4RM2A 2H27A 1HF0A 3ECOA 3S8PA 2UWMA 2VL8A 1SFUA 3AL0B 1VTNC 1HDPA 2XV4S 4GYGA 1WFXA 4G12A 4R8HA 1RUNA 4RLQA 4JOMA 2QKMB 1R23A 2IGNA 1EF4A 2CUJA 2V9VA 3FX3A 4HX8A 3WU1B 1LNWA 2M8EA 2STWA 4A5NA 4A3DJ 3OR2C 4EM0B 5J47A 4L9TA 1GXPA 1TW2A 2EB7A 5GPAA 3O6BB 1R5HA 2DT5A 3DU6A 3DQVC 3F8BA 4BYYA 1MJAA 1LE8B 2RNJA 3DV8A 1PVEA 3F6OA 3HPHA 1X58A 1WH7A 2RKHA 1ZGJA 2XB5A 2OCCH 2QEXI 1B6AA 5H6QA 4NC7A 5HODA 3ZP5A 2LLKA 2X51A 3HOWJ 3H0GJ 5FGMA 1ZR2A 1ZQ3P 2ITJA 2DOEA 4IQJA 1XSVA 1I3AA 3NARA 2JPCA 4KICA 2QM3A 3HKZA 4I0AA 3ZQHA 2IS4A 5B5EC 2KRHA 1F08A 2XF6A 5M3FJ 3E5QA 2HYGD 2GLOA 1U9OA 1HKQA 2XB0X 2CMPA 3GTLJ 2GXAA 3QN2A 1BOBA 2F2EA 4YIRX 1A35A 1XCVA 3HOSA 1JHFA 2IBDA 2LBFA 1XGNA 2EZKA 3F9KA 3RZDJ 1YG2A 2M7AA 5CVJA 4BKXA 2GBYA 3H5AA 2PJRB 3CO7C 4A69C 2HR3A 3JRHA 4KIGA 1WJEA 1YX3A 3CESA 2V1DA 3A0HC 3ECHA 2VQHA 5EG0A 5GP9A 1BOAA 3ASNH 4AIHA 2R5ZB 2GWRA 4RM3A 1FP2A 3ZPLA 3GLXA 1K6YA 4ZQ9A 3TGNA 1OFCX 3TKYA 3CDIA 1Z3XA 1TC3C 1MH4A 4B1RA 3ABMH 4P9UA 3WU0A 2ZNZA 2VB6A 1TNTA 3LQQA 2XPVA 1UZCA 2L7FP 3A4CA 2CW0F 3FXOA 2VKVA 2V9PA 3AAFA 1VNDA 1S9HA 3ASOH 5LRSA 1BJAA 2XKPA 5LD2C 2VIXA 2R4GA 3PQKA 2CW8A 3K4BA 3FM3A 3T0YA 2B9SA 2R7DA 1OCCH 4F92B 1ZH5A 2RGVA 3I4PA 3HOYJ 2EV0A 3BROA 3KIOA 4HLXA 2P5KA 4MNUA 2WBMA 2XVCA 1ZGWA 4XBFA 3S14J 2ZO4A 5E3MA 2HTJA 1MSEC 1SMTA 4KDPA 1SFKA 2RREA 3FK6A 3FWEA 1O7LA 4O3MA 3E3VA 2MD5A 2CRGA 4MHGA 1VQMI 1T39A 3K7AJ 2WC2A 4X0GA 2BY2A 3OYFA 2CUFA 4D9JA 3MFKA 3DKWA 4HNUA 1ZGAA 3GEZA 3GZ5A 5J1RA 2CQNA 5M5YJ 3TW7A 4Q47A 3HOZJ 3OS0A 3KP4A 4D1QA 1X2NA 2DQRA 5DV5A 1IG7A 3DKXA 3SZGA 3A2KA 1L5IA 2E36A 2F48A 3ERMA 3L09A 4NC8A 2I8DA 5GAEJ 1IRZA 4RS8A 1ETQA 5B1AH 2EFNA 2PBIA 4B3AA 4M3EA 2NTCA 1FTTA 4IHTA 2JRMA 2CS3A 3BZ6A 2CV1A 5JI6A 1QVUA 1MH3A 2WAFA 1O4XA 4HAMA 3REOA 3HZJA 2R5YB 1HQCA 3J81Z 1DQUA 2YPRA 1VFCA 2AQFA 1IDZA 1ETWA 1MBEA 4OMZA 1FIAA 1W1WE 2A69F 1KZHA 4FISA 5K7FA 2BY0A 2F4IA 2VN2A 1KGSA 5IOYA 5CKTA 3OWTA 3BP8A 4IL6C 3CJNA 1FBQA 4I6ZA 4RA2A 1BIAA 4H0EA 5FFXA 2D2WA 3D0SA 4CYCA 2Q0OA 2F6CA 1P7IA 4UNOA 2ZJPF 4IHWA 1X1PA 2ITLA 2DOFA 3TMOA 3OSGA 1OPCA 2GIVA 3AG4H 2LSOA 2Y69H 1B8IB 2QYOA 4HG2A 3ZMVA 4CICA 5E1XA 1R71A 1W0UA 1VQ5I 4ZYGA 4E7SA 2M4KA 5ERIA 4JX5A 5JHUA 4MQVA 3WTYC 1BIBA 2E5NA 5ICFA 3M4OJ 3LMMA 2RQPA 3BCAA 1AKHA 3S1QJ 3BR2A 4BE1A 3G3ZA 1XMKA 3OYLA 4IO9F 2PJPA 1JXSA 1RR7A 3FXJA 2DPDA 5J4VA 2DT6A 3GZNB 3ZQCA 5EZHA 4CSWA 2QZ8A 1N77A 3FXKA 3RPUA 1YOVB 2H94A 3G1MA 5HVQC 5J8CA 3EETA 5BYGA 3BG3A 4M74A 5J6XA 1FZPB 3HBLA 1LPQA 1HKSA 2L4MA 2KRFA 3OOUA 2KIFA 3QRFF 4B48A 2GXBA 2HYJA 3FIWA 4E7IA 2ZB9A 2DA3A 3F6VA 4LMYA 2R7TA 1X3WB 2KIQA 5DUKA 1NG6A 2FMLA 3FXRA 1LDJA 4W1UA 2CH0A 5JHFA 1XGOA 4XSZF 2K27A 5KVRA 4L0ZB 2LDUA 1KQ0A 1IRGA 1LE8A 2KHMA 3I55I 5F0HA 2EV5A 3KLNA 3SFZA 3IWZA 2PG4A 2Y2ZA 4CDGA 3M7GA 3WTVC 1GT0C 2CV0A 1OCTC 1EKEA 2EA2A 1D1CA 1U5TC 4UV8A 4DJAA 2V26A 2EK5A 1UFMA 2Y0SA 2QBYB 4U87A 1SD6A 1XG1A 3BQZA 1H9TA 1Z3YA 3SFIA 2HZTA 1FY7A 2ZJRF 3UNGC 3ERED 5IP7J 1DPRA 1IN8A 3MCZA 3E0JB 3PFYA 3ZGKA 4HF1A 4RGRA 3ESWB 1Q1VA 4K2EA 4HLYA 3BR1A 1D1BA 3FM5A 2GA2A 3RZOJ 1ZARA 4BXXJ 1RPWA 2CWEA 2GIZA 2L9NA 1X4PA 1TNSA 4YIIA 3H92A 4ZTFA 4Y3OA 1G4DA 3ZOBA 2Z2SB 2AHQA 1XS9A 1IAWA 2PJRA 4ASNA 4ENKA 2F5EA 2ELHA 3QYFA 1P6RA 3LOCA 1Z21A 1J7KA 4GGGA 3WHBA 1X2MA 2XAFA 5GTHC 5FKLA 2JA2A 5L3FA 2JVHA 3P7NA 4A3GJ 3MAJA 1D0XA 2IVMA 2GZWA 1WJDA 3TQNA 2LY1A 4UVCA 2LFBA 2WAEA 2D1VA 1ZLJA 3BOQA 2R0QC 5J1YA 1T95A 1WVRA 3MMYB 4G94A 1IXSB 2IA0A 2MH2A 3ULQB 4A3MJ 3WTUC 2HXIA 2EINH 5D4RA 1ETXA 5BQTA 1WPKA 1TP4A 3I53A 2P5LC 4NBPA 1OR7A 3I64A 3DEWA 4II2A 1TT0A 4ZH4F 4O5VA 4XONA 1ZR4A 2E2JJ 4NDLA 4AYBA 2HQNA 1TLHB 2DN0A 4JP0A 4XKCA 5LBQA 1YFHA 2M0CA 1UB9A 2OBPA 4LGWA 2XGXA 3CCEI 1MNMC 4L0YB 3P9KA 5FJ8J 1HW5A 1ETYA 2IP2A 2PMUA 2OTJI 1EA3A 3RQIA 3L2QA 2V7FA 3BDDA 3ONQA 4RAFA 4YFNF 2I10A 3T8RA 2FRHA 4BUPA 2V6EA 3ABLH 1R6RA 2FF4A 3WGHA 3G6EI 3D1NI 2MBFA 4HEA2 4IVNA 3ISPA 1X4OA 4Q4ZF 1YW8A 5L3BA 2Y75A 3RDIA 3K1NA 5E1ZB 3JRIA 3BTIA 1ACIA 1R36A 1Q1HA 4M6XA 2E5ZA 2Y31A 4KT5C 2DK8A 4XN3A 2CQQA 3CCMI 1YJWI 2ME6A 2X6YA 3S3NA 2OA4A 1SFXA 1WJBA 1ZTRA 3BQYA 4BHCA 2LRDA 2PN6A 5JVGF 2M45A 3TDUC 1J75A 4DGWB 1S7AA 1JJ6C 3HOUJ 4HDVA 1J09A 4MFDA 3I0TA 2R5YA 2MW8A 3HJEA 1MKMA 4HYEA 3LAPA 3ZQQA 5D5WB 1RIOH 4F52A 4LLNA 3GYHX 2EIMH 2E2IJ 5A2QK 5CLSA 4FB3A 4BACA 1HSJA 1OMIA 5AIQA 1VQOI 3GWZA 1NTCA 3PIOF 3KCCA 1H9GA 1YS7A 1IO2A 2JUGA 1NHAA 2VJ4A 1SANA 5DD8A 2L7ZA 2DTZA 2FOWA 5D9IA 1POGA 3QK2A 4LOCA 2X85A 4G8XA 4XL9A 1K83J 2HGCA 5KCMA 4CYDA 2Z33A 1QHHD 1WGXA 1V3FA 2WB1A 1XMAA 2BHZA 5F1RA 2JT1A 2XROA 3VFZA 2D45A 5IP9J 5EYRA 3HOVJ 1JTYA 4OOIA 1CF7B 2IT0A 4IKFA 2DA7A 1KYWA 4XLPF 1T08B 3BPXA 1B8IA 2P7CB 4L9VA 3KP6A 2WAQA 3OL3A 1BA5A 1C0WA 1YW9A 4L9JA 1TQMA 3F8FA 3HRTA 1K7AA 1R5GA 1WKMA 4OIOF 2JQ7A 3RPQA 3IHUA 1MJ9A 1IRXA 5FD5A 4TV7A 2BV6A 1YITI 1SFOJ 1N25A 3KPHA 4C2MJ 5DCXA 4F55A 2IXSA 3J80K 2EWNA 1DP3A 2Z99A 2KLOA 2K86A 3VDXA 3SQNA 2D1HA 2R7UA 3K70D 4AM3A 2KIUA 4IXAA 5K5OA 3U2RA 2OPTA 2JSPA 4YEJA 3CCVI 4EGZA 3HTUA 3KETA 1FYLA 2DTRA 4UV9A 4HF2A 4NC6A 3CC2I 2BXZA 3NRVA 2EIJH 2H8WA 2KPMA 1U0JA 2J5OA 2QENA 4XRSG 5J4YA 2ADUA 2ZC2A 1EH7A 5EF6A 3S16J 2VQGA 1ZHFA 2LVSA 4AVZA 2HOSA 4GRIA 3V7CA 1LFUP 5E1WA 3E5UA 3R6SA 1ODDA 4BQQA 4I01A 2E2HJ 4JQFA 3JRAA 5H6RA 2NVQJ 2G9WA 2RV8A 2XASA 3LL7A 2F4OB 5D5XB 2PEXA 4AU7A 3H3ZA 5HDNA 2FBKA 4PGHA 3IKTA 1W0TA 5HS7A 1E3OC 4RAZA 2IPRA 1JUMA 2LREA 2XUBA 1X1DA 4BXUA 2P6TA 1MIJA 2VPRA 1ZREA 2ZXHA 2O03A 1AU7A 2NS0A 1HC8A 4OIQF 4O6JA 1IRFA 2PLYA 4HV6A 2UZKA 3GTOJ 2R7ZJ 4M71A 3OYIA 1B9MA 4C3IJ 3DTKA 2QBYA 2G7UA 3L2RA 2QLZA 3CMEI 1UHWA 2ZKZA 3QU3A 2EFWA 3R60A 4QPOA 4JX6A 5M5WJ 2DYSH 2HU9A 1IN5A 3M8JA 1SAUA 1Z67A 1IF1A 2DA1A 3K4LA 3JRCA 3BG7A 3BG6A 1T2KA 5F0FA 2M3AA 3SZPA 1M1EB 3AG2H 3T8TA 4YIFA 5LHHA 1KSXA 4M9XA 4F7ZA 3BR5A 1FIPA 1O57A 4E7KA 1HKTA 2CJJA 6PAXA 4LFUA 4N9IA 5CVRA 2CO5A 2KJCA 3K6GA 3QYEA 4CYCB 3HB9A 4PJLA 1OQYA 1TT5B 3LSHA 3GZ6A 3EUHC 1QHGA 1TW3A 2MSYA 3QWLA 4F3QA 4CZCA 3VB2A 1KSYA 4XK4A 3S2WA 1Z05A 5LFAA 1W7PD 4IOAF 5EEHA 1X3UA 2V1XA 1EJ9A 3T5XA 1A31A 3OL4A 1RUOA 2E1MB 2FUG2 3FXMA 4PUSA 1IGNA 3ZMZA 1BR4A 2JJ7A 1O3RA 4GDFA 4I09A 4HA8A 2LH9A 1FTZA 1X3ZB 1LFPA 2K9QA 5E3NA 4AVPA 2GOMA 1OYYA 5FFZA 2BEOA 4XLAA 4FASD 1NK2P 1QA6A 3HTSB 4BXFA 1B4AA 1JKRC 3TBIA 1OISA 4ZDOA 3KLOA 2COMA 3CLOA 4JBAA 5ICEA 