3DLEB

Crystal structure of hiv-1 reverse transcriptase in complex with gf128590.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
428
structure length
403
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 114
structure length 403
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dleB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dleB03
4J9PA 1RT3B 4PUOB 3PVXA 2WK4A 4F4ZA 1JLGB 3KLHB 1LW2A 4XO0A 2ATLA 4NLSA 1EETA 1K1SA 3I0SA 3OL6A 1JLFB 3PJWA 1IM4A 1QUVA 3KK2A 4KBIA 4J9QA 1S97A 1VRUB 1LWCA 1T03A 3G6XA 1U09A 2R8GA 4XPCA 3H4DA 3BSAA 5KFGA 4IOBA 4NLOA 2RDIA 4PQUB 3H5UA 4QW8A 4EO6A 4DL6A 1RT7B 4URGA 1MU2A 2C2RA 2D3ZA 4J9LA 4TY9A 3QGHA 3IG1B 4IRCA 3DRPA 2BQ3A 4MK7A 4Q0BA 4ZP7A 1TQLA 1BQMA 1HNVB 1TVRA 2XI3A 4RNHA 3KK3B 3UR0A 1QE1A 1RT6B 1JKHB 4NLQA 4NRUA 1RTHB 1RTJA 4MFBB 3EZUA 3KJVA 4TQRA 2YNFA 1VRTA 3MECA 4H4OB 2HMIA 4EO8A 4NLYA 1JXLA 2ILYA 1IKWA 1C1CB 1TL1B 3H59A 5HP1A 4NLDA 3T5LA 5DQIA 3CDEA 4ID5B 2UUWA 3C6UA 4H4MA 1CSJA 4I2PB 1JLAB 4IFVA 3LAKA 3RB3A 1K1QA 1KLMA 1HQEA 3KLGA 4H54A 4Q8FA 4RW8B 5J2QA 4KSEB 5DG8A 2OPQB 2RF2A 1R0AB 4O3RA 1C1BA 4ECSA 2AGOA 5DLGA 5KG1A 2IM2A 4HKQA 5KFDA 2FJXA 3VQSA 3MR5A 5KT4A 2R8HA 4DL2A 3LP2A 2FVPA 3LAMA 5KFUA 3OLBA 5FDLA 2OPPA 3KHGA 2B5JB 3TVKA 4O3NA 3SFUA 1HNIA 3QIPB 4MIAA 5KFNA 2JEGA 5KFBA 1IKXB 4RW7A 4NLGA 2VA3A 1BQNB 3V81B 3QO9A 4ZVFA 3SI8A 5J2NB 4NYZA 5KFZA 2W7PA 2IA6A 3NL0A 1GX5A 4IRDA 2ZD1B 3CJ2A 5HBMB 1S1WA 4MFBA 4ECYA 3KOAA 4DG1A 4K4ZA 5KG5A 2W7OA 4DL7A 1SH0A 3OL7A 2J6TA 2BQRA 2R2SA 2FVCA 3CJ4A 1LWFA 4I2QA 4K4TA 5L1KA 3CVKA 2IJNA 4WYLA 4RUAA 4ZP6A 1TL3B 4RUCA 2HNDA 2AU0A 4TLRA 5L1IA 4QWCA 5KG2A 4XPEA 4JUZA 4R8UA 1RT2B 1RYSA 3MEEA 5HROB 2IAJA 4ZPCA 1S1XB 3GQCA 1LWEB 2HNZA 1REVA 3KLFB 3KLEA 5I3UA 2IC3A 4QW9A 4NRTA 2XC9A 2YNIA 3HVTA 5C25A 2D41A 4F4YA 5DG7A 2YNHA 4IG0A 1TKTB 3V4IA 4K4VA 3MR6A 3LP0B 4RNFA 2I5JB 3ITHB 1IKVB 4IDKA 4IH6A 3TAMB 2XWYA 3MFIA 2BANA 2RKIA 3IS9B 3DMJB 4NLTA 3OHBA 2R8IA 4IFYB 1SUQA 2GC8A 4O4RA 4ZVHA 1JLEB 3T19A 1T05B 2WB4A 3GILA 3T1AA 4ZMMA 3MR3A 4MH8A 2OPRB 5KFYA 4KFBB 1RTDA 4I7FB 4NLRA 3DRRB 2R2TA 2ZE2A 1RT4B 4B3OA 3NAIA 3I5AA 3PW0A 4G3IA 2ASLA 3KK1A 5EWGA 3KNAA 4LSLB 2W9CB 3KLIB 4KKOB 1N5YB 5KG4A 5F8HA 3IGNA 4MKAA 3E01B 5C24B 3CO9A 1S1TB 5L1LA 4DL5A 4DL4A 5KFTA 2C28A 3DLGB 1UWBB 3DYAB 1HYSB 4LSNA 1GX6A 4O3QA 1N56A 1RT2A 4WXWA 2UVWA 3PJXA 5F8LA 1LW0A 3BQ0A 3CDUA 2YKNB 1XR6A 4Y2CA 5EDWA 5KG3A 4R0EA 1S9GB 4Y2AA 2FVQA 3UDLA 3OSNA 2VG6B 1TKXA 5K14A 3NAHA 3H98A 5J1EB 5KFOA 3DI6B 5KFQA 2ZKUA 1IKYB 2J6UA 1S0MA 2I5JA 3BGRB 5I42A 1KHVA 2BRLA 2QE5A 4Q45A 1DTTB 1S9FA 2HNYA 4O4GA 3QGGA 4RW4B 3QYYA 2WONA 4OL8A 1S10A 4RZRA 2C2DA 4RNOA 3T5JA 1C0TA 5KFEA 3NKYA 1S6QA 1S49A 4TY8B 3QZ7A 3DM2B 2VG7B 3HHKA 1N6QA 3H5SA 4EYHB 1S6PB 1TV6B 3FFIB 2W9BA 3DDKA 5DLFA 2I1RA 2VG5A 5F8GA 3OHAA 2HAIA 4PWDB 1DLOA 5EWFA 1RYRA 2B6AA 3Q8QB 3JSMA 5KFHA 2ALZA 2IJFA 4KO0B 4ECUA 3T5KA 5DGBA 1J5OB 4ECVA 1RTIA 3DOKA 3V6KA 2E9RX 1I6JA 2VA2A 4R5PA 3QLHB 4IG3A 3M8PB 3DYAA 2R2RA 1SH2A 1S4FA 2R8KA 2E9TA 3RBDA 4FS1A 1JLBB 1FK9B 5J2MA 3CJ0A 2OPSB 3KMQA 2WOMB 4RU9A 5F8IA 1JLCA 2O5DA 1SH3A 3C6TB 3DOLA 2FVSA 2JC0A 4ED2A 4ED7A 1HPZA 1S9GA 4KE5A 4KV8A 1ZETA 2UVUA 4K4YA 2C22A 3H5XA 4WE1B 3H4BA 2ASJA 3M8QA 1QAJA 4LQ3A 2AX1A 3NBPA 3GIMA 5KFFA 1FKPB 1HMVA 3BGRA 1RT3A 4PUOA 1JLGA 1D1UA 3KLHA 5KT7A 1YVFA 3FRZA 3DRSB 4J9KA 4RNNA 3HVWA 5DQHA 1JLFA 3MEDB 1JLQB 2WHOA 2FVRA 4FBUA 5KFVA 4YR3A 4FS2A 1VRUA 3HVAA 4IRKA 4K4XA 1HQUB 4RW9B 1S6PA 3BSCA 4KB7A 1NHUA 3N6NA 3I0RB 4GC6A 1RA7A 2FJWA 4PQUA 4ECQA 4G1QB 1RT7A 5KFRA 3PZPA 3I5BA 1FKOB 1D0EA 4J9OA 3GV8B 3IG1A 3LP1B 3M8PA 4WFZA 4YP3A 1XR7A 2E9ZA 5C42B 3RBEA 1HNVA 2JEIA 4IKAA 2UUTA 4ED8A 3NGDA 1SV5B 3KK3A 2XGPA 1RT6A 1JKHA 3LANA 4WFYA 2FLNA 1RTHA 2YNGB 3CWJA 1HARA 3M9MB 5T14A 4H4OA 5KT3A 3ICLA 5DQGA 2IM0A 1C1CA 1TL1A 4JV1A 4ED0A 3Q8SB 5KT2A 4ID5A 3V6DB 4TYBA 3MEGB 3FDSA 4I2PA 5D3GB 1JLAA 3QZ8A 3KMSA 2BR0A 3D28A 5HLFB 4ZVEA 3OSPA 2FLPA 2XCAA 4EBDA 5F9LA 4RW8A 2BE2B 4YMEA 4KHRA 2OPQA 1R0AA 3DLEB 2JLEA 1RT1B 3V6JA 3GIJA 1TKZB 1HQUA 2B43A 4ICLB 4Q8EA 1S0NA 3HKWA 1C2PA 3G6VA 1RDRA 3M9NB 3KHHA 4URSA 4NCGB 2B5JA 2YKMB 3IRXB 3T5HA 4DL3A 3V6HA 3QIPA 1ZTTA 4YR0A 3EPGA 1IKXA 3MR2A 1WNEA 4F4WA 1BQNA 4ZHRB 1S1VB 3V81A 3PR4A 3DLKB 3RB0A 5J2NA 5KFLA 1S1UB 4EBCA 2BQUA 1MMLA 2ZD1A 5HBMA 4J9MA 1DTQB 4J9NA 2YNGA 3QIDA 3H40A 2IBKA 1TP7A 4O44B 1S9EB 3BQ2A 3TQ1A 4K50A 3JYTB 3E51A 4K4WA 4NLXA 4ECXA 1TL3A 2XCPA 1EP4B 5EWEA 3PW4A 2V0NA 3OL9A 3RAQA 1W25A 5KFKA 4TQSA 1LW2B 4TYAA 5HROA 1S1XA 1LWEA 2CKWA 1EETB 3BR9A 3KLFA 2GIQA 1JX4A 4ED6A 3KK2B 4Y34A 3G6YA 1LWCB 4RW6B 1TKTA 2BRKA 1C0UB 1KHWA 2JC1A 3LP0A 2DPIA 2OH2A 3ITHA 4O3SA 1IKVA 1S48A 4F4XA 3ISNC 3TAMA 4WYWA 1MU2B 3IS9A 3DMJA 4QWEA 3Q8RB 2R8JA 4IFYA 1JLEA 1T05A 3GIKA 3BQ1A 4Q0BB 4RNMA 1BQMB 2OPRA 4URQU 4KFBA 5CYMB 1TVRB 4I7FA 3FSIA 4NLUA 4TXSA 3PW5A 1QE1B 3DRRA 3RB4A 2AWZA 1RTJB 4ZP9A 4IQXA 1RT4A 3KJVB 2YNFB 2WCXA 1VRTB 3MECB 3H5YA 2HMIB 2UVVA 1IKWB 3IGVA 4LSLA 4ZPDA 3KLIA 4KKOA 5HP1B 3OLAA 1N5YA 2W9CA 4ED1A 4JV0A 5C5JA 