3DL2A

Hexagonal structure of the ldh domain of human ubiquitin-conjugating enzyme e2-like isoform a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
303
structure length
289
Chain Sequence
GSSKSTVNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTLDTVTEKLQSSASSIHSLQQQLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Investigation Into the L-Lactate Dehydrogenase Domain of Human Ubiquitin-Conjugating Enzyme E2-Like Isoform A.
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Ubiquitin-conjugating enzyme E2 variant 3
total genus 100
structure length 289
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dl2A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3dl2A02
3B20A 5TLSA 4KOAA 1WZIA 2VCYA 3Q11A 5KVSA 4I1IA 3DXFA 4WLFA 3S2IA 5EL0A 3R3SA 4OMUA 4PCVA 4CLEA 2I65A 4YYZA 2I9PA 4AJIA 4M55A 4RVFA 4DC0A 5BSGA 1LUAA 1LA2A 4R4JA 5DZSA 3KSUA 1ZVMA 3W4IA 3ST7A 2JAHA 1LSJA 1U7TA 3WXBA 4AJ1A 5BT9A 2ET6A 3TJRA 2W90A 3AY7A 1EEHA 3ZU3A 1CQIA 1X13A 1V0JA 3BMOA 3PJGA 4XJTA 4C7KA 3A4VA 3E5MA 4CLXA 2NVUB 1HL3A 2Q4BA 1NM5A 2CVZA 4IS3A 3AWDA 4XQEA 1KVSA 4L73A 3PWSA 1CETA 4D3FA 2W8ZA 5FEUA 1W4ZA 3I9JA 4IXTA 2EIHA 3P7MA 4IPTA 3JTMA 3DHEA 4ZD6A 3KXDA 3CTMA 4J4HA 1WNTA 1LLDA 3OQ1A 5HTOA 1U3WA 4IQ0A 3WNQA 4L76A 1JWBB 3F46A 3E9MA 5F5NA 3QW2A 4DYVA 1KERA 2BI7A 3ZGYA 1MG0A 1CEQA 1VSVA 4Q3EA 4UVHA 2DVMA 4F45A 2YUTA 1LU9A 4N5NA 5CFZA 5ICMA 2AQHA 4OSOA 1EDOA 2TMGA 4WK6A 4D3SA 4IJVA 4PLFA 3JV7A 4CLOA 1DFGA 4QXMA 5DBIA 1NBOA 4RVUA 3HUDA 3JQ7A 4EUEA 1FMCA 3VDRA 5DCUA 5KJ1A 4RF4A 4OQYA 1CDOA 3ENNA 5JAQA 4XR4A 4E3ZA 1U28A 3DBRA 3PHGA 4OAQA 3VC7A 4E12A 3TRIA 1IY8A 2X0RA 3WYEA 1KEUA 3K9QO 3KM0A 5JPIA 4LCEA 5KJEA 1KY5A 1NPYA 4JP2A 4ZJUA 1DBVO 2DQ4A 2E6UX 2ZIZA 3V5NA 3ZWVA 4BNLA 2NQTA 3KO8A 1H9AA 5A02A 1A9ZA 5ENVA 1T4DA 4Z9FA 5K9ZA 5I7SA 2P2SA 1EVZA 3UXYA 1K89A 4CLHA 2Z5LA 3NT5A 4K9DA 3C1TA 2ZATA 1I2ZA 3ASUA 4DREA 5KVQA 2A92A 1CQJA 3SXPA 1VL6A 4DBZA 2NUAA 1IZ0A 1ZXBA 3FPCA 3V2GA 5JC1A 4CMKA 4XGKA 3EMKA 4XX0A 4CODB 3DZJA 1GTMA 1H94A 2UVDA 5DP2A 2V6GA 4J9UE 2PY6A 1KY4A 1NTOA 1P9LA 1ULUA 1YOVB 2JD1A 3O9ZA 4DPLA 1FJHA 4UVDA 4LRSB 3EZLA 1YWGO 4JCOA 5K0ZA 1SOWA 3BXXA 5TS3A 4TRNA 3MJSA 4MKXA 3PRJA 1IYZA 1MXFA 4EUFA 5G0TA 3JQBC 4G5HA 4IMPA 4ESOA 1KS9A 5IFLA 1LDEA 3ONEA 4G81A 4JGBA 2EF1A 1J6UA 2ZJ0A 1VC2A 1PJSA 3QIVA 1WAMA 1HRDA 2AEFA 3GLQA 3GZNB 1RKXA 4UUMA 5ER6A 4BS9A 1TT7A 2CZCA 2DBZA 2B4TO 2I6TA 2P5UA 1DXYA 4ALLA 3BIOA 3MWEB 2BGKA 3F5QA 5EJ2A 4RVHA 3STHA 3AOEA 4EEXA 3F4LA 1WMBA 5KKAA 6ADHA 1E92A 3HFGA 4YJHA 2NLOA 1MGOA 3VKVA 3HFSA 1MUUA 2EGGA 4RLHA 3TOZA 1R4NB 4MVJI 1MC4A 3ZV4A 3M6IA 3L07A 4BO0A 1XKQA 1EK6A 1TLTA 1Y7TA 1PJ4A 1ZMOA 3GZNA 3WR5A 3DAFA 3U4DA 4LMPA 3OICA 3PEFA 4RVGA 5T8KA 5IJZA 1WP4A 1P1HA 1C3VA 2I76A 2J6IA 2J3JA 4YJFB 3JQDA 1U2GA 3GGOA 7ADHA 1PS0A 3I6IA 2D1YA 4DGSA 2BD0A 3QVXA 4KUEA 3WLFA 4XRGA 1MFPA 3PLNA 4BNXA 1O8CA 3ZV6A 1ARZA 3GHHA 4M87A 2GZ3A 1YH3A 2AG8A 3ZV3A 4CUZA 3KLPX 4MVJD 1GV0A 3N58A 4FR5A 5BSHA 4K6FA 4YDRA 3PGJA 1GUYA 3PI7A 2VYVA 4CQMA 4AJPA 1L7EA 5F1PA 3AOEC 1HYGA 1ORRA 3RUCA 4EBFA 4ALJA 5CHEA 4GKVA 1GQYA 1XELA 4IQGA 4KWIA 4XB1A 3GVPA 3PJFA 2H9IA 4M89A 5EESA 1DRVA 1LDGA 2HU2A 1CIVA 4Y6PA 5F3RA 3SC6A 3LF1A 4QTZA 1UXIA 1PZHA 2ZKLA 3I6QA 4IZHA 4F6LA 1GYRA 5DCWA 3ROKA 2YY7A 3RCBA 3CH6A 5EINA 3JQ8B 3FF4A 5F1KA 4DL9A 5HM8A 5A9TA 3FNEA 1QORA 4YAKA 2PNFA 4ZICA 4MJLA 3VAZA 3RFTA 3UGKA 5U4QA 1HSOA 1ZSVA 1LNQA 4RZHA 2FRDA 3LK7A 5KVVA 1E7RA 3QSGA 4IY1A 5G0WA 1UZMA 1N7GA 4GKBA 5I9MA 1H6CA 3H9QA 4G65A 3GN1A 4J6FA 4XWYA 4CV3A 3KB6A 2OZPA 2OO5A 4I8XA 5KWEA 1Y8QB 4GLOA 3D1LA 2VWQA 4CMCA 1NVTA 3PJDA 1BXKA 1GCUA 1M75A 3GC6A 1ADFA 1BGVA 2GUGA 3I83A 5A9SB 5TT1A 1M67A 3JQBA 4WOKA 1I3MA 4MIOA 1IL0A 2DUUA 4GX1A 1LLQA 4P8RA 4ALNA 4WCFA 1UDBA 1H2HA 1I01A 5THKA 4IDCA 3G0OA 3F47A 3SEFA 4B7XA 4PG8A 1CRWG 1TI7A 3AM3A 3K5PA 1XYGA 2PZMA 1EVYA 2OORA 3I9NA 4LRTB 4E21A 2QIOA 1OI7A 1JDJA 3T7CA 5C7OO 3A28A 2IEBA 3ZNNA 4AJNA 1IPEA 2YV3A 3JD3A 4YAEA 1HDCA 1WLYA 5L40A 3EVNA 3OSUA 2VRCA 3OETA 5AYVA 3JQAA 4WCFB 2BKAA 3CSDA 4AL4A 3E18A 4Y9DA 4I5FA 1JQBA 2GNAA 2NQ8A 2X8LA 4C7JA 5F1OA 3JD1A 4L8VA 2PFGA 1P1RA 2OBYA 1P44A 4NDNE 1W6UA 4Q3NA 4BB5A 5A06A 1DAPA 2NNLD 2ZCUA 3N74A 4FC7A 2NADA 3UAGA 4BO4A 2WD7B 2DBVO 1L7DA 4PVDA 1RM4A 4ROSA 4W7HA 1BDMA 1DC6A 1EE2A 1NWCA 1RM0A 1SMKA 1WVGA 2NV6A 1HE2A 3ITKA 4Q3DA 1VLLA 3ONFA 4IQ8A 3H7AA 4WJZA 1E7YA 1NFQA 3JQ9C 4J91A 3BMQA 3FBGA 4CM4B 1OOEA 4E0BA 5GZ1A 3OJFA 3WQRA 5BNFA 1IUKA 4A27A 4DLBA 3D3EA 3EK2A 3VZPA 1NWHA 5JC8A 3WWZA 2V7PA 2DPHA 4ZGWA 5IDXA 2FZEA 4ALKA 3IIEA 4YT8A 2HMSA 3C7AA 4RPGA 2YV1A 4MVJM 3S2EA 1I8TA 1T2DA 2FR0A 1PR3A 2WDZA 1ZBQA 3HB5X 1NHGA 4OJNA 1NQ5A 5JFOA 4BHTA 1BXGB 1NVMB 4MDHA 1VKOA 4PRLA 2B4RO 1R12A 2VTDA 5BNTA 2RIRA 4L9RA 1QRRA 5TGDA 3BZUA 3E1KA 3QWHA 1HETA 4OXYA 2UDPA 2NTVA 3OIDA 1O9BA 1R4NA 3PGXA 3C1OA 2V6MA 4WOJA 5DNAA 2ZJ1A 3KHUA 4PLYA 5KOIA 4BGVA 4LGVA 4TRRA 1EZ4A 2HMTA 1IHXA 4AICA 3WGHA 3PDJA 4QSMA 1V3TA 4RPJA 4CUKA 3D5TA 3I4FA 1OC2A 1JKJA 1T2AA 4NR0A 1E3SA 4WNIA 3VVBA 1YBVA 3I3OA 4GI2A 2JFGA 3DZKA 2BF7A 3BHMA 4WEOA 4IIVA 