4UHTA 3E6MA 5GADJ 1XDSA 1F9NA 1I5ZA 5LLQA 1FMWA 4I99C 1BL0A 3S1RJ 1P92A 2KFDA 5FD6A 3L9FA 3R4KA 2XC7A 4KN7X 3F23A 3SYTA 1Y56A 3GTKJ 3HYIA 2X48A 2ECCA 3JAMZ 2E1OA 1H89C 1FMVA 4RB3C 1YX5A 3BR0A 5EDNA 1YQAA 3BCBA 4KT6A 5CVVA 3SEQA 3GUDA 3K4NA 2ELJA 3CMYA 4BE0A 1OCZH 4HQEA 1DU6A 3MEXA 1ON1A 4PK4A 4MGRA 2KL4A 2OC6A 1KYZA 2HQAA 4F93B 3K2AA 2VE9A 2W7NA 1WI9A 1XN7A 3J7AO 1K79A 3RQ4A 1GVDA 4U7DA 1STZA 2IPQX 2IRFG 2HDCA 3VWBA 1BI0A 2Y48A 2QVOA 2DYRH 3K9TA 4E7ZA 3H0DA 4CUGA 2OU2A 1R1UA 5IT9K 2DQLA 2WADA 2QSGX 1WCMJ 2HYFA 3CCQI 4DZJA 2X6WA 4ZZLA 1KU2A 2ETHA 3E5XA 3OV8A 3T1BA 2V9KA 1WWXA 4HNTA 2LK2A 3ZXSA 1XD7A 3IL2A 3W2WA 3RJPA 2JVGA 4MLOA 5A2QZ 3TO6A 3AKZA 4CCMA 4L5JA 2ZCWA 2AS5F 2BVLA 5JLXA 3LFUA 5HNHA 3PO3J 3CF2A 2K5CA 5HLHA 2QKLB 1X19A 3DP7A 2CQKA 1FX7A 2M5WA 4NB5A 3OYGA 1WJ5A 3DLLF 2IS6A 3CLQA 2MA3A 4G6DA 4BJ5C 3ZMDA 3OIQA 4AIJA 5LRRA 3LSPA 3E7LA 3BZKA 2HVQA 3QAHA 3CUQC 2DA2A 5HLIA 1O3SA 1N78A 2LY9A 3I9V2 2AQEA 3WTWC 3F8MA 3SJMA 4R79A 1LKXA 1CF7A 3HOXJ 2VE8A 1O3QA 5HLTA 1ZG5A 3JTHA 2KZVA 2V1NA 2MC3A 3HDDA 3WTTC 2KQRA 3PO2J 2HDWA 5CVUA 1BR1A 2NRAC 5D4SA 2LMDA 3NQOA 3CJRB 2DDBA 2HEOA 3EDPA 4PZJA 3HG9A 4I7HA 3J80Z 3DCFA 1BBYA 1QZYA 2XRLA 4DYRA 5FRMA 3ABTA 4BL0B 1IV6A 2YS9A 4B3XA 2ZBKA 1G8XA 1IJWC 4A3LJ 1VQNI 3HGGA 4XORA 1RESA 3H3VK 2HXOA 1OYIA 4MO7A 3JRFA 4NNJA 4DBRA 1WJAA 2F5DA 2XHKA 2KMUA 5CVIA 4CCJA 4E4HA 3HKZN 4C3JJ 1YTYA 4IF4A 2E34A 3QOPA 5FLXZ 3A03A 1TBXA 1JT0A 5IYCJ 2XAUA 3L2VA 1B72A 2BXYA 3VEPA 1QRYA 1Y1WJ 3VODA 3HRMA 4EATA 3PSIA 1XGMA 3JTGA 4OINF 3GF2A 5IT3A 2BE5F 5E3OA 1YJ9I 1KU3A 4UUSB 2M7BA 1UHSA 3IC7A 3H9JA 3KX2A 2K9NA 3MZ8A 1T8IA 4CA0A 3GTMJ 4RB0A 4ZDLA 3CF5F 2DFHA 2VJ5A 3WTXC 4DW6A 1HW1A 1S5LC 1USTA 2JA7J 4V19K 2KT0A 3KZIC 2Y0MA 1U9NA 4AC0A 1IUFA 1FPQA 5HOOA 1G59A 4HRIA 4A6DA 5K1YA 5BMZA 1O3TA 2GM4A 3QP6A 4LB5A 3BR3A 1AOYA 3JRGA 5TGTA 4LG0B 2M30A 5F27A 2VONA 2DW4A 1R1VA 5C44J 4IHVA 1J0RA 3A01B 4HQMA 4RMNA 1YHQI 1A04A 1KU7A 4Q48A 1S3JA 2HFHA 4A3EJ 4U7BA 4IX7A 1XPXA 3DF8A 4DQ2A 3U1KA 1AA7A 4FT8A 4B4CA 1FC3A 4IJAA 3I4NJ 1JKPC 3QFQA 1TTYA 4XKBA 1W5TA 3IWFA 2R7SA 2K85A 1U5TA 1ZRFA 4G6QA 2CU7A 4XKWA 4YFXF 3AG3H 1ZG1A 2OF7A 3IRRA 2VXZA 2NL8A 2WY7Q 1S7OA 2V6CA 1T6SA 4HBLA 2VBXA 2MD0A 1LEBA 2MYSA 1YW7A 3I54A 5CQGA 2XSDC 1V5FA 3V8JA 4OIPF 1B1BA 2IF9A 2MLKA 4J01A 5FKOA 3DEUA 4P1WA 2W84A 2Z1DA 3ZCOA 4EJOA 1BJZA 3HIFA 2G0EA 2HNHA 4XR6A 2A6TA 4QIWN 3GTQJ 3K2ZA 3ZN0A 3CD6I 4BBRJ 5ICGA 2LF8A 3W6KB 3GLLA 2BGCA 1RKWA 3OYMA 4UB8C 3K10A 2NAZA 1W5CC 1U8BA 3LSIA 3OY9A 2OQRA 3J7YJ 3K70C 2JTVA 4OWRB 1F4KA 2ACJA 5BOXA 1OCPA 3LWFA 4PJJA 5ILSA 4BJTA 1SC7A 3WE2A 1GV5A 2KJBA 3COAC 2A07F 1WI3A 3NEUA 1Z77A 1LDDA 5ICCA 1PUEE 3LSMA 3ZRGA 1MMGA 2MC4A 2FUFA 1V5GA 4ESJA 2CW7A 2VC0A 3OR1C 1HCRA 2TBDA 5IT9Z 5J40A 3UR3C 2FMYA 1FOKA 4M9ZA 2E7XA 1I27A 2EFOA 1BM9A 4NBQA 3DXJF 4E7JA 3DPLC 3D5LA 2STTA 3SHFA 2HKOA 3MD2A 2NVUB 4RDUA 3GTJJ 3H9GA 2DFIA 3ABKH 4C9YA 4G7ZF 3HRUA 5K5RA 2RQQA 4XKVA 2KISA 2Z9OA 2O6GE 2VBZA 3A1YA 3Q5FA 3MVPA 4LJZF 3U1DA 1ETOA 1ITYA 3FBNB 3JRBA 2YUSA 2TRTA 3EYYA 3F8NA 1FYKA 2DU9A 3IH4A 1ONVA 3FXLA 3WTZA 3H35A 3TO7A 1GDTA 3I5UA 3V4GA 2NNYA 3S15J 2DBBA 1LB2A 2M34A 2W1OA 2XIGA 3ZR8X 3OMYA 2OZ6A 1Y0NA 2XF7A 3KYCB 3HHGA 3WODF 4EVIA 2Y9ZA 2X6OA 2VKEA 4UVAA 2O5RA 2P81A 2FEZA 2OAZA 4PDKA 4E70A 1MNEA 1H0MA 1P2FA 3FHNA 3B6AA 1GLNA 1SEUA 5E3LA 3AFHA 3JSPA 4BU2A 5IP6A 4BJ6C 1JKQC 1TQPA 3CCUI 3H36A 1Y39A 4XICA 1D5YA 3AL0C 4HW0A 3KP3A 3IAS2 5AONA 2DDAA 2X1CA 1FSEA 3FMQA 4JK1X 3KP2A 3ZQ7A 5J8FA 3L00A 2GXGA 1G3WA 4FHTA 3JR9A 1SMYF 2M8GX 1YJNI 3LNQA 2ZFUA 1BI1A
chains in the Genus database with same CATH topology
3S32A 4BQQA 4NC7A 3E1SA 2IGMA 3EUAA 2X51A 3IAM2 4JQFA 1W36C 2K9MA 2VJIA 2W82A 4HSRA 4E7HA 2ITJA 3LL7A 4IQJA 2VJJA 2R7OA 4AU7A 3HXLA 2IPRA 1M55A 3HPGA 2LREA 3HKZA 2IS4A 1MMNA 2KRHA 1X1DA 4NUBA 3OYNA 1F08A 2XF6A 3OIPA 3S3OA 2RNGA 2ZXHA 3MKWB 2CMPA 2L5QA 1OLTA 3QN2A 1BOBA 3HOSA 4B44A 2LBFA 2VPLA 3F9KA 3OYIA 2M7AA 4IZZA 4LG3A 3H5AA 3DTKA 3L2RA 2PJRB 1WJEA 1YX3A 4OAZA 3MKYB 3CESA 2KDOA 4CCLA 2VQHA 4F91B 2LY2A 2NOJB 4XM3A 4QPOA 2HU9A 1Y6IA 4ZTJA 3CMMA 3M8JA 1SAUA 4YRVA 3K4LA 4XN0A 2BW3A 3BG7A 3BG6A 4RM3A 2M3AA 1KSXA 1K6YA 4ZQ9A 4E7KA 4KJZA 3HUGB 1Z3XA 1MMAA 4P5OA 3DTIA 4DOZA 3K6GA 2VB6A 3QYEA 4XQFA 3A4CA 4PJLA 2VXDA 3LSHA 3EUHC 1QHGA 1S9HA 4CCOA 1P9QC 3U21A 4F3QA 4CZCA 5CYNA 1KSYA 1WJFA 2VIXA 5LD2C 2R4GA 2CW8A 3K4BA 5LFAA 2VQLA 4H4KC 1W36D 3EUKL 1T0FC 3N05A 4F92B 2XF5A 2VASA 3OL4A 2E1MB 2FUG2 2LC2A 4PUSA 1BR4A 4XOTA 4GDFA 2WBMA 2LH9A 2Q1ZB 2HPMA 1LFPA 1R9WA 2GOMA 1OR7C 4FASD 1SFKA 2P0WA 2RREA 3PUBA 4XLAA 4BXFA 3OS1A 1WJCA 1Z1DB 3TBIA 4ZDOA 4BDZA 2LG4A 2LOOA 4X0GA 2R7QA 3OYFA 4ZDPA 4D9JA 4OAYA 3VSKA 3QODA 2E1MC 4B47A 4HNUA 1FMWA 3KYLA 3OS0A 4G6TB 2XC7A 3H5RA 4D1QA 3SYTA 1Y56A 3OYDA 3DKXA 3SZGA 3A2KA 1L5IA 1FMVA 4C2UA 2X1EA 4NC8A 3DPTA 2I8DA 1YX5A 4XLHA 3MKZA 3BCBA 3OYBA 4KT6A 3SEQA 4DBQA 3K4NA 2ELJA 2NTCA 4BE0A 2CS3A 2CV1A 4PK4A 2HVSA 1ZELA 2KL4A 2OC6A 2WAFA 5HNFA 2HQAA 4F93B 2W7NA 2MFZA 3D5RC 4PSWA 1DQUA 3K4JA 3RQ4A 2AQFA 2PMZA 4QPQA 4NQWB 1JI8A 2DT7B 1X1CA 4ANJA 3FKJA 3S93A 3VWBA 4Y4RA 2HW0A 3PL8A 5KHDA 3BLYA 2F4IA 2X6XA 4E7ZA 3H0DA 1ERDA 4PJMA 4CUGA 2CFOA 4BEHA 1VZ0A 4ZO0A 2WADA 5CKTA 3OWTA 2OUMA 2K3PA 3CZ6A 2X6WA 4CCKA 3M1CA 2M0MA 1MMDA 2Q2EB 2V9KA 4J00A 1MNDA 4BE2A 2F6CA 3BC8A 4ZC3A 3CP8A 3ZXSA 4HNTA 3DEEA 3W2WA 4IQ4A 2ITLA 2JVGA 4MLOA 4RLFA 3TMOA 4HSTA 3AKZA 4CCMA 3HL2A 2IGOA 2BVLA 2L2OA 3LFUA 2ZSIB 5HNHA 3CF2A 4HG2A 4PFPA 1X1AA 2K5CA 2ZXIA 3HC7A 2QKLB 1X19A 4PJNA 3VYTB 2X1DA 1BR2A 2M4KA 4E7SA 3OYGA 3NWSA 2VKDA 4N4NB 1WJ5A 2E5NA 3DPUA 4BQNA 2IS6A 3LMMA 3BCAA 4BJ5C 2VQCA 3K4CA 3OIQA 3W3CA 4BE1A 1KONA 2HVQA 3H9QA 3OYLA 1N78A 3I9V2 1UELB 2AQEA 3DLAA 2DT6A 4BS9A 3RPUD 4CSWA 4R79A 1LKXA 2R7RA 4E7LA 1N77A 2W4SA 2R7XA 4LIFA 3G2BA 5HVQC 5HLTA 5BYGA 2KZVA 2V1NA 3IUOA 3OOUA 2KQRA 3W2VA 2HVRA 2HDWA 1BR1A 2L7KA 4B48A 3CJRB 3PJRA 4E7IA 3HG9A 2R7TA 1NG6A 5FRMA 4BL0B 4ITVA 2CH0A 1TBDA 2ZSHB 4LITA 4B3XA 1G8XA 2DOAA 5JHFA 2VLAA 3VSLA 1UUTA 3IP4B 4XORA 4II3A 2KHMA 2DJIA 4XMYA 3RCOA 2MABA 4NNJA 4DBRA 2Z16A 1WJAA 4HPQA 2CV0A 2KMUA 4CCJA 4PSXA 4E4HA 1RZ9A 3DWLE 1D1CA 2BVMA 2LBFB 2L9SA 2XAUA 2V26A 4DJAA 1QU3A 3L2VA 2IGKA 2Y0SA 4U87A 4EATA 1Z3YA 3OYEA 3PSIA 3UNGC 3S3MA 3E0JB 3PFYA 3ZGKA 3QOEA 4FETA 2BW3B 2M7BA 