3DLKB

Crystal structure of an engineered form of the hiv-1 reverse transcriptase, rt69a
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
423
structure length
409
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWELGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal engineering of HIV-1 reverse transcriptase for structure-based drug design.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 115
structure length 409
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dlkB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dlkB03
2OPQB 4R8UB 5C25B 2XCPA 3KK3A 2YKNB 2R8HA 2HMIB 3IGVA 3T5JA 4ECRA 2EC0A 5DQHA 3HKWA 2JEJA 4IFVA 4DL7A 3UR0A 3BGRB 3NAHA 4F4XA 4RUCA 3H4BA 3IRXA 4IKAA 3RB6A 1RTIB 1N56A 4TY9A 3MFHA 3T5KA 1VRTA 3DRSB 5C25A 3JYTB 2YNIA 3IS9A 5C5JA 3KJVA 2W9AA 4TN2A 3Q8QB 4ED8A 2B5JB 1DTQA 3DLEB 3DM2B 3ITHA 4G1QB 5CYMA 3MR3A 4I2QA 3KOAA 2FVPA 4PQUB 4ED6A 1RYSA 2CJQA 5HP1A 5J2PB 3LP0A 4K4WA 4K4XA 4F4WA 5EWEA 1RTIA 2BANA 3C6UB 4EBDA 2E9TA 4Q0BB 1BQNA 4J9LA 2FVCA 4FBUA 4K4VA 3GIMA 2WRMA 3KK3B 1UWBB 5KT2A 3DRSA 3JYTA 4R8UA 4ZP9A 5DG9A 3IN5A 3CJ2A 4ED3A 1S0MA 2F8EX 2R8JA 2GIQA 3DLKA 3T1AA 1RT2A 4H54A 3BGRA 3PVXA 4RW4B 1C2PA 4KB7A 3FFIB 1JLGB 5KFPA 2VG6B 5F8JA 5FDLA 4M94A 4ED7A 4WE1B 1Z4UA 4ECXA 1SUQA 4TLRA 1JLFB 3DOLB 2IJFA 4Q8EA 5I3UB 2FVQA 1RT5A 4NZ0A 3CWJA 4FBTA 4ED1A 4RW6A 3HVTA 3CJ5A 1C1BB 3DDKA 4Q43A 3SFUA 4J9MA 4R5PB 5DGAA 5F8GA 4I7FA 1S6QB 3RAXA 1IKVA 3E01A 5KFKA 2IM0A 3M9MB 4O3QA 3LALA 2WB4A 2HNYB 5KT5A 4K4UA 2XGQA 4MK8A 4HKQA 4NLTA 1SUQB 2AQ4A 5FDLB 4LSLB 4R5PA 1LWCB 3FQLA 1JLEB 4TXSA 3QO9B 4O44A 1HMVA 4NCGB 1S1VA 1S1UB 2IC3A 4J9KA 2ILYA 5C42B 3G6XA 5I3UA 3MFIA 3CIZA 3M9OB 1RA6A 3KK1B 3BSOA 2VG6A 4WXWA 2JEGA 1LWCA 5KFEA 4NLGA 5DQGA 2OPSA 1N5YA 5D3GB 3BSNA 5F8IA 2E9ZA 3NL0A 3KHHA 4RNMA 2VG5A 3E01B 1RT7A 4NCGA 2UVVA 