3E01A 5C24A 3C6UB 5KT6A 4H4MB 1S1TA 5JXSA 5F9NA 3BSNA 3GV5B 4IFVB 3DLGA 1UWBA 1HYSA 1T3NA 4YR2A 2AGQA 1KLMB 1HQEB 3KLGB 4O3OA 2AGPA 3NMAA 2HWIA 4NLPA 5J2QB 3KHRA 1XR5A 3MTKA 4O3PA 2RF2B 2YKNA 4Q43A 3PR5B 1C1BB 3D5MA 4ZPAA 3IN5A 1Z4UA 2VG6A 4IH7A 4TN2A 4RW6A 5KFJA 4IR1A 5J1EA 3DI6A 3LP2B 4ECWA 1C0UA 1IKYA 1S0OA 2IM3A 3CJ5A 4U6PA 5FDLB 4IH5A 2OPPB 2ASDA 1DTTA 4RW4A 2D3UA 1HNIB 3MF5A 5KFSA 5EUHA 2QV6A 1ZTWA 4RW7B 4LQ9A 3QO9B 4WZMA 4TY8A 2ILZA 3DM2A 2VG7A 5CYMA 3N6MA 2W9AA 1TV6A 3FFIA 1S1WB 1RA6A 4DG1B 2JEFA 3OL8A 1RT5B 1QAIA 4PWDA 5DG9A 5KFCA 4J9RA 3GV7B 5KT5A 4MK9A 5L1JA 1LWFB 4I2QB 3CIZA 4KO0A 3CDWA 1J5OA 2IM1A 5J2PB 3QLHA 3G86A 4K4SA 4KAIA 2HNDB 1NHVA 2FLLA 5KFWA 1JLBA 1FK9A 5KFXA 2AQ4A 2OPSA 2WOMA 4Q44A 3PW7A 3C6TA 4R8UB 3MEEB 2IAJB 4WE1A 2HNZB 1REVB 5I3UB 3KLEB 4QWDA 2IC3B 2YNIB 3HVTB 5C25B 5KFIA 3UQSA 3FQKA 2V9WA 1FKPA 2YNHB 4IG0B 4EBEA 5CYQB 3V4IB 3KLVA 4QWAA 2J6SA 4ZP8A 3DRSA 4IDKB 5KG6A 4QWBA 2BANB 4FBTA 1JIHA 3MEDA 2RKIB 1JLQA 5KFPA 3LALA 4J9SA 2XI2A 3UPFA 3CJ3A 1SUQB 4RW9A 2V4RA 2V4QA 5DGAA 5F8NA 4MK8A 4NLVA 3I0RA 1RTDB 1RT5A 4ZVGA 4X2BA 4G1QA 1N48A 3KHLA 4DEZA 4YQWA 4WXOA 5KG0A 2ZE2B 4B3OB 1RAJA 1FKOA 5J2PA 3KK1B 2WRMA 3MFHA 4U7CA 3I5CA 2CJQA 3LP1A 2HWHA 3RAXA 2JEJA 5C42A 5KFAA 4MKBA 4ZPBA 4QPXA 4K4UA 1SV5A 2WTFA 4NLWA 1OS5A 4ED3A 4LSNB 2AX0A 4MIBA 4EYIB 2W8LA 1LW0B 3PW2A 3V6DA 2XGQA 3MEGA 4M94A 1TKXB 5K14B 5D3GA 2IMWP 5CYQA 5HLFA 5KFMA 1N4LA 4ECZA 5I42B 2BE2A 2HNYB 4O4GB 3DLEA 4JV2A 2WONB 1RT1A 3BREA 4Y3CA 3QGIA 1TKZA 3FQLA 3I0SB 4ICLA 2R2UA 3GIIA 1C0TB 2C2EA 1S6QB 2D7SA 4EEYA 1T03B 3BSOA 4GC7A 5F8MA 1N6QB 5L9XA 4NCGA 2YKMA 3IRXA 2W9BB 3N6LA 4M95A 5JUMA 2VG5B 3PHEA 4KHMA 4WFXA 3M9OB 1DLOB 2UVRA 5F8JA 2B6AB 1T94A 4ZHRA 3JSMB 1S1VA 3SFGA 5KG7A 3DLKA 3Q8PB 4ECTA 4ECRA 1S1UA 2W8KA 1RTIB 3DOKB 3ISND 2GIRA 4R5PB 3RB6A 1DTQA 4IG3B 4WZQA 3DRPB 3BJYA 2FJVA 1NNDA 5J2MB 4O44A 4NZ0A 2RDJA 1S9EA 1JLCB 3GYNA 3DOLB 3H2LA 2EC0A 4IR9A 1HPZB 3JYTA 4KV8B 2DPJA 4HYKA 3EPIA 3M8QB 4F50A 3NBPB 1EP4A 2F8EX 1HMVB
chains in the Genus database with same CATH superfamily
1RT3B 2VBWA 3KLHB 1MMDA 3CJKA 3UE2A 2B4OA 1IM4A 1VHFA 4M5MA 4LF7F 4QW8A 4EO6A 2ZKTA 2C2RA 2IPOB 4C9DA 4Y00A 2RRNA 3MHYA 4IRCA 2BQ3A 3US5A 1BQMA 4WP8A 4FPIA 4HTJA 3EVMA 3ZZUA 3W2VA 2G4BA 4EWTA 2ZBCA 1U4BA 3CGIA 4B3TF 4KTQA 2X7IA 2MLZA 5K5MA 4OZ1A 4PPDA 1GMVA 3C15A 1UVLA 5KFDA 4USMA 2ZOMA 4B9SA 2V67A 3BM7A 1WTBA 2XS2A 1PKUA 4HH0A 5KFBA 1IKXB 3GJSB 1SBRA 1VJWA 3NL0A 1K8AT 3AJ1A 1HR0J 4QR2A 3TUIC 2IY5B 3KNGA 3TA0A 3QFWA 2KT2A 5IM0B 4LF8F 1CG2A 1VQPS 1YJUA 1R6VA 3RUBL 3M7VA 1WJ9A 2ZHOA 4IG0A 2UXCF 1LQ9A 3MR6A 3L9ZA 3CC7S 1V3SA 4N77A 2YH0A 1RT4B 1AB8A 3KK1A 5HSPA 1WOSA 2YWFA 3FCWA 5C24B 1UEVA 4EZ9A 2HIYA 1L3SA 2MZSA 3DYAB 4O3QA 3PJXA 4KH1B 3DDIA 2XS5A 2E7XA 1XR6A 5K14A 8AT1B 2POKA 3BBCA 1U1PA 3DLLQ 4DFMA 2CADA 2C1EB 4JI4J 2I1RA 4OZLA 5LL6d 1GXLA 4KO0B 5DGBA 3NG8A 1I6JA 4XIUA 2C2NA 4YB7A 3N5BA 2AX1A 3RBZA 2HVEA 2DH8A 1YKWA 4DFPA 2EXUA 4ZCMA 2F3JA 3A8EA 4FS2A 4OFZA 1RAEB 1S6PA 3I0RB 4DQSA 3OXLA 2UUTA 3IR5B 1RTHA 1APSA 4H4OA 1R6YA 1SXLA 3MEGB 3MUMP 1JLAA 3FZ2A 2UV8G 4LF9J 4X4VA 1P1TA 2JLEA 2JRSA 3MM5B 4ICLB 2AKWB 2OD6A 3L7OA 3W66A 1WNEA 4K59A 2C3PA 2OIHA 3H40A 3RW7A 3E2EA 1AYEA 3ELHA 1HKAA 3SQGB 2QJ3A 4FNIA 1WF2A 2GA7A 1JJ4A 5C7PA 2CKWA 4CO0A 4TU7A 2E7VA 1I3OB 4GKKF 4HLBA 4DX5A 3ISNC 1NU4A 2XO6A 5B0DA 4IFYA 2B9XA 4R0JA 3SEOA 3POTB 4BHQA 1NPPA 2DGUA 3TWZA 4JV0A 2CPDA 4HI1A 4WIIA 4JI5F 3MMAA 1C1BB 2HVIA 5A6PA 3MMBA 4YB5A 2JHEA 2D1CA 1ZTWA 4OX9J 3QO9B 3NOCA 4TY8A 1N34F 2Z56B 4C0BA 1QAIA 3GCWP 5KT5A 5L46A 1WKJA 2PSZA 2N4CA 1FK9A 2O67A 2OPSA 3HMJG 1S77D 4CI0B 1REVB 3UQSA 4A48A 3OW2R 2OSQA 4E98A 2R9LA 1FNXH 1JIHA 2MGZA 1Q0NA 1HBOB 3W5XA 2QMWA 2ZJPQ 3RR8A 2XM3A 5D8HB 3FSYA 1H72C 4OV1A 4ZVGA 1S59A 1N48A 4OJ1A 5D0GA 4JI6J 3NP5A 3TR5A 5A0YA 1NKEA 1R3NA 5GMEA 4L3NA 4DFKA 5I42B 3CCQS 1IQZA 4M8LA 3QGIA 4CDIA 2ZH5A 4LREA 3CO0P 4EEYA 4B9TA 1T03B 3IFEA 3PRVA 3VZHA 1BMQB 1DTQA 3CDAA 4PABA 2XZWA 2RUSA 1UVMA 1H2TZ 4WCEQ 1K9MT 1WUUA 4DUTA 1DQAA 2ATLA 2NREA 1FVQA 4WF9Q 2PD1A 3ZC4A 4PQUB 4LIRA 4XDDA 1XNQJ 1Q82T 3NWGA 5LSLA 2CQIA 2NXNA 3LPYA 2VOPA 3QGHA 1HI0P 1RHRB 2XBPA 1Q7YT 3M6VA 4CM0A 2J9EA 2HMIA 4YY3F 5LXYA 3ETOA 3BPDA 2M3DA 4OZNA 2DY1A 8RUCA 4KSEB 3UW1A 4DV6F 1R0AB 4CT8A 4HKQA 4OYBA 2ABYA 5AXLA 5HN0A 1FVSA 2ZNZA 3OV7A 2B5JB 2X1BA 3TVKA 1N32F 3FVYA 1KSPA 2IA6A 3KOAA 1URNA 4YOEA 3J80Y 2R7UA 1Y5LB 1CJKB 2V8HA 4NEZA 3AOAA 3FCHA 3ULHA 3MEEA 5I3UA 5EGYA 4NRTA 4JYAF 2XMKA 4OYAA 5BR8F 3M2UB 1VLOA 2PGCA 4DSJA 1Y0HA 1N33J 4AT1B 3LP0B 4RNFA 3NS7B 1P6TA 3CCSS 5KFYA 1YRUA 2KT3A 4I7FB 4G1PA 4NLRA 5A8KB 1SL2A 4MKAA 1B7FA 1N56A 2HBZB 5AXNA 1R8CA 1RADB 4B3MF 2E5IA 5THWA 1ZYQA 1DTTB 5A6WA 3AD8C 3TNVA 1S10A 3T5JA 4LF5J 2YPZA 3DGPA 2HRYA 2W9BA 1ZPVA 1N5VA 1YQHA 3DOKA 2R2RA 1S4FA 1JLCA 1PJ5A 1X4DA 1DQ8A 1T7PA 2AEJA 2E1AA 3F73A 1F3FA 2VFTA 1LV5A 3LH2S 1WHYA 4FF4A 5D77A 1LK5A 4JI7F 2YKAA 1FDNA 1KONA 3T3FA 4K5RA 1RA7A 3HPOA 1FKOB 3VV2B 2L41A 2WVFA 2N3OA 3FKBA 5A8RB 2MHEA 3J80U 4WP9A 3ICLA 2IM0A 