5CQEA 4KW3A 1D1BA 1V5EA 3W2AA 4XOPA 3H9JA 3KX2A 4CA0A 4ZJZA 4N4OB 1LVKA 2R7VA 4ZDLA 2DCEA 2VJ5A 4C30A 2DXIA 2KP6A 2L9NA 1X4PA 4ZTFA 3NWTA 2R7WA 4Y3OA 2UUZA 2GOXB 2Z2SB 4KISA 2PJRA 3QYFA 5HOOA 3FBIB 1UG0A 1G59A 4HRIA 4LIUA 1Z21A 3OYHA 2WY8Q 5TGTA 3DKYA 1TZLA 2JA2A 2JVHA 1NG7A 1D0XA 1WJDA 2LY1A 4RMNA 3VYUB 2WAEA 1MW7A 4U7BA 3OS2A 4IX7A 1T95A 3MMYB 3VYSB 1AA7A 3FDYA 4NBPA 2M4GA 3OYCA 4YELA 3QFQA 4XKBA 1HA8A 4II2A 4KITB 4E6KG 1TT0A 5FRNA 2R7SA 4XONA 3PNYA 4AYBA 3L2WA 3TL4X 4XKCA 4XKWA 4DIQA 3RSNA 2HZDA 4LIVA 4XLCA 2VXZA 3C2GA 2NL8A 5CPRB 4XNFA 2XDVA 2WY7Q 1D0ZA 1DGWY 4CH7A 3OYKA 4XLFA 2MD0A 1N75A 2MYSA 1EA3A 3L2QA 2V7FA 5CQGA 3ONQA 2V6EA 3CJQB 1V5FA 4BUPA 1R6RA 2IF9A 3DTEA 4J01A 3V42A 2UV1A 3H5NA 4HEA2 3PNTA 2Z1DA 4P1WA 1X4OA 4Y33A 3ZCOA 2HNHA 4XR6A 1X1BA 5FROA 3I3LA 2A6TA 2XSJC 2CV2A 3RTRA 3HOTA 4FGNA 4BQOA 2E5ZA 4XN3A 3OYMA 4PFOA 3C2HA 3K10A 1E0EA 2W00A 3DU5A 2X6YA 3S3NA 3LSIA 2IS2A 4CCNA 4BEHB 2E60A 1WJBA 3OY9A 2LRDA 3K70C 4OWRB 1D1AA 3QYBA 2K9LA 4ZYAA 4DGWB 4BGDA 3OYAA 4PJJA 4XLEA 2BOLA 3KEYA 1J09A 2A5WA 4C2TA 4BJTA 3ZQQA 1L2MA 2WA0A 4F52A 2VKHA 2LYCA 3LSGA 2F5VA 3GBGA 3VYRB 3LSMA 3ZRGA 3L2UA 1PYVA 1MMGA 2MC4A 4BACA 4BDYA 2FUFA 1V5GA 4FB3A 2CW7A 3OR1C 2TBDA 4LMDA 1DGRM 2JUGA 2VJ4A 2CUZA 3UR3C 3K4MA 5D9IA 3D5SC 4E7JA 1YE9A 3QK2A 3DPLC 3D5LA 2X85A 4XL9A 5KCMA 3MD2A 3OYJA 3H9GA 1QHHD 4B43A 2WB1A 1UAAA 1D0YA 4C9YA 1LDKB 2RQQA 4XKVA 2IS1A 4IKFA 2HPIA 3A1YA 3LSKA 3CP2A 3FBNB 2WAQA 3OL3A 2V4JC 3SEZA 4RM2A 3H35A 2UWMA 3S8PA 3J7AY 2VL8A 3AL0B 2W1OA 1WFXA 1IRXA 3ZR8X 3OMYA 5KNLA 2XF7A 4RLQA 4JOMA 5DCXA 3PSFA 2QKMB 3PNVA 2IXSA 4F55A 2OV7A 2IGNA 2KLOA 2O5RA 2CUJA 1DP3A 3VDXA 1PJRA 2R7UA 3OR2C 1MNEA 3K70D 3K4KA 3SDBA 2KRCA 3FHNA 1GLNA 2JSPA 3AFHA 4YEJA 4BU2A 3DU6A 4BJ6C 3DQVC 3AL0C 2KPMA 1U0JA 3EPZA 3IAS2 1Z7LA 2X1CA 3HPHA 2VQGA 4AVZA 4GRIA 2ZFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKX A;  4U87 A;  3DKY A; 
#chains in the Genus database with same CATH topology
 3S32 A;  3ZQI A;  3E1S A;  1GUU A;  2IGM A;  1MBH A;  2RC4 A;  3EUA A;  3IAM 2;  2VJI A;  4HSR A;  4E7H A;  1S7E A;  2VJJ A;  2R7O A;  1FT9 A;  2XAH A;  4W97 A;  1UG2 A;  3HPG A;  5FKK A;  4HNV A;  4EM1 A;  3Q0U A;  4IHS A;  4IPA A;  1Z6T A;  2JSC A;  2ZXJ A;  4NUB A;  4WX9 A;  3CQZ J;  3S3O A;  1R4M B;  5CYV A;  3JAM K;  1L0O C;  4RGU A;  4UXN A;  5LEJ A;  2L5Q A;  3ABU A;  2A68 F;  3QPS A;  4OU0 A;  4YFK F;  4L18 B;  2LNB A;  1F1Z A;  3JSO A;  1H88 C;  2E7W A;  4EJW A;  2ID3 A;  4IZZ A;  2X9D A;  3BJ6 A;  3ZQL A;  4IRH A;  3L1P A;  4B09 A;  1JTX A;  1ULY A;  2KDO A;  1A36 A;  2ISZ A;  3BPV A;  1QPM A;  2NOJ B;  4XM3 A;  5FLM J;  2QGU A;  3P9C A;  4ZTJ A;  4XN0 A;  4UUS A;  4L5I A;  4BAY A;  5FLV A;  3BJO A;  2IEK A;  4EJV A;  3PIP F;  1RET A;  5DS9 A;  1OCR H;  1I39 A;  3C3W A;  4KJZ A;  4RAG A;  1FSH A;  9ANT A;  1REP C;  3I58 A;  4EM2 A;  4P5O A;  3F72 A;  3FKI J;  3DTI A;  1SFE A;  4S0H B;  4DOZ A;  2A05 A;  2O8X A;  3RKX A;  1V4R A;  2XAQ A;  4XQF A;  2FE3 A;  1SVL A;  2VXD A;  3KEO A;  2W48 A;  2EH3 A;  5B3S H;  1TWF J;  4CCO A;  1P9Q C;  5GAG J;  3CJT B;  3U21 A;  1QQI A;  1RC9 A;  1XCB A;  2JZY A;  5F64 A;  1U78 A;  5CYN A;  2W85 A;  3C2B A;  2HQR A;  2Y30 A;  1YI2 I;  2VQL A;  3H1C A;  4LG0 A;  3WGI A;  1Y8R B;  3QPT A;  1G3T A;  5DCM B;  4H4K C;  1S72 I;  1SD5 A;  1W36 D;  1T0F C;  3N05 A;  4M3B A;  4GCV A;  1DP7 P;  2LC2 A;  3ZQF A;  3A01 A;  4M3F A;  1JKO C;  3KFW X;  1QZE A;  4U88 A;  2HPM A;  3CO6 C;  1R9W A;  3W6V A;  4AYB N;  1OR7 C;  3F21 A;  5KK1 A;  2LKS A;  1TL8 A;  3J7Z I;  3KP5 A;  5C4X J;  2F5F A;  3OSF A;  1Z1D B;  3HHH A;  4KMU X;  4BDZ A;  1BI3 A;  2LOO A;  1DPU A;  4XRM A;  2HDD A;  4ZDP A;  3VSK A;  1XDU A;  3QOD A;  4DZP A;  4Y7N J;  3TOA A;  1R1T A;  3KYL A;  4M6V A;  1OYW A;  3H5R A;  3KP7 A;  3G73 A;  3E6B A;  2CYY A;  3A0B C;  1MZB A;  5H20 A;  2X1E A;  4NHJ A;  3MKZ A;  4D5F A;  2EFQ A;  2L3D A;  2NYX A;  2E19 A;  4I0B A;  1F5T A;  4JYK A;  4ZYH A;  2HVS A;  2WWY A;  2JK3 A;  2LKP A;  1AHD P;  1WH5 A;  5HLG A;  2FD5 A;  3D5R C;  1XSD A;  2F5C A;  4KIF A;  1P4A A;  5HDK A;  5D8K B;  2PMZ A;  3GXO A;  2OCE A;  4NQW B;  4L9N A;  4WXC A;  1APL C;  1MGT A;  1JI8 A;  1X1C A;  1CQT A;  4D0P A;  3FKJ A;  1YYV A;  2HW0 A;  3PL8 A;  2XAG A;  3BLY A;  5KHD A;  1ERD A;  5L3E A;  3M3Y J;  5FKM A;  5FLX K;  4FE4 A;  2NS7 A;  4KYW A;  4ZO0 A;  3LQR A;  4B8X A;  1B72 B;  2OUM A;  1QZZ A;  1I1S A;  1RRJ A;  1ENH A;  2EJR A;  2YX4 A;  3PM1 A;  4CCK A;  2H6C A;  1V54 H;  2W24 A;  4BE2 A;  2RDP A;  3CP8 A;  2DFE A;  1FEX A;  3BR6 A;  2EIK H;  4IQ4 A;  2BBY A;  2OTL I;  3HL2 A;  1VQ4 I;  1SD4 A;  2IGO A;  4U0Y A;  1XTA A;  5BS6 A;  2L2O A;  3R61 A;  2ZSI B;  2IAI A;  1X1A A;  1WHU A;  2ZXI A;  3HC7 A;  4FX0 A;  4AUX A;  1OCO H;  4D7M A;  5ILV A;  4GXO A;  3VYT B;  2X1D A;  2WB1 N;  1BR2 A;  1TWG J;  2L54 A;  4N4N B;  3BG9 A;  3M8E A;  3CDH A;  4EJT A;  1KON A;  2PI0 A;  1IXC A;  2A6H F;  2NNN A;  4M9S A;  1P4X A;  1F36 A;  1T98 A;  2HKX A;  2QSH X;  1UEL B;  3DFG A;  1IV8 A;  5M5X J;  2UXX A;  3HRS A;  4MIM A;  3RPU D;  5EGO B;  2R7R A;  4E7L A;  2ZME C;  2R7X A;  2YX7 A;  3G2B A;  3LA3 A;  4BY7 J;  4MTD A;  4A5M A;  3M1E A;  3S2D J;  2ISY A;  4L5E A;  4S04 A;  5L3C A;  2P5V A;  3WG9 A;  2KZG A;  3CMA I;  2H6B A;  3IUO A;  1ZYR F;  3CTA A;  5C3E J;  3BTC A;  5LHG A;  1ZRC A;  4A3I J;  3V8L A;  4RBO A;  1J2X A;  3CCL I;  1YIO A;  3RI4 A;  1YIJ I;  3LA7 A;  1MD0 A;  2FU4 A;  1GV2 A;  4V2F A;  3EQL F;  1U5T B;  1BC8 C;  4M6Y A;  1XC5 A;  2EZI A;  4CHU A;  2QWW A;  1TBD A;  1G3Y A;  1VQ9 I;  2VI6 A;  3O8G A;  3CUO A;  2VLA A;  3WTS C;  1JUS A;  5TIS C;  3VSL A;  1G2H A;  5GTI C;  2DA5 A;  4II3 A;  3WE3 A;  1LQ1 A;  3Q9S A;  5HDG A;  1PUF B;  2H8R A;  1IN7 A;  2Y9Y A;  4XMY A;  3RCO A;  2MAB A;  5JR3 A;  2E1C A;  1AWC A;  1R58 A;  3BZC A;  2P4W A;  1O7F A;  4HPQ A;  4I76 A;  3E97 A;  3TDZ C;  3TP3 A;  3WG7 H;  4PSX A;  3FIS A;  3DWL E;  1YLF A;  5JLW A;  3UKG A;  2CQX A;  2VUM J;  1U2W A;  1QGP A;  2QQ8 A;  2DMN A;  1YO5 C;  1FJL A;  2IGK A;  3F0C A;  3KE2 A;  2KDZ A;  5BNG A;  5F6F A;  1PDN C;  4HV5 A;  2FNP A;  2O7O A;  3PUF A;  2OJE D;  4MEY F;  2DLL A;  4WK8 F;  1P7J A;  4LB6 B;  1G6N A;  5J3L