3C7CB 1LDMA 1PJQA 1UJMA 3GRPA 5DOVA 3RC2A 3RROA 5IZCA 3WS7A 2X5OA 2XOXA 1HF3A 3DB2A 5KKCA 4GGPA 1ISHA 2QYTA 1LX6A 2Y0EA 4JJIA 4HFMA 5G4KA 2HMWA 2YHIB 3WYCA 1MB4A 1C0PA 2NU6A 4YJGB 5KIAA 3GMDA 1EMDA 1NR7A 4JBGA 3BMNA 7MDHA 3B1KA 4CM5A 1H5QA 3E8XA 3Q0EA 4FBGA 4XCVA 3QVSA 3ZZNA 1AUPA 5ITVA 2GN9A 1EDZA 3I9KA 4CQMB 4QFDA 1HZJA 5FWNA 1B7GO 4M86A 4QEDA 2Q45A 1O94A 4R16A 1MLDA 1PJBA 1JTVA 4R3NA 4RZIA 2AQ8A 5COAA 2D8AA 3R3JA 4DTIA 4ZN6A 1E1MA 1JKFA 3JD4A 1OFGA 1V35A 3GEDA 1B16A 1F17A 2JFFA 4GBJA 4CM3A 1I33A 1GU7A 5C7IO 3BMNB 1QXSA 4II2A 4BKPA 3NEPX 3INRA 4R1SA 5F5LA 4U8GA 1UZNA 2HK8A 1UXHA 3QVWA 3OIFA 4MPDA 1PGPA 4N5MA 4DC1A 1BWSA 3PYXA 4KUHA 3GAZA 1U7HA 5IZCC 3R1IA 2V6FA 1RYDA 2VUUA 4O1MA 3IUPA 4XYMA 2EGHA 2FOIA 4CR6A 1ZCJA 3PFWO 3DBHB 2LDXA 2Q4EA 4R5MA 2BLLA 2UAGA 3HDQA 3QA9A 3GFBA 2H1SA 2OUIA 4J1QA 4YT5A 1W73A 4Z3KA 4G2NA 3W4JA 3PP8A 1C1XA 1PZEA 2Y05A 2DT5A 4J7XA 3DBLB 4INAA 3WTBA 4EI2A 4RV9A 1GFSA 3QLJA 4XIJA 4B7UA 4Z9YA 4I9UA 2JJYA 4GX0A 1UR5A 3KYCB 4K1LA 3F6YA 3HG7A 4YQZA 3TF5A 1LI4A 3NGLA 4FGWA 1T1SA 2J3IA 1TVEA 2HK7A 3UOGA 3U09A 5EPOA 1HE4A 5T5QA 3GAFA 3H2SA 1NXQA 4BO1A 2ZK7A 4LW8A 3LT1A 3FNHA 3RU9A 3LF2A 2GR9A 5T67A 2GN8A 3C24A 2AHRA 3ZW9A 4FSHA 3ENKA 1A27A 1PL6A 3JCZA 3QY9A 1TB4A 4O5OA 1DLJA 2X5JO 2RH4A 1QLHA 4GWKA 3ZU2A 5TF4A 1S7CA 4LSMA 4CM7A 3KYCA 4Y8VA 2JL1A 4HNGA 4KDEA 4WASA 2YDYA 3DL2A 1N5DA 1B2LA 4RO0A 4FFLA 4XGIA 1QR6A 4ND3A 5FI3A 3GDGA 3PXXA 2P4QA 2Q99A 1N8KA 1ZH8A 5IN4A 4BMNA 4MIYA 1PGQA 2A9FA 3VKUA 3VOSA 3PHHA 5AVOA 3G17A 3OJ0A 3HDJA 4BNNA 1GEGA 4E2XA 5IZ4A 2AXQA 1DIAA 4XGNA 3ETEA 3MOIA 3PZRA 2NVBA 2XXBA 3WGOA 3RC9A 1DHTA 3HDYA 5AXBA 2IODA 1G6KA 3OEWA 4WLEA 2FPIA 1R37A 4PLWA 2X9VA 1MX3A 2PZJA 3WMXA 3S2GA 1DFIA 4PZEA 3DOOA 3SC4A 3ZWYA 2ZB8A 4Z0HO 5ER9A 3GVCA 1PX0A 3ZWXA 4BNUA 2DBRA 3M2TA 2YZ7A 3G49A 2G0TA 1N1GA 1O5IA 2Q2VA 2IZ1A 5B37A 1EE9A 3U9LA 2AA3A 2CY0A 4IUYA 2A4KA 2PTGA 4J4TA 4K6CA 3AU8A 4LN1A 4NFHA 4AJLA 4ILKA 3DZIA 1PJ3A 1N1EA 3LC7O 4BO7A 4I5EA 5DP1A 2VOJA 1YB5A 1XHLA 3RI3A 3TWOA 1P45A 4C4OA 3DHNA 3H65A 4E31A 3AI1A 4IIUA 1R6DA 3U49A 5G0SA 3OM9A 4GSLA 4ZQEA 4UUNA 3RUEA 5L51A 2FZWA 5A05A 3AUAA 2NSDA 1PWXA 4NJOA 3VZQA 4CM6A 1J49A 4WNCA 1XQ1A 3IMFA 4OKNA 3DMTC 3KYDA 5IDYA 4YPOA 2POQX 1G0NA 3BHIA 3FR8A 4HY3A 1JA9A 4UEKA 1ISGA 1QLJA 1Q7BA 1XWFA 5C7LO 1PQPA 4IMRA 1F8GA 4KTVE 4I5GA 1R4MA 4R41A 3W6UA 4CMAA 3AUUA 4J43A 4QFCA 3C3XA 4BV9A 4DMLA 4OHUA 1E3LA 3BAZA 2RCYA 2G76A 5H83A 1XLTA 4QT0A 4AVYA 3E82A 2GN6A 2PK3A 3F3SA 2DU8A 4B3HA 1L1FA 2NTJA 3DBVO 3EUWA 5L53A 1O89A 4FOSA 3S8MA 2BRUA 4YJGA 4ZRMA 1ZKMA 3B70A 1AE1A 1Y81A 3PZBA 1Y5RA 4E2YA 2W4QA 9LDBA 5I7VA 1SOVA 3HADA 3RKUA 4FW8A 3KUXA 5JDIA 3GT0A 4WUVA 3VPHA 3ZU5A 1YB1A 4XB2A 3RBVA 4YA6A 3O26A 2CVOA 2PGDA 3LLVA 4B3JA 5I9NA 1D1SA 2I3AA 1GQQA 5DOZA 4ZA2A 3W4KA 2PZKA 1DAOA 2EKPA 2EKLA 2BFOA 5HS6A 3RC1A 3FNFA 2O7QA 2EP7A 2FHSA 2PV7A 3IJPA 3EHEA 3H9GA 1D1TA 1MXHA 3P2OA 3UFXA 3GPDG 1HDZA 4F3YA 3I9OA 4AJKA 5AOVA 1NNUA 4QO7A 3DWFA 3KETA 2GSDA 4H15A 5B4UA 2ZYDA 1ISJA 2CF5A 4BL5A 1QYWA 1LRJA 1PGJA 4II3A 2IYPA 3KTDA 1HDRA 4RPHA 5JDCC 1GADO 2O3QA 1NFRA 1Z45A 2C5EA 2ILTA 4XR9A 1BVUA 4GSKA 2WWRA 4D43A 2VHVA 3ADOA 3RD5A 1SZJG 3F9IA 3IP1A 4MVJA 1C1XB 2G1UA 2W2KB 4W6ZA 3PHJA 2CDCA 4W82A 2C2YA 2VYND 3PLRA 1XG5A 3NDIA 1PSDA 2WD8A 4IJUA 2IYOA 3EZYA 3GHYA 3L4BC 3PQFA 4J1SA 2X22A 3KSDO 4R69A 4A2CA 3K2BA 1ZZEA 3WGGA 4WCFC 4IDEA 4CL8A 1JKIA 4NPCA 5ENDA 3RJ5A 4HKTA 3OHSX 3Q9NA 3B6ZA 2GRAA 1ZEJA 5DBGA 4CMIA 2G17A 1HXHA 3MJEA 1KVUA 5ADHA 2GZ2A 3SJUA 1B15A 3TL2A 2D2IA 3HN7A 4GL4A 2VHWA 4EZBA 4RDHA 2QYSA 3VZSA 3DFZA 2W2KA 1H9BA 2QX7A 5AXCA 3FHLA 3MJTA 1F12A 4CV1A 1T1RA 2D4AA 8ADHA 1NVGA 2VWPA 4RF2A 3WSVA 5TSDA 3U3XA 5G4LA 3A06A 5CEFA 2GASA 3BA1A 4DBVO 3AJRA 1NFFA 2QQ5A 4I08A 3SBOA 5IAAA 4UEJA 3AUTA 5L4NA 3FN4A 4E5YA 1ISMA 4BNMA 4OXKA 4BOYA 2Y1FA 1I5RA 1E7MA 5JS6A 2HMVA 3RUFA 3QQPA 2DM6A 1U4SA 2O3JA 3KVOA 5H81A 1T25A 5CP8A 2Y1DA 3WBFA 2BFAA 4KZPA 4ITUA 2EW8A 3D7LA 3NJ4A 4RCVA 3CE6A 3VPGA 1QP8A 2VQ3A 4E5NA 2Q3EA 5ICSA 3ZI0A 2YW9A 1J4AA 2I99A 2E82A 1N92A 1YB4A 4DQUA 3D3WA 3GN2A 4BGEA 5JDIC 4FJ1A 3H4VA 2CUKA 3BMOB 4B4WA 4Y67A 2X58A 3AOGA 2GYYA 1KIFA 3NUGA 5LDHA 2R6JA 4GX2A 5CPFA 3OJOA 4KQWA 2ZTUA 4PVCA 5IF3A 3BTSA 3RWBA 3AM4A 3K96A 5DBFA 2QG4A 3GVIA 2D5CA 1P0FA 1NPDA 3OA2A 2Q1TA 8LDHA 2W2LA 4PG6A 1U1IA 4E4YA 2C0CA 3LYLA 1KYQA 1C14A 1H2BA 3JYPA 3K6JA 3BTVA 1GUFA 4XYGA 4ZQGA 3A1NA 4KP7A 2VWHA 4D7AA 1W0CA 4CMJA 4IINA 2ZYAA 1EQUA 3ZHBA 3DMYA 2I66A 2J5RA 2O3TA 4WCDA 2CFCA 1RWBA 2WE7A 1EFLA 3GA0A 4RF5A 1DB3A 3A14A 4QQRA 3L6DA 4J9VA 1NR1A 1SPXA 4URFA 1GPJA 4S3MA 1K6IA 1R66A 2ZYGA 2QRJA 5COQA 5L7WA 4IJKA 4YVFA 5C37A 1PZFA 4DPKA 1M76A 3WLEA 4FFRA 3H5NA 3OQ6A 3Q1LA 2Y0DA 5CG1A 1X1EA 4AFNA 3IL2A 1BXZA 1MP0A 4BNFA 1HLDA 4HFJA 4O59O 1P33A 4LSWA 2Y1OA 1SB9A 1F0YA 1GAEO 5GY7A 4E32A 1TEHA 4NIMA 1V3UA 1X14A 4J7UA 3L6OO 3NT4A 4UULA 3K31A 1MFZA 1NHWA 3FCOA 3MOGA 3OFSA 3E03A 4GWGA 4IZIA 4H7PA 1ZJYA 1LJ8A 2D59A 1WXDA 2BFMA 2Y93A 3EDMA 4N7RA 5IN5A 4NZ9A 4BGIA 4TZKA 2QZ9A 1E3WA 2IXAA 2PA3A 4TVOA 3VH1A 3F1LA 4FFPA 1K0UA 1IE3A 3EAGA 1N9GB 3JYOA 