1T3NA 4I2QB 1VRUB 1IKWB 4LSLA 5F9NA 4Q45A 1FK9B 1GX6A 5KG5A 1JLQB 4EYIB 2WK4A 2FLNA 4DL5A 2YNIB 3IS9B 1S1TA 3OL7A 3LP0B 4K4ZA 1TVRB 1JLCA 3V4IA 4ZVEA 2AU0A 1BQMB 2ZE2A 5KFVA 3GIJA 2FJVA 2FLPA 2C22A 2J6UA 4WFYA 3PHEA 4ZPAA 3CJ0A 2YNGA 1T05B 3DLKB 3BQ1A 1C1CB 3IG1A 3M8PB 4F4ZA 3V6JA 1IKYB 2YKMA 5KG7A 3GQCA 1W25A 4WE1A 1QAIA 2IM2A 4NLWA 4WYWA 4ZHRA 3MR5A 4RW4A 1NNDA 2RDIA 1JLAB 2B6AA 1BQMA 1CSJA 2YKNA 3TVKA 4ECWA 1JLCB 3V4IB 4ICLB 4J9RA 1IKYA 2YKMB 3MF5A 3KHRA 3GV8B 5L1KA 1S1TB 3IGNA 2W9BA 4LSNB 3BQ0A 4JV0A 2YNGB 1WNEA 5DG8A 1C0TB 3KJVB 1T94A 2RF2B 3MECB 1TVRA 4JV1A 1TL1B 2ASDA 1R0AB 1TQLA 4MFBB 4IFYA 1XR5A 3LANA 4JUZA 4KFBA 4NLSA 4O3SA 4DL4A 4NLVA 4RNOA 4KBIA 1N6QA 5HBMA 1S9GB 5KFQA 1RT4B 1S1XA 5F9LA 1N4LA 4QWDA 3KK1A 5L1LA 5HLFA 2J6SA 1YVFA 4ECUA 1RT6A 5J2NA 2BRKA 4ZPBA 1S1UA 4EYHB 2W8LA 1JLAA 5D3GA 4RNFA 1HMVB 1JIHA 3DRPA 5KFYA 4RW9B 1T03B 3M9NB 4ECZA 1S9EB 2BQUA 3H40A 2R8IA 4RW7A 3TQ1A 2HNZA 5HLFB 5KFUA 3TAMA 3C6TB 1JLBA 5J1EB 1S1WB 2QV6A 3BJYA 4H4MB 1J5OA 1FKPA 4IQXA 4QWAA 1S10A 2D7SA 4ZMMA 4XO0A 2R8KA 3QIPB 3MECA 4RW6B 3V81A 2AX0A 3CDWA 2DPIA 1C0UB 4R0EA 1LWFB 1HARA 2WHOA 5KFNA 2ZD1B 1JLFA 3DOLA 4F4YA 4NLYA 3MR6A 4U7CA 2C2RA 2FJXA 3H2LA 2E9RX 3OLAA 4KKOA 3GILA 3HHKA 2JLEA 5C24A 4O4GA 1RT3B 2RKIB 5KG2A 4TQSA 4KV8B 1JXLA 1REVA 4I2PB 4MK9A 3TAMB 1S0NA 4IG0B 2XGPA 3KK2A 2WOMB 4WFZA 3DRPB 3FDSA 4YR2A 3ICLA 4OL8A 3I5BA 4Y34A 3KLHB 4KV8A 1RTJB 1ZTWA 4DG1A 5HP1B 5C24B 3ISNC 4KKOB 3QO9A 4O44B 5HROA 4B3OA 2UVUA 1TKZB 3ISND 2CKWA 3C6UA 5KFIA 3OLBA 4IG3B 4KFBB 3T19A 3PR5B 1OS5A 4IFYB 2BRLA 3PW7A 4RU9A 3DLGA 4NRUA 1EP4B 2WONB 4PUOA 4MIBA 1HQUB 3LAKA 4O3PA 3NMAA 3RAQA 2IAJB 1C1BA 1HQEA 3KLGB 2RDJA 5J1EA 3NKYA 1QE1B 2J6TA 2HMIA 3KLHA 2W8KA 3UQSA 3I5CA 1S0OA 4RW9A 1T03A 2ZKUA 5HROB 3IRXB 1N48A 4MH8A 4ZPDA 1RTDB 3EZUA 5DQIA 5DG7A 2DPJA 1TP7A 4YR0A 2IMWP 