A;  1L3L A;  4FET A;  4N9H A;  2BW3 B;  3GTP J;  2CGP A;  4KW3 A;  3TP0 A;  1DU0 A;  1T56 A;  1ZAO A;  2ZJQ F;  4QTR A;  3R0A A;  1XB4 A;  1GXQ A;  1T38 A;  4DYC A;  5FB2 A;  2YU3 A;  4KA4 A;  2DCE A;  1GVJ A;  4C30 A;  2DXI A;  2O0Y A;  2KP6 A;  3TO9 A;  2D5V A;  3PFI A;  3RKQ A;  4X1E A;  3C18 A;  2R7W A;  2UUZ A;  2GOX B;  3LSJ A;  1R00 A;  2DFF A;  1KU9 A;  3CCS I;  1FBS A;  4ESB A;  4BHP A;  5D5V B;  2LD5 A;  4LIU A;  2E35 A;  3QP5 A;  1ZG3 A;  3MZH A;  1UMQ A;  2DMQ A;  4P9F A;  2CG4 A;  3OYH A;  1U6G A;  4BH9 A;  2WY8 Q;  1I50 J;  1RNL A;  2ID6 A;  4S05 A;  3TED A;  3QPL A;  5B66 C;  1W7P B;  3QU6 A;  3V7R A;  1FOW A;  4I2O A;  2GQQ A;  1A6Q A;  1MW7 A;  4ENN A;  2WV1 A;  5CJ9 A;  1UJ8 A;  3OS2 A;  3S17 J;  4GFB A;  2OQG A;  3VYS B;  2HI3 A;  3JCU C;  3TOB A;  3FDY A;  2X0L A;  3S2H J;  3OYC A;  2O3F A;  3HSF A;  2EQR A;  2LTP A;  5IYB J;  5M3M J;  5ILU A;  2VOO A;  4I02 A;  5FO5 A;  2MLG A;  3MKL A;  4U0V A;  2BY3 A;  4UUV A;  3PNY A;  2XKO A;  5DCM A;  1MBG A;  4BY1 J;  1SD7 A;  1KQ9 A;  3RIR A;  3I4M J;  1VI0 A;  3SZT A;  2A3S A;  2MH9 A;  2DMP A;  3BY6 A;  1D3Y A;  3RSN A;  5HS9 A;  5JVT A;  5BPI A;  5JFR A;  2IJL A;  4LLL A;  3SDG A;  2JA6 J;  1IW7 F;  2XDV A;  3OYK A;  4RB2 C;  5DDG A;  4XLF A;  1N75 A;  1XSX A;  5L3D A;  2K9S A;  3MN2 A;  3ZMT A;  1WSU A;  2DAO A;  2AXT C;  3CJQ B;  1VQP I;  1Z1D A;  4MTE A;  3I59 B;  4A3J J;  2EA4 A;  2UV1 A;  1BN5 A;  3PNT A;  3MWM A;  1X1B A;  5FRO A;  3I3L A;  1FLI A;  2XSJ C;  3HOT A;  4WF2 A;  3TW6 A;  4YG2 F;  3X2Q H;  2J5P A;  4HF0 A;  2NOG A;  2KIM A;  3W6J B;  5L3G A;  2DO7 A;  2FQ4 A;  3C2H A;  1IXR C;  2ZXW H;  1U8R A;  1E0E A;  2JA8 J;  3DU5 A;  2IS2 A;  4BEH B;  2TDX A;  3OIO A;  2XPW A;  5IPA A;  3RYP A;  3K69 A;  2R92 J;  1LFB A;  4KMF A;  4ZYA A;  2K9L A;  4BGD A;  3OYA A;  4XLE A;  4KNY A;  2BOL A;  3KEY A;  2VBY A;  3V7S A;  4IHX A;  1BW5 A;  1WRJ A;  1VQK I;  2JRT A;  2WA0 A;  3CDL A;  2WTE A;  2HOE A;  5E8G A;  2VKH A;  2DA4 A;  1ORK A;  2XGD A;  4XRS A;  4NQW A;  3JW4 A;  1W5S A;  2F5V A;  3GBG A;  3DBH B;  3GW2 A;  1PYV A;  1HST A;  2F4M B;  3GFL A;  4A3K J;  2FA5 A;  3G71 I;  1MDM B;  4AID A;  1SVM A;  4LMD A;  1DGR M;  2CUZ A;  3K4M A;  4PJ0 C;  1HW2 A;  3C7J A;  1XX5 A;  3D5S C;  1DUX C;  3S1N J;  2QQA A;  2JUC A;  3ML6 A;  1R22 A;  3OYJ A;  4FQG A;  3G1O A;  3DBL B;  5EZG A;  1UAA A;  5K7H A;  2BYV E;  1LDK B;  4LK0 F;  2IW5 A;  2R3S A;  2IS1 A;  4GO1 A;  2HPI A;  1K78 B;  1D8J A;  3WGG A;  4HDU A;  2O8K A;  1FBU A;  2AO9 A;  4ENJ A;  3B73 A;  1HLV A;  2FNA A;  4IRI A;  3J7A Y;  2DI3 A;  2HQ5 A;  4A0X A;  3GFI A;  1ZKG A;  1RZ4 A;  3M9A A;  2LR8 A;  2AXL A;  5IOZ A;  4WWC A;  5KNL A;  3Q0V A;  3PSF A;  2NVY J;  3PNV A;  3BG5 A;  2OV7 A;  5F0C A;  5EGO A;  3O8H A;  4Y52 J;  1XGS A;  4G9Y A;  1PP8 F;  1PJR A;  1K4S A;  3K4K A;  4WXD A;  2KRC A;  3K0L A;  3SDB A;  4ZYE A;  4EQQ A;  2L9V A;  5IYD J;  3CCJ I;  2JN6 A;  3EPZ A;  1Z7L A;  2FBI A;  2VT3 A;  1ZRD A;  2PQ8 A;  1K6O A;  2G7H A;  1T33 A;  3SXY A;  4JX4 A;  3ZQG A;  2R7F A;  1OJL A;  3ELK A;  4MQ9 F;  1W36 C;  2K9M A;  2W82 A;  1I1G A;  2HS5 A;  4M3D A;  3HXL A;  2PX9 A;  1LJ9 A;  5D6E A;  1M55 A;  5LGU A;  2V1U A;  1MMN A;  3MZY A;  3OYN A;  2NXN B;  3OIP A;  2ZJ2 A;  2RNG A;  3HSR A;  2E71 A;  1S29 A;  3F3X A;  2XRN A;  3MKW B;  1PP7 U;  1PUF A;  4CO8 A;  4CGZ A;  2E1N A;  1OLT A;  4BNC A;  1Z0X A;  1P4W A;  2C6Y A;  2ZME B;  2RN7 A;  4B44 A;  1R9T J;  3KEQ A;  2VPL A;  2HWV A;  3IH2 A;  5GPC A;  3CC7 I;  3LFK A;  4LG3 A;  5DM7 F;  3M8F A;  2L02 A;  1VF9 A;  2JWT A;  1NK3 P;  3L2C A;  2A61 A;  4DYQ A;  4OAZ A;  3MKY B;  4CCL A;  3FMS A;  4F91 B;  2LY2 A;  1Z9C A;  1Y6I A;  3CMM A;  4YRV A;  4LK1 F;  2O9L A;  2BW3 A;  3RKW A;  1HOM A;  3ZMS A;  1BW6 A;  2A5Y B;  5DTD A;  2CQ7 A;  3HUG B;  2H1K A;  2XGC A;  2P7V B;  1MMA A;  4I98 B;  2FJ1 A;  2DJN A;  3WHC A;  3F22 A;  2K4J A;  3BTL A;  2M9H A;  3FK7 A;  3NAU A;  4XLN F;  1D5V A;  1I6X A;  4R1H A;  4KIB A;  5DYM A;  1MBF A;  3BJA A;  2L9R A;  1MSF C;  3M07 A;  1WJF A;  1W7P A;  1E2X A;  5K7Z A;  1R5I D;  1YRN B;  2M1B A;  2EFP A;  2RAE A;  3EUK L;  1QO0 D;  2XF5 A;  2YU9 J;  2O61 A;  2VAS A;  1IC8 A;  3LA2 A;  2L4A A;  4XOT A;  5F1J A;  4AWX B;  3GTG J;  1ON2 A;  2Q1Z B;  3LST A;  3GX4 X;  2XGE A;  2BY1 A;  2K4B A;  2DOD A;  3N4M A;  2QSF X;  2P0W A;  3LSR A;  4N0B A;  3PUB A;  2ME0 A;  4HX4 A;  4ZZD A;  1Y8Q B;  3OS1 A;  1WJC A;  2VOP A;  4KFC A;  2DA6 A;  2FBH A;  1R4N B;  2LG4 A;  1TQI A;  1VQ6 I;  2R7Q A;  1NH3 A;  4OAY A;  4ON0 A;  4B47 A;  2E1M C;  5DEQ A;  1RI7 A;  2ZFW A;  3Q0W A;  2Q8K A;  1QBJ A;  1UCR A;  5EJC A;  4C3H J;  2MGQ A;  5DUI A;  3K1M A;  4G6T B;  3GCM A;  3GFJ A;  3IRQ A;  2FX0 A;  3OYD A;  4PCQ A;  2FQ3 A;  1IN6 A;  4BQA A;  4HX7 A;  1V55 H;  2LF7 A;  2JMW A;  4CXF A;  1LEA A;  4C2U A;  3DPT A;  4EGY A;  1XMX A;  2QQ9 A;  4XLH A;  2MG4 A;  3H3U A;  1D8K A;  2QUF A;  3HGY A;  3O3K A;  3OYB A;  2DMU A;  3GO5 A;  3I59 A;  4DBQ A;  2DMT A;  5TRD A;  4Y13 A;  1ZEL A;  2KKO A;  5HNF A;  4IRG A;  2FXA A;  2EIL H;  5IY5 H;  1LUJ B;  4A6E A;  2MFZ A;  4PSW A;  2Z5U A;  3FF5 A;  3JRE A;  4M73 A;  3K4J A;  3N97 A;  2QCO A;  1B9N A;  3FHZ A;  4QPQ A;  4IOC F;  4Y15 A;  2WV0 A;  2DT7 B;  2H1L A;  4FE7 A;  4ANJ A;  3S93 A;  3QPH A;  3U9G A;  4Y4R A;  1I6H J;  2X6X A;  2R5Z A;  4X6A J;  3GME A;  4PJM A;  1R49 A;  2CFO A;  4BEH A;  4OMY A;  1RKT A;  1VZ0 A;  2PFB A;  5F08 A;  1W4M A;  3EYI A;  3R0J A;  1E3P A;  2K3P A;  3CZ6 A;  1T0F A;  3QQA A;  3JRD A;  1LVA A;  4DNC A;  3M1C A;  4A0Y A;  2M0M A;  5KAI C;  1MMD A;  2B0L A;  4EJU A;  4D7N A;  2Q2E B;  4J00 A;  1MND A;  1Z6R A;  1EH8 A;  2LKX A;  3BC8 A;  4ZC3 A;  3KYD B;  2Y0S N;  1ZK8 A;  3CUQ B;  3DEE A;  5H2F C;  5C4J J;  4RLF A;  4HST A;  1JE8 A;  1J59 A;  5E79 C;  5ED4 A;  2CFX A;  2ELK A;  4PFP A;  1TWA J;  1QNT A;  2VOD A;  3IH3 A;  4PJN A;  1MDM A;  2HTS A;  3HSE A;  1JT6 A;  2VKD A;  3NWS A;  4RGX A;  3DPU A;  4BQN A;  4BBS J;  1WZ2 A;  3DBR B;  5LEK A;  2VQC A;  3GFM A;  3I71 A;  3K4C A;  2TCT A;  3C1D A;  3W3C A;  4A3F J;  2EZL A;  2GAU A;  4M3G A;  1DDN A;  3H9Q A;  4RGS A;  4UY8 I;  3DLA A;  1VQ8 I;  4Q5S F;  