1X7GA 4TVBA 3SJ7A 4TSKA 1HT0A 5EIOA 1QYDA 3ITDA 3D4NA 1TA4A 3NKLA 3TL3A 2DTEA 5U9CA 1DJQA 2OOSA 3D4PA 3NX4A 1Z7EA 4XYEA 4GAEA 3C7DB 5I9LA 1A4IA 1P0CA 4J3FA 5K6AA 4HWKA 2Z1MA 3TN7A 1Q1NA 4DA9A 4KWHA 4Z0PA 3G1TA 3DONA 1T2FA 2QZZA 2JAPA 1PS8A 1AHHA 4B7CA 3W6ZA 4WLOA 3LT4A 3L4SO 3MZ0A 4RPKA 1C0KA 2R00A 1YL7A 4P4LA 4DMMA 4JLWA 1U3VA 3AFMA 1LLCA 4U0JA 4JBHA 3T4XA 5CDYA 4LK3A 2Y66A 5ILOA 3HE3A 1M66A 3GMSA 1G1AA 4FN4A 1LRKA 1PZGA 4UUPA 3UUWA 4Q3BA 2GZ1A 4B3IA 4WLNA 1U5AA 2NU9A 4YRAA 1YS4A 1XA0A 3FSRA 2PD4A 4BKOA 2BHLA 1OBFO 3ANMA 4J7CA 1A4UA 1Z73A 4JXKA 4TKLA 3RIHA 1ZK4A 4FJ2A 3ICPA 4Q3CA 1NAHA 1HYHA 4IJWA 1QV7A 1PQUA 2HJSA 3G1UA 3JSAA 4NNJA 3PIIA 1RM5A 1TXGA 4CV2A 1NYTA 1HDXA 1NAIA 2O4UX 3WOHA 4A5OA 3ZW8A 3HNPA 4YXFA 1XGKA 3VTZA 1IB6A 3PYLA 3ZWCA 2R00C 1Q7GA 1BW9A 4D46A 4UVGA 1HDYA 1BVRA 4B4UA 3H5RA 2YDXA 3DMTA 4DIFA 3DFUA 1ONOA 3CMCO 1Z74A 3QVTA 4CR8A 4E2ZA 4EITA 2JD0A 3TDKA 2X9NA 2CMDA 2VRBA 3O8QB 1LXCA 4E5KA 1XU7A 2F1KA 1EUZA 3IOYA 4D3DA 4WEQA 1HTBA 4KDFA 1WWKA 2VNAA 3SVTA 5JO0A 3QWBA 1ZO8A 4IDFA 5DF1A 3GGPA 2GLXA 4NK4A 5EQDA 1NASA 4R3WA 5TC4A 4Q9NA 1BW9B 1ZSYA 2UYYA 2NVWA 3NJ8A 2IE0A 4HFNA 4HFRA 5A3VA 2QRKA 1Q0LA 4I9NA 2O2SA 4R5HA 2WEKA 3ETDA 3UH1A 1ZK3A 3G79A 3HWRA 3DZHA 2Q1SA 4YEDA 5MGBA 3QWAA 4CQLA 1FK8A 3WGQA 2BI8A 1Y8RA 1KVQA 1RM3A 1D7OA 1XEAA 3ONDA 4J0FA 4AJ4A 2RHRA 3TFQA 5L7YA 4E33A 5L4LA 2IXBA 3OA0A 4Z6KA 2Q50A 3JYQA 4NU5A 2JD2A 3ICCA 4BNIA 4XDYA 3S2FA 4HUJA 2J3KA 5K6AC 4ZVVA 1K5HA 2WSBA 4JQCA 2V6BA 1OAAA 4GVLA 4YAIA 2GCGA 2IDZA 4D42A 4YJDA 4HBGA 2JCYA 4ND4A 2EJVA 3HHPA 4BNGA 1E77A 1E3EA 4Y6SA 5JSFA 5T57A 1U3TA 2UUPA 1XR3A 3RBXA 3IP3A 4E2WA 3P19A 5G2OA 1AXGA 4PLCA 4PN3A 5FYDA 1MG5A 1PJCA 5JW6A 1S6YA 4BB6A 3VHRA 3HJAA 1LBEA 3V1YA 3V1TC 4LISA 5TNXA 3NRCA 1GQ2A 2X7HA 3EY4A 4QO8A 3GDFA 4JIGA 5B12A 3ZV5A 1HDOA 5THQA 3LVFO 4OH1A 3S55A 3GF4A 4XYBA 3H3JA 5BNIA 4CM8A 4QX6A 1Z6ZA 3GZ4A 3H6KA 2UUOA 4AJ2A 5IXSA 1V6AA 4MIEA 1EFKA 3UF0A 4UVEA 2XPCA 1Y1PA 1NP3A 3AW9A 1VPDA 4JK3A 2FSVA 4ID9A 1A71A 2CD9A 5EERA 1CWUA 1ZK2A 3I4CA 4OYRA 4PLTA 3WQSB 2PKQP 3DBRB 4M1QA 2DFVA 4FD3A 3GEGA 1GYQA 1I3LA 2WD7A 1FDSA 1LDNA 5I8ZA 3H9JA 5A5FA 4BO8A 1EVJA 4FCCA 3WFJA 2AEMA 3K73O 3GR6A 4ND1A 3S1LA 1KC1A 2PWZA 5G0VA 3UHAA 4CM8B 5IXYA 2A35A 3I9MA 1EK5A 3OJEA 4RLSA 4WPGA 4BNTA 3WTCA 2ZB4A 4GQAA 2AE1A 2EXXA 3BMQB 3KLMX 4YRBA 1SBYA 4E6PA 2FY8A 1PGNA 5B1YA 3VZRA 3HQ4O 2DLDA 3TPCA 4NQZA 3DTYA 4JX8A 4R9SA 4W99A 3L0DA 1Y6JA 2EHDA 4TZTA 4HV4A 4J4BA 4J2OA 2D3TA 1ZEMA 3ETGA 4ND5A 3U4IA 3JQFA 4D44A 3LC2O 2C54A 4CPDA 3QRWA 3PVZA 2DKNA 2HLPA 1Q0HA 3AFNA 3I1JA 2YFQA 3AI3A 4W7IA 3WJAA 2NM0A 3MJVA 1YOVA 2FR1A 1IHYA 3CZMA 3H8VA 2H6EA 5KNLA 2X86A 3GVXA 2E37A 3JYLA 4NBUA 3ZWWA 1UUFA 4U0KA 1QV6A 1WDKA 4YRDA 1RJWA 2V65A 4J1TA 4FFMA 4AJEA 2DAPA 2DFDA 4ZQBA 2VUSA 4DXHA 1E6EA 2AG5A 2B37A 4RGBA 1BSVA 4IXWA 1T4BA 4D45A 4IDAA 4NK5A 3E48A 3RVDA 4OOFA 2X1HA 1V9LA 2YJZA 1GD1O 4TQGA 5CAEA 3FR7A 4RQTA 3A9WA 4AJJA 4BNHA 3RBZA 1H6DA 1A7AA 3R0IA 3GUCA 1C1DA 4PG5A 5ES3A 3PIDA 1JVBA 1MA0A 1B8UA 4P4NA 3H9UA 3GDOA 2DC1A 2NACA 1UXKA 3JQEA 1Q7CA 2VT2A 5FI5A 4FB5A 1GUZA 2PR2A 4W4TA 4PFJA 5IDWA 3KEOA 4OO3A 1FF9A 2P91A 4R1TA 3JQGB 1K6XA 4IBOA 2PZLA 3L9XA 1P1FA 1X0XA 4KMSA 1X1TA 3ZDFA 3W8DA 1ZK1A 3F4BA 2HRZA 4ZQHA 3EYWA 3GH3A 3UW3A 2Y1GA 1P77A 4N54A 3IC5A 3NTQA 3O8QA 3PHLA 4PLHA 1DC5A 3AY6A 1YE3A 2XF8A 2X0JA 3C1AA 5KJ6A 2GERA 4YJFA 3C85A 3E9QA 2VZ0A 1TT5A 1D3AA 3JQ6A 3ANLA 2WJPA 3WIDA 2RBEA 4X54A 1B3RA 1YJQA 1P3DA 4DYDA 3WSWA 1WDLA 3GRKA 4Y6RA 1SEPA 1EVIA 2OP1A 2PD6A 4WE3A 1IOLA 5U1PA 1I3NA 2X0NA 2X5KO 4EJ6A 2C29D 3DZFA 3X2EA 2WE8A 4WLUA 1DRUA 1I3KA 1YQGA 2W2LD 4CQLB 1EUCA 3MJ4A 3TSCA 1LSOA 5CPBA 1Y8RB 2X0IA 3EC7A 2Y1CA 5HWSA 2JCXA 3UCEA 1YL5A 1I0ZA 2ZCVA 4I9HA 3Q9UA 1D8AA 1TT5B 3WICA 1JU9A 3WX0A 4D79A 5B4VA 2OMEA 4L4RA 3SX2A 2GGSA 5KCZA 3VPSA 4R1NA 3UICA 3W8EA 4EGFA 5KJCA 1DFHA 3ASVA 1E3IA 4EJ0A 2PH3A 5A3JA 3GVHA 1UXGA 4FDAA 4MVJH 1SO8A 4MVJF 3IDSA 5JY6A 4P4GA 2NU8A 4DIOA 2JHFA 3CKYA 1AN9A 1QG6A 2CSUA 2Q49A 2OP0A 4R1UA 4EJMA 1D4FA 1O95A 4J2HA 5AXAA 4A0SA 3NDRA 2ZB7A 1GYPA 2H63A 2P9GA 4CLOB 3PPIA 2Y68A 4HP8A 4RDIA 4XRRA 4F46A 1JAYA 2XAAA 2ZTMA 4FIZA 5ILGA 1ADCA 4YWJA 3RSHA 3RUIA 3WMWA 1PJ2A 2C7GA 5I7EA 3AK4A 4PRKA 1U3UA 4UAGA 1Y8QA 3DO5A 2CDBA 4WECA 5A9SA 1NX6A 2C07A 1EQ2A 1C0LA 1GR0A 2B83A 3E6AA 2GF2A 3D4OA 2C20A 2VUTA 4U5QA 1PQWA 4NHEA 5F21A 1U4OA 1V8BA 3COSA 3I9LA 4DUPA 3OQBA 5KVCA 4NBRA 1P1IA 4PGFA 1YQDA 4XIYA 1I10A 5TJ9A 3IQDB 4XJSA 1MC5A 4FOOA 1FDVA 3GPIA 1N7HA 3ZWNA 3D5QA 1YXMA 3RQSA 3IKTA 1DEHA 2B35A 4KQXA 2C2XA 5IDQA 2B36A 3K8ZA 3V1UA 4U7WA 2FWMX 2VYVD 4CQMD 3OECA 3JQAB 1VRWA 4NBTA 3LT0A 2VTEA 3ROQA 2YV2A 1SAYA 3KOUA 4B79A 1M6WA 2B4QA 2HQ1A 4HADA 5IG2A 3GNQA 2P68A 1BXGA 4U6QA 2GDZA 1LRLA 1VSUA 5T6BA 1FDUA 1LC3A 2O7SA 2HAEA 2R2GA 1UZLA 4RORA 4RQUA 2Q1WA 3TQHA 5GZ3A 1JW9B 4R68A 3VH3A 4CMBA 1E7SA 1M6HA 3O03A 2JKVA 2B5VA 4B8WA 5CEEA 1DJNA 1NQOA 2I67A 1BHSA 1OMOA 5I8WA 5BR7A 4MP8A 1UH5A 3TZKA 4HX5A 4ND2A 4J49A 3ZHXA 2AMFA 2HSDA 4L0QA 4NH4A 1HKUA 2PH5A 4JNKA 2VYNA 4CM4A 1UDAA 2IEDA 4YT4A 1Y5MA 1JVSA 1T24A 5I7FA 