3FRZA 3CDEA 5DGBA 3PW4A 2HWHA 4H4OB 2W9CB 5F8MA 3KNAA 4ECTA 1TV6A 5I42B 2ILZA 3H4DA 4TY8A 1BQNB 4MKAA 3LAMA 1RTHB 3N6NA 3OHBA 3V6HA 2V9WA 4O3NA 1C0UA 1ZETA 3NBPA 4PWDA 3V81B 3FQKA 5KFJA 4EBCA 5J2PA 2RF2A 3OL8A 4ED2A 2BR0A 2QE5A 3MR2A 3H98A 3MEEB 4ECSA 3NAIA 1IKWA 3QLHB 3EPIA 2V0NA 5KFHA 1S9FA 4M95A 5KFOA 3GV7B 1RTHA 1DTTA 2VG7B 2WCXA 2YNHB 3V6DA 4IRKA 4WZMA 1TKXA 4HYKA 1S6PB 3KLEB 1DLOA 4QPXA 4ZVGA 3UPFA 4U6PA 3DRRB 5J2QA 3H59A 1RA7A 2BE2B 3KMSA 1C1CA 2GIRA 4ZVFA 3OL9A 1RT4A 1S1XB 4IRCA 1SV5A 5HBMB 3I0RA 2C2EA 1TKTB 4YP3A 2WTFA 1D1UA 4J9NA 2VA3A 5J2NB 3SFGA 3MEEA 2ZE2B 2C2DA 2UVWA 4J9QA 4Y3CA 2IBKA 1EP4A 2WONA 5K14B 2O5DA 1LWEA 4URSA 3QGHA 2HNYA 4K4SA 4KAIA 2IAJA 3ITHB 1JKHA 2B5JA 1IKXA 2JEIA 4LSNA 3RB0A 3LP1B 4KO0B 4FS2A 1LW0A 1VRTB 5KFAA 4RNNA 4EO8A 2B6AB 4NLDA 2HNDA 2R8GA 3T5LA 4EEYA 2HWIA 2AGPA 3JSMB 2OPRA 3DMJA 3KLIB 4XPEA 4KHRA 3NGDA 4IRDA 1TL3A 4NLXA 3BSCA 4ID5A 5KFMA 1JLGA 2W9BB 3T5HA 3CJ3A 4IG0A 3E51A 5KFBA 2W9CA 3DOKB 4H4OA 2FLLA 1HNVB 2IC3B 3KHGA 1U09A 1FKOA 5JUMA 5KT3A 5EWFA 3SI8A 5L9XA 4O4GB 4J9SA 3LP2A 4NLRA 4IDKA 4NRTA 4ID5B 2HAIA 3CVKA 5KFDA 3PJXA 4QWEA 2I5JA 3PJWA 3KHLA 3EPGA 3H5SA 4Y2AA 2HNDB 4TYAA 3H5YA 1LW0B 1RT1B 4ZPCA 1JLQA 5DLFA 4IG3A 1S6QA 4NYZA 3N6LA 1TKZA 4ZVHA 4PQUA 1VRUA 5EDWA 1MU2A 2GC8A 2FVRA 4PUOB 1K1SA 1FKPB 2B43A 4O3RA 3DLGB 4DG1B 5KFRA 4ZP7A 3C6TA 5KG0A 2R2SA 3OSPA 2HNZB 2JEFA 3G6YA 3KLEA 4ZP8A 5KG1A 4TYBA 3Q8SB 4K4YA 4ECVA 3OSNA 3LP2B 5KFLA 4IH7A 4H4MA 1J5OB 1SV5B 3KLFB 2AGOA 1FKOB 5KFXA 4ED0A 1HNVA 2BE2A 4QWBA 3MEGA 3N6MA 2RKIA 4RW7B 1N5YB 4YR3A 3M8QB 1S6PA 3I5AA 1JLEA 1NHVA 4IR9A 4Q0BA 4Q44A 4TQRA 1QUVA 1I6JA 4J9OA 1SH3A 4X2BA 5C42A 1HPZA 2IJNA 2C28A 1LWEB 4J9PA 5DLGA 1RT3A 1SH2A 3GYNA 3H5UA 2W7OA 2IM3A 3DYAA 3MEDA 1IKXB 3RBDA 5KT4A 3GIIA 2ZD1A 4RNHA 5KFTA 4YMEA 2D41A 2XI2A 4IH5A 4DL6A 3PW5A 4K50A 1HYSA 