4BS9 A;  2W4S A;  4LIF A;  2B7E A;  3RKY A;  1K78 A;  1B59 A;  3BWG A;  5EEG A;  3I56 I;  2JA5 J;  1IZ1 A;  4LLG F;  2IA2 A;  2H09 A;  1A5J A;  1CGP A;  2P6S A;  2IA1 A;  3W2V A;  2HVR A;  5GAH J;  2L7K A;  4Z2Y A;  4PGG A;  5DCF A;  3P9I A;  3PJR A;  4QLC U;  2Z3Y A;  2K02 A;  1FYM A;  4U0W A;  4ITV A;  1KQ8 A;  2LP0 A;  1MBK A;  2ZSH B;  4LIT A;  2DOA A;  4XRF A;  1UUT A;  3IP4 B;  1Z91 A;  4QWQ A;  1SVO A;  2QQB A;  1EV7 A;  2DJI A;  4MFE A;  2Z16 A;  2QA4 I;  1F43 A;  1RZ9 A;  1J9I A;  3FXQ A;  2EBI A;  4UVB A;  5TJJ A;  2BVM A;  3L7W A;  2LBF B;  4CZZ A;  4EMS A;  2L9S A;  2COB A;  1U3E M;  4MEX F;  1QU3 A;  4G7O F;  2FSW A;  4ETS A;  2B63 J;  4A3C J;  3Q3S A;  4UUT A;  3OYE A;  1K61 A;  3FXU A;  3S3M A;  4FTH A;  5EG0 B;  3IKV A;  1FOY A;  3V8K A;  4ENM A;  3QOE A;  3E6C C;  1ETK A;  5CQE A;  3CCR I;  1V5E A;  3W2A A;  4XOP A;  3BT9 A;  1FP1 D;  4ZJZ A;  4N4O B;  1LVK A;  2OD5 A;  2R7V A;  4A12 A;  2CSO A;  1JUP A;  3IV5 A;  5BPD A;  1SAX A;  2ZME A;  3A02 A;  5F04 A;  2HOT A;  2W25 A;  3NWT A;  3VPR A;  4KIS A;  2JPB A;  1UHM A;  2NS8 A;  1Y0U A;  2PMH A;  1S8N A;  5EEA A;  2K7L A;  3FBI B;  1UG0 A;  2I5U A;  4LD5 A;  4D5C A;  1WQ2 A;  2HOA A;  1J5Y A;  3EUH A;  5B1B H;  4ZYD A;  3DKY A;  1TZL A;  5E17 F;  1NG7 A;  4WXH A;  1JGG A;  3HUG A;  1E3H A;  2N8G A;  1EH6 A;  2RVC A;  3VYU B;  2CUE A;  3AG1 H;  2BHY A;  2L7M P;  4V2G A;  3O2P E;  2L01 A;  1IN4 A;  4WCG A;  5D8L B;  4HOB A;  4P96 A;  2M4G A;  1K4T A;  4YEL A;  2YR2 A;  1MMS A;  2ECB A;  1HDD C;  1HA8 A;  4KIT B;  1MJB A;  1A6I A;  2GA1 A;  4E6K G;  3E6D A;  4Z6Y A;  5FRN A;  1VQ7 I;  2R93 J;  3L2W A;  1YRN A;  1KA8 A;  1RR8 C;  3TL4 X;  1ZLK A;  4DIQ A;  3VOE A;  2HZD A;  4LIV A;  4XLC A;  4AD9 A;  3C2G A;  4A0Z A;  1JJ8 C;  5CPR B;  1QPI A;  4XNF A;  1GHC A;  1DGW Y;  1D0Z A;  1JGS A;  2A6E F;  4CH7 A;  2NVT J;  2WAQ N;  2QF7 A;  4A93 J;  1I3Q J;  2ESN A;  1FOX A;  2FOK A;  1VQL I;  4IEJ A;  3CC4 I;  1R7J A;  3DTE A;  4HZF A;  3ROU A;  3V42 A;  2YSR A;  2P8T A;  3H5N A;  4EEF G;  1YS6 A;  4A2U A;  2M87 A;  2X4H A;  4Y33 A;  1Z7U A;  2VC1 A;  4GYI A;  4ESF A;  1E17 A;  4OIR F;  1BC7 C;  2ESH A;  2CV2 A;  1OKR A;  3RTR A;  1IDY A;  4FGN A;  3J81 K;  3LAJ A;  4BQO A;  5LHI A;  2VT2 A;  3WU2 C;  4M72 A;  3Q9V A;  1ZN2 A;  3GVA A;  2EPF A;  3B6C A;  1BI2 A;  4XID A;  1USS A;  1JHH A;  2K3F A;  1MBJ A;  4PFO A;  4Y17 A;  2ICW G;  5E18 F;  2W00 A;  3KZY A;  1HXD A;  5D5U B;  3KZZ A;  4ABZ A;  1QVT A;  1S6L A;  5LGN A;  4CCN A;  4FCY A;  2E60 A;  3F8C A;  4AIK A;  2PMZ N;  2K40 A;  1D1A A;  3QYB A;  5J1U A;  4XSX F;  2A5W A;  4C2T A;  1H8A C;  4BHB A;  5FKN A;  3CCY A;  3G4S I;  4J19 A;  4P55 A;  5AIP A;  3ZMU A;  2W57 A;  1L2M A;  2EZH A;  4G7H F;  3FZV A;  2UXN A;  3LSG A;  2LYC A;  2DPU A;  5E8I A;  3ZN1 A;  2M2E A;  1HBX G;  3BTJ A;  2XAJ A;  3VYR B;  5KAF C;  4RB1 A;  2EV6 A;  2V79 A;  3L2U A;  4BDY A;  3RYR A;  2L0K A;  3B02 A;  1FWZ A;  4RAY A;  3G1L A;  3OOP A;  3K1P A;  1TWC J;  2OZU A;  5D6F A;  3P5J A;  4A3B J;  2ZNY A;  1AKH B;  2BZT A;  3HM5 A;  4KUM A;  1YE9 A;  1Y1V J;  2NVX J;  2Q2E A;  5LGT A;  3HEF A;  3PQJ A;  5K5Q A;  4B43 A;  3CUQ A;  2VBW A;  5DM6 F;  1D0Y A;  4KN4 X;  1G3S A;  5HS8 A;  5DD4 A;  4FX4 A;  3MQ0 A;  1TWH J;  3LSK A;  3CP2 A;  1ETV A;  3FMR A;  5E20 A;  4EV0 A;  3S1M J;  1IUY A;  1FNN A;  4UB6 C;  2DK5 A;  2V4J C;  2XPU A;  3SEZ A;  4IHY A;  4QSH A;  4RM2 A;  2H27 A;  1HF0 A;  3ECO A;  3S8P A;  2UWM A;  2VL8 A;  1SFU A;  3AL0 B;  1VTN C;  1HDP A;  2XV4 S;  4GYG A;  1WFX A;  4G12 A;  4R8H A;  1RUN A;  4RLQ A;  4JOM A;  2QKM B;  1R23 A;  2IGN A;  1EF4 A;  2CUJ A;  2V9V A;  3FX3 A;  4HX8 A;  3WU1 B;  1LNW A;  2M8E A;  2STW A;  4A5N A;  4A3D J;  3OR2 C;  4EM0 B;  5J47 A;  4L9T A;  1GXP A;  1TW2 A;  2EB7 A;  5GPA A;  3O6B B;  1R5H A;  2DT5 A;  3DU6 A;  3DQV C;  3F8B A;  4BYY A;  1MJA A;  1LE8 B;  2RNJ A;  3DV8 A;  1PVE A;  3F6O A;  3HPH A;  1X58 A;  1WH7 A;  2RKH A;  1ZGJ A;  2XB5 A;  2OCC H;  2QEX I;  1B6A A;  5H6Q A;  4NC7 A;  5HOD A;  3ZP5 A;  2LLK A;  2X51 A;  3HOW J;  3H0G J;  5FGM A;  1ZR2 A;  1ZQ3 P;  2ITJ A;  2DOE A;  4IQJ A;  1XSV A;  1I3A A;  3NAR A;  2JPC A;  4KIC A;  2QM3 A;  3HKZ A;  4I0A A;  3ZQH A;  2IS4 A;  5B5E C;  2KRH A;  1F08 A;  2XF6 A;  5M3F J;  3E5Q A;  2HYG D;  2GLO A;  1U9O A;  1HKQ A;  2XB0 X;  2CMP A;  3GTL J;  2GXA A;  3QN2 A;  1BOB A;  2F2E A;  4YIR X;  1A35 A;  1XCV A;  3HOS A;  1JHF A;  2IBD A;  2LBF A;  1XGN A;  2EZK A;  3F9K A;  3RZD J;  1YG2 A;  2M7A A;  5CVJ A;  4BKX A;  2GBY A;  3H5A A;  2PJR B;  3CO7 C;  4A69 C;  2HR3 A;  3JRH A;  4KIG A;  1WJE A;  1YX3 A;  3CES A;  2V1D A;  3A0H C;  3ECH A;  2VQH A;  5EG0 A;  5GP9 A;  1BOA A;  3ASN H;  4AIH A;  2R5Z B;  2GWR A;  4RM3 A;  1FP2 A;  3ZPL A;  3GLX A;  1K6Y A;  4ZQ9 A;  3TGN A;  1OFC X;  3TKY A;  3CDI A;  1Z3X A;  1TC3 C;  1MH4 A;  4B1R A;  3ABM H;  4P9U A;  3WU0 A;  2ZNZ A;  2VB6 A;  1TNT A;  3LQQ A;  2XPV A;  1UZC A;  2L7F P;  3A4C A;  2CW0 F;  3FXO A;  2VKV A;  2V9P A;  3AAF A;  1VND A;  1S9H A;  3ASO H;  5LRS A;  1BJA A;  2XKP A;  5LD2 C;  2VIX A;  2R4G A;  3PQK A;  2CW8 A;  3K4B A;  3FM3 A;  3T0Y A;  2B9S A;  2R7D A;  1OCC H;  4F92 B;  1ZH5 A;  2RGV A;  3I4P A;  3HOY J;  2EV0 A;  3BRO A;  3KIO A;  4HLX A;  2P5K A;  4MNU A;  2WBM A;  2XVC A;  1ZGW A;  4XBF A;  3S14 J;  2ZO4 A;  5E3M A;  2HTJ A;  1MSE C;  1SMT A;  4KDP A;  1SFK A;  2RRE A;  3FK6 A;  3FWE A;  1O7L A;  4O3M A;  3E3V A;  2MD5 A;  2CRG A;  4MHG A;  1VQM I;  1T39 A;  3K7A J;  2WC2 A;  4X0G A;  2BY2 A;  3OYF A;  2CUF A;  4D9J A;  3MFK A;  3DKW A;  4HNU A;  1ZGA A;  3GEZ A;  3GZ5 A;  5J1R A;  2CQN A;  5M5Y J;  3TW7 A;  4Q47 A;  3HOZ J;  3OS0 A;  3KP4 A;  4D1Q A;  1X2N A;  2DQR A;  5DV5 A;  1IG7 A;  3DKX A;  3SZG A;  3A2K A;  1L5I A;  2E36 A;  2F48 A;  3ERM A;  3L09 A;  4NC8 A;  2I8D A;  5GAE J;  1IRZ A;  4RS8 A;  1ETQ A;  5B1A H;  2EFN A;  2PBI A;  4B3A A;  4M3E A;  2NTC A;  1FTT A;  4IHT A;  2JRM A;  2CS3 A;  3BZ6 A;  2CV1 A;  5JI6 A;  1QVU A;  1MH3 A;  2WAF A;  1O4X A;  4HAM A;  3REO A;  3HZJ A;  2R5Y B;  1HQC A;  3J81 Z;  1DQU A;  2YPR A;  1VFC A;  2AQF A;  1IDZ A;  1ETW A;  1MBE A;  4OMZ A;  1FIA A;  1W1W E;  2A69 F;  1KZH