2X9GA 4BO9A 1N2SA 3L77A 5A9RA 3GK3A 1JAXA 4XZ3A 3H9EO 5A4DA 4PLZA 5G4KB 1K3TA 2E48A 1HZZA 5TT0A 4Z9XA 4LMRA 4B8ZA 1DC4A 1Y9AA 2E49A 3KYDB 4JN6B 1IZ9A 3WWYA 1B3BA 4FC6A 5CDGA 3GG2A 4MOWA 1DIHA 1R4MB 1QSGA 2G5CA 5A5EA 3EW7A 1H6BA 1LLUA 3KYBA 5DT9A 1P1JA 1GPDG 4M54A 4AJOA 4ZU3A 3TOXA 5J23A 3PK0A 4DRYA 4E5MA 1PWZA 5GMOA 3NTRA 5EQFA 2Q1UA 3U5TA 2OBNA 4CM9D 1UP4A 1BTOA 3MTGA 5CEJA 3BMCA 2Q46A 3D64A 3M1AA 3HB4X 3JQ9A 2QHXA 4O0LA 3PWKA 1EBFA 1VL0A 3U4HA 5EMHA 2JFHA 3RUHA 3SLGA 1KEPA 1XU9A 3RASA 5TIIA 1R0SA 1VI2A 2O23A 3ZHZA 3AUSA 3I52A 3ORFA 4BV8A 2P5YA 1XSEA 3IAHA 4YTEA 3GUYA 4GVXA 1T2CA 1ZIDA 1PL7A 1ADGA 3JQ8A 1PTJA 3G3EA 5ITWA 3DOJA 4TKMA 1B0AA 2Y0CA 2WMDA 3VVCA 3WB9A 1ENPA 1XCBA 3LZ6A 3BMCB 1AXEA 4KTTE 4DQVA 3WJ7A 2HJRA 5GZ6A 3LLSA 3CXRA 1DIGA 3TZ6A 1HLPA 4RPLA 4XKJA 2Y99A 2NU7A 4AJHA 4MKZA 4BNWA 3WNVA 4W9NC 1YVEI 5A03A 3UCFA 4FJ0A 3WGZA 5KJFA 4D0RA 3RAJA 3F1KA 1P74A 1H0KA 4PZDA 3MTJA 1VJ0A 4GX5A 4NMHA 4FS3A 1F06A 2VN8A 4PZCA 3IUSA 4BO2A 4MVJP 2C82A 2HK9A 3GY0A 4K26A 4BQRA 4RL6A 4NBWA 1YRLA 3L4BA 3W1VA 4E5PA 3UN1A 1U8XX 1LEHA 5JCJD 3PJEA 1HEUA 2OXIA 2FPPA 5B4TA 3BTOA 4QUKA 2PD3A 1PIWA 1I24A 4JBIA 3T4EA 4Y98A 4R54A 1DRWA 1UP6A 3ZHYA 5LCXA 3ZWBA 1A9YA 4PG7A 4Q3AA 2J5KA 2DTXA 2GD1O 1IULA 1OZAA 4J1NA 3DBLA 5L4SA 4XA8A 1X0VA 4L4XA 1O0SA 1LC0A 4BNKA 1GCOA 3CUKA 3ZCXA 4RVSA 5G0UA 4TROA 2SCUA 5JY1A 3E9NA 4BVAA 2JCVA 4RF3A 4GMFA 2O3SA 3GQVA 1FDTA 3FTPA 2G82A 2VHZA 1LDYA 5JMPA 4BO3A 2HDHA 2AQIA 1HE5A 1B8PA 2NWQA 3V8BA 1YONA 4BNYA 3K2EA 3F5SA 4CV0A 3GOHA 3HN2A 1A72A 3CIFA 3M1LA 1VJTA 3LSYA 3ABIA 3BYZA 1AGNA 2YQ5A 3ZNPA 4ONEA 2D0IA 2WTBA 4H3VA 1GL3A 1LTHR 3LU1A 2OHXA 2Z1NA 1EBUA 4MP6A 4TRMA 2IRWA 1YDEA 4MVJG 4OOEA 1UDCA 5KTKA 1PU2A 1R0KA 2DPGA 4L74A 3QHAA 5DDIP 1RPNA 4WKGA 2P9CA 1KC3A 4A7PA 3WBBA 5JAZA 2UV8A 5TQVA 1ZJZA 1ZSNA 4BNVA 1CYDA 3C8MA 4GGOA 4NG5A 5BQFA 1Y9EA 4DLAA 4NI5A 1I36A 4XQGA 3ZH2A 1JLLA 1LSUA 1ML3A 3KSZO 1WDMA 1Z75A 1H93A 1CERA 2I3GA 1B14A 1YBMA 2AE2A 2OL4A 1E1NA 2TMDA 4YB8A 3PDUA 3U0BA 4N18A 5LC1A 1LQUA 4JROA 1UP7A 3ROPA 3V2HA 3RKRA 3NT2A 4UEOA 4GH5A 3WGYA 3BTUA 1YDWA 3O38A 5JXWA 1LQTA 2BGMA 3T7EA 2HRBA 2CNBA 5C5IA 3BHJA 3KEQA 3QJ5A 1I2CA 1GEEA 3SLKA 1BRMA 1SNYA 3P5SA 4BNZA 2P4HX 5A1TA 4M49A 4UREA 1B26A 2O4CA 4JP3A 2RHCA 4EDFA 4BQPA 4TRJA 3UKOA 1M2WA 4S1VA 2OGUA 4W9NA 2VZ9A 3Q2IA 2AQKA 3H5AA 1UAYA 4CM9A 3DHYA 3DAGA 3DQPA 2BFPA 3WFIA 1X7HA 1XIVA 1YGYA 4HXYA 3WGTA 1DHRA 1WMAA 4HNHA 4CLRB 2C7VA 4IDGA 3AI2A 3RC7A 3NYWA 1DO8A 4LVCA 3RU7A 2DBQA 5A04A 2FSSA 1JN0A 1ZUD1 1QMGA 4D41A 1FXSA 2XXJA 4GLLA 4OM8A 1JWAB 2OFPA 4R51A 1DC3A 1Z82A 1KEVA 1O6ZA 2QRLA 5HS4A 2O3UA 5JNLA 2YHIA 4Z3DA 1KOLA 2Y67A 3OH8A 1T26A 3GG9A 2B69A 3M2PA 5TX7A 1KVTA 4FFNA 5DN9A 3E5RA 3CINA 1Z7BA 1X15A 1BMDA 4NBVA 5H82A 1R16A 2E4AA 3MWDB 4CLRA 1U5CA 2EV9A 4A26A 4LCJA 2W98A 3QWIA 4OKIA 3WIEA 4PLGA 4CL3A 4J16A 1ZW1A 4GPD1 1ULSA 4XQ9A 1YL6A 4DVJA 1KBZA 2BH9A 3WGIA 1N9GA 2J5QA 4YQYA 1GZ6A 4B4OA 3I23A 1ISFA 4PLVA 2Z95A 2O50A 4EW6A 1HDGO 1ISIA 4MKRA 4BMVA 1SEVA 1ENZA 4MP3A 3H3FA 5T64A 3GNSA 3KRTA 4FPXA 1ADBA 5EN4A 5L95A 3QV1A 5JYEA 3DZBA 3R6DA 1V3VA 2YYYA 5FF9A 3TFOA 1R15A 2DTDA 3FRJA 5JO9A 2VHXA 3RUDA 3DBHA 2O48X 4BO6A 3INTA 2ZTLA 3B1FA 3JQAD 3HDHA 3B1JA 1E5LA 2YHUA 2BMAA 1E6UA 4ALIA 2PKQO 3GFGA 3LQFA 5JAIA 1E0DA 1NPTO 3WQQA 2VWGA 3U4CA 5L3ZA 5CG2A 5JMWA 3CMMA 4Z0TA 3DAPA 2F00A 4E30A 1E1LA 4ZQFA 2CDAA 4OXNA 4RVDA 4TWRA 2EW2A 2CF6A 3H2ZA 5JLAA 1PJLA 2IZZA 2FR8A 3I5MA 2ZB3A 2RAFA 1AHIA 5L9AA 2C5AA 4JJGA 3OF2A 2AW5A 2JHGA 2X4GA 3VH2A 1UXJA 3ZN2A 3V2UA 1RYEA 4QECA 2GPTA 3IKVA 4B4VA 3NV9A 5TJHA 1BDBA 2YQ4A 3ZWPA 4XQCA 3TZHA 3O4RA 4FGSA 4NU6A 5JBIA 3PHIA 2HUNA 1CJCA 1ONPA 3MJCA 3Q3CA 2O2YA 4XYLA 4CMIB 3CPSA 3NGXA 4DLLA 1DDOA 4K28A 1E3JA 2HKIA 2FPGA 3ZWOA 1E7QA 3LT2A 1PEDA 4L4SA 4JJFA 3DR3A 1LDBA 4YAJA 3HSKA 2DUWA 1ENOA 2ZQZA 4UUOA 5DCYA 5HA5A 1ONNA 1PR9A 2CVQA 4IGEA 5AQ1A 1VL8A 3VTFA 1QYXA 1OC4A 2D5AA 2ZTVA 3JD2A 5T8KC 2VRCD 3RUAA 5BSFA 1U9JA 3K92A 4J0EA 3RFVA 3P2YA 1BG6A 1DIBA 4CR7A 1A5ZA 4A73A 2B0JA 1P1KA 2Y1EA 2PGLA 4PLPA 5JDCA 4IS2A 4CLDA 1NQTA 4DIBA 1VM6A 2HO5A 4AG3A 2EG9A 2NVUA 4OL9A 2BELA 1XDWA 3DZGA 3TNLA 4FQ8A 1U2DA 3ZWAA 3TZCA 1J5PA 3QP9A 1FDWA 1YBAA 1P31A 2EP5A 4BIIA 4CMEA 5CDUA 4R01A 4UVIA 1MV8A 1UAGA 1LSSA 2WYUA 2YFHA 3N7UA 2PGJA 3FTNA 5BSEA 2VNSA 5DULA 3GNTA 3Q6IA 3ZNQA 4XEHA 3X2FA 4KUGA 3ZNOA 4BKUA 2J8ZA 3D3WB 1WZEA 5MDHA 5L45A 2EERA 4NFYA 1QYCA 3Q2KA 3WDSA 3ADPA 4BGUA 2Q2WA 2NTNA 1ZMTA 2PKRA 1R0LA 1YKFA 1ZNQO 2VZ8A 4CM1A 1YO6A 4IDDA 5COBA 5JE8A 4BKQA 1IPFA 1KETA 3L9WA 4WGGA 2WYWA 4BKRA 3GGGA 3UVEA 2VT3A 4A10A 5JYDA 3JQ7B 4N5LA 3QE3A 3DTTA 3JQFC 3MEQA 3QVOA 3INGA 2PLAA 3CZRA 4XD2A 3K30A 3D0OA 4RJTA 3JYNA 4ZHSA 2GO1A 4NFSA 1SB8A 3IS3A 2HMUA 4FFOA 3ZU4A 5AXDA 5CDTA 4DQXA 1Q2XA 4CMEC 1I2BA 3OP4A 1SCUA 4PIVA 3QWFA 1NQAO 4ZRNA 1KVRA 1VJ1A 3DC2A 1ZK0A 1I32A 4O63O 2LDBA 4D0SA 4GMGA 4P22A 4DWVA 4MO2A 5TRTA 1ZXLA 3HZZA 3ANNA 1X7DA 1DIRA 1W8DA 2IZ0A 3ON5A 5LDGA 4YACA 1KEWA 1GZ3A 3KBOA 2J3HA 3LC1O 3TZQA 1GV1A 3OBBA 4WLVA 3WYBA 2ZQYA 3GEMA 2FMUA 4PG4A 2C59A 3JQCA 3U62A 4OIMA 1HSZA 4L75A 