3DRYA 1VYAA 5KT2A 4ID5A 2RHSB 2W4PA 2K3IA 3WDOA 4KHRA 2OPQA 2YH1A 4M5JA 3CCWA 2DO4A 1MW7A 1F9FA 4DX6A 4H4KA 3SSRA 2YTCA 1P9QC 5HBMA 4E0DA 3HULA 1JJ2R 4K4WA 5B0BA 4ECXA 5KAKA 1HD1A 1RAGB 1HW8A 1EETB 2F63A 4N5SA 3G6YA 1NZAA 4DR2F 1N36J 1XNRJ 2VICA 5E3CA 4F4XA 4HDGA 4I6YA 2OPRA 4KFBA 1HHSA 1NSPA 3PJ9A 3AHPA 1YJTA 1YLXA 2EFOA 5CD4H 3N0VA 2P2CB 3KHRA 4ZPAA 4LIWA 4R25A 3CUNA 2OAUA 3DI6A 2YWKA 2A2CA 2D3UA 5KFSA 3DU5A 5G4DA 1GMUA 4DV5F 3G82A 3AJ2A 5DG9A 1GK8A 3VGSA 1SJFA 3CMQA 3IAS9 3W3SA 2M52A 4K4SA 2FLLA 1RAAB 3C6TA 3MDFA 3FQKA 4N41A 4C48A 4ZLNA 1NJYA 1FDDA 1JLQA 2ADBA 1D9DA 2HQFA 2QMXA 4NLVA 1U8SA 4WWSA 2ZE2B 1EX8A 2GMJA 2CJQA 3P8BB 2XO7A 2DHSA 4BLGA 4LSNB 2KRBA 3FRYA 1NUEA 4DV7J 3V6DA 1DHMA 4JV5J 1N4LA 5IFMA 3H20A 1Y00A 4DCPB 4JI2J 5LMUF 3BREA 3IBWA 4OZ0A 2J0QD 2NCKL 2ZUAA 2V5HG 2YKMA 1P8GA 1DLOB 2B6AB 5GAGU 2AEMA 2W8KA 5AE1A 3V5RA 4PEOA 2BJ9A 4CTAA 3HFZB 2KXFA 2JOQA 4J9PA 4PUOB 2ZITA 3EZ5A 4AYBD 2AZ3A 4DL0C 4LF4J 5ETKA 4RLEA 3KK2A 1H74A 4U7UD 2LQJA 3G6XA 2B4PA 5H1SV 2DRBA 1VQSA 3P5BP 1FDAA 4P7VA 4K2JA 1X9MA 3UR0A 3EZUA 2J8SA 3MECA 4L76A 1JXLA 2HHSA 1VK3A 3MAAA 1CSJA 4X66F 3QAUA 4UT4A 3KLGA 2KXNB 1I94F 2FJDB 1X5OA 5FIIA 1FRXA 3QGPA 1T0TV 5AXMA 1ITPA 4U96A 5G0RB 5KFNA 2KTQA 1BQNB 3V81B 5J2NB 4LF8J 3VGVA 4ECYA 1GXUA 2W7OA 1SH0A 2WVCA 1S99A 2FVCA 3LTOA 3PCOB 2HQIA 3R1HA 1NAQA 2UXCJ 4DR6F 3SYZA 2ERRA 1LWEB 1WEYA 2XC9A 5C25A 2JFKA 4WBFA 3I9ZA 4X65J 3ITHB 1U0HA 5H9FJ 4ZLLA 3NS5A 1T05B 2WB4A 2GVZA 3PEHA 3UCZP 3FBFA 4U95A 3DRRB 2ASLA 3GFZA 2XYHB 2GO9A 3NGTA 4X4PA 2C28A 1GX6A 4CO1A 2UUAJ 4WXWA 2UVWA 1WG4A 2FVQA 5EX0A 2KFNA 4IO9Q 3EJMA 3QMQA 1IR2A 5IC4B 2HNYA 4ILLA 2G1DA 2FD2A 2MEWA 4DR5J 3T9ZA 1VQ4S 3H5SA 1S6PB 2ROPA 5DLFA 4Y6IA 3OHAA 1M90T 2ZH8A 5D6GA 2C3OA 1SH2A 2GMHA 1QSSA 1RWOB 5F8IA 2O5DA 2C22A 5FD1A 2I0XA 3SBMA 2HBYB 2J8AA 2AYGA 2AP6A 1AZSB 1RJJA 3PM9A 3M6WA 2QIFA 3HVWA 5MAOA 1VRUA 1UFKA 4KB7A 2VBYA 4P10A 1HD0A 3MOZA 1QVGR 2FJWA 1WWHA 5HMZA 1D0EA 3U27A 2E9ZA 4WFZA 3OFGA 2GFFA 1HNVA 4Y65A 3UCUP 1SV5B 1T9TA 4WFYA 5DQGA 5K8PA 2DHGA 4I2PA 4KGXB 2F9DA 1C2PA 4FF2A 4QYRA 4I56A 3D3CJ 3OR1A 2JNJA 1E6VB 3N01A 2X1FA 3RB0A 3PR4A 2CWKA 2HZAA 2EW9A 1FWPA 4OMFG 1NPRA 3OJUA 2V0NA 5B08A 2ZH1A 3W2WB 2QLBB 2GNKA 1R8PA 3R97A 1FERA 2LLZA 5D15A 2BRKA 2OH2A 4L73A 2MKKA 3DMJA 1KTQA 2DYAA 1WI6A 1YJNS 5LMNF 3DCAA 2XTJP 2O3DA 3PRBA 3VVUA 3C6UB 3DLGA 5D0EA 3IA0A 4YR2A 1MN9A 3NMAA 2HWIA 5D0HA 1X4AA 4AE5A 2VFVA 1X4BA 4IH7A 1OQ6A 1OYDA 4LRFA 1C0UA 1IKYA 1NEEA 1HNIB 4ZPWR 3J7Z5 4O23A 1F6TA 2DR8A 2FHJD 5E41A 2IM1A 3DOMA 4OHWA 1ZM4A 4C11B 3BEGB 2AQ4A 4EGLA 2L9NA 4QWDA 1YRXA 1GMWD 4DV0J 2V9WA 3CC4S 4F36A 2UU9J 2VBZA 2J6SA 4O0NA 4QWBA 4P9SA 1VFJA 1HBNA 5B7WA 1SPBP 4MK8A 3ETMA 3DLJA 1HWLA 1RAOA 3GLJA 1NDLA 2A3JA 3LGMA 5GMKa 1RBLA 2KRRA 3H2VE 2EG1A 1HBMA 3TJ9A 1IR1A 3NRBA 4YHHF 1RLDA 1X9WA 2OFGX 5M2RA 3MUVP 1RT1A 2JH3A 2KN4A 2VIHA 2C2EA 1BGXT 3C16A 1R7IA 5JUMA 2VG5B 2RDDA 1F9HA 2WBRA 3W61A 1T94A 2V8VA 2YWGA 1D3WA 1AW0A 4PG5A 4USVA 3MMJA 2BJ3A 3Q8UA 3NMRA 3CF5Q 2DNQA 4KY3A 1PAEX 4K0KF 1S97A 1R0CB 1LWCA 3HD1A 2VODA 2Y8WA 2FQQB 5KFGA 4NLOA 2XWXA 1FRKA 3HSZA 1YRTA 4TY9A 4PAAA 2BOPA 4ED4A 2ILYA 4P2XA 3T5LA 2HQGA 2PI5A 1FXDA 2ZM6F 3GP9A 4IFVA 4QIGA 1FRJA 2JLFA 3R27A 2GVDA 2RF2A 1N32J 2EKNA 1CS4B 3R5JB 3R6GB 2IM2A 3KUGA 4C0OC 3LAMA 4N7TA 2DIUA 5I3QA 4RW7A 4ZPVR 2H51B 4QYZK 2QFIA 4DG1A 4DDFA 1X5SA 2BYCA 3D0HE 1Q8IA 1U47A 4ALZA 1TL3B 4RUCA 2HHVA 2RNEA 3NGRA 3HHDA 1CLFA 1YITS 3W9JA 3B6BA 3GYGA 4K4VA 1Q79A 2XWYA 1UETA 2QA4S 1XMOJ 1SUQA 4O4RA 3TJAA 1FNMA 1TL5A 1T9YA 1TL4A 5EWGA 4LSLB 5GAHU 1EHWA 2DXEA 5D78A 3EGWB 4HT7A 1LW0A 1IUJA 2V34A 3FBEA 5HO4A 5B0CA 1NDPA 2HFUA 1HNWF 4F0KA 3QFHA 3NKYA 3DM2B 2VG7B 3M2RA 1KOHA 1TV6B 1G7CB 3OPKA 1CQNA 3V6KA 4R5PA 2LVWA 1YZ6A 4TU9A 1XC9A 4DR7F 4C0HA 2VF3A 4JI7J 3UN2A 2ASJA 2EFQA 3KXDA 1OPIA 1NJWA 4FYDA 2F65A 2F8HA 2NYIA 1CC7A 3FRZA 1MN7A 1VBKA 2GAHC 4HT5A 2WHOA 1ZPWX 3D1OA 4G1QB 5KFRA 2CG8A 2BJ7A 3C3LA 1FJ7A 4UY85 1XR7A 1QDUB 1FWKA 4IKAA 2M70A 3NGDA 3CWJA 3W8PA 2CQCA 4OV6A 3QZ8A 2HGMA 4N47A 4ZVSB 4ED5A 4W98A 3NNHA 2ZEJA 1WG5A 4DL3A 4YR0A 2N7YA 1KTVA 1RKJA 3KUHA 1MMLA 1YJ7A 4I4BA 1I1GA 2IBKA 1VC6A 4LF2A 2W2PP 4ID8A 2G0CA 4M63A 1IBMF 1EP4B 3D66A 3QT8A 2UUBF 4MIWA 2G1HA 2WVEA 1LW2B 4TYAA 4IYQA 2MKSA 4ES3A 1TAQA 4ED6A 3RW6A 2BE9B 3VGUA 1CJUA 3PXGa 2L48A 3Q8RB 4CYUB 1M1GA 2H54B 3KJVB 3KYLA 3A3PB 3RTVA 5HP1B 2DH9A 3E01A 3SDEB 3GV5B 3ZFVA 4FVCA 1NDKA 2ATCB 2W2NP 1FRHA 4IR1A 2HHPA 1PAUB 4RW4A 3LF0A 2KM8B 4DUZF 4DN0A 3AQPA 4PYDA 2JEFA 5KFCA 3ENQA 3O5TB 2XMJA 4TU8A 3ILOA 2WOMA 3T1YF 4FKYA 1WF1A 2C3MA 5FLXU 2B9WA 1MWZA 4OZ3A 1REGX 4WPAA 2LQ9A 1YZ7A 3EDQB 4MYUA 2CYYA 3OTOJ 1HWIA 2L9WA 4U67Q 4U7CA 2KYXA 1M1KT 3GIRA 4GO7X 2GQQA 4DS4A 1FF2A 3HK2A 4DLEA 5HLFA 2HZCA 7FDRA 1O8BA 2BE2A 2RQ4A 2MDAA 1UA0A 4O4GB 3HHLA 2PT0A 2WONB 1F0XA 3RJMB 2R2UA 4B9LA 2ZDPA 3FUYA 3L4BC 5LSOA 5CCMA 1Q16B 3M9OB 2UVRA 1SQEA 5HVGA 3DLKA 1S1UA 3JSBA 3DRXA 3RB6A 4IG3B 1V3RA 3BJYA 2WBMA 1NDCA 3UO0A 5GAGI 3N9UC 3HKZD 3NBPB 2E5HA 2ZH6A 1PG5B 4U7UK 2RIJA 1CULB 1K1SA 