A;  4FIS A;  5K7F A;  2BY0 A;  2F4I A;  2VN2 A;  1KGS A;  5IOY A;  5CKT A;  3OWT A;  3BP8 A;  4IL6 C;  3CJN A;  1FBQ A;  4I6Z A;  4RA2 A;  1BIA A;  4H0E A;  5FFX A;  2D2W A;  3D0S A;  4CYC A;  2Q0O A;  2F6C A;  1P7I A;  4UNO A;  2ZJP F;  4IHW A;  1X1P A;  2ITL A;  2DOF A;  3TMO A;  3OSG A;  1OPC A;  2GIV A;  3AG4 H;  2LSO A;  2Y69 H;  1B8I B;  2QYO A;  4HG2 A;  3ZMV A;  4CIC A;  5E1X A;  1R71 A;  1W0U A;  1VQ5 I;  4ZYG A;  4E7S A;  2M4K A;  5ERI A;  4JX5 A;  5JHU A;  4MQV A;  3WTY C;  1BIB A;  2E5N A;  5ICF A;  3M4O J;  3LMM A;  2RQP A;  3BCA A;  1AKH A;  3S1Q J;  3BR2 A;  4BE1 A;  3G3Z A;  1XMK A;  3OYL A;  4IO9 F;  2PJP A;  1JXS A;  1RR7 A;  3FXJ A;  2DPD A;  5J4V A;  2DT6 A;  3GZN B;  3ZQC A;  5EZH A;  4CSW A;  2QZ8 A;  1N77 A;  3FXK A;  3RPU A;  1YOV B;  2H94 A;  3G1M A;  5HVQ C;  5J8C A;  3EET A;  5BYG A;  3BG3 A;  4M74 A;  5J6X A;  1FZP B;  3HBL A;  1LPQ A;  1HKS A;  2L4M A;  2KRF A;  3OOU A;  2KIF A;  3QRF F;  4B48 A;  2GXB A;  2HYJ A;  3FIW A;  4E7I A;  2ZB9 A;  2DA3 A;  3F6V A;  4LMY A;  2R7T A;  1X3W B;  2KIQ A;  5DUK A;  1NG6 A;  2FML A;  3FXR A;  1LDJ A;  4W1U A;  2CH0 A;  5JHF A;  1XGO A;  4XSZ F;  2K27 A;  5KVR A;  4L0Z B;  2LDU A;  1KQ0 A;  1IRG A;  1LE8 A;  2KHM A;  3I55 I;  5F0H A;  2EV5 A;  3KLN A;  3SFZ A;  3IWZ A;  2PG4 A;  2Y2Z A;  4CDG A;  3M7G A;  3WTV C;  1GT0 C;  2CV0 A;  1OCT C;  1EKE A;  2EA2 A;  1D1C A;  1U5T C;  4UV8 A;  4DJA A;  2V26 A;  2EK5 A;  1UFM A;  2Y0S A;  2QBY B;  4U87 A;  1SD6 A;  1XG1 A;  3BQZ A;  1H9T A;  1Z3Y A;  3SFI A;  2HZT A;  1FY7 A;  2ZJR F;  3UNG C;  3ERE D;  5IP7 J;  1DPR A;  1IN8 A;  3MCZ A;  3E0J B;  3PFY A;  3ZGK A;  4HF1 A;  4RGR A;  3ESW B;  1Q1V A;  4K2E A;  4HLY A;  3BR1 A;  1D1B A;  3FM5 A;  2GA2 A;  3RZO J;  1ZAR A;  4BXX J;  1RPW A;  2CWE A;  2GIZ A;  2L9N A;  1X4P A;  1TNS A;  4YII A;  3H92 A;  4ZTF A;  4Y3O A;  1G4D A;  3ZOB A;  2Z2S B;  2AHQ A;  1XS9 A;  1IAW A;  2PJR A;  4ASN A;  4ENK A;  2F5E A;  2ELH A;  3QYF A;  1P6R A;  3LOC A;  1Z21 A;  1J7K A;  4GGG A;  3WHB A;  1X2M A;  2XAF A;  5GTH C;  5FKL A;  2JA2 A;  5L3F A;  2JVH A;  3P7N A;  4A3G J;  3MAJ A;  1D0X A;  2IVM A;  2GZW A;  1WJD A;  3TQN A;  2LY1 A;  4UVC A;  2LFB A;  2WAE A;  2D1V A;  1ZLJ A;  3BOQ A;  2R0Q C;  5J1Y A;  1T95 A;  1WVR A;  3MMY B;  4G94 A;  1IXS B;  2IA0 A;  2MH2 A;  3ULQ B;  4A3M J;  3WTU C;  2HXI A;  2EIN H;  5D4R A;  1ETX A;  5BQT A;  1WPK A;  1TP4 A;  3I53 A;  2P5L C;  4NBP A;  1OR7 A;  3I64 A;  3DEW A;  4II2 A;  1TT0 A;  4ZH4 F;  4O5V A;  4XON A;  1ZR4 A;  2E2J J;  4NDL A;  4AYB A;  2HQN A;  1TLH B;  2DN0 A;  4JP0 A;  4XKC A;  5LBQ A;  1YFH A;  2M0C A;  1UB9 A;  2OBP A;  4LGW A;  2XGX A;  3CCE I;  1MNM C;  4L0Y B;  3P9K A;  5FJ8 J;  1HW5 A;  1ETY A;  2IP2 A;  2PMU A;  2OTJ I;  1EA3 A;  3RQI A;  3L2Q A;  2V7F A;  3BDD A;  3ONQ A;  4RAF A;  4YFN F;  2I10 A;  3T8R A;  2FRH A;  4BUP A;  2V6E A;  3ABL H;  1R6R A;  2FF4 A;  3WGH A;  3G6E I;  3D1N I;  2MBF A;  4HEA 2;  4IVN A;  3ISP A;  1X4O A;  4Q4Z F;  1YW8 A;  5L3B A;  2Y75 A;  3RDI A;  3K1N A;  5E1Z B;  3JRI A;  3BTI A;  1ACI A;  1R36 A;  1Q1H A;  4M6X A;  2E5Z A;  2Y31 A;  4KT5 C;  2DK8 A;  4XN3 A;  2CQQ A;  3CCM I;  1YJW I;  2ME6 A;  2X6Y A;  3S3N A;  2OA4 A;  1SFX A;  1WJB A;  1ZTR A;  3BQY A;  4BHC A;  2LRD A;  2PN6 A;  5JVG F;  2M45 A;  3TDU C;  1J75 A;  4DGW B;  1S7A A;  1JJ6 C;  3HOU J;  4HDV A;  1J09 A;  4MFD A;  3I0T A;  2R5Y A;  2MW8 A;  3HJE A;  1MKM A;  4HYE A;  3LAP A;  3ZQQ A;  5D5W B;  1RIO H;  4F52 A;  4LLN A;  3GYH X;  2EIM H;  2E2I J;  5A2Q K;  5CLS A;  4FB3 A;  4BAC A;  1HSJ A;  1OMI A;  5AIQ A;  1VQO I;  3GWZ A;  1NTC A;  3PIO F;  3KCC A;  1H9G A;  1YS7 A;  1IO2 A;  2JUG A;  1NHA A;  2VJ4 A;  1SAN A;  5DD8 A;  2L7Z A;  2DTZ A;  2FOW A;  5D9I A;  1POG A;  3QK2 A;  4LOC A;  2X85 A;  4G8X A;  4XL9 A;  1K83 J;  2HGC A;  5KCM A;  4CYD A;  2Z33 A;  1QHH D;  1WGX A;  1V3F A;  2WB1 A;  1XMA A;  2BHZ A;  5F1R A;  2JT1 A;  2XRO A;  3VFZ A;  2D45 A;  5IP9 J;  5EYR A;  3HOV J;  1JTY A;  4OOI A;  1CF7 B;  2IT0 A;  4IKF A;  2DA7 A;  1KYW A;  4XLP F;  1T08 B;  3BPX A;  1B8I A;  2P7C B;  4L9V A;  3KP6 A;  2WAQ A;  3OL3 A;  1BA5 A;  1C0W A;  1YW9 A;  4L9J A;  1TQM A;  3F8F A;  3HRT A;  1K7A A;  1R5G A;  1WKM A;  4OIO F;  2JQ7 A;  3RPQ A;  3IHU A;  1MJ9 A;  1IRX A;  5FD5 A;  4TV7 A;  2BV6 A;  1YIT I;  1SFO J;  1N25 A;  3KPH A;  4C2M J;  5DCX A;  4F55 A;  2IXS A;  3J80 K;  2EWN A;  1DP3 A;  2Z99 A;  2KLO A;  2K86 A;  3VDX A;  3SQN A;  2D1H A;  2R7U A;  3K70 D;  4AM3 A;  2KIU A;  4IXA A;  5K5O A;  3U2R A;  2OPT A;  2JSP A;  4YEJ A;  3CCV I;  4EGZ A;  3HTU A;  3KET A;  1FYL A;  2DTR A;  4UV9 A;  4HF2 A;  4NC6 A;  3CC2 I;  2BXZ A;  3NRV A;  2EIJ H;  2H8W A;  2KPM A;  1U0J A;  2J5O A;  2QEN A;  4XRS G;  5J4Y A;  2ADU A;  2ZC2 A;  1EH7 A;  5EF6 A;  3S16 J;  2VQG A;  1ZHF A;  2LVS A;  4AVZ A;  2HOS A;  4GRI A;  3V7C A;  1LFU P;  5E1W A;  3E5U A;  3R6S A;  1ODD A;  4BQQ A;  4I01 A;  2E2H J;  4JQF A;  3JRA A;  5H6R A;  2NVQ J;  2G9W A;  2RV8 A;  2XAS A;  3LL7 A;  2F4O B;  5D5X B;  2PEX A;  4AU7 A;  3H3Z A;  5HDN A;  2FBK A;  4PGH A;  3IKT A;  1W0T A;  5HS7 A;  1E3O C;  4RAZ A;  2IPR A;  1JUM A;  2LRE A;  2XUB A;  1X1D A;  4BXU A;  2P6T A;  1MIJ A;  2VPR A;  1ZRE A;  2ZXH A;  2O03 A;  1AU7 A;  2NS0 A;  1HC8 A;  4OIQ F;  4O6J A;  1IRF A;  2PLY A;  4HV6 A;  2UZK A;  3GTO J;  2R7Z J;  4M71 A;  3OYI A;  1B9M A;  4C3I J;  3DTK A;  2QBY A;  2G7U A;  3L2R A;  2QLZ A;  3CME I;  1UHW A;  2ZKZ A;  3QU3 A;  2EFW A;  3R60 A;  4QPO A;  4JX6 A;  5M5W J;  2DYS H;  2HU9 A;  1IN5 A;  3M8J A;  1SAU A;  1Z67 A;  1IF1 A;  2DA1 A;  3K4L A;  3JRC A;  3BG7 A;  3BG6 A;  1T2K A;  5F0F A;  2M3A A;  3SZP A;  1M1E B;  3AG2 H;  3T8T A;  4YIF A;  5LHH A;  1KSX A;  4M9X A;  4F7Z A;  3BR5 A;  1FIP A;  1O57 A;  4E7K A;  1HKT A;  2CJJ A;  6PAX A;  4LFU A;  4N9I A;  5CVR A;  2CO5 A;  2KJC A;  3K6G A;  3QYE A;  4CYC B;  3HB9 A;  4PJL A;  1OQY A;  1TT5 B;  3LSH A;  3GZ6 A;  3EUH C;  1QHG A;  1TW3 A;  2MSY A;  3QWL A;  4F3Q A;  4CZC A;  3VB2 A;  1KSY A;  4XK4 A;  3S2W A;  1Z05 A;  5LFA A;  1W7P D;  4IOA F;  5EEH A;  1X3U A;  2V1X A;  1EJ9 A;  3T5X A;  1A31 A;  3OL4 A;  1RUO A;  2E1M B;  2FUG 2;  3FXM A;  4PUS A;  1IGN