4MINA 4YT2A 1G0OA 1T2EA 1QYVA 4O6VA 2RH8A 3FWNA 1E1KA 3FPLA 1PJTA 1DLIA 1F14A 4YCAA 3ROMA 4LVUA 9LDTA 3PQEA 2EKQA 2FP4A 2GN4A 4F6CA 1PS9A 2VHYA 2WYVA 2X23A 4R9RA 2O3RA 3AM5A 5JAMA 2H5LA 3KV3O 5HBRA 1J0XO 4J90A 3PYMA 3NAQA 1U8FO 2VOEA 1C0IA 4BUCA 4DPMA 3OMLA 3AY3A 5JCJA 2FN7A 2WM3A 1F8FA 1DPGA 2EEZA 4CMGA 1E3WB 3CEAA 3OEYA 1SC6A 4Q39A 4BO5A 3MCVA 4CUJA 4YBZA 4NJMB 3OJLA 1VKNA 3FI9A 1H6AA 2BGLA 3AU9A 1HE3A 4YR9A 4IGFA 2EJWA 3RFXA 3WG9A 4CJXA 3OIGA 3UCXA 3FNGA 2HCTA 5L7TA 3PTZA 3PQDA 4H16A 3VPFA 4P38A 2Q2QA 3FD8A 3KZVA 3W8FA 4OSPA 2A94A 1DSSG 3LDHA 3ULKA 1GY8A 1PL8A 4MVJE 4E13A 4YAGA 4BNJA 2EWMA 1B8VA 1E5QA 1EUDA 1GZ4A 1YQXA 4YJHB 3EGOA 3FBTA 5CDSA 4ALMA 3DOCA 1WW8A 3L6EA 4NJMA 3VH4A 1WPQA 4M8SA 3EVTA 4BMSA 1K6JA 2P9EA 3IJRA 1GDHA 1Q0QA 4IM7A 2AEJA 1XQ6A 5FFFA 2B5WA 1E6WA 1CF2O 1E7WA 1ID1A 1PGOA 3DDNA 4EUHA 4A03A 1I30A 4EYEA 5JCXA 3ZWMA 1A7KA 1ZFNA 3DEYX 4EEZA 6LDHA 1C1DB 1YJ8A 2I5PO 3JD0A 3RJ9A 2QW8A 1K2WA 3NTOA 3VPXA 1VE9A 4I5DA 3FWZA 1HWYA 3PFFA 3PWZA 4OGWA 4CMHA 5C3MA 5HRUA 4TMFA 4XDZA 1HYEA 1QKIA 4OQZA 4IDBA 4U6SA 1ENYA 2X6TA 3VDQA 3JQGA 3NDJA 1DOHA
chains in the Genus database with same CATH superfamily
1E2JA 1BQ4A 1XDDA 1WZIA 5KVSA 5CLLA 2QLMA 1U0RA 4B31A 4FUQA 4WLFA 2PANA 1D5CA 3KUUA 4OFXA 4OMUA 2I65A 4PCVA 2GOYA 5CVCA 1Q0PA 4YMVA 2ZDHA 4KITB 4Q4AB 4AJIA 3BEDA 1EFTA 4DC0A 4EI8A 5KYUB 1LUAA 3ZZTA 4CRWB 1JNXX 1L3CA 2YOGA 3DV2A 3H84A 3KSUA 3MMSA 5AMXA 5MGNA 1PR6A 1W47A 2PV0A 4LF5B 2ISQA 2JAHA 3WXBA 5IASA 1T0BA 4OXRA 5IYZF 1GKYA 2I0FA 5EJ8A 1GQOA 1GGKA 2CXXA 2NZVG 4FCTA 4M0MA 2XMGA 3TJRA 2BV3A 2HX1A 1MX5A 4JOQA 4YCBA 4CYMA 5M5BA 1V0JA 3PJGA 5TR9A 4C7KA 4QOEA 1U28C 3MMZA 3OZAA 1NM5A 2CVZA 4RCYA 5KREA 3PR3A 1IVSA 1EAMA 1KVSA 3L5OA 3S3TA 5HJEA 4RVNA 1R0RE 2DGDA 3L8GA 4LKOA 4GQIA 1J2JA 2JHAA 4W1QA 3RC3A 4BQSA 1W4ZA 3REFA 1ZD4A 1EUCB 2X1MA 3OTQA 4H3KB 3WLTA 4KE6A 4I14A 1E1RD 3TCNA 1VBMA 4P98A 4Z53A 5DIZA 3SZLA 4A3SA 3TTWA 2IFTA 4MXDA 1XF9A 1LZKA 5AKYA 3OM8A 2UYHA 5IFKA 5IJ0A 5LN1A 3QVGA 5LFAA 3OQ1A 3JYHA 3HP7A 1HFJA 1KYXA 4ZVNA 4LG1A 4MLCA 1PYDA 1AKNA 1GTL1 2ATIA 3MMXA 4IQ0A 3NKFA 3C15C 4LJ7A 4QUIA 1DG1G 1JWBB 2VR1A 5F5NA 3L7MA 2OWEA 1T2UA 1E3TA 1QG4A 1VTKA 2CXPA 1FEZA 3RIEA 1T6BY 2MSNA 4L4YA 1VSVA 1JSCA 3OE7D 5DASA 2DWUA 2C04A 2XW6A 4M38A 4MJ7A 2YZKA 3SG0A 1F0PA 4N5NA 2AQHA 1KPHA 3O4HA 3QF4A 4YQFA 4GXRA 2V8OA 5DM4A 3VR3A 5TVGA 4D3SA 3U4QB 4IKEA 1YB7A 1AN0A 1ESDA 3LA8A 3VNVA 5DM70 1DX4A 3PTLA 4PAOA 4R2IA 3ZVKA 4ZEWA 4BZZA 1MIOA 2EYUA 4L16A 1R00A 4M7OA 5ALEA 1FMCA 3VDRA 5CFOA 5ALLA 1BH6A 1U6KA 1CDOA 4RV4A 1Q50A 1U28A 1TZ2A 2Z98A 3FKQA 3N8HA 3PHGA 1DG9A 3EQ8A 2CFSA 4RGVA 5AHOA 1KJYA 3TRIA 3VC7A 4E12A 5C46F 1C3OA 1C9KA 3KU4A 4BNDA 2B7CA 3M6XA 4EMTA 3OBIA 4D9FA 2X0RA 3WYEA 1KEUA 3K9QO 1X1SA 2QL9A 3SZGA 5EG5A 1QIKA 4LCEA 2GM9A 4UPDA 1KY5A 2LXNA 1HQYE 2QZ4A 5LBUA 4JU8A 1YVDA 4KHPB 1OASA 3FNQA 2E6UX 2OXRA 3OE5A 4H18A 3V5NA 4Y1RB 2XECA 2UVPA 4QPNA 4WJKB 2NQTA 5DGHA 1XMXA 4O5AA 5ENVA 1ZISA 1A0OA 2G5GX 1G66A 1DCMA 5CVVA 3DXYA 2JAWA 1FYEA 3HU2A 3V8BA 4CLHA 7YASA 4O29A 4QVKA 5AKIA 2PUTA 2A0FA 1II0A 2HFKA 2OV3A 4K9DA 5CJ2A 2ZATA 3T4PA 3ZXIA 5I7AA 2A92A 1TM3E 3SXPA 1VL6A 2NUAA 1KP2A 1IZ0A 3B7WA 3EEIA 4NESA 4X44A 2WNSA 5G1OA 1C3OB 3BN3A 3KQTA 3REGA 3V4LA 1HFEL 3ODGA 4CMKA 4XX0A 1P0MA 4CODB 4DA7A 1DUIA 4R0NA 2H29A 3EMDA 4GKAA 1EEXB 1H94A 1DT5A 2FX5A 1HQDA 2NYAA 1RMTA 1OI3A 4J9UE 4ZOBA 1KE2A 1I1OA 4ZV9A 3GL9A 5F76A 1UDRA 4B7ZA 2IS1A 4JQSA 5HDQA 1P9LA 5AVVA 1Q3HA 5E8JA 4QG3A 3ZD9A 4LRSB 2GXAA 4M46A 3PLAE 1YWGO 2NNWB 4RHTA 3V32A 2FQXA 3D7MA 2D8MA 3IPAA 4L02A 5K0ZA 4F5WA 1WU8A 4LGCA 4TUYA 3V00A 2OAQ1 2FW8A 1A9RA 1EFVA 1S3FA 3W6NA 4MKXA 1DX9A 1E2DA 5WRFA 1M1XB 1NGSA 4RTMA 4RZ3A 4AQYB 4IV8A 1MXFA 2BMVA 3KBBA 4K1XA 5EUCA 1QIJA 1O57A 1G21B 1WABA 1QS0B 1DOZA 1GSHA 3JQBC 2QTRA 2EFDB 2WJJA 3LPCA 1RWQA 2PKXA 4KB5A 4AK9A 3MXTA 2O8CA 2HD4A 5KNDH 3ABOB 3CC8A 2JPDA 1XVUA 4JGBA 2ZAIA 4EKNB 2NSJA 5LA6F 2ZW9A 3PX3A 4CZ2A 2AEFA 1HRDA 1WAMA 3EDYA 1Q83A 3F97A 2DRIA 1EDBA 1E2HA 3BQNB 4N7BA 2C2BA 2DBZA 4UUMA 4XX1A 5ER6A 3TK1A 2B4TO 4N6NA 1BMQA 1QQTA 3VR6D 1AV7A 1JXAA 1RADA 3T5TA 3BIOA 1MZVA 2BGKA 3F5QA 5FLKA 3KC2A 4EEXA 3EPHA 1H23A 3HYRA 1WMBA 4OHVA 2V3CC 5KKAA 2JEZA 3TLKA 3RK0A 2DWQA 2QTGA 1J99A 3IUBA 3TD9A 2B9VA 3K53A 4BVJA 3VKVA 4Z4EA 3HFSA 1M34E 2W6ZA 2H4ZA 3EOBI 4R6XA 3OESA 4UE2A 1UPUA 2A9RA 3ZV4A 3SQLA 2G88A 2WG1A 4HZUB 4Z4FA 2QRQA 4OBBA 4MS4B 1YASA 1QAOA 4GOOD 1NE7A 1TL7C 3AETA 3WR5A 4KXNA 1H1LB 3U4DA 4U4AA 1UMKA 3W2FA 1JH8A 3SIPA 1UWVA 4FMPA 5J5VA 3WLJA 3U9TA 3BL5A 4X97A 1MOQA 2J3JA 3JQDA 4TWBA 4C4AA 3DNMA 1Q77A 5AVRA 4AF6A 4F56A 1PS0A 2CJFA 4FZRA 1DV1A 2XRMA 3GCDA 5KNCD 1ZUNA 2FPUA 2HU8A 3EXEB 5CXQA 4XIIA 2AW3A 1O8CA 3H1GA 4Q00A 4LWQA 2PZAA 4DR1B 1VXOA 2UZ3A 5JSYA 2XDYA 1KU0A 2DFTA 3NTUA 1J70A 4N3BA 4MVJD 3IAUA 1PNRA 1KDPA 3AETB 1JR3D 1N6LA 4BFZA 2NXNA 3IPXA 1YJAA 4K6FA 1KKMA 1GUYA 2B2XA 1OB2A 2AKYA 3K9CA 1MJGA 5F1PA 2HNBA 3AOEC 3RUCA 4ALJA 5CHEA 1U2TA 1GQYA 2VKTA 4COOA 2HA3A 3GVPA 2O6LA 2H9IA 2MTBA 5F3RA 1CIVA 2CKMA 2VDRB 3Q98A 3GJ7A 4S1OA 4Y6PA 3P0JA 4L2IB 4NMXB 4BBZA 4IZHA 3I6QA 