3IWXA 2PEBA 4K2XA 5CHCB 1RT7B 1F3VA 2D69A 1XWLA 1YHQS 3TZXA 1TVRA 4OX8A 1JKHB 1RTZA 4TQRA 1RE1B 4EO8A 1QAXA 4RX6A 2VHGA 1TFWA 3BYRA 4RW8B 1F5CA 1F5AA 2ZC3A 5DLGA 2FJXA 2HSEB 2JEGA 2VA3A 5B0GA 4LFAF 2G2ZA 2WSEC 4DR6J 4D3HA 4LR8A 2R2SA 3CJ4A 1RABB 3CNQP 2MYFA 5L1IA 4A8FA 1PC5A 4PG6A 4F25A 3BDEA 1F9EB 2PEHA 4GKJJ 4J91A 2YNHA 1YG0A 4CLWA 3HM9A 4IH6A 3B4MA 3J7A1 3KKFA 2I9SA 3PYDA 4UQTA 3CCLS 2H65B 4B3OA 2F7VA 4PG7A 4AQYJ 2YWHA 3KLIB 3MCSA 1RHUB 5KFTA 1HYSB 1RT2A 1DFDA 4Y2CA 2P9CA 1IBCB 1GNKA 3WIUA 2BRLA 4Q45A 5JVHQ 3QYYA 1UWAA 4RNOA 4MMOA 4ZDNA 1AUDA 3TAQA 2H9ZA 1ZZNA 5JJBA 1KVIA 3I56S 1R8BA 5M2UA 4PWDB 5KTQA 2GW8A 4UOFA 3Q8QB 1U6ZA 1WKLA 4X4SA 1GFWB 1RTIA 4DCJB 3CJSA 2VA2A 2C2ZB 4M5NA 2WAQD 2XSJA 3GFHA 2AJ4A 4RU9A 3CT9A 3HO1A 4ED7A 1L3VA 2CNKB 3M8QA 2AYMA 4F3OA 1RHJB 2BJDA 1FKPB 1RWXB 4LBIA 3L09A 4USUA 2KM8C 2FVRA 3PIOQ 2PFFB 4IRKA 4KHPJ 3CCZA 5L39A 3IG1A 5C42B 3RBEA 1H2UX 4DSEA 3LANA 3QRRA 3M9MB 5KT3A 1RWMB 1NLKL 3TP2A 3FDSA 1WOOA 3FMBA 2V69A 3ZO7A 2FLPA 1N54B 4C8OA 4KC5A 4BC9A 3HKWA 3ENAA 1WSRA 5IWAF 5BYSA 1WTFA 4L6V3 3TUZC 4ZHRB 3HZGA 2DNMA 3CIMA 5ETOA 4O44B 5KFKA 1TMJA 4DWIA 2CQ2A 2CRLA 2DGTA 3TAPA 1UA1A 2DCUB 2C2KB 1C0UB 2XLJA 4WYWA 1A9NB 2AWZA 1WC1A 2FJBB 3AQOA 2CJBA 4UZCA 2R7RA 2YPYA 4MAKA 1GQEA 4OYPA 1JK9B 4QU6A 1UWBA 4B9VA 1HQEB 3SIPB 1Z4UA 3BBFA 1VHIA 2IM3A 1CEZA 3DN9A 3BB5A 4KR0B 3FFIA 1S1WB 2BABA 3P4UB 1LWFB 9RUBA 4I2QB 3CIZA 4BS2A 2IVMA 1J5OA 1S6UA 3MM8A 4KAIA 2VQEJ 1NHVA 4NXMJ 4PKDB 2IC3B 1NSQA 3HVTB 5KFIA 5DS7A 4PXEA 3B82A 4EBEA 4Q7AA 2HWTA 4ZK7M 3OTDA 4CT9A 1VQ9S 2CNOB 2LFVA 2BBEA 2MPUA 4CM2A 3IM8A 1WC6A 3OQ2A 1ZH5A 5D3GA 5CYQA 2DCLA 1BE4A 2Z58B 1CVJA 3P96A 2D9PA 2OJ3A 2D7SA 2EBGA 4NCGA 3EGNA 4WK3A 5F8JA 1U1NA 4DPYA 3Q8PB 2YQ3A 1Q8LA 5CQGA 4RBTA 1SKSA 5J2MB 1NK9A 4K0KJ 1L5UA 3A4TA 1M0SA 3OVSA 3FC9A 2FLOA 4KPCA 2CQ4A 1HNZJ 2F8EX 2IDEA 3Q8VA 2DR9A 3PVXA 4P2MA 1JLFB 1QVFR 4DV1J 3H5UA 4DL6A 2X51A 4QIFA 3C2PA 2X1GA 4JI4F 3DRPA 2FHOB 2F4VF 2YNFA 1VRTA 1IKWA 1C1CB 2IRXA 4NLDA 3FK4A 2DXDA 3FEXB 3Q23A 3HCXA 4CIOA 1VQ7S 2WSFC 2DNGA 3GJQB 2FVPA 4ZJQA 3SFUA 3IWLA 3IC1A 4QQBA 2U2FA 3OL7A 6FDRA 4TLRA 4JI8J 2QT7A 5KG2A 3MMCB 1RYSA 1TU0B 5IZHA 1T3NA 2A0FB 4B17A 2GCFA 4J90A 2GHPA 1WELA 4UQGA 2XY6A 5ETVA 2OMOA 2BANA 1PSDA 2XNQA 1VQNS 2V68A 3JSYA 3MR3A 4KGKA 2BDPA 2HRUA 1VIXA 1MG7A 5GAHI 3UDLA 4P7TA 1TKXA 4MTPA 4LR7A 2CPZA 2J6UA 1JJCB 4OI1A 1KHVA 2RS2A 2DNRA 1FESA 4Y28C 3FCVA 1S49A 5L38A 4KT0C 3AA9A 1RYRA 2QFJA 4I69A 5F3ZA 1RAHB 5IT9Y 1S9GA 4KV8A 2H4YB 2IHR1 5B0EA 4LQ3A 3ZZ0A 1VISA 2AJQA 1KQFB 3MEDB 4LT6A 3TA1A 2E5JA 3CDBA 3GFXA 4OX6A 4GVBA 2FJAB 1R43A 1XN9A 3LP1B 1HBUB 2P6SA 4HI2A 4TYBA 3KMSA 3ZZPA 3D28A 4ZVEA 2LP4A 2B8QA 1S0NA 1H3DA 5HI7A 4ZJLA 2F5GA 1KVJA 4ZN3A 1WDDA 3MCMA 2YKPA 3JXOA 5KFLA 4EBCA 1WC0A 2HAFA 4J9NA 2P6TA 4FXVA 3THVA 1GH8A 4UZBA 1UVIA 4CLTA 2VV5A 3AA8A 2MQMA 4JI6F 1RUSA 1W25A 3NWRA 4F3MA 1X8DA 3A1YG 5D4PA 2XHWA 4O3SA 3TAMA 1KBRA 3CJ8A 4Q0BB 4DQQA 3FSIA 1ZZFA 1W26A 4BWJA 4ZPDA 1CJVA 2HS4A 3QJLA 3UVJA 4NCBA 5IT9U 1KLMB 1ZM9A 2DIVA 1KQSR 1XR5A 4O3PA 1X0PA 3D5MA 3BZQA 2RQMA 1DARA 4A8YA 3VHQA 4A8SA 2AEFA 5FDLB 2R7WA 4ZVUB 1PYOB 1U2FA 1KLNA 3BF4A 4I0WA 5AE3A 3OL8A 1UZHA 5A8WB 3CDWA 3TYTA 1VQ5S 4X4UA 2GHVC 1WEZA 2Z57B 1JXVA 1PBUA 1AROP 1X4HA 4WE1A 1VQMS 2HNZB 3KLEB 2KHDA 2C2OB 2NYHA 4QR1A 3AT1B 1KR4A 4ZP8A 1E6YA 3KJNB 4FBTA 2V63A 2RKIB 4UTGA 5KFPA 5CYJA 2LDIA 1LFWA 2V4QA 2ADCA 1JNZB 4WXOA 5KG0A 2A1BA 3AXKA 2B7BB 3TQEA 3WQPA 4K4UA 4IOAQ 2AIRB 2NUHA 3NXZA 1VQLS 2G9OA 1IXKA 1VJQA 3PACA 3VQTA 1NZ8A 3FBCA 1FD2A 3BSOA 1N6QB 2HGLA 1N33F 2HFOA 3RRGA 2CIMA 4M5HA 2EI5A 2BZ2A 5JMNA 1HQ2A 1S9EA 2JSXA 3G8QA 3H2LA 2BX6A 3FEZA 5DO2A 1R31A 3PNIA 2KXHA 3GR1A 1HMVB 2CPEA 3SZ2A 1WKKA 3Q2SC 4LF1A 3MM6B 3BO2A 3TX0A 1HL6A 3I96A 1VBYA 2RSQA 4WFBQ 1UPMB 2AYBA 4OJ3A 1TTHB 3J7YU 1TQLA 2PFDA 2X3DA 3KK3B 4DHVA 2BV3A 4L72B 2YQ0A 2V4JA 1U48A 4H4MA 3J81Y 1JMTA 1QD1A 3ZTQA 1BC6A 2GGPB 4DOZA 4NPOA 2MZTA 2M8HA 1YBTA 1FWLA 1R0BG 5A76A 3Q8YA 3KFWX 2FZCB 4AFFA 4NYZA 2UXDF 3JAMY 3K0JA 2CJKA 3S7RA 5AJ3F 5L1KA 5IOLA 2IJNA 2DR5A 3R7SB 1FXLA 4NI2A 1RT2B 5HROB 3OUYB 1Q8BA 3HSGA 3EGZA 3CCVS 2B4UA 4C6AA 1O6XA 2K1RA 1EQMA 5IQ6A 2Q66A 1H98A 1N5SA 2OTJS 1NK7A 4A8WA 4OI3A 2CWXA 3HVRA 4A8OA 1RB0A 1SB6A 3ONQA 3G6ES 4IO1A 4TLQA 3UWTA 1VDHA 3UD3P 5KG4A 1S1TB 2PE8A 4DL5A 3AD7C 4M5IA 3GYXB 2B56A 5KG3A 4FXDA 2E1RA 2ZKUA 2I5JA 2QE5A 4ETZA 1S9FA 4TKTA 1SL1A 4DZDA 1KD1T 1S6QA 3HHKA 1XNRF 3SSSA 1UFLA 3SSQA 1V5IB 2VPYB 4PR6A 1IVZA 5KFHA 4ECVA 5BXIA 2LKZA 1B99A 2HW3A 3MPUB 3CCMS 1ZETA 2MKIA 4OYWA 3P49B 1QAJA 1FKAF 2IRYA 3J81U 2OHDA 2J7WA 1Q4RA 4RNNA 4ZVPB 2WSCC 3OR2A 3BSCA 1IM6A 3O3LA 1NXIA 4ZCLA 3AODA 3HX9A 4RL1A 3IBFB 3I5BA 3JAMU 5HMYA 4M5DA 3TA2A 1RT6A 1P27B 2HQ3A 5M2PA 2H5IB 5IWAJ 4CRJA 4QYZJ 5F9LA 3QJJA 3R3TA 1C4AA 7AT1B 1RZMA 1F1BB 2ZH7A 3IRXB 4USTA 1S1VB 1AA1B 2BQUA 1FD8A 2YNGA 2FPHX 3MZIA 3VALA 2IMOA 2RRAA 1EQ0A 1VGYA 4UOCA 4DV4J 2QEXS 3A3NB 3BR9A 1Q81T 1J5EJ 1JX4A 3UNYA 1WF0A 3T41A 2HLTA 3U1LA 5HJXA 4JV5F 3OBIA 4JI2F 3IS9A 4DZ6A 2ZC4A 3I32A 4RNMA 