A;  3ZMZ A;  1BR4 A;  2JJ7 A;  1O3R A;  4GDF A;  4I09 A;  4HA8 A;  2LH9 A;  1FTZ A;  1X3Z B;  1LFP A;  2K9Q A;  5E3N A;  4AVP A;  2GOM A;  1OYY A;  5FFZ A;  2BEO A;  4XLA A;  4FAS D;  1NK2 P;  1QA6 A;  3HTS B;  4BXF A;  1B4A A;  1JKR C;  3TBI A;  1OIS A;  4ZDO A;  3KLO A;  2COM A;  3CLO A;  4JBA A;  5ICE A;  4UHT A;  3E6M A;  5GAD J;  1XDS A;  1F9N A;  1I5Z A;  5LLQ A;  1FMW A;  4I99 C;  1BL0 A;  3S1R J;  1P92 A;  2KFD A;  5FD6 A;  3L9F A;  3R4K A;  2XC7 A;  4KN7 X;  3F23 A;  3SYT A;  1Y56 A;  3GTK J;  3HYI A;  2X48 A;  2ECC A;  3JAM Z;  2E1O A;  1H89 C;  1FMV A;  4RB3 C;  1YX5 A;  3BR0 A;  5EDN A;  1YQA A;  3BCB A;  4KT6 A;  5CVV A;  3SEQ A;  3GUD A;  3K4N A;  2ELJ A;  3CMY A;  4BE0 A;  1OCZ H;  4HQE A;  1DU6 A;  3MEX A;  1ON1 A;  4PK4 A;  4MGR A;  2KL4 A;  2OC6 A;  1KYZ A;  2HQA A;  4F93 B;  3K2A A;  2VE9 A;  2W7N A;  1WI9 A;  1XN7 A;  3J7A O;  1K79 A;  3RQ4 A;  1GVD A;  4U7D A;  1STZ A;  2IPQ X;  2IRF G;  2HDC A;  3VWB A;  1BI0 A;  2Y48 A;  2QVO A;  2DYR H;  3K9T A;  4E7Z A;  3H0D A;  4CUG A;  2OU2 A;  1R1U A;  5IT9 K;  2DQL A;  2WAD A;  2QSG X;  1WCM J;  2HYF A;  3CCQ I;  4DZJ A;  2X6W A;  4ZZL A;  1KU2 A;  2ETH A;  3E5X A;  3OV8 A;  3T1B A;  2V9K A;  1WWX A;  4HNT A;  2LK2 A;  3ZXS A;  1XD7 A;  3IL2 A;  3W2W A;  3RJP A;  2JVG A;  4MLO A;  5A2Q Z;  3TO6 A;  3AKZ A;  4CCM A;  4L5J A;  2ZCW A;  2AS5 F;  2BVL A;  5JLX A;  3LFU A;  5HNH A;  3PO3 J;  3CF2 A;  2K5C A;  5HLH A;  2QKL B;  1X19 A;  3DP7 A;  2CQK A;  1FX7 A;  2M5W A;  4NB5 A;  3OYG A;  1WJ5 A;  3DLL F;  2IS6 A;  3CLQ A;  2MA3 A;  4G6D A;  4BJ5 C;  3ZMD A;  3OIQ A;  4AIJ A;  5LRR A;  3LSP A;  3E7L A;  3BZK A;  2HVQ A;  3QAH A;  3CUQ C;  2DA2 A;  5HLI A;  1O3S A;  1N78 A;  2LY9 A;  3I9V 2;  2AQE A;  3WTW C;  3F8M A;  3SJM A;  4R79 A;  1LKX A;  1CF7 A;  3HOX J;  2VE8 A;  1O3Q A;  5HLT A;  1ZG5 A;  3JTH A;  2KZV A;  2V1N A;  2MC3 A;  3HDD A;  3WTT C;  2KQR A;  3PO2 J;  2HDW A;  5CVU A;  1BR1 A;  2NRA C;  5D4S A;  2LMD A;  3NQO A;  3CJR B;  2DDB A;  2HEO A;  3EDP A;  4PZJ A;  3HG9 A;  4I7H A;  3J80 Z;  3DCF A;  1BBY A;  1QZY A;  2XRL A;  4DYR A;  5FRM A;  3ABT A;  4BL0 B;  1IV6 A;  2YS9 A;  4B3X A;  2ZBK A;  1G8X A;  1IJW C;  4A3L J;  1VQN I;  3HGG A;  4XOR A;  1RES A;  3H3V K;  2HXO A;  1OYI A;  4MO7 A;  3JRF A;  4NNJ A;  4DBR A;  1WJA A;  2F5D A;  2XHK A;  2KMU A;  5CVI A;  4CCJ A;  4E4H A;  3HKZ N;  4C3J J;  1YTY A;  4IF4 A;  2E34 A;  3QOP A;  5FLX Z;  3A03 A;  1TBX A;  1JT0 A;  5IYC J;  2XAU A;  3L2V A;  1B72 A;  2BXY A;  3VEP A;  1QRY A;  1Y1W J;  3VOD A;  3HRM A;  4EAT A;  3PSI A;  1XGM A;  3JTG A;  4OIN F;  3GF2 A;  5IT3 A;  2BE5 F;  5E3O A;  1YJ9 I;  1KU3 A;  4UUS B;  2M7B A;  1UHS A;  3IC7 A;  3H9J A;  3KX2 A;  2K9N A;  3MZ8 A;  1T8I A;  4CA0 A;  3GTM J;  4RB0 A;  4ZDL A;  3CF5 F;  2DFH A;  2VJ5 A;  3WTX C;  4DW6 A;  1HW1 A;  1S5L C;  1UST A;  2JA7 J;  4V19 K;  2KT0 A;  3KZI C;  2Y0M A;  1U9N A;  4AC0 A;  1IUF A;  1FPQ A;  5HOO A;  1G59 A;  4HRI A;  4A6D A;  5K1Y A;  5BMZ A;  1O3T A;  2GM4 A;  3QP6 A;  4LB5 A;  3BR3 A;  1AOY A;  3JRG A;  5TGT A;  4LG0 B;  2M30 A;  5F27 A;  2VON A;  2DW4 A;  1R1V A;  5C44 J;  4IHV A;  1J0R A;  3A01 B;  4HQM A;  4RMN A;  1YHQ I;  1A04 A;  1KU7 A;  4Q48 A;  1S3J A;  2HFH A;  4A3E J;  4U7B A;  4IX7 A;  1XPX A;  3DF8 A;  4DQ2 A;  3U1K A;  1AA7 A;  4FT8 A;  4B4C A;  1FC3 A;  4IJA A;  3I4N J;  1JKP C;  3QFQ A;  1TTY A;  4XKB A;  1W5T A;  3IWF A;  2R7S A;  2K85 A;  1U5T A;  1ZRF A;  4G6Q A;  2CU7 A;  4XKW A;  4YFX F;  3AG3 H;  1ZG1 A;  2OF7 A;  3IRR A;  2VXZ A;  2NL8 A;  2WY7 Q;  1S7O A;  2V6C A;  1T6S A;  4HBL A;  2VBX A;  2MD0 A;  1LEB A;  2MYS A;  1YW7 A;  3I54 A;  5CQG A;  2XSD C;  1V5F A;  3V8J A;  4OIP F;  1B1B A;  2IF9 A;  2MLK A;  4J01 A;  5FKO A;  3DEU A;  4P1W A;  2W84 A;  2Z1D A;  3ZCO A;  4EJO A;  1BJZ A;  3HIF A;  2G0E A;  2HNH A;  4XR6 A;  2A6T A;  4QIW N;  3GTQ J;  3K2Z A;  3ZN0 A;  3CD6 I;  4BBR J;  5ICG A;  2LF8 A;  3W6K B;  3GLL A;  2BGC A;  1RKW A;  3OYM A;  4UB8 C;  3K10 A;  2NAZ A;  1W5C C;  1U8B A;  3LSI A;  3OY9 A;  2OQR A;  3J7Y J;  3K70 C;  2JTV A;  4OWR B;  1F4K A;  2ACJ A;  5BOX A;  1OCP A;  3LWF A;  4PJJ A;  5ILS A;  4BJT A;  1SC7 A;  3WE2 A;  1GV5 A;  2KJB A;  3COA C;  2A07 F;  1WI3 A;  3NEU A;  1Z77 A;  1LDD A;  5ICC A;  1PUE E;  3LSM A;  3ZRG A;  1MMG A;  2MC4 A;  2FUF A;  1V5G A;  4ESJ A;  2CW7 A;  2VC0 A;  3OR1 C;  1HCR A;  2TBD A;  5IT9 Z;  5J40 A;  3UR3 C;  2FMY A;  1FOK A;  4M9Z A;  2E7X A;  1I27 A;  2EFO A;  1BM9 A;  4NBQ A;  3DXJ F;  4E7J A;  3DPL C;  3D5L A;  2STT A;  3SHF A;  2HKO A;  3MD2 A;  2NVU B;  4RDU A;  3GTJ J;  3H9G A;  2DFI A;  3ABK H;  4C9Y A;  4G7Z F;  3HRU A;  5K5R A;  2RQQ A;  4XKV A;  2KIS A;  2Z9O A;  2O6G E;  2VBZ A;  3A1Y A;  3Q5F A;  3MVP A;  4LJZ F;  3U1D A;  1ETO A;  1ITY A;  3FBN B;  3JRB A;  2YUS A;  2TRT A;  3EYY A;  3F8N A;  1FYK A;  2DU9 A;  3IH4 A;  1ONV A;  3FXL A;  3WTZ A;  3H35 A;  3TO7 A;  1GDT A;  3I5U A;  3V4G A;  2NNY A;  3S15 J;  2DBB A;  1LB2 A;  2M34 A;  2W1O A;  2XIG A;  3ZR8 X;  3OMY A;  2OZ6 A;  1Y0N A;  2XF7 A;  3KYC B;  3HHG A;  3WOD F;  4EVI A;  2Y9Z A;  2X6O A;  2VKE A;  4UVA A;  2O5R A;  2P81 A;  2FEZ A;  2OAZ A;  4PDK A;  4E70 A;  1MNE A;  1H0M A;  1P2F A;  3FHN A;  3B6A A;  1GLN A;  1SEU A;  5E3L A;  3AFH A;  3JSP A;  4BU2 A;  5IP6 A;  4BJ6 C;  1JKQ C;  1TQP A;  3CCU I;  3H36 A;  1Y39 A;  4XIC A;  1D5Y A;  3AL0 C;  4HW0 A;  3KP3 A;  3IAS 2;  5AON A;  2DDA A;  2X1C A;  1FSE A;  3FMQ A;  4JK1 X;  3KP2 A;  3ZQ7 A;  5J8F A;  3L00 A;  2GXG A;  1G3W A;  4FHT A;  3JR9 A;  1SMY F;  2M8G X;  1YJN I;  3LNQ A;  2ZFU A;  1BI1 A; 
#chains in the Genus database with same CATH homology