3LY5A 5ERXA 3GLUA 5DCWA 1SOUA 5BN4A 3BDIA 3L8ZA 3MMNA 3QU4A 2PJRA 4UD6A 1CV2A 3RCBA 1Z8NA 2BRUC 4WD3A 1OYOA 1RJGA 3LBNA 4HEJA 1A8UA 3ABRB 1DC8A 4DL9A 5HM8A 1XFAA 1PNOA 3I8SA 4QGHA 4RY2A 5IKMA 5KNDA 4A36A 1TLFA 2O2EA 2CYAA 1Z4JA 3LDFA 3LQQA 5AKKA 1SC4A 3M6VA 3LKVA 3CX3A 5H16A 1ZUHA 1HSOA 2B6NA 3I45A 1IBKB 3ORYA 2F3QA 5FLEX 3ELWA 3TG8A 2C78A 1WDTA 1LNQA 1BFUA 3HB0A 3CW2A 3SNKA 3LK7A 4NHOA 1QKJA 2VHCA 3STVA 1O4VA 2AWOA 1OLSB 2KB0A 4UHFA 3AR3A 4GKBA 5I9MA 3ZI7A 2J9YB 4YIHA 4ZZ0A 4LQCA 5FA8A 1RRVA 3KPYA 2YCLA 3MSCA 1UF9A 4N48A 2OZPA 2OO5A 4I8XA 1DL5A 4JLVA 4RVOA 4F7WA 5BN5A 2HRDA 3EIHA 5EP1A 4EG0A 5H02A 1JIQA 3JAMA 1ZN2A 2Z2KA 3SZUA 1M75A 3H4MA 4BC1A 4B83A 1ADFA 4JXXA 5A9SB 4DCVA 5TT1A 3P9KA 4TS1A 1WTCA 2OKCA 2OZLA 3CY6A 1CY2A 1I3MA 1US8B 1SK9A 3EWSA 3KQYA 2YHBA 4MIOA 4ML3A 4Y2PA 4ALNA 4E14A 4WCFA 3EC1A 3GGCA 4WKCA 3EZGA 5JZSA 4Q6WA 3SEFA 1KI6A 1YRHA 1MVOA 5JSQA 1B1AA 3ZWDA 1UT5A 5IAEA 1CRWG 1NUQA 1TI7A 5LUBA 1WBDA 1XMIA 4RD3A 3R0VA 1A9XA 2V9PA 2PZMA 1TPZA 4Q4HB 1E0JA 1EVYA 3ABQB 3I9NA 1C7JA 4JT4A 4L95C 2GKOA 2HBYA 4ZTBA 3RANA 1QBKC 1OI7A 4A8JA 3HCBA 4BBPA 2DPXA 1JDJA 1FP4B 1H2WA 1I51A 3EIQA 2H4HA 3T7CA 5C7OO 3A0RB 3AVOA 4JLDA 4IUBS 4JEHA 3A28A 1B00A 2XOEA 1UKCA 4AJNA 1KDOA 2YV3A 3JD3A 4PS1A 4YAEA 1NW4A 2PZBA 3DEAA 4UCWA 3GCWA 1SBCA 4E46A 1PJRA 2AK3A 5LJIA 4AL4A 3DE4X 3LX6A 3E18A 1SQ0A 4NJEA 2ZYTX 4I5FA 4N6GA 2GNAA 2JW5A 2NQ8A 2X8LA 3WYNA 3PE3A 4DXAA 2ACVA 2IV2X 2XA2A 3JD1A 1S2IA 1J2EA 1O6GA 2PFGA 2QV0A 2X2FA 4HAXA 1W6UA 4OI1A 3SE7A 1RWXA 3EF3A 1UKEA 5A06A 2ZCUA 2X7JA 3UENA 3UAGA 4PTZA 4MUXA 1E2MA 1UBKS 4L5IA 3GRFA 5E38A 5TV2A 4BFLA 2QTNA 3G88A 1RPTA 1VJCA 4EA9A 5BV0A 1FP4A 2HYDA 2QNRA 3SS9X 5BR1A 4EUNA 5FO0A 3GPCA 1DBWA 1RM4A 2VPTA 1CDDA 4A0QA 4MVYA 3SICE 2XKBA 4P7FA 1DC6A 3L4EA 1WVGA 3NW9A 3C87A 1TCUA 3ZDAA 4MHSA 2NV6A 5HTKA 4WBSA 4QVGA 2WAMA 3DOEA 4WJZA 1O0CA 1ZM2A 2JLRA 1E7YA 1NFQA 2Z58A 1XX6A 4KXQA 5A3RA 5ES4B 1WBBA 1PG5A 2XT6A 2WIFA 2BR3A 4G09A 3TCXB 2WA2A 4D9JA 1ORWA 5BNZA 1CS0B 5BV8A 2OUKA 2J1LA 1M1NB 1U04A 5KKNB 4XASA 5BNFA 4BWYA 1IUKA 2DR3A 4IO0A 4N3AA 2OC9A 3H17A 3EK2A 1AKUA 2IPOA 3GLHE 4FFBB 4P3XA 3VZPA 3OLVA 2V7PA 1TMGE 3B12A 5SY4A 2IGTA 4H6PA 5A0FA 3CB2A 4ALKA 1JAHA 1IY0A 1JMVA 1N5LA 2K87A 3AXTA 3BWCA 3IKMB 1I5OA 1LPOA 3VSDA 2H11A 4JCCA 1N36B 2V7TA 1T2DA 2WU8A 3RAPR 2FR0A 1IBCA 2GVNA 1Z6XA 5EHXA 3H6GA 1PR3A 5C1IA 2P2CA 4L08A 1XZNA 2J5BA 2J0QA 3VO8A 1M2EA 5CH8A 4Z7OB 2PIDA 3F67A 4DVGA 5JFOA 2HPAA 4X94A 3RAGA 1BXGB 3UC9A 1NVMB 3IQXA 3EOZA 1VKOA 3X2SA 1M6VB 1O94C 2CWWA 1M2JA 1R12A 2IHYA 3N5KA 4F6RB 1BKYA 1HA3A 4L9RA 3QBJA 3AG6A 1F9AA 3E1KA 5JUWA 1U8ZA 2VSYA 2G09A 1X3SA 1FSFA 1GLVA 3EEQA 4YGYA 4YP1A 3RBAA 1R4NA 3SYMA 2OR3A 2V6MA 3NONA 3TLXA 1Z5UA 2NU6B 2CXSA 2ZJ1A 3KHUA 2VS1A 3P9ZA 4PLYA 1B6GA 1N9ZA 1EZ4A 1O5OA 4TRRA 4BX9A 1IHXA 2WIGA 2WU4A 4AICA 3EIXA 1MTOA 1RHJA 3PDJA 2CZQA 4K2AA 1WV0A 1P2DA 4LRXA 4QSMA 1V3TA 1BJRE 5KDOA 4QSHA 2G4VA 1ODFA 1RAIA 2R9VA 4QU0A 1T2AA 1Z0IA 4ON9A 2DOKA 4WNIA 4X5OA 3I3OA 4GI2A 1BMFA 3DZKA 4LXGA 4YRTA 2W2MA 3TR5A 1AB5A 1H1TA 1LDMA 2YBEA 4IQFA 4K88A 4CF7A 3AVWA 4H0FA 4OU4A 4DLTA 5DLQC 3TTYA 5EUMA 1L4LA 3R5HA 1ISHA 4FFVA 4EQZA 1K75A 4V0KA 5DM0A 4FYPA 4PN7A 1LX6A 3K3PA 1WXFA 2V54A 4JJIA 2IUEA 5G4KA 2HMWA 4JC8A 5EE5B 2YHIB 3RTDA 3FMFA 5KIAA 1BOFA 1UK9A 1DKPA 4JBGA 3Q8MA 4Z9BA 3WNZA 2F1JA 3W2EA 2XBLA 1JLHA 4FHZA 1KNXA 5IVIA 2JS7A 3OUZA 3RRXA 2FWRA 5ITVA 1WMFA 2G0AA 3I9KA 3UGJA 2PAFA 1HZJA 5FWNA 1I80A 1C9JA 2DFKB 1U81A 2HIAA 4FONA 2M6LA 4JBXA 4G01B 2WG0A 5HYVA 1XOIA 5LMCA 1AF4A 1L8AA 3HUUA 4AY3A 2UZAA 4R3NA 4M7WA 2JFUA 5HGXA 3BF7A 2BUCA 2IDKA 2Z8XA 4DTIA 1OFUX 1E1MA 2HN9A 3IVXA 5J4VA 5CLQA 4EO7A 1CHNA 3EBOA 1XTPA 1OAOC 1B16A 3LQYA 3BCHA 1F17A 3DHVA 5BN3B 3UMMA 3EQ7A 4JUIA 3A7EA 3N6RA 5C7IO 1TCVA 3PRYA 3V4OA 1JILA 5EIBC 2F1OA 5F4BA 3NEPX 4OXXA 2BF4A 3FZGA 1EFHA 3KPVA 1VKJA 3OIFA 2MU1A 3L0PA 4MGHA 2EQAA 3LD9A 4KUHA 5CXSA 3ETHA 3GAZA 5PNTA 2H00A 3QI7A 4PV7A 3RADC 2V6FA 1WOMA 2BUBA 1RYDA 2DE0X 2CNWD 2VUUA 3I37X 4CT5A 1HNZB 1RT9A 2FOIA 1JTFA 2IH4A 4ZIRB 4UCFA 4ZK6A 3PFWO 2RG7A 3P0IA 1XA4A 2Z56A 5TXGA 1Y3DE 2BKUA 1XPUA 3FYUA 3DEJA 1FDRA 5CIYA 3IB3A 1PZEA 3DYIA 5EXEA 3SN6A 2LZ0A 1PDOA 1WXWA 2DT5A 2ECFA 4J7XA 3X1KA 5EJ5A 3IOCA 1PQYA 4INAA 3G0BA 4Z2YA 3WBJA 3DF9A 2WJZB 3II6X 2ECPA 1QUFA 3E9RA 4N5HX 4KOEC 4DQLA 3RIYA 4I9UA 4FBLA 3QYFA 4GX0A 3MINA 1UR5A 4L5BA 2PMWB 2R8YA 1APBA 4K1LA 3HXQA 4BFXA 2CLHB 1E9SA 1GZ5A 2WKSA 2GF0A 3NGLA 1ODKA 1QTIA 4FGWA 1T1SA 2AR9A 3UOGA 3E15A 2IA5A 3VJRA 1CRLA 3I2KA 5T5QA 5B58T 1KSGA 1O7JA 3DE3X 4Q1VA 5ECGC 4YRJA 3BJZA 3RU9A 2E5LB 4JYCA 3PGA1 4M0CA 2PO7A 3H1BA 4NXMB 1DELA 3ECAA 3AVUA 5CLHA 1V2GA 2AHRA 3A9UA 4EH1A 2QTVA 1L3IA 1O96A 2E7ZA 3L0IB 2BFBB 1C8VB 5HGJA 1A27A 4X65B 1MTZA 2JLCA 3QFCA 1TB4A 4CCSA 1M54A 3GJTA 1Q5PA 1IVNA 4M9CA 3SLRA 2AFHE 5IBRA 2N1MA 3GW8A 4OHMA 1GJRA 1QLHA 2RH4A 5ALSA 4E6EA 5KX5B 5CB4A 1B76A 2XDQB 3RV4A 5TY0A 2ZVPX 4Y8VA 5E7QA 4HNGA 1NYLA 4WASA 3H8SA 2YDYA 3QLVA 3KTFA 1SUBA 3O3OB 3VAYA 1PD1A 4RO0A 1T0IA 2BFEB 4FFLA 4TWZA 4JI8B 3QW4B 2Z9CA 1OWMA 1X8XA 1G3IA 4TMZA 1AZLA 3QEBZ 