2CQPA 2CPHA 1PC4A 3VCDA 3SXLA 2W9CA 4KKOA 5KT6A 5F9NA 1HA1A 4B3SJ 2AGQA 5HQ8A 3E8OA 2VG6A 5J1EA 1G4CA 5D4OA 4QCLA 3MM7A 4LF4F 3K5NA 2YX1A 3TEGA 2BJEA 4I1TA 3SCIE 3D0IE 2Z2YB 4C8ZA 2VFUA 3Q24A 5E3AA 1JLBA 5KFXA 2Y1JA 2JFDA 2IAJB 3PY8A 2LXUA 2HQDA 3GR0A 3R5CA 1DURA 5CYQB 4QWAA 1K73T 3AAWB 4P75A 2EFNA 2QSWA 4RW9A 3M32A 5DGAA 1N88A 1RTDB 3C14B 1NO8A 3HXMA 2BW2A 2JVOA 2V94A 2AX0A 1VQ8S 3VZIA 1RCXB 4YEAA 1XIQA 1KEKA 2ZVSA 2WW8A 1TKZA 3THPA 1C0TB 1K44A 4X65F 2DNHA 3PHEA 4ECTA 1HFEL 2M0GB 1WHVA 3GCXP 1NK6A 3MM9A 1QJHA 4WZQA 3DRPB 3LQVA 1Z2ZA 2N3LA 3GZ7A 5T41A 5K20B 1HPZB 2AW0A 1UW9A 2DJWA 1YBAA 2UUAF 3QT7A 1JLGB 2M5YA 2B9YA 2QSFA 2VASA 5ETRA 4L75A 4J9QA 2LQ8A 2UZAA 2R8GA 3BSAA 2F4VJ 4ANCA 4M5GA 3N4WA 2CVIA 4V19J 2DGXA 3K59A 4DR5F 2R3VA 2JL9A 3GTYX 5J1NA 1QE1A 2HHWA 1KFSA 1RHMB 1RTJA 5T7LB 3HFKA 3G2XA 1TL1B 4KGMA 4QIEA 3L7UA 3CDEA 2F1FA 1DAXA 3RB3A 1N5TA 3UI3A 4CLZA 4ILRA 2G0IA 4DL2A 3LP2A 2KB2A 3QIPB 3RRHA 2HFZA 2B3TB 5KFZA 2ZD1B 1S12A 3PO5A 5HANA 4DL7A 2QMUB 3R5AA 1SJQA 2VQFF 3CXCR 2YX7A 4ZKAA 4XPEA 4R8UA 1CJTA 1TL7B 3KLFB 1NCLA 1HW9A 4X4NA 3HI9A 1AUSL 2KYZA 3WC0A 1TKTB 3V4IA 4EZ6A 2O66A 4OYMA 2OELA 3A3OB 3BR8A 2Y1RI 2MQPA 4OHYA 1NMEB 2W1BA 1ZAXA 2A6MA 5LM7E 3MTJA 2YKNB 3QWPA 1S9GB 4P71A 1S0MA 1NHKL 4W90B 4YUDA 3CPWR 1VQ6S 4RZRA 1ZBTA 3HP6A 1EIYB 2DH7A 3JSMA 1UPPA 3ET6A 3R2CJ 2HKEA 2Z2LA 3QLHB 5ITHA 1VK8A 3HLUA 3KJFB 1ACMB 4KE5A 2A6OA 3HFVA 4RO0A 2GHWA 1RT3A 4LJMA 4GVLA 3KLHA 4ZA1A 1KS2A 1DZ5A 4C4WA 2Y1LB 2OEKA 5DJBA 1HWJA 4K4XA 2EVZA 5GADI 2CQHA 3PZPA 5EX3A 2GJIA 4YP3A 2YBVA 5D4LA 4JV1A 3Q8SB 2DXFA 4RWWA 1NH8A 1U24A 4OI4A 3BBBA 3GIJA 4DV0F 3S01A 1BHNA 5B0AA 3I4HX 3M9NB 2UU9F 3LUYA 1ZTTA 4P52A 4CH0S 2FZKB 3AOBA 1IKXA 1LFPA 2IYIA 3QIDA 4W4MA 2BW7A 2LA4A 3JYTB 4HACB 1OIAA 3BGOP 4B9MA 2VFRA 2R7QA 3NY0A 5IM0A 3SMZA 4UOGA 2MSSA 3GU0A 3C46A 1QSLA 4EK2A 4OYIA 1ROFA 4AXJA 2BE7D 4UY8T 1Y4ZB 1YBUA 4FN5A 4F3QA 1HHTP 2JC1A 2EC2A 4DU8A 1MU2B 3PYEA 3WX8A 1JNRB 1OPZA 2HHXA 3RB4A 4UUWA 4ZS6A 3P6YC 1RT4A 1RACB 1BXNA 1KC8T 1BD6A 1X7VA 3RGIA 5C24A 1SC6A 4A4JA 4L3KA 1KNZA 4O3OA 5J2QB 3K2YA 3PR5B 4I6AA 2QC3A 2CPJA 1AXQA 3JSRA 2KFYA 4KJIA 4IH5A 2OPPB 4EMDA 2QV6A 2QYCA 1IN0A 5CAAA 2OP5A 4KO0A 2XY5A 2HNDB 5KFWA 3H90A 2V50A 1ICEB 1MWYA 2HHHJ 2YNIB 4IDKB 4QIWD 5C2CA 2FGOA 3CJ3A 3M1VB 3I0RA 3OFFA 2CQ1A 3ZZZA 2RVJA 5J2PA 5KFAA 1T9WA 2WTFA 1PJ6A 4ED3A 2ZWPA 3MEGA 2EFVA 3DXBA 1U8WA 4N56A 5E5NA 1MROB 5KFMA 2RB7A 4USKA 5HQMA 4WK1A 2HIQA 3U1MA 4ZVRB 4OJHA 3MM5A 4ICLA 2LXFA 2V6AA 2N82B 4WFXA 1XMOF 2E1PA 1HI8A 4PXDA 3S6EA 2D9OA 1P9YA 3DOLB 1TAUA 3MPWA 2KVIA 3CJTA 4KH0B 1LKZA 4C3KA 2ILZA 3FMWA 4FYVB 5E7OB 3RR7A 3PJWA 2B4VA 2QO3A 1RWPB 3PYFA 4IOBA 4DN9A 1NRKA 2RMLA 3FJ2A 4QJVA 4OIXA 4E2FB 1Y9OA 2PMHA 4DR1J 1JQGA 1SJ1A 2RU3A 3POTA 2ASYA 2ZUGA 4WKRA 1CQMA 2DNPA 2JVRA 3QNWB 2QLXA 3HSDA 4JI0J 1C1BA 2UXDJ 2RH3A 2QL7B 1MMNA 3OLBA 4OZ2A 5AJ3J 3SI8A 1F2HA 3QO9A 3QSYB 1PYSB 1RP5A 3CJ2A 3TO8A 4K4ZA 1HNXJ 3IR7B 5ETTA 4LF6J 2AU0A 2EKYA 4J7CA 3GQCA 1S1XB 1REVA 1SIWB 4QW9A 4F4YA 3W62A 1RWVB 3N79A 3RRKA 3OXGA 2I5JB 1IKVB 1WORA 4C8YA 4NLTA 1HBOA 2GC8A 1JLEB 3PX4A 2XG8A 4MH8A 6AT1B 3LOUA 3MAQA 1UMJA 2I8EA 3PW0A 2FZGB 1N5YB 1KOOA 2ZZTA 1SC3B 1OY8A 2ZNYA 3BQ0A 3CDUA 1XMBA 1Q86T 1YJWS 4KGVB 4F8RA 1Q5YA 4N8OA 2NQPA 5I42A 4NXNJ 3ISZA 2IIHA 3LW5C 4EFAC 1NJZA 5KFEA 2HZVA 3R7NB 2BACA 4LFCJ 2ZDOA 2XMWA 5DM7Q 3T5KA 4FPRA 2DNOA 4BDPA 4IOCQ 2N7CA 2R8KA 3RBDA 3KMQA 2JC0A 4ED2A 3TUPA 4LRDA 2E1CA 3M2VA 2M8DB 5KOWA 5E2QA 1QLNA 3HT0A 3FNNA 2IA0A 3DRSB 5DQHA 1JXEA 4FBUA 3KDNA 1U6FA 4JI3F 3MI7X 4LUBA 3D7SB 1X9SA 2W2OP 4PQUA 3D67A 4M5KA 2MZ1A 3MXHP 1OY9A 1WI8A 1FRMA 3IP0A 4LRAA 2H1YA 2YNGB 3QRQA 2O1PA 3LGHA 2P5VA 4F04B 3VTIA 2D74B 2WW4A 4DR3J 1NBEB 1R0AA 3DLEB 2VH7A 3V6JA 4LFBF 3EXCX 3TVYA 2B5JA 3T5HA 1NKCA 2FTRA 5B0FA 4J9MA 2RQCA 3QWUA 3OTOF 1EKRA 2J9DE 3P45B 2R7XA 4F67A 1CJKA 2ZJRQ 1CBKA 1H7XA 3M30B 3GSDA 3OL9A 4C7QA 2ACYA 4RUHA 2UP1A 3CJKB 3RG6A 2XULA 1D09B 4NYPA 5DDOC 2GIFA 3M2UA 3LP0A 4K7QA 2BKPA 5DM6Q 2APOA 1BQMB 1UZDA 4I7FA 3W2VB 2V8GA 5A8KA 4YFUA 2DT9A 4ZN1A 5IC6B 3CD0A 3V4MA 3C15B 2GV1A 3A8KA 3UDVA 1AFIA 2DGVA 3RBXA 3TZYA 2VJUA 2ASDA 1DTTA 4NOHA 2L9DA 4OYOA 2YWWA 2UUCF 2R7TA 1FFSB 2QA4G 3WHIA 4PQAA 3BKTA 4X4OA 4IG0B 4J9UE 2OFHX 1T95A 2C3YA 3PKYA 4DPUA 2V4RA 2M88A 6FD1A 4USHA 4KPYA 2CDQA 5GAEU 2QLJB 3OXFA 1FKOA 3KK1B 2VONA 2JEJA 2LEBA 1SJ3P 5A8RA 1YSJA 3P3DA 2BEFA 2XGQA 3EXYA 5K14B 2Z2MA 1LK7A 2HVHA 4ECZA 2YQ1A 2J9CA 3G8TA 2ZJQQ 1Q7LB 4GKJF 2GQ2A 1RCOB 1GTEA 3SFGA 4DSLA 4Q2LA 4M5LA 2I6WA 3VR1A 4LRBA 4UUXA 4IR9A 4DX8H 4AQYF 3T6BA 1IJFB 3A8IA 4HYKA 2GZOA 3EZOA 4LVNP 1EETA 2DNLA 1XMQJ 2Y0BB 4Z37A 3D54A 4PXBA 1FJGJ 1U09A 3M8WA 3OVAA 2RDIA 4ELVA 2ZH2A 3BH6B 1KQGB 5ADZA 4DPOA 2M9KA 3KG1A 4GMKA 4MKVA 3CSKA 4NMXA 1RTHB 5DZ7A 4H4OB 5ETPA 2NXCA 5CZVA 2XSFA 1JLAB 3LAKA 2I2YA 2Z8QA 3T9NA 4P6QA 4O3RA 4RBUA 3PEJA 2BM1A 4FKXA 2R4FA 2HHUA 1H38A 2NPFA 2VQFJ 3LA0A 4IRDA 3VGTA 4MFBA 5U47A 4KHPF 3M8YA 1D9FA 3JS9A 1RWUA 3F44A 4CLFA 5GVQA 3GG0A 3W1YC 2MJNA 4JP8A 1AFJA 1IJEB 3HZEA 2HHTA 1UAWA 2ZH9A 