1TV6B 1RT5B 5F8HA 4DL2A 1TL1A 2IM1A 4QW8A 3RB4A 3BR9A 3HVAA 4LQ9A 1K1QA 3FFIA 2R2RA 4URQU 4MIAA 5KFCA 4IFVB 1DTTB 2VG7A 3FSIA 4MKBA 3PR4A 3QZ8A 1XR7A 4LQ3A 2BQRA 2AGQA 4ICLA 2I1RA 5KFZA 3OL6A 3MEGB 2XC9A 1DLOB 3IG1B 3M8PA 3GIKA 1S9EA 2OPPB 5EUHA 3MTKA 3QLHA 4FS1A 3D28A 3QIDA 1TKXB 3QGIA 5KT6A 3DI6B 4ZHRB 4XPCA 2W7PA 5F8NA 5JXSA 1S4FA 2XI3A 4KSEB 5F8LA 2V4QA 1HYSB 1QE1A 1C0TA 1HQEB 3KLGA 2R2TA 4G1QA 2OH2A 2FVSA 2XCAA 4KE5A 1MU2B 4URGA 2D3ZA 1HQUA 4MFBA 2YNFA 5L1JA 4Q8FA 1R0AA 4RZRA 3G6VA 1RT7B 5KFFA 2AWZA 2JC1A 5L1IA 1EETA 3NBPB 4PWDB 5T14A 3DI6A 1FK9A 4NLOA 2OPSB 5KG3A 4TY8B 4B3OB 2XWYA 3QYYA 1TL3B 5I42A 3M8QA 5KG6A 4IH6A 3KLIA 2VG5B 2OPQA 4GC6A 2ASJA 1RTJA 1NHUA 1LW2B 3DOKA 3CDUA 3RBEA 2UUWA 1MMLA 4KO0A 1S48A 4WXOA 3LP1A 1ZTTA 2WOMA 4RW8A 5J2MB 3D5MA 3BSAA 4YQWA 1HNIB 5KG4A 3KLVA 2OPRB 3DMJB 1JX4A 1RDRA 5KFSA 1EETB 4G3IA 1T05A 1S1VB 1S49A 4RUAA 3RB3A 4I7FB 3DYAB 1RYRA 2VA2A 4ECYA 2UUTA 3I0RB 1RT1A 3OHAA 5CYQA 1GX5A 2V4RA 2ATLA 4KHMA 1SH0A 1JLBB 3BREA 3PZPA 3QIPA 5K14A 2FJWA 3DRRA 5J2QB 1HNIA 1KHWA 1XR6A 3Q8RB 5J2MA 2I5JB 4ZP6A 5EWGA 2BQ3A 1KLMB 2UVRA 3I0SB 1TKTA 3GV5B 2YNHA 3V6DB 3VQSA 3KMQA 4Y2CA 4JV2A 1LW2A 4WZQA 2OPPA 2R2UA 3KLFA 3V6KA 1UWBA 1D0EA 4NLPA 2JC0A 4DEZA 2ALZA 1S97A 3UDLA 4MK7A 3G86A 1KLMA 5KFWA 3KK2B 4IOBA 4K4TA 1N6QB 1RT2B 2BANB 4WYLA 3PW2A 1RAJA 3QGGA 3JSMA 1RT6B 3HVWA 5KT7A 4QW9A 1REVB 4I2PA 1IKVB 4NLQA 3I0SA 2YNFB 1QAJA 4GC7A 2D3UA 1S9GA 5KFGA 3CJ4A 3DLEA 3DM2A 5CYMB 4O3OA 4QWCA 2AX1A 1JKHB 3BQ2A 3MEDB 3HVTB 3Q8PB 4NLUA 1LWFA 1S1WA 1KHVA 5CYQB 3CO9A 2ASLA 4DL3A 4EO6A 4RW8B 1HPZB 3QZ7A 4ECQA 2IA6A 4IDKB 4EBEA 1DTQB 1RTDA 4IR1A 1IM4A 4O4RA 3PW0A 4WFXA 3H5XA 4F50A
chains in the Genus database with same CATH superfamily