5H1YA 3GDGA 3CWCA 4BBJA 1WBJB 2IVFA 3VR1A 2P4QA 4TLLB 2FW9A 2RGCA 5DLEA 2I2CA 2GVZC 2WBLC 5KAPA 3W06A 4J94A 2O2DA 3F6EX 4ARVA 1ABFA 2BZGA 4ZARA 4GI5A 5B53A 3BEOA 3ZGVA 5KYGA 3MJHA 3FUUA 1WRBA 3G17A 2ODBA 3I0ZA 3OPMA 5FUXA 4BB9A 5KOJB 3ESAA 3OKPA 1PP4A 3I64A 4RIFA 5JZ9A 2TMYA 1HFWA 1Y9JA 2IF2A 2AXQA 2O52A 3MOIA 5K0JA 3AEZA 4KQ6A 5A3QA 2I1VB 1NW8A 1OA0A 1WZCA 3DPSA 1E6LA 4HQOA 3FZYA 4TS3A 3OEWA 1G6KA 1VPLA 4FGUA 5AXBA 2FPIA 3V7UA 4BVHA 3S8EA 4Z8YA 2BFEA 2PZJA 4DNOA 4IVNA 3EAQA 1JPJA 4YUYA 2ZB8A 5KEIA 4KO2S 3CVVA 3HWSA 4XCXA 3OZDA 5KB3A 2A2ZA 2RARA 4E08A 1W0JA 1IU9A 2GWRA 2DQSA 2YZ7A 3AESA 4N4AA 4TV9F 1N1GA 2ZWVA 3D6FA 2AK2A 3MNFA 3KJXA 4NYIQ 4QFMA 1NBAA 3KS9A 5B37A 2AA3A 2CY0A 4IUYA 4O33A 4CFSA 2ZRPA 1YQEA 4W1SA 2V98A 3LQKA 3HWWA 1REQB 3DLPX 4NFHA 1SHLA 1U9ZA 4AJLA 1EX1A 4HXEB 3PRKE 4AN4A 3A1UA 1N1EA 3I01A 2BCEA 3LC7O 5JAUA 1PUIA 1MEJA 3DUFA 3IODA 2P1ZA 3IXLA 4MB6A 4O1IA 1COWD 2ASEA 3D6NB 1Q92A 3OZBA 4MPJA 1V8PA 2FSGA 3UFBA 3X44A 2WTEA 3HPRA 3Q8WA 1JR3E 4AZVA 3X1WA 4P4SB 2PEYA 5GONB 2VDVE 2EKZA 4Y2VA 4L85A 2VJDA 3H1TA 3IMFA 5CLGA 1TU3A 1W34A 3IUEA 4PC6A 1CRQA 3LUHA 4YPOA 2POQX 1G0NA 3BHIA 4UEKA 1EGMB 1REQA 3L82B 3TTTA 3ORRA 3PXEA 1KEZA 3PKJA 4HJRA 4Q7JB 2ZRHA 1V5FA 4PAWA 2OECA 2NXEA 3HDVA 4P9NA 3GFTA 3NCHA 2X5XA 4FWBA 3MHTA 4H27A 5H4GA 1JA1A 1N6HA 2GQ0A 1OR8A 1IMOA 1CP3A 2G76A 3BXEA 1XLTA 3EBPA 4L9WA 2HF9A 2WIBA 3AYZB 1DMSA 2GN6A 2PK3A 3AFOA 3LP6A 2DU8A 5BORA 1QTRA 2NTJA 1L1FA 3F6CA 4LAFA 3BXHA 3DAHA 4IV5A 4MA4A 3UPDA 3PZBA 1E1CA 2GZHA 2PKCA 3WRXA 1RYHA 3UUFA 3OF3A 4PGAA 4HYYA 3HADA 3DVSX 2ESRA 1KRWA 4H7FA 3CURA 4M21A 3KUXA 4HAUA 4E7PA 5JDIA 2JLZA 1E2EA 2EL7A 1TIBA 3C5VA 3GT0A 3QBVA 4NV1A 4WUVA 4XB2A 3RBVA 4YA6A 1LX7A 3MCAA 5FQOA 3ZEAA 2PGDA 4EENA 2ZR7A 5I9NA 3MTBA 5JQGF 2RHLA 1V9SA 2GWHA 2C92A 4CNBA 5DOZA 3CQ9A 2FSPA 4IDQA 4C4XA 3A1SA 1PZXA 4IGAA 1X9GA 2VJMA 1TW3A 2OO5C 3VV2A 3R3UA 2NUPB 4JMLA 3QKWA 5EZYF 4XTCS 4CG0A 3O93A 1VSTA 1W96A 1XRQA 3L7KA 3TAXA 3NNNA 4R3UC 4LHSA 1RTTA 1HDZA 1YUBA 1UBRS 4UE6A 4DMFA 3HJTA 1Q1QA 3EH2A 4AJKA 2CLDX 4YH1A 3V55A 4D74A 2A3RA 1NNUA 3OCJA 3EVCA 3KQLA 1LI5A 3SBDA 3KETA 3TSOA 3P26A 3VNQA 2ZYDA 2CF5A 4II3A 4DSNA 4UMEA 1HDRA 4F60A 2YV4A 4YRFA 2DQYA 3LO8A 1WUYA 4XR9A 3C98A 3EZ6A 4D43A 4DMUB 1YRWA 2VHVA 1UC9A 4Y1FA 4S0ZA 3K7EA 4AW9A 4JQOA 5A7GA 1LB1B 3M33A 1Z07A 3UFXB 2CDCA 4W82A 1SZCA 3I04M 3L7IA 4EY7A 5GIPE 3NRBA 1XG5A 3OD1A 4RNCA 1YZQA 3O4VA 4J1SA 4R69A 2X22A 4TX1A 2M6KA 3K2BA 4LOHA 4ZANA 4IDEA 1SRQA 2C5SA 2CYCA 3L8DA 3RJ5A 1NJ2A 4G0UA 4YJ3F 2XDAA 5BMOA 4RD6A 1T43A 1OBCA 4MRAA 2CJYA 1ODJA 4ZEVA 2ZYSA 3D3KA 1I7SB 1KVUA 3MCTA 4U3JA 3OPVA 2YR0A 1HK7A 1B15A 4MQ6A 4E11A 5IJWA 4BJHB 2BMWA 1PLLA 1WSAA 2VHWA 2XNJA 4RDHA 3GU3A 1ZMRA 2QYSA 3VZSA 4JLKA 2VK1A 2D2VA 3AR2A 4CIBA 1JFTA 3A6KA 2OAP1 1F12A 1PD0A 1T1RA 1QGOA 2PWAA 4UFPA 3G5MA 2H3EA 4R8VA 4AYXA 3KJIA 1V71A 4D3FA 2VWPA 2VPZA 3QFHA 1SVNA 5IVKA 5AJHA 2XQFA 3OG9A 2MYNA 3NC4A 2JBAA 5E1BA 3WMGA 2FQYA 1P61B 3AJRA 3ZDZB 4C76A 5JVDF 2VYQA 2QLNA 4NF2A 2REQA 1CUYA 2YFKA 4XRGA 1J21A 4M22A 4U6NA 2H2FA 5L4NA 1AY0A 1H2ZA 3C97A 5BPFA 4F4UA 1NI5A 2Y1FA 5E6SA 3ZBTA 1SCJA 4C6SA 3ZJUA 4AO7A 2OILA 1NW5A 4B32A 4B44A 1UBCA 3PXUA 3ZVNA 2Y1DA 1HEYA 4Q9HA 3WBFA 1FW6A 2GBGA 3IT2A 5EP3A 4G0QA 1D2EA 3HYNA 3CE6A 1XZJA 3FPAA 3ILHA 3PNKA 4YRSA 4DTCA 4G0YA 4O4HF 3TQIA 4C1BA 2FEWB 1KI4A 5K8CA 3ZI0A 1UBMS 1GRNA 3T3OA 1N92A 1GARA 3K0CA 3D3WA 3GN2A 3R40A 4DQUA 3W5JA 5AOAA 2G07A 5JDIC 2J07A 3W7VA 3NHSA 3N39C 4W5TA 2V7UA 2CUKA 1XAJA 1XNRB 4Y67A 1I1HA 1H9CA 1VBNA 3V4VB 1KIFA 1DNPA 5E6SB 3A2KA 1IK4A 4DM7A 4LGYA 2GDJA 4LZPA 2YBDA 2A4MA 3OJOA 4RA9B 1V4VA 3QTBA 4PVCA 5E4YA 4OIFA 5IF3A 1FX0B 2LCQA 3AM4A 3RWBA 4K03A 1OIVA 3VKFA 3LQ2A 3Q6NA 2XZOA 4NS1A 2WSLA 4MRRA 4MRMA 1NPDA 4ECEA 3OA2A 2MHCA 4EA8A 2FSHA 4F5DA 1N77A 3NOVA 2F3UA 5TMPA 1U1IA 4E4YA 2HSJA 2C0CA 3FRHA 1KYQA 1QE5A 1C14A 4ETMA 1XCLA 2BGNA 1H2BA 3JYPA 4PIMA 3BTVA 3D43A 4WXYB 4XYGA 5IYZA 5HFAA 2VWHA 3IKLA 2FA9A 2HLHA 3SZ3A 3WLSA 5AO9A 2B6HA 3CLHA 3RYTC 5FT9A 4IINA 4CMJA 4TXMA 1EQUA 2BTQB 2AC4A 4FYKA 2DHDA 5KYKA 2XB9A 4OAPA 5IJ9B 1BCSB 2IU0A 4ZTZB 1D4OA 2V7VA 4N5IX 3VR0A 1TGVA 4RW0A 4M37A 4GC9A 1O95C 1QRSA 1WULS 1SPXA 3KIPA 4W5NA 4URFA 4J8PA 4S3MA 1K6IA 4ZVOA 5A5DA 1H5UA 2ZYGA 5COQA 2M9MA 3EWAA 4FINA 2BBOA 2R6HA 1E32A 3EN0A 1FCJA 3IB6A 1PZFA 1SG6A 2VPIA 3CRVA 4MVWA 1QHIA 3H5NA 3OQ6A 1XEXA 4UZEA 4FFWA 4X3PA 4D4MA 2Z6AA 3ZY4A 4UPVA 4C20A 1BXZA 4FOPA 4RMGA 2X4IA 3RS2A 1R5NA 3ND8A 2BTQA 4QXAA 3RHSA 2BFCA 1SB9A 2XTNA 5GTDA 4PC1A 4NIMA 4FTWA 1FFCA 1MABA 4J7UA 2E4YA 2P30A 3OJWA 3NQ41 3K0SA 4LXTA 1SCKA 4ZVPA 4EF6A 3AEYA 4BAZA 5AVZA 3MOGA 1KORA 2OYSA 2VDNB 5FIUA 1D4AA 4YGXB 4PC7A 4LXIA 2ZGVA 4M9RA 3ROEA 3TM4A 3K5HA 3M0EA 3THWA 3PX7A 3KQUA 1ZJYA 4EAQA 3TMYA 1LJ8A 3EDMA 2BFMA 4OP3A 5IN5A 2JGJA 1SBHA 4WJLA 1GU1A 1P0PA 4G0WA 1FP6A 1T36B 4JVLA 4MW9A 2DSNA 4TZKA 4J03A 5DX8A 3LUCA 3SMVA 3MA0A 2ZRAA 3UQZA 2XZTA 10MHA 1WCWA 1N9GB 1HOXA 1FTQA 3JYOA 3RYFA 4Y0AA 3UMRA 3Q0TA 1NDHA 1Y6GA 5EIOA 3LBFA 3ZH9B 4AM8A 3D4NA 1IJEA 2GAJA 2VPPA 4U2EA 4AO6A 5LKRA 1RZVA 3B53X 4WZAE 1DJQA 