3GE9A 4AXIA 2VKZG 2EG2A 4IFYB 1WC4A 2V2QA 2ZE2A 1UW4A 3I5AA 2BA9A 5HK4A 3DKDA 4PCQA 4CH1A 1VIOA 1SQGA 4LSNA 4DFJA 5F8LA 3E3XA 3MMAB 4F2RA 3OSNA 3NAHA 3MMBB 5KFQA 3K5MA 2W01A 1TUWA 3BPSP 2E9RX 2MQ8A 3QGGA 2C2DA 1DJ0A 4TY8B 1GEHA 4DI6A 3ZTRA 2AJ2A 1DLOA 2B6AA 1K0VA 4RBVA 2Y0SD 2ZZMA 1N5QA 1FK9B 2XMAA 2OPSB 2KDOA 2FVSA 2CQ3A 1I5OB 2UVUA 2LXIA 3GIMA 4QIVA 4DQPA 4PUOA 3AJDA 5HVHA 2CJXB 3OTBA 2MGZB 2CNNB 3W5ZA 5KFVA 4YR3A 2RILA 3HJVA 4F4AA 2WB1D 3R5BA 2V8DA 2HG4A 4J9OA 5H9EK 4ED8A 4PPZA 5T14A 1VQOS 5A0YB 4WIQA 2CJAA 1R89A 3D1QA 5L8RC 2VQEF 2XCAA 4NXMF 2AHOB 1YJRA 2B51A 1TFYA 1A7GE 3PYGA 4Q8EA 1BY9A 5G0RA 4EI2A 2ZZNA 2JWNA 2PDAA 4OJGA 1TR0A 2I38A 1BQNA 3V81A 5J2NA 1DTQB 3L3CA 3IMQJ 1SKRA 3I82A 2DHXA 3UCGA 3E51A 3VAIA 4J37A 3G96A 2K06A 5EWEA 1SCJB 1LWEA 5K8MA 1SIZA 1UEKA 4MJKA 3ITHA 4NASA 3H42A 1T05A 5HATA 4CLPA 3DRRA 2WCXA 2HMIB 1QY7A 2ROGA 3QPIA 1QM9A 1PGZA 4QU7A 5C5JA 3TUJC 3MCNA 4D3GA 3MTKA 4QOTA 1VRQC 4TN2A 1HNZF 1S5ZA 1Q8KA 3IBCB 2D3O1 1UFWA 3R2DJ 2OLWA 2CJ9A 2KI2A 1M5VC 2J0SD 2NR0A 2W2QP 4WZMA 4DV1F 4ZLJA 1S6OA 1IBLF 2QA2A 4J9RA 3GV7B 2CJYB 5L1JA 3FZBA 1OQ3A 5J2PB 2CXEA 1J27A 3DFEA 1VI7A 4ZCIA 3M8ZA 4ZVTB 3MEEB 1EB0A 1D8ZA 1VQKS 1NPKA 5I3UB 3QT5A 1VC0A 1AZSA 3ZZYA 2LU1A 2FHKA 5IT0A 1QUPA 4P2FA 1RT5A 3LGNA 1T11A 3T1HJ 4WP3A 3MFHA 1D9AA 3CD5A 5AXKA 1SV5A 1S7HA 3NGKA 4ZIWA 4M94A 1X4EA 1YX2A 4JI8F 2PMZD 2KG1A 4PWWA 1WACA 5L9XA 3DGPB 2Q1LA 2W9BB 1E6VA 1BWVA 2BJ1A 2GS8A 3DOKB 3H8YA 1SJRA 3MWBA 1GAOA 2ZBPA 3BO3A 4DV2J 3JQJA 1JLCB 5FJ4A 3R1LA 4DSKA 2Y3YA 4OI6A 4ZVQB 2CNLB 3D9BA 1T8EA 4NLSA 3EVOA 3W2WA 2E1MC 3OFEA 3I0SA 4MYTA 3K8VA 4DV3J 1PBAA 2VB6A 3KTQA 4I64A 3SV3A 4KRWA 4Y0FA 3W9IA 3F41A 4FF3A 2HRTA 3EMTA 3A12A 3UDCA 2XI3A 4NCAA 3C19A 3K8WA 4NRUA 2EEYA 2DHAA 2NSCA 4ID5B 3D6TB 3C6UA 1NH7A 3EWGA 2RRBA 3JQMA 3DNCA 4H54A 2OPQB 2Z2ZA 1RWKB 5KT4A 4PXCA 5ETNA 1K47A 4O3NA 1HNIA 4OZ5A 2V9KA 3C66A 2FHJA 5HBMB 3CEDA 3ZZTA 1B64A 1EKSA 4F2SA 4RUAA 4C11A 4UOHA 2HK3A 7FD1A 1GMWA 1B0VA 2CPXA 1NSAA 2LDYA 3MFIA 4ERDA 3ENVA 2X1AA 2PN6A 1YGYA 1DQ9A 3D6FB 2OPRB 4KFBB 5DZ6A 2QX0A 3PX6A 4Y2MA 2GAGC 1U26A 3K89A 2K2PA 3CO9A 1TMMA 2F8MA 2IRUA 4X62F 3BN4A 4Y2AA 3M2VB 2KT5A 2CA9A 3OD2A 3DI6B 4CH7A 3MCOA 4OL8A 2RT3A 4PYAA 4N8NA 1XK8A 5D0RA 4EYHB 2ALYB 3G82B 4K8RA 2VG5A 3TW0A 1ZA2B 1W7WA 1TK8A 4GRSA 3MR7A 1S76D 1SH3A 3C6TB 3TI0A 5E0OA 4JI3J 3FEYB 1R8HA 2XQCA 1JLQB 1Y5IB 2CQGA 4QZVB 3SCLE 1NHUA 4NA2A 4GC6A 5RUBA 1ZM3A 1U1OA 3PRDA 2KU7A 5LJ3Y 4DU7A 1U0SA 2VPWB 4LFBJ 3V6DB 2P8IA 4MT1A 3SCJE 1CS4A 3ZNJ1 4XAKA 1HQUA 3R5GA 1I51B 2YKMB 3V6HA 1F5BA 2VKRA 2CZVC 2J0WA 4ETXA 2MQQA 3I9V9 1RAFB 3D6MB 1WD6A 3Q89A 1TP7A 4Q2MA 3BQ2A 4FYXB 4K50A 4CTAB 1UL3A 3I87A 2QLWA 1U2RA 1TL3A 5HL7Q 2HQCA 3BGFA 4DPXA 2BVZA 2LU2A 2ROEA 3KK2B 3WC2A 1H7WA 4NA1A 2H5JB 2QRRA 2QLFB 5A2QY 2ZFHA 3R9LA 3M05A 3NCPA 4FDFA 3D3BJ 2Q6BA 1UTAA 4ZP9A 1M1HA 4IQXA 1ZAWA 1UVKA 3MECB 1DBDA 4LSLA 4HDHA 3OLAA 3MAAB 2DGSA 1P1LA 2K8GA 2B8PA 3KLGB 3W5YA 3KG0A 2UUCJ 1M5OC 4WTOB 4DCOB 2MZQA 4DQRA 3OTCA 1J2VA 1S7IA 2OKQA 5EUHA 3DM2A 2VG7A 1ZS6A 4ZVOB 3J7AN 2W9AA 1M5SA 1TV6A 1HI1A 3CTRA 2FGCA 1SQFA 2DEIA 4CQ1A 3H0PA 3GPAA 4OLPA 3FSXA 1OWXA 3K5LA 4X64J 5C25B 1ZM2A 4H4KC 1UCNA 1T02A 1YJ9S 2RD5C 1YI2S 5KG6A 1U0HB 1XBWA 4HH1A 3UPFA 2GVZB 1U1KA 2LQ5A 4KGZB 4DF4A 4G1QA 2VDHA 1B70B 4ANDA 2HWHA 3BKUA 5GAEI 4NLWA 1LNQA 3PW2A 3LO3A 2RS8A 4YDXA 2O01C 3BGUA 2HNYB 4JV2A 1IBKJ 4ZLPA 1UJ4A 5A2QU 3S8SA 1D8YA 1EZZB 2PMWA 1YIJS 4DLGA 5KG7A 3DLHA 1XTZA 2QG9B 2RDJA 5CZXA 2PA8D 3ZNUA 2J0XA 4F50A 1EP4A 1PIEA 2OD4A 1LW2A 3G8SA 1VRUB 2ZH3A 2E44A 1PJ7A 3H4DA 4F0HA 4URGA 4HVZA 4CYUA 4MK7A 2WVDA 3B54A 1HNVB 5CABA 4NLQA 4MFBB 2QZ8A 2DB1A 3KJVA 3H59A 5HP1A 1H73A 4FVMA 3ZZRA 3SDEA 4I2PB 2YKOA 3I6PA 2N4DA 4Q8FA 1RBAA 2DHHA 4A8QA 1WDTA 4NA3A 3OR1B 5ETSA 3D1HA 4NLGA 2KH9A 3K58A 4ZVFA 2KG0A 1RKIA 2P9EA 2AD9A 2A18A 4A8MP 3K5PA 4DR4J 4K4TA 1TK0A 5HMXA 1NM2A 2PA3A 3HT3A 3JB9k 2GQCA 4DS5A 1R8AA 1OYEA 2UV8A 1U1LA 3DMJB 1SI9A 4PG4A 1OSCA 3ZTSA 3KUEA 2AJ1A 5F3TA 1TELA 3NAIA 3NCRA 3NGUA 3IGNA 2DVIA 3DLGB 2KHCA 3MGJA 2QL5B 1O5JA 4LF7J 4B9NA 1IKYB 3NLCA 2J9DA 4O4GA 4DV4F 2WONA 1J5EF 3QZ7A 1N0UA 1NJXA 4A47A 1WG1A 2PC6A 2ALZA 4B3TJ 3DOMB 3G9CA 4IG3A 1Y10A 3BGLA 3NBPA 1Y3JA 2DD8S 4B3SF 1D1UA 1LXJA 1YVFA 5HQLA 1CULA 5ETLA 3EGVA 1HBNB 1EAYC 2G2YA 3N6NA 1U02A 1HLWA 1RT7A 1VR6A 4WFNQ 3M8PA 2NPIA 1FFWB 1RBOB 1JKHA 3CCES 1HARA 1HBMB 3H7HB 3KDOA 3WIVA 4Z2XA 4ED0A 2M2BA 5L9NA 2IYGA 2MQLA 4RW8A 4RJVA 2DGWA 2VPZB 2MHNA 1RT1B 1VLYA 4JOUA 1B3TA 4FF1A 3C16B 4WJBA 1TK5A 2AT1B 1Q1KA 5IV3A 4Z7CA 3AB4B 3OT9A 1WHWA 4YDDB 2XY7A 2MY7A 1L3TA 4TQSA 5DDQC 3UNGC 2GIQA 1BQXA 4Y34A 1LWCB 2K7JA 3CCJS 1KHWA 2VD3A 1XJWB 2H48B 4QWEA 2R8JA 2MMYA 5LT5A 2OMLA 1Y11A 4XK8C 3AY0A 4ATNA 3CJRA 4X84A 2L08A 3KLIA 5JXSA 4IFVB 1HYSA 1TZ0A 2AGPA 3IR6B 1RXOB 2GVDB 3KWMA 2RF2B 4U8YA 5KFJA 2HLUA 1S0OA 1IBLJ 2SXLA 3OJSA 4RW7B 3W63A 2XYPB 4DG1B 2RAQA 1RT5B 4PWDA 4Y2KA 5LSRA 2BKOA 4JB8B 1KKHA 4OYXA 3TX8A 1VBZA 1FKPA 2QTWA 4JI1F 2FHMA 2IBOA 4RUBA 4UF4A 2XI2A 1SUQB 5F8NA 3L95X 1MWQA 1Y3KA 