3F44A 2FZKB 4R8UB 1FRHA 1SJRA 2XCPA 4P75A 2YKNB 1ZM4A 2ZH5A 2HQIA 2Q79A 3NS6A 2YWKA 4MAKA 4OYOA 5DQHA 4USMA 4HH0A 2BE9B 5E33A 3BGRB 4ZCKA 3UR0A 4DL7A 3WHIA 1HR0J 4F4KA 1SI9A 1PYTA 2DIVA 2IPOB 3K5LA 4IKAA 1OY9A 1EJ7L 3UN5A 3ILIA 1VQLS 4HHJA 3BKTA 3RRGA 4Y65A 2Y8WA 4DV5F 1UEKA 1XC9A 4CWBA 2L48A 3MMBA 3FCWA 3OTCA 3M6XA 1VI7A 2QL5B 2WAQD 3L7UA 3QMQA 4NMLA 3SBMA 4ED8A 5LMUF 1UFWA 1NDLA 4I2QA 2FVPA 2XG8A 1RYSA 5LSLA 4CP5A 3R6LB 1RKIA 3W9IA 4I0WA 1KFDA 3C2PA 4F4WA 4YY3F 3TA2A 1RTIA 4LBIA 3WIUA 4EBDA 4ES3A 4Q0BB 1FERA 3BN4A 3KUEA 1HI8A 2FVCA 3QBCA 3TOQA 3BDPA 2CVEA 2GJFA 1MN7A 3KK3B 3CJQA 2I38A 3CW2C 3W2WB 1S0MA 1R8BA 4PYDA 2GIQA 5GAGI 5ETQA 4JYAJ 1RT2A 4H54A 1WC3A 5F8JA 2D9PA 4TLRA 3HD2A 2GQ2A 4UF4A 4ZJOA 5I3UB 2FVQA 2FPHX 4R0JA 4NZ0A 4Y00A 3MPYA 3BH7B 2R7SA 2N4DA 4W90B 2A0FB 1FRLA 4HLBA 3FBBA 5LJ5Y 4Q43A 2PSZA 3TZYA 1NB7A 2JWNA 4C98A 1S0VA 4JV5F 3RAMA 3C15B 5LXRA 3M1VA 2QFIA 1YIJS 3T9NA 4AFFA 1WTFA 2FIUA 2Y1LB 3LTOA 2DRBA 2HNYB 4O23A 5KT5A 4LF9J 2FHKA 1LKZA 2P8IA 2V8DA 2XMKA 1MW7A 4DX6A 3D1HA 2CXEA 3FQLA 3D67A 2BKPA 1EX8A 3LWMA 1HMVA 3JQKA 1L3KA 1T9YA 1GAOA 1IJFB 1RAAB 3L4BC 4J9KA 1RI7A 2R7OA 1UTAA 3G6XA 1OSCA 4CM2A 3QWUA 1NPPA 4WTOB 1VQKS 4GKKF 4L3NA 5IM0B 4X65J 1GXTA 4ANDA 1JNZB 2EVZA 1PBAA 2YTCA 4CNZA 3TZZA 5DQGA 5D3GB 3MPDA 3NNCA 2NYIA 4AYBD 5F8IA 4DR4J 3NL0A 1KVJA 1URRA 2V2ZA 3MPWA 3RUBL 1V6HA 1RT7A 4FKYA 1FX4A 2WBMA 3C8YA 2GA7A 1CJUB 3D0GE 2ADCA 1T3NA 3C15A 4I2QB 4G65A 2KHDA 4LSLA 5F9NA 4DV0F 2UUAF 4YOEA 5KG5A 3U1MA 3FEZA 2XQCA 1T3OA 5D0GA 4DL5A 4ZPTR 3M30A 3LP0B 4HACA 3O8WA 1CJTA 5LJ3Y 1NJYA 4JI1F 4K4ZA 1WWHA 2ZOMA 3V4IA 2HVHA 2AU0A 1X8DA 3QT7A 5J1PA 3NWRA 3ILJA 4NEZA 2ZJQQ 1CPZA 4WFYA 2NS1B 3CJ0A 2YNGA 1T05B 1Q79A 1U02A 2DHHA 1NPKA 2DEJA 1C1CB 1FTRA 3M8PB 2DY1A 2WSFC 3BQ1A 4F4ZA 3GJRB 1NBEB 1ZAVA 2YKMA 2QA4G 4P2SA 3GQCA 4WE1A 2RHQB 4ZHRA 3OT9A 3MR5A 5JVGQ 3F73A 3BDEA 1FRIA 1CLFA 3G8SA 4BWJA 2VHGA 1VIOA 3MPUB 2OMOA 4J9RA 4ECWA 1HI0P 1TU0B 4CM0A 