1HY3A 1BD4A 2XUPA 3RDPA 3LQ4A 3N2NA 1GUBA 2WIKA 2BKEA 3FKSA 5ADUS 1KFJB 3A9SA 4UBOA 3W8NA 5K6AA 4HAVA 1T5BA 5FOWA 3ZE2B 2Z1MA 4TLAA 1IXZA 4AY2A 1EUDB 1JHVA 3PGLA 3TNDA 3G1TA 2X9QA 4ZJYA 1YR2A 4RKEA 3WV5A 1II8A 1NXVA 4V0QA 4PICA 3W6ZA 1PRYA 3L4SO 1DBPA 3MZ0A 4G0XA 2R00A 3COVA 1TRKA 1WHTB 1QHHB 1QS0A 1YL7A 2BEVA 3DKVA 3LVRE 1R6VA 4PINA 4EPRA 3VNRA 4ENQA 1FU4A 3BCUA 3T4XA 5IMBA 3QYJA 2Y66A 4V0ME 1Z29A 3U0VA 3HE3A 2WVJA 3GMSA 2WPNA 4QQ8A 1FBNA 2BONA 4UASA 1MVNA 1E6CA 1KI3A 3FLAA 3FHCB 2EBHX 1Y6ZA 4YRAA 3AR6A 3ZUPA 4B6EA 4UUBA 3UJAA 2CV1A 2QQGA 3MK31 1QB8A 5EVCA 1LVUA 1Z9BA 4KGVA 2QJOA 3MGCA 1FB5A 2FZ4A 2VQSA 1WKCA 2HT6A 3GA7A 2W6NA 4UNNA 3ZC3A 3ILXA 4A0FA 1Z15A 4I50F 1GL6A 4K9MA 2H4FA 3SKVA 2O8EA 4REQA 1R2QA 2XJ9A 4C0QC 1Z73A 3RIHA 3W2IA 3T5PA 4J3JA 5EHIA 2QP3A 1OGIA 3K0KA 2AD1A 2G9ZA 3ICPA 5HK8A 3ONWA 3BBLA 4Q3CA 5CRIA 3UOWA 1NRJB 1G5FA 2FMKA 2HA4A 3B6IA 1C9NA 1OYWA 4GUAA 4NNJA 1U0OC 1YKGA 3C3KA 4MA5A 4U2BA 3PQ7A 1XPJA 3OZGA 1NAIA 1WD7A 3WOHA 4C30A 5AW2A 4KPUB 3HNPA 4YXFA 3VTZA 1NBIA 4FDMA 1CQIB 5LBTA 1OZHA 3INYA 5HQ3A 1WX1A 2GUWA 2BBSA 5DSXA 1GPBA 1AKQA 4B4UA 4Q01A 1IM5A 1AKRA 1SQ6A 2AOXA 2ODTX 2ZUCA 3VC3A 4DIFA 4ZC1A 3DFUA 2V1XA 3CMCO 4BMZA 3E61A 1KBQA 2BCGY 5FORA 2AFIE 3BIFA 3CF6R 3EEBA 4AS3A 3WSTA 4EITA 3TDKA 2PUJA 3W5VA 3AUXA 3OU7A 4O3MA 3PS9A 2HHHB 3MWLA 3KE9A 1M74A 1MO4A 3OC0A 4DJFC 3CA8A 4D3DA 5IVPA 4WEQA 5KMGB 3TW4A 3G8CA 3FPHA 1B0UA 1UOOA 3B13B 2IYVA 2JHPA 2PWPA 1KMQA 2QN8A 4HEA6 4JB0A 4C0LA 4JLBA 5JO0A 3PNVA 4M1YA 2W2OA 2GLXA 3P9XA 1B0ZA 4R83A 1RJEA 3L7AA 3GLGB 3NXKA 2RGYA 1DKRA 3RQIA 4CE6A 3T7AA 1JJVA 1TOAA 2CD7A 3A7DA 2UYYA 3V4ZA 4LF9B 2QJWA 5A3VA 3JPWA 4PY2A 4F04A 2Q21A 1Z22A 4LZLA 2VQDA 5ALDA 3BGIA 3DJFA 4FZ3A 3H5VA 2JBHA 1JMKC 1XUOA 2WEKA 4R5HA 1ES9A 4YAGA 2ES4A 5ARDA 4IH4A 5JVDA 1SBIA 4MYUA 2PBRA 1U0TA 3G79A 3LPNA 4B33A 5DLDA 3AQIA 4PQEA 3WGQA 4B2YA 1AGPA 1Y8RA 1KVQA 5CFRA 2WJIA 1D7OA 3A4TA 1UWLA 2RHRA 2XQJA 4E33A 3DZ8A 4YMSA 5ED0A 1KU6A 3H9BA 4W5QA 1G98A 1Q1GA 1T5SA 2LV8A 4JVMA 4RZQA 1CXZA 5EQJB 3GNLA 3JYQA 1TM4E 1KO8A 3HP1A 3EVDA 3G85A 4QRHA 2J3KA 2WJWA 3WWCA 3UAVA 4PQFA 4C06A 1J33A 2OQRA 2WSBA 1WIWA 2VFAA 4GVLA 1EXDA 4YAIA 4D42A 4YJDA 3G6KA 3LRXA 5FBLB 3KV1A 5H59A 3ZU6A 5KOHA 1CB0A 2I1WA 2JHCA 4ND4A 3N8IA 4ASUD 1AUVA 2C5FA 1YB6A 2HWYA 3RRBA 1AKMA 1KJZA 4OHFA 1EVEA 1CF9A 1RXSA 3OX2A 4JY7A 2QU7A 2BFFB 4YQEA 2OGZA 2VPWA 4AY4A 4JH0A 2VL7A 1Y98A 4DLXA 2O2XA 1W75A 4V0LA 2BDEA 2OBLA 3FNRA 3T34A 1BH2A 3QVGB 4GM4A 3OM0A 5JNRA 3U16A 1M83A 1LBEA 2YIDA 2ISCA 4UU0A 4ZEMA 3RPEA 2B2CA 1L7NA 4DSAA 3ER9A 4H3HB 1RRFA 3VU1A 1YCGA 2YJ5A 2H59A 4DIKA 3EY4A 2VRWA 1UOEA 4ASUA 4QO8A 2DERA 3V97A 1Q3TA 3BGVA 3GEEA 1HDOA 2IZ5A 1Q22A 3LVFO 3LFHA 4I99A 3GF4A 5EXPA 3S55A 1EXVA 3OQMA 2WP8J 3G2HA 3HKDB 2ZM5A 1Z6ZA 2QMOA 5AJYA 1Z34A 2UUOA 4WN9A 4DJ5X 4M7RA 3K94A 5IXSA 4MIEA 3UF0A 2GK4A 1I3OA 3IBYA 4ZOAA 3K16A 1MMFB 4CF6A 1NP3A 5DFAA 5DHRA 4EKDA 4JK3A 4EHIA 2FSVA 2CD9A 5CH5A 2D3WA 4P6VF 1YR1A 3KKQA 2GA8A 2PKQP 1E59A 1EHCA 3TIFA 3WQSB 4CCWA 3DBRB 2ATCA 2C95A 2JAQA 3GEGA 3KCQA 3CRW1 4UEQA 1XZCA 3I1YA 1G20A 1GVHA 4QKQA 4KAXA 1LDNA 5CYPA 3W7BA 2ZBUA 3KT3A 4YV2A 5A5FA 1SBTA 4DMRA 4U7JA 4NENB 1EVJA 1BE0A 1G2QA 2AEMA 3K73O 3NEAA 4ND1A 5LVAA 2ILVA 3HZHA 2ATXA 2PWZA 3R6GA 3UHAA 2VSOA 3BGDA 2XMPA 3CCCA 4CM8B 5KPJA 2WSIA 2YWBA 4RLSA 1DOAA 3SE0A 2IY8A 4BNTA 4HYTA 4US2R 3WTCA 2ZB4A 4GQAA 4RHXA 3UMVA 5J2UF 2PSFA 1NW9B 2XGSA 3EPLA 3OX1A 3F8TA 4OHZA 4A6PA 4CCAA 4TLMB 3HQ4O 3OTOB 1K2VN 3EVBA 1NMXA 4W99A 1USKA 5D1NA 3H11B 4HV4A 3HL4A 2IYZA 4YROA 2RHBA 2O8DB 1I6LA 1E9AA 4KH1A 4C3UA 1ZEMA 1J0BA 3ETGA 4L78A 3U4IA 1LFDB 1KF0A 2PA0A 4EJSB 4GLFA 1L7PA 3L1UA 4RH1A 5ALUA 3CG0A 1K92A 5FPKA 1G3MA 2W11A 2B61A 2DKNA 1Q0HA 3AFNA 2G40A 4Q16A 3I1JA 3WADA 2LUOA 6ABPA 3BL6A 4OYHA 4Q9DA 3IKJA 4FK8A 4AUNA 3H5OA 1XNHA 4YMLA 3H8VA 4IJMA 1Y1RA 1LBSA 3GVXA 2E37A 3M6LA 2LIPA 1FFWA 4P3KA 4KI0A 2HHJA 2PL3A 4U0KA 2OVBA 5ARBA 3FY4A 1N0WA 2HB6A 1J7JA 3OOEA 4J1TA 2J7KA 4HX2A 1KFBB 4P3PA 1DX6A 3B5JA 3PPYA 1M2OA 4Y2SA 1E3QA 3I8XA 4CIDA 4DXHA 4GL2A 3PT9A 1NLYA 2B37A 3A25A 3VR6H 1T4BA 1O87A 1F4VA 1PSWA 3RNOA 1Z5VA 1CUXA 2Y9MB 1B93A 3Q41A 2YJ4A 4P81A 3VX3A 5B2FA 2X1HA 4BPBA 2Q7DA 3UK0A 4AKSA 5CAEA 3FR7A 3UY4A 1XZMA 2D5LA 4MIKA 1ZBDA 3LCVB 2YN2A 4KBYA 2C1ZA 4AJJA 4BNHA 5BV2P 5AM5A 2XTMA 3R0IA 4GE0A 5B6JA 4AKHA 1OYVA 5HQTA 5ES3A 5LZ5A 2C8LA 4KI7A 2ZR9A 2NACA 1JU3A 1JYSA 3NBFA 4OMFG 1DJLA 5ITSA 4PFJA 5IABA 5D6NA 4OO3A 1RYFA 2PBZA 4BAUA 1Y1TA 4N39A 4R1TA 1E63A 2P91A 4JB2A 3HWX1 1OH5A 2XIQA 3U4MA 1P29A 3JQGB 4KR9A 2O9JA 1P1FA 4KMSA 4F2WA 1Y5NA 1X1TA 2ZBRA 2WJHA 1BU8A 3ESQA 5LYJA 4MCHA 4ESVA 4DR6B 2JFPA 2GCOA 3W8DA 1GO2A 3T5AA 4ZQHA 2VF2A 2H3HA 2NZJA 2XEDA 5JJKA 1KI7A 2IOYA 2JRLA 4UUQA 5JD6A 2F1RA 1B6RA 2EARA 3O8QA 2XNKA 3PKZA 4ZT7A 3AHEA 3PHLA 4PLHA 1C3JA 1XQWA 5C18A 4CTJA 4OYYA 5H3CA 4RSGA 3M5DA 4RL4A 3L8YA 2GERA 1K7XB 2C8JA 2VJQA 3E9QA 2VZ0A 1TT5A 4L5CA 5E6UB 2HJ9A 4H77A 5JU6A 2WJPA 3WIDA 4F4FA 4MV5A 1K1EA 2PX6A 3DPUA 1P3DA 2C2MA 1FW8A 3EXEA 3HSYA 3IP9A 4GOXA 5C81A 5LQUA 4KXXA 5E9JA 5AK0A 2XMQA 1VMKA 2F43B 1BEEA 2QROA