4DEZA 3EDRB 4DPWA 2J5AA 4XDCA 4CLKA 5C42A 2VPXB 2EK1A 3O1LA 4QPXA 1NK5A 1UJ5A 1OS5A 3HD2A 3WBZA 1LW0B 3UD4P 3X3UA 3NS6A 4GKKJ 1T9UA 2NS1B 3GIIA 3I0SB 2Q6CA 2XS7A 2ZH4A 1QTNB 2BMBA 4AD6A 3M2RB 4KHMA 1HWUA 4ZHRA 4ECRA 4R5PB 5JVGQ 2FJVA 3HDSA 4CLSA 4O44A 4JI5J 1OY6A 2Z4PA 4U9RA 1G6BA 3CB4A 4XO0A 1OJ4A 2MKCA 4EUVA 2YWEA 2OUGA 2MZRA 2MJUA 4F0MA 1N34J 4XPCA 2W7AA 5E33A 2VUGA 4J9LA 1A6LA 1FE0A 4RNHA 3M4XA 2C42A 5DQIA 2UUWA 3W9HA 2Q43A 1HQEA 2ZOGA 2W25A 2AGOA 3TVZA 2OEMA 3SV4A 3UFCX 5KFUA 2YY3A 2XZDB 1YDLA 2BXJA 4MIAA 3VAHA 3MPVA 2W4CA 3IWNC 1S1WA 1Y5NB 5CD4A 1LWFA 4I2QA 1NKBA 2Y9HA 3CVKA 4LBPA 3R8YA 2GJ2A 3HHNB 2DITA 4RKUC 2F4FA 2IC3A 3HVTA 2EK6A 2J7KA 1RHQB 1CJUB 3G4SS 5I4MA 4ZVHA 3T1AA 4ZMMA 2IVFB 4X62J 4P74A 3UN3A 4X4QA 5HJYA 3E01B 5L1LA 3H2UB 3VAMA 2FIUA 2OTLS 3AH6A 2DK2A 2HEKA 2W4DA 4DUYF 4A8KA 4I68A 1WEXA 1LWXA 5HVFA 5EDWA 4R0EA 3ILLA 3H98A 1DRZA 2HURA 4LRCA 2RE1A 3TZZA 4RW4B 1FI4A 3PHTA 3CMAS 2XNRA 3T6JA 1X0FA 4J9VA 3R6LB 3DDKA 5F8GA 1IR0A 2HAIA 5EWFA 2IJFA 4YY3J 2Y1IA 5J2MA 1FT8A 2WOMB 1FCAA 2ZHBA 1T3OA 4DV6J 3H5XA 3W8GA 3H4BA 1M5PC 2BUNA 2ZWOA 5KFFA 1SKWA 1JLFA 2DNYA 1HQUB 4IUFA 3Q86A 4ECQA 3M8RA 3GV8B 2B9EA 3THTA 2B7CB 2JEIA 2XGPA 2MQNA 2VDIA 3PO4A 4MKYA 2JZ5A 1C1CA 2VC0A 4JYAJ 2CQ0A 2BR0A 5BR8J 5HLFB 3OSPA 4EBDA 2BE2B 3HHLB 2HHHF 3HHLD 2MKYA 3KHHA 2VL1A 3MR2A 3Q0AA 3DLKB 1R27B 1S1UB 4ZJOA 2R42A 3D4JA 4ELUA 1UKUA 3F0NA 3VF0B 2CPYA 3TQ1A 2JX2A 9ATCB 2RJZA 4B3MJ 2J76E 2XCPA 2DY9A 3PW4A 3DHWC 3MMCA 3LWLA 5IT4A 2K3KA 2DPIA 2YX4A 2E5LF 4DPTA 2KJVA 4OI0A 2V2KA 2NZCA 4FP9A 1ULRA 1TVRB 1QSYA 2NLWA 1S79A 1X5TA 3CD7A 4NZ6A 4B3RF 1WC5A 3HHEA 4NLPA 1B0PA 2HHQA 3BDPA 3D68A 4OX7A 4LR9A 1JJHA 2ZBIA 5CYMA 3AXMA 4Y2IA 2G0JA 2XLKA 1XQIA 4DR1F 3ZTPA 1X4CA 3K17A 1HHQA 1HWKA 5H9EJ 2YNHB 3K5OA 4JI0F 1RWNB 5FLXY 2B0GA 3MEDA 3LALA 2LEPA 4J9SA 4CO3A 2AYEA 4X2BA 3KHLA 4B3OB 2WRMA 1KDNA 3LP1A 2E7WA 1V3ZA 2RHQB 3NOGA 3M8SA 1HBUA 1H2VZ 1HNXF 2Q3PA 2V8PA 4MIBA 5C2GA 4TNOA 4EYIB 2MLYA 1GT8A 4LF6F 1FA0A 3FBBA 4DR2J 4NE9C 4C3LA 2IFXA 3FQLA 2DEJA 4NL5A 2VBXA 2E5GA 5LXRA 3QJPA 1RTIB 4CNZA 3LPEA 3P5TL 3DU6A 2XSJB 2BJ8A 4C8MA 1VMBA 1N52B 1GTHA 2LCWA 3C8YA 3EPIA 1A0OB 3M8QB 4G6VB 2XMUA 4FYWB 4FYYB 4EU0A 2HBRB 3PTWA 4KBIA 3BN7A 4DV5J 1OMSA 2W2MP 3VAFA 2D3ZA 4NXNF 3IO1A 4DSIA 3IG1B 4Q0BA 1SJ4P 4ZP7A 2ZHAA 1YTYA 4LFCF 1LXNA 4AUKA 4DXLA 1K1QA 1KLMA 2EFPA 4WFAQ 3EYZA 5KG1A 3VQSA 1X4FA 1UEUA 3S1TA 5FDLA 3MUTP 4G65A 2CUYA 3NEKA 2L3MA 1FTCA 3R7BB 4A46A 3GJRB 1PO6A 3AD9C 5F0UA 2W7PA 3MD1A 1UVNA 4OI2A 8ATCB 2J6TA 2BQRA 3RYLA 2FY8A 5A8WA 5DETA 4WYLA 4ZP6A 3HHLC 1TKDA 1F2GA 4JUZA 1KP6A 5LMUJ 2HNZA 3KLEA 2D41A 1H6KX 4PZVA 4DR3F 1SKUB 1UVJA 2RKIA 1FNOA 3ZTOA 3OHBA 3GILA 3T19A 4CO2A 1B7YB 4USWA 2MB0B 1TUVA 4NZ7A 1WSVA 3F56A 1ZOTA 2CVEA 1UWBB 1L3UA 1ELOA 4LVOP 4PWUA 4M1KA 2QYGA 2M7SA 4OHVA 3JTNA 4DMZA 5CH7B 2MQOA 1DY3A 4CP5A 5K9FA 2QN6B 1N6QA 3FFIB 3A8JA 1YWXA 2OSRA 1J5OB 3M8PB 3MM8B 4X66J 3CJ0A 5J1PA 1I94J 1VQYA 2ZOFA 2MXYA 2LMIA 1JB0C 3V2UC 1HMVA 3BGRA 5ETMA 2R7OA 5K8OA 5KT7A 3UD5A 4J9KA 1RISA 2MY8A 3MM6A 3HVAA 5I3PA 2KL8A 1XEZA 4UW2A 4CLUA 3KK3A 3CCTA 1X4GA 4WTYA 2FLNA 3EE3A 3VAJA 4HEA9 3PFEA 1RLCL 2UXBF 2XEXA 4YB6A 4DSFA 5D3GB 5DRKA 4X4TA 4F7VA 4YMEA 1FJCA 2Y8YA 2QGFB 1WHXA 3BYPA 2GGPA 1WOPA 4KIAA 3Q22A 3G6VA 4NCGB 4OZJA 2UVVA 4NMLA 3L7PA 5CA5A 3J7ZT 1Z1ZA 2GMLA 5F41A 3D2WA 4NLXA 3O8WA 3WZ0A 4AL7A 1OSDA 2OEJA 1FO1A 1SC1B 5HROA 3OUYA 2GX8A 4DF8A 4TVAB 4W92B 4BC7A 1RAIB 1S48A 2FC9A 1G2EA 3DDNA 5B09A 1XERA 1UP1A 1LOUA 3BH7B 3QSIA 4NLUA 5BJRA 3TANA 2YNFB 1VRTB 1IKWB 3GB0A 1S1TA 3N5FA 4B08A 1U6BA 4C8NA 2WVBA 2DNKA 4Q43A 2MLXA 3DXSX 4BWMA 4RW6A 4ECWA 2YKQA 3CJ5A 2RUGA 2U1AA 2HGNA 2KO1A 1XMQF 4U8VA 4QPTA 3B4DA 1FJGF 1RA6A 4USIA 4X4RA 5SUHA 4C8LA 1M5HA 3W64A 4JI1J 3NNAA 1U49A 2FJEB 3O6QA 4Q44A 3PW7A 2VC1A 3CCUS 1RQ0A 4O0IA 2HBQB 2PO4A 3EM1A 1GXTA 2LEAA 2HFNA 2BANB 3EUNA 4ZIVA 3PX0A 1SC4B 1RAJA 4P73A 3I5CA 3RAXA 3GJTB 5E3RA 4ZPBA 2ACMA 2NXEA 3LWMA 1N8RT 2KJWA 3JQKA 1TKXB 5BYRA 1G1XA 3UR3C 4RR5A 4N76A 3BO4A 1V9OA 3OVBA 2G13A 5LMNJ 4GC7A 3IRXA 3N6LA 1RU1A 1S1VA 1PCAA 2IJRA 2DR7A 4NYOA 4AL5A 3ZXWA 3PV8A 2EC0A 2EWHA 4F26A 4KV8B 2DNNA 2DRDA 3KJQB 4F4ZA 2VOOA 4FZVA 3NCQA 4ELTA 3OL6A 4ZPTR 1QUVA 3NNCA 1RSCA 3PFOA 4GVBB 2LECA 1CPZA 5GMDA 2XMVA 1RI7A 2BM0A 1S0VA 3M6XA 4ER8A 3KG4A 3U1NA 5DG8A 3B78A 1G3OA 2D3OR 3GG1A 4CO4A 1GX5A 2NXUA 2AV5A 2HS3A 1U1RA 4YHHJ 1MLAA 3BKFA 2W24A 1HR0F 2IAJA 4CNYA 5LOQA 1L3KA 2COLA 5DG7A 2NZ4A 1PILA 3TAMB 2IDLA 5KOXA 4BBYA 2WZ1A 4YB1P 2F40A 2QA1A 3QAEA 2VFSA 1RTDA 2CZ4A 3C14A 4C97A 2DGOA 5IS2A 4DUYJ 4G3IA 2XZTB 1CJVB 2AJFE 1MNEA 4DL4A 3UVJB 2EBEA 3I31A 2OGUA 5BYQA 1U1MA 1JWWA 2KFZA 4GO5X 1FJEB 3MOJB 5KFOA 2CQBA 1C0TA 1IWAA 4CWBA 4Z7YA 1KN6A 3R5DA 2A2DA 2CZ9A 4ECUA 2JDJA 3TEHB 1KRPA 2ZM6J 3DYAA 1BUXA 2E9TA 5CXTA 1N0VC 1HPZA 4WKYA 4WE1B 4IQMA 1JLGA 1T9XA 1E6YB 2MTLA 3D6HB 2M4MA 1FXRA 4CLYA 2MKHA 4P72A 4HR2A 4OHXA 5T7LA 1X31C 4DJBA 1U2CA 1TL1A 2XMTA 2CG4A 3ADAC 1Q5VA 4DQIA 2DRAA 2F9JA 4XTTA 2B43A 1NK4A 1RDRA 4URSA 5DDRC 1KQKA 3QIPA 1VBXA 4LF9F 3EPGA 3PG9A 4OYZA 2ZD1A 3DHXA 2E29A 1NJIT 3QBCA 2PI4A 1S9EB 3T1HF 3RAQA 1HNWJ 2E5LJ 3GMGA 1V5VA 1TL7A 3KLFA 4ANEA 3HSJA 1TKTA 2H5EA 2MZJA 3U7JA 3JTOA 3BQ1A 1YK9A 4B3RJ 3CJQA 1W2BR 5CYMB 3PW5A 2DGQA 2CPIA 4TXSA 1S72S 4DR7J 2DO0A 2CQDA 3SQGA 2R7SA 1W2IA 3MD3A 2V4JB 4ED1A 4H4MB 1S57A 3BSNA 1VS3A 2DKOB 2Z30B 1VCTA 3GFYA 4DV2F 3W65A 2YKNA 1FE4A 3IN5A 3TRGA 4CZCA 2MSTA 2NUUG 4U6PA 3MAHA 5GADU 4ILMA 1QAYA 4LBHA 2ZBRA 2LQBA 4DV3F 2ZBQA 3N6MA 4DBQA 2EFGA 3J7YI 2CPFA 3MURP 1EJ7L 4MK9A 2KZZA 4OX9F 3QLHA 3G86A 3CW2C 3I4PA 4NI2B 4KYZA 3Q83A 3IRWP 2FYXA 2H4WB 2K1RB 1VC5A 3B8HA 3BV8A 1OO0B 4NEYA 3UN5A 2XHCA 2CDRB 3MEKA 5HAOA 2IVYA 2HK2A 3EX7B 1IBMJ 1LEOA 3RAMA 3SCKE 2UUBJ 3NGSA 4HHHA 5H9FK 4ES1A 4OHZA 2IMWP 1Q53A 2CAJA 1U1QA 2RQKA 3W60A 5HMWA 3K57A 4Y3CA 3UDEA 1O51A 1T9VA 1FTRA 1S6QB 3ZZOA 4J5OA 5F8MA 3EVWA 2FDNA 4M95A 3QT6A 2BKNA 1FRLA 1ZAVA 2FB0A 1NNDA 3OFHA 2FC8A 3JYTA 4HACA 2DPJA 5F0WA 2HFVA 1NK0A 1HIYA 1Z2LA 2WK4A 2V2ZA 3OR2B 1T03A 4DUZJ 4B02A 2R7VA 1MU2A 4JBCA 2C3UA 3RZAA 4M5DB 1RT6B 5MLCV 2MKJA 4BCAA 4NLYA 1YJVA 3T1YJ 3AB2B 1XNQF 2C2MB 4ZOSA 2Q79A 4K5SA 5J2QA 3N28A 1KWMA 4ECSA 2HYIB 2Z0GA 3MR5A 2R8HA 1X60A 2G2OA 3U02A 2OPPA 3KHGA 1F60B 4L74A 3QATA 4CLLA 5EN1A 1TUGB 3WX4A 4F4KA 1AT1B 2EPIA 2P9GA 5KG5A 2CFXA 2K7KA 4PRFA 2PIIA 1FDBA 2HNDA 2FY1A 3CE8A 4QWCA 4ZPCA 4E8UA 2JLGA 2YNIA 4C3MA 5SZTA 4NWBA 2BOAA 2NXJA 2JJ4D 4IDKA 3CMES 3DGVA 3IS9B 5EHHA 2R8IA 4HHUA 4ENOA 3M1VA 2DR6A 1BLUA 3O2IA 3DLBA 2R2TA 4C8KA 3KNAA 3GONA 5D4NA 2W9CB 4KKOB 3TARA 5F8HA 4WU3A 2HS0A 4HL9A 3VAGA 5AT1B 3K7RA 2DISA 3A13A 1FX2A 1MSWD 1V6HA 2V2VA 2VG6B 3CD6S 3PIPQ 5J1EB 1MROA 4V19X 4B9UA 4HTIA 3BGRB 3MM7B 1U7LA 3M6UA 2XLIA 4KQZA 2HVZA 3CC2S 1BWEA 1Q95G 2VZ9A 3Q2TC 4S0MA 2HVDA 2NSBA 4LF5F 4FS1A 1JLBB 4OQJA 4A8XA 3DOLA 3ILJA 4ZITA 4K4YA 3AOCA 3ENWA 3PDNA 4ITSA 4DX7A 2DTJA 1IQTA 1FEHA 1Q78A 4RW9B 3M32B 4LFAJ 4ES2A 3MPDA 1RWWB 2X3GA 2UXBJ 2AF6A 2KZMA 2AZ1A 1Y7PA 2XYGB 3MPYA 3BS9A 5ETQA 3VWSA 3X1LB 4I67A 3JTPA 5E3QA 3IAM9 1VOMA 1IWGA 2KKHA 5E3PA 4AL6A 1NB7A 4C2MA 3HJFA 4X64F 3VVTA 1TKZB 2XMMA 1URRA 3IXQA 4I6WA 3G71S 4RU2A 3CULA 4F4WA 4P2SA 3TOQA 4LMZA 1O0PA 3MM9B 1WC3A 3SQOP 2YVSA 5LJ5Y 1PYTA 1NSKL 1U25A 2OI2A 3EICA 4C98A 3CCRS 3QRPA 3OTEA 2VJVA 4OLOA 4HHJA 4ZCKA 1S1XA 4PG8A 1FRIA 2GJFA 4RW6B 1FHTA 3I55S 5IXUA 1IKVA 2HFSA 1SVDA 1RHKB 1IBKF 2DNZA 1JLEA 3GIKA 4CCHA 4URQU 1N36F 2FUG9 1QE1B 4USJC 1RTJB 3W7BA 3H5YA 2H3EB 3IGVA 1N5YA 3O44A 4RPFA 4WU2A 5IQQA 3D0GE 1ZA1B 3HF5A 5AE2A 3LP2B 2J7UA 1H0HB 1UJ6A 4FNHA 2HPUA 3MF5A 5CCLA 2DBBA 4LQ9A 1SL0A 5K8NA 1KFDA 3PKMA 1C4CA 4Q5VA 1K0TA 3VAKA 1EARA 1S4EA 4F02A 3TJ8A 4YS2A 4G1IA 4QBUA 1NK8A 1RK8A 1FFGB 2LYVA 4R8UB 2A10A 4YN3B 1CJTB 2AJ0A 1NB2A 3G87A 1U45A 3GWCA 3QQCD 1FX4A 3IM9A 3V4IB 3KLVA 2XB2D 3DRSA 2QL9B 4LSZB 5IV4A 2KVQE 1KVKA 1RGVA 4NX9A 4YQWA 1X5PA 4CO5A 1QTMA 3GSIA 4MKBA 1M5KC 2GO8A 3RU0A 4DR4F 2W8LA 2E66A 3ILIA 3DC2A 4RWXA 5DDPC 3FGVA 4V1Ak 2LA6A 1FEEA 2YXLA 3DLEA 2AMCB 2VU5A 4DV7F 1B0TA 3TZWA 3H25A 1CC8A 3JSMB 3ET6B 2RU9A 3ISND 2GIRA 4NZ0A 3GYNA 4QR0A 1B4SA 3J81j 4FXWA 3M30A 2OO4A 2ZVIA 1RU2A 3AFGA
chains in the Genus database with same CATH topology
3FMWA 1RT3B 2VBWA 4U7UK 3KLHB 4XO0A 1MMDA 3CJKA 3UE2A 2RIJA 5E7OB 3RR7A 2MKCA 4EUVA 2B4OA 1K1SA 3IWXA 2YWEA 2MZRA 3PJWA 1IM4A 1VHFA 2B4VA 4K2XA 2MJUA 2QO3A 4LF7F 5CHCB 4XPCA 4IOBA 2W7AA 4QW8A 4DN9A 4EO6A 1NRKA 1RT7B 2RMLA 2ZKTA 5E33A 2C2RA 1XWLA 3FJ2A 2VUGA 4QJVA 4C9DA 4J9LA 1A6LA 4Y00A 2RRNA 3MHYA 4OIXA 1YHQS 4IRCA 2BQ3A 3US5A 1FE0A 1Y9OA 1BQMA 2PMHA 1SJ1A 1TVRA 4RNHA 2RU3A 3POTA 4HTJA 3M4XA 4OX8A 1JKHB 3ZZUA 3W2VA 2G4BA 4TQRA 2ASYA 4EWTA 4EO8A 2ZBCA 2C42A 2ZUGA 1U4BA 3CGIA 5DQIA 4B3TF 4WKRA 1QAXA 4RX6A 2UUWA 1CQMA 4KTQA 2DNPA 2JVRA 5K5MA 4OZ1A 2QLXA 2Q43A 4PPDA 1HQEA 1TFWA 4RW8B 2ZOGA 1F5CA 1C1BA 1F5AA 2W25A 2ZC3A 2AGOA 5DLGA 1UVLA 3TVZA 5KFDA 2FJXA 3SV4A 2RH3A 3UFCX 1MMNA 5KFUA 3OLBA 2ZOMA 4B9SA 3BM7A 1WTBA 2XS2A 2YY3A 4HH0A 2BXJA 4MIAA 2JEGA 5KFBA 1IKXB 1SBRA 1VJWA 3VAHA 3SI8A 3QO9A 3MPVA 2VA3A 3NL0A 1K8AT 3AJ1A 1RP5A 5B0GA 2W4CA 3CJ2A 3TO8A 4LFAF 3IWNC 1S1WA 1Y5NB 2WSEC 4K4ZA 4D3HA 4QR2A 2R2SA 3CJ4A 1LWFA 3TUIC 4I2QA 1NKBA 3CVKA 3IR7B 3KNGA 3TA0A 2MYFA 2AU0A 2EKYA 5L1IA 2KT2A 5IM0B 1PC5A 1CG2A 4PG6A 4A8FA 4LF8F 1VQPS 2GJ2A 1YJUA 3HHNB 3GQCA 1S1XB 4F25A 2DITA 4RKUC 1REVA 1SIWB 3BDEA 2IC3A 4QW9A 2ZHOA 3HVTA 4F4YA 2EK6A 2PEHA 3N79A 2YNHA 4IG0A 1YG0A 2J7KA 3RRKA 2UXCF 3HM9A 1LQ9A 3MR6A 3OXGA 2I5JB 3G4SS 1IKVB 4IH6A 3B4MA 4C8YA 4NLTA 3J7A1 3KKFA 1HBOA 2I9SA 2GC8A 4ZVHA 5I4MA 1JLEB 3PX4A 4UQTA 3T1AA 4ZMMA 2XG8A 4MH8A 3LOUA 3MAQA 3CC7S 3CCLS 1V3SA 1UMJA 2I8EA 2IVFB 4N77A 2YH0A 1RT4B 4B3OA 2F7VA 4PG7A 3PW0A 3KK1A 2YWHA 3KLIB 1N5YB 1KOOA 4X4QA 2YWFA 3MCSA 3E01B 5C24B 1UEVA 4EZ9A 5L1LA 1L3SA 3H2UB 3VAMA 2FIUA 2MZSA 2ZNYA 3DYAB 3AH6A 1HYSB 2DK2A 5KFTA 2OTLS 4O3QA 1RT2A 3PJXA 2W4DA 3BQ0A 2XS5A 3CDUA 4DUYF 1XMBA 2E7XA 1WEXA 1XR6A 2P9CA 4I68A 4Y2CA 5EDWA 4R0EA 4A8KA 1Q86T 1YJWS 5K14A 4F8RA 3H98A 4N8OA 1GNKA 1DRZA 2POKA 2RE1A 2NQPA 5I42A 2BRLA 4Q45A 5JVHQ