3C14B 1TK8A 3OVSA 5L1KA 4OI3A 1SQGA 5D15A 1SIZA 3BYPA 4LSNB 5IC4B 2ZHAA 4KGKA 3BQ0A 4F04B 2UZAA 1KFSA 2ZOFA 4WP3A 5K5MA 3LO3A 3W65A 2NXEA 3J81j 2J9DE 3NCRA 2DYAA 4JV1A 1R31A 6FDRA 1RUSA 3DU5A 2ASDA 3MUVP 1MMDA 2GJIA 4C0BA 2LCWA 1BE4A 1XR5A 4JUZA 1SC1B 1XNRJ 4KFBA 2DBBA 4O3SA 4NLVA 4KBIA 2H4YB 1SQFA 3JTPA 3H7HB 2ZBPA 3MCMA 4NEYA 1RT4B 4KH1B 1IM6A 3N79A 4FYXB 1N4LA 4AL6A 2MZ1A 5L1LA 3MOZA 2FY1A 4HI1A 3W64A 4Q7AA 1YVFA 1TTHB 3MAAA 3I6PA 4ECUA 4ZPBA 2G0JA 4EYHB 1JLAA 1JIHA 4NL5A 4X4QA 3DRPA 3M9NB 4RW9B 2XMAA 4YB7A 2ZWOA 4E98A 3UD3P 1H98A 1RBLA 4RW7A 1CULA 2HNZA 3ISZA 3MM5A 1NSAA 1S4EA 2JZ5A 2J8SA 5KFUA 5HVGA 4LF7J 2FZCB 3AOBA 1S1WB 4PXDA 1Y3JA 4H4MB 1J5OA 1FKPA 4IO1A 2YWHA 5ETVA 2F8HA 5I3PA 2Q43A 1F5CA 4HH1A 4ID8A 3UD5A 2MB0B 2D7SA 4NA2A 2LQ5A 2BW7A 3DGPB 3M05A 3VF0B 2R8KA 1SJ3P 4C3LA 4JI4F 4PXBA 1TAUA 1Q1KA 4ZS6A 3PTWA 3S01A 1FNXH 1UZHA 2ZD1B 3DFEA 1SJ1A 4V19X 3MR6A 3TAQA 1BY9A 4JI6F 1B64A 4USVA 3MM9A 3ZZ0A 3MM8B 4P2MA 3GILA 3LGNA 2M2BA 2DD8S 2JLEA 1NK0A 1NSKL 4JI6J 3RBXA 1UMJA 4DV6J 4A8YA 2W2NP 1RB0A 3HSGA 2CRLA 4OHWA 4ELTA 4LBHA 4B9NA 4WTYA 4MK9A 1U1LA 5F0UA 4EU0A 1X60A 1UA1A 4IG0B 2UV8G 3OXGA 3MGJA 4BCAA 4CLYA 2VPYB 4P2FA 5BYRA 1DRZA 4AXJA 2OD6A 3DRPB 3FDSA 3TVYA 4CLZA 1LOUA 3FCVA 4YR2A 3KLHB 1DAXA 1R8AA 3NGRA 3UW1A 4DG1A 2X1FA 5C24B 2JRSA 2BJ7A 2LKZA 3BO2A 3KJNB 3OTOF 4O44B 2WW4A 1HBNA 3OTBA 1VLYA 2DNPA 4WIIA 3X3UA 3ISND 3I82A 3C6UA 1IQZA 2DNQA 4KFBB 3NNAA 3VAKA 3AJ2A 3DLGA 1RWKB 2MKKA 2IHR1 2HQFA 2LQ9A 4ES2A 1HQUB 4F25A 3LAKA 4KGXB 4O3PA 4UY8T 1TK5A 1CJUA 1X0PA 2IDEA 3SMZA 2MJUA 1XK8A 4B3TJ 2KZMA 3RAQA 3MCOA 3PY8A 1HQEA 3IBFB 1DQ9A 2R7TA 1KN6A 2GFFA 4B9UA 1EB0A 1TL7B 2UP1A 1CQMA 2CPIA 5ETSA 3TJ9A 1AXQA 4CDIA 1S0OA 2B0GA 2ZKUA 1VQ4S 1SJQA 1HW8A 1CS4A 3K17A 3NOCA 4ZPDA 2WZ1A 2ZH4A 5DG7A 5B09A 1WG4A 2HHXA 3I87A 1IBCB 3CJTA 4H4OB 1WC5A 2MEWA 1Q4RA 