 3S32 A;  4BQQ A;  4NC7 A;  3E1S A;  2IGM A;  3EUA A;  2X51 A;  3IAM 2;  4JQF A;  1W36 C;  2K9M A;  2VJI A;  2W82 A;  4HSR A;  4E7H A;  2ITJ A;  3LL7 A;  4IQJ A;  2VJJ A;  2R7O A;  4AU7 A;  3HXL A;  2IPR A;  1M55 A;  3HPG A;  2LRE A;  3HKZ A;  2IS4 A;  1MMN A;  2KRH A;  1X1D A;  4NUB A;  3OYN A;  1F08 A;  2XF6 A;  3OIP A;  3S3O A;  2RNG A;  2ZXH A;  3MKW B;  2CMP A;  2L5Q A;  1OLT A;  3QN2 A;  1BOB A;  3HOS A;  4B44 A;  2LBF A;  2VPL A;  3F9K A;  3OYI A;  2M7A A;  4IZZ A;  4LG3 A;  3H5A A;  3DTK A;  3L2R A;  2PJR B;  1WJE A;  1YX3 A;  4OAZ A;  3MKY B;  3CES A;  2KDO A;  4CCL A;  2VQH A;  4F91 B;  2LY2 A;  2NOJ B;  4XM3 A;  4QPO A;  2HU9 A;  1Y6I A;  4ZTJ A;  3CMM A;  3M8J A;  1SAU A;  4YRV A;  3K4L A;  4XN0 A;  2BW3 A;  3BG7 A;  3BG6 A;  4RM3 A;  2M3A A;  1KSX A;  1K6Y A;  4ZQ9 A;  4E7K A;  4KJZ A;  3HUG B;  1Z3X A;  1MMA A;  4P5O A;  3DTI A;  4DOZ A;  3K6G A;  2VB6 A;  3QYE A;  4XQF A;  3A4C A;  4PJL A;  2VXD A;  3LSH A;  3EUH C;  1QHG A;  1S9H A;  4CCO A;  1P9Q C;  3U21 A;  4F3Q A;  4CZC A;  5CYN A;  1KSY A;  1WJF A;  2VIX A;  5LD2 C;  2R4G A;  2CW8 A;  3K4B A;  5LFA A;  2VQL A;  4H4K C;  1W36 D;  3EUK L;  1T0F C;  3N05 A;  4F92 B;  2XF5 A;  2VAS A;  3OL4 A;  2E1M B;  2FUG 2;  2LC2 A;  4PUS A;  1BR4 A;  4XOT A;  4GDF A;  2WBM A;  2LH9 A;  2Q1Z B;  2HPM A;  1LFP A;  1R9W A;  2GOM A;  1OR7 C;  4FAS D;  1SFK A;  2P0W A;  2RRE A;  3PUB A;  4XLA A;  4BXF A;  3OS1 A;  1WJC A;  1Z1D B;  3TBI A;  4ZDO A;  4BDZ A;  2LG4 A;  2LOO A;  4X0G A;  2R7Q A;  3OYF A;  4ZDP A;  4D9J A;  4OAY A;  3VSK A;  3QOD A;  2E1M C;  4B47 A;  4HNU A;  1FMW A;  3KYL A;  3OS0 A;  4G6T B;  2XC7 A;  3H5R A;  4D1Q A;  3SYT A;  1Y56 A;  3OYD A;  3DKX A;  3SZG A;  3A2K A;  1L5I A;  1FMV A;  4C2U A;  2X1E A;  4NC8 A;  3DPT A;  2I8D A;  1YX5 A;  4XLH A;  3MKZ A;  3BCB A;  3OYB A;  4KT6 A;  3SEQ A;  4DBQ A;  3K4N A;  2ELJ A;  2NTC A;  4BE0 A;  2CS3 A;  2CV1 A;  4PK4 A;  2HVS A;  1ZEL A;  2KL4 A;  2OC6 A;  2WAF A;  5HNF A;  2HQA A;  4F93 B;  2W7N A;  2MFZ A;  3D5R C;  4PSW A;  1DQU A;  3K4J A;  3RQ4 A;  2AQF A;  2PMZ A;  4QPQ A;  4NQW B;  1JI8 A;  2DT7 B;  1X1C A;  4ANJ A;  3FKJ A;  3S93 A;  3VWB A;  4Y4R A;  2HW0 A;  3PL8 A;  5KHD A;  3BLY A;  2F4I A;  2X6X A;  4E7Z A;  3H0D A;  1ERD A;  4PJM A;  4CUG A;  2CFO A;  4BEH A;  1VZ0 A;  4ZO0 A;  2WAD A;  5CKT A;  3OWT A;  2OUM A;  2K3P A;  3CZ6 A;  2X6W A;  4CCK A;  3M1C A;  2M0M A;  1MMD A;  2Q2E B;  2V9K A;  4J00 A;  1MND A;  4BE2 A;  2F6C A;  3BC8 A;  4ZC3 A;  3CP8 A;  3ZXS A;  4HNT A;  3DEE A;  3W2W A;  4IQ4 A;  2ITL A;  2JVG A;  4MLO A;  4RLF A;  3TMO A;  4HST A;  3AKZ A;  4CCM A;  3HL2 A;  2IGO A;  2BVL A;  2L2O A;  3LFU A;  2ZSI B;  5HNH A;  3CF2 A;  4HG2 A;  4PFP A;  1X1A A;  2K5C A;  2ZXI A;  3HC7 A;  2QKL B;  1X19 A;  4PJN A;  3VYT B;  2X1D A;  1BR2 A;  2M4K A;  4E7S A;  3OYG A;  3NWS A;  2VKD A;  4N4N B;  1WJ5 A;  2E5N A;  3DPU A;  4BQN A;  2IS6 A;  3LMM A;  3BCA A;  4BJ5 C;  2VQC A;  3K4C A;  3OIQ A;  3W3C A;  4BE1 A;  1KON A;  2HVQ A;  3H9Q A;  3OYL A;  1N78 A;  3I9V 2;  1UEL B;  2AQE A;  3DLA A;  2DT6 A;  4BS9 A;  3RPU D;  4CSW A;  4R79 A;  1LKX A;  2R7R A;  4E7L A;  1N77 A;  2W4S A;  2R7X A;  4LIF A;  3G2B A;  5HVQ C;  5HLT A;  5BYG A;  2KZV A;  2V1N A;  3IUO A;  3OOU A;  2KQR A;  3W2V A;  2HVR A;  2HDW A;  1BR1 A;  2L7K A;  4B48 A;  3CJR B;  3PJR A;  4E7I A;  3HG9 A;  2R7T A;  1NG6 A;  5FRM A;  4BL0 B;  4ITV A;  2CH0 A;  1TBD A;  2ZSH B;  4LIT A;  4B3X A;  1G8X A;  2DOA A;  5JHF A;  2VLA A;  3VSL A;  1UUT A;  3IP4 B;  4XOR A;  4II3 A;  2KHM A;  2DJI A;  4XMY A;  3RCO A;  2MAB A;  4NNJ A;  4DBR A;  2Z16 A;  1WJA A;  4HPQ A;  2CV0 A;  2KMU A;  4CCJ A;  4PSX A;  4E4H A;  1RZ9 A;  3DWL E;  1D1C A;  2BVM A;  2LBF B;  2L9S A;  2XAU A;  2V26 A;  4DJA A;  1QU3 A;  3L2V A;  2IGK A;  2Y0S A;  4U87 A;  4EAT A;  1Z3Y A;  3OYE A;  3PSI A;  3UNG C;  3S3M A;  3E0J B;  3PFY A;  3ZGK A;  3QOE A;  4FET A;  2BW3 B;  2M7B A;  5CQE A;  4KW3 A;  1D1B A;  1V5E A;  3W2A A;  4XOP A;  3H9J A;  3KX2 A;  4CA0 A;  4ZJZ A;  4N4O B;  1LVK A;  2R7V A;  4ZDL A;  2DCE A;  2VJ5 A;  4C30 A;  2DXI A;  2KP6 A;  2L9N A;  1X4P A;  4ZTF A;  3NWT A;  2R7W A;  4Y3O A;  2UUZ A;  2GOX B;  2Z2S B;  4KIS A;  2PJR A;  3QYF A;  5HOO A;  3FBI B;  1UG0 A;  1G59 A;  4HRI A;  4LIU A;  1Z21 A;  3OYH A;  2WY8 Q;  5TGT A;  3DKY A;  1TZL A;  2JA2 A;  2JVH A;  1NG7 A;  1D0X A;  1WJD A;  2LY1 A;  4RMN A;  3VYU B;  2WAE A;  1MW7 A;  4U7B A;  3OS2 A;  4IX7 A;  1T95 A;  3MMY B;  3VYS B;  1AA7 A;  3FDY A;  4NBP A;  2M4G A;  3OYC A;  4YEL A;  3QFQ A;  4XKB A;  1HA8 A;  4II2 A;  4KIT B;  4E6K G;  1TT0 A;  5FRN A;  2R7S A;  4XON A;  3PNY A;  4AYB A;  3L2W A;  3TL4 X;  4XKC A;  4XKW A;  4DIQ A;  3RSN A;  2HZD A;  4LIV A;  4XLC A;  2VXZ A;  3C2G A;  2NL8 A;  5CPR B;  4XNF A;  2XDV A;  2WY7 Q;  1D0Z A;  1DGW Y;  4CH7 A;  3OYK A;  4XLF A;  2MD0 A;  1N75 A;  2MYS A;  1EA3 A;  3L2Q A;  2V7F A;  5CQG A;  3ONQ A;  2V6E A;  3CJQ B;  1V5F A;  4BUP A;  1R6R A;  2IF9 A;  3DTE A;  4J01 A;  3V42 A;  2UV1 A;  3H5N A;  4HEA 2;  3PNT A;  2Z1D A;  4P1W A;  1X4O A;  4Y33 A;  3ZCO A;  2HNH A;  4XR6 A;  1X1B A;  5FRO A;  3I3L A;  2A6T A;  2XSJ C;  2CV2 A;  3RTR A;  3HOT A;  4FGN A;  4BQO A;  2E5Z A;  4XN3 A;  3OYM A;  4PFO A;  3C2H A;  3K10 A;  1E0E A;  2W00 A;  3DU5 A;  2X6Y A;  3S3N A;  3LSI A;  2IS2 A;  4CCN A;  4BEH B;  2E60 A;  1WJB A;  3OY9 A;  2LRD A;  3K70 C;  4OWR B;  1D1A A;  3QYB A;  2K9L A;  4ZYA A;  4DGW B;  4BGD A;  3OYA A;  4PJJ A;  4XLE A;  2BOL A;  3KEY A;  1J09 A;  2A5W A;  4C2T A;  4BJT A;  3ZQQ A;  1L2M A;  2WA0 A;  4F52 A;  2VKH A;  2LYC A;  3LSG A;  2F5V A;  3GBG A;  3VYR B;  3LSM A;  3ZRG A;  3L2U A;  1PYV A;  1MMG A;  2MC4 A;  4BAC A;  4BDY A;  2FUF A;  1V5G A;  4FB3 A;  2CW7 A;  3OR1 C;  2TBD A;  4LMD A;  1DGR M;  2JUG A;  2VJ4 A;  2CUZ A;  3UR3 C;  3K4M A;  5D9I A;  3D5S C;  4E7J A;  1YE9 A;  3QK2 A;  3DPL C;  3D5L A;  2X85 A;  4XL9 A;  5KCM A;  3MD2 A;  3OYJ A;  3H9G A;  1QHH D;  4B43 A;  2WB1 A;  1UAA A;  1D0Y A;  4C9Y A;  1LDK B;  2RQQ A;  4XKV A;  2IS1 A;  4IKF A;  2HPI A;  3A1Y A;  3LSK A;  3CP2 A;  3FBN B;  2WAQ A;  3OL3 A;  2V4J C;  3SEZ A;  4RM2 A;  3H35 A;  2UWM A;  3S8P A;  3J7A Y;  2VL8 A;  3AL0 B;  2W1O A;  1WFX A;  1IRX A;  3ZR8 X;  3OMY A;  5KNL A;  2XF7 A;  4RLQ A;  4JOM A;  5DCX A;  3PSF A;  2QKM B;  3PNV A;  2IXS A;  4F55 A;  2OV7 A;  2IGN A;  2KLO A;  2O5R A;  2CUJ A;  1DP3 A;  3VDX A;  1PJR A;  2R7U A;  3OR2 C;  1MNE A;  3K70 D;  3K4K A;  3SDB A;  2KRC A;  3FHN A;  1GLN A;  2JSP A;  3AFH A;  4YEJ A;  4BU2 A;  3DU6 A;  4BJ6 C;  3DQV C;  3AL0 C;  2KPM A;  1U0J A;  3EPZ A;  3IAS 2;  1Z7L A;  2X1C A;  3HPH A;  2VQG A;  4AVZ A;  4GRI A;  2ZFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...