1GNKA 2MZJA 1TV6A 2CPYA 1N88A 4HDGA 2ILZA 1TK0A 3H4DA 3BPDA 1X4FA 1MLAA 2KM8B 4Q2LA 2VDIA 2V6AA 2QLXA 1C0UA 4O3NA 3VVUA 3CSKA 4EBCA 3GTYX 2N4CA 4ZITA 2V67A 2ZBCA 3NS5A 3MR2A 3H98A 5HVFA 2MY8A 4CT9A 4U67Q 5CXTA 1G1XA 1IN0A 4K59A 1OQ6A 5AE3A 4N5SA 1RACB 3B78A 3CCUS 2B4OA 2V0NA 5AXLA 4ZIWA 4V1Ak 2GGPB 3TWZA 5KFHA 2HVIA 3UVJB 3AH6A 3B8HA 1BLUA 1JMTA 2ZH8A 3PIPQ 1DTTA 5CD4A 4P72A 3M8SA 1VQOS 2UU9F 4PRFA 2AIRB 2CJ9A 3P3DA 5IS2A 4EZ9A 3KUGA 4IRKA 3A3OB 3PRBA 4DSEA 1D8YA 1FKAF 4QBUA 5L8RC 1K0TA 2IRUA 3QATA 1RA7A 4HT5A 2XO6A 3N01A 2K8GA 2QA4S 3OW2R 2JEJA 1S6OA 2M9KA 2PA3A 1X9WA 1TUWA 3R5CA 2C2EA 2WTFA 2PA8D 3PYEA 1UA0A 2YKOA 2AF6A 3CPWR 2VPWB 3CC2S 3CCLS 2VICA 1YJ7A 1DURA 2M70A 4WJBA 1EP4A 2WONA 5K14B 1YBAA 1RWVB 2EW9A 3PM9A 1MROA 2BJ1A 3QGHA 2HNYA 3US5A 4NCAA 4BBYA 3WX8A 2QA2A 2JEIA 3D0HE 3RB0A 3FVYA 5E5NA 4OZLA 1LWXA 1P9YA 2DEIA 3NGKA 1I94F 4KO0B 4RBUA 5KFAA 4U96A 3CD7A 3OFEA 2AZ3A 4EO8A 4RNNA 1U4BA 3HHLB 2HNDA 3L7OA 4X4PA 4EEYA 2XYPB 4KHRA 2OPRA 4LF2A 1YITS 3PFOA 1X4AA 2CNLB 1VBZA 4B9MA 5F0WA 3VAIA 2W9BB 2XNRA 2QZ8A 3R1LA 1YRTA 1K44A 3E51A 3LOUA 2VKRA 2VFVA 1HHSA 4H4OA 2J7KA 2IC3B 4USJC 1U09A 3TEHB 5JUMA 3HSDA 3D1QA 3OXLA 2LP4A 3W2WA 2ZFHA 2IMOA 4J9SA 2XLKA 2V4JB 4IDKA 1U2RA 3NEKA 2HHUA 4ID5B 2DXDA 4QWEA 4OMFG 5KFDA 4CLWA 3GJSB 1U24A 2XS5A 2RS2A 2KG1A 3SEOA 1WF0A 2VFSA 3H5SA 4ANCA 4LFAF 1CEZA 5IV4A 1CJKA 2OHDA 3AD9C 1F2HA 4IG3A 2X1BA 4B9TA 3VGVA 2M3DA 4ZVHA 2GC8A 2FVRA 1K1SA 1X5TA 2G0IA 3DLGB 1WDTA 4OV6A 3FZBA 3CMAS 4DR6F 4FKXA 4C3MA 4CI0B 1B0PA 3JTOA 4X64J 1DY3A 3KLEA 2F7VA 4ZP8A 4QU6A 1ELOA 5KG1A 3V5RA 2V63A 4TYBA 3Q8SB 1WJ9A 4ECVA 1T95A 2Q6BA 2CADA 3OSNA 1S7IA 2I9SA 2ZBQA 1HD1A 4H4MA 1J5OB 2AGOA 3KLFB 2VOOA 1FKOB 1Z2ZA 3D0IE 2BKNA 1HNVA 2BE2A 1RU1A 2OEJA 2YBVA 2CQDA 2KVIA 4RW7B 3A4TA 3GWCA 3ZNUA 3CCMS 4AL5A 1TL5A 3NGTA 4H4KC 1KOHA 3DN9A 4M5IA 3SQGB 4TQRA 1PYSB 1HW9A 4U7UK 2PIIA 4J9OA 1SH3A 4UOFA 4X2BA 4DCJB 4LREA 1RZMA 4ZOSA 2C28A 2BJEA 1FF2A 1SIWB 1C4AA 3I9V9 1T0TV 4LR9A 4CIOA 3BZQA 3M32A 2RE1A 2VDHA 3H5UA 4BHQA 2W7OA 2IM3A 3DU6A 1QAYA 2GAHC 1XMQF 3LW5C 5B0FA 1VRQC 2ZD1A 4ILRA 5JMNA 5KFTA 2D41A 1U47A 5E3RA 4DL2A 3EVMA 5HJYA 5E3QA 5HJXA 3BR9A 1Q0NA 3R7BB 1UW4A 2DNLA 3ZNJ1 1K1QA 3JXOA 3FFIA 3R2DJ 2A10A 3Q2SC 4UT4A 4URQU 1HBMA 1NDKA 5KFCA 1Q16B 4IFVB 5G4DA 3EZOA 2MSSA 3W3SA 4MKVA 2CJXB 2EWHA 2BQRA 1VQNS 3N5FA 3MEGB 1PBUA 1DLOB 1H7WA 2J6UA 1HD0A 5EUHA 4DQRA 1NK9A 2KYXA 2OFGX 2CQCA 2RU9A 5MLCV 1SBRA 4CO1A 1RBOB 1VGYA 3GFYA 4ZHRB 4ZVPB 3BGLA 1CVJA 2BJ3A 2ZH3A 5JXSA 5CYJA 3NCQA 5JVHQ 1S5ZA 1VQ7S 1HYSB 2WSCC 1C0TA 2R2TA 4WP9A 1A9NB 4I6YA 2Q3PA 2DGQA 2DITA 1PC4A 2DIUA 4U9RA 3QWPA 1HNWJ 1UPPA 1UCNA 4C6AA 1FESA 2MKSA 4S0MA 2EBGA 2NSCA 2AWZA 1FWPA 1EETA 3OUYA 5H9EK 2GCFA 1FJGJ 4TY8B 4B3OB 4Z37A 1WORA 2L9DA 4PG8A 3IRWP 1BWEA 3M6UA 2C42A 1U26A 4F3MA 3O5TB 5KOXA 1ITPA 2I6WA 1L3TA 3GB0A 4A8OA 2W24A 4B9SA 2OTLS 3DOKA 3CIMA 3RBEA 4ZLNA 2MMYA 2UUWA 4KO0A 2YWWA 5KTQA 2A6OA 2WOMA 2B51A 4RW8A 5J2MB 4L74A 3OJSA 1YKWA 3BSAA 1M5HA 1HNIB 3S6EA 2HWTA 2H65B 4YQWA 2QJ3A 4C11A 1WEZA 2NCKL 3FCHA 3H42A 3CXCR 3G87A 5DDOC 1NZAA 2XSJB 1T05A 1X4GA 1S49A 3G8TA 3RB3A 1U1RA 4I7FB 2P2CB 2V2KA 4LIWA 2BA9A 2GJ2A 3ZTSA 4CH0S 4WK3A 4DSIA 3B54A 3NCPA 2KHCA 3EM1A 1RT1A 3N28A 3OHAA 2V4RA 5IQ6A 4KHMA 1SH0A 1F2GA 4JP8A 3QIPA 2CPXA 2FJWA 3M2RB 4PG5A 1HNIA 4X84A 5J2MA 2I5JB 1RBAA 1XERA 2O1PA 1KLMB 2BQ3A 5KFMA 1V3RA 3GLJA 3I0SB 2P6TA 2NLWA 3RRHA 4DUZF 3GIRA 3CT9A 2NSBA 3JAMY 3K5NA 2Y8YA 1D0EA 1WC4A 3GYXB 4NLPA 1S97A 2ALZA 1EARA 2KXNB 2HLTA 3G86A 1KLMA 5KFWA 4KY3A 4LRAA 1X5SA 4R25A 5BR8J 2FJBB 1RT2B 4ES1A 3RU0A 4WYLA 4CYUB 3N0VA 4N8OA 4PWWA 1RT6B 4QW9A 1VQYA 1D8ZA 1O51A 4TVAB 2NPFA 2ZJPQ 1TAQA 4Z7YA 5A6PA 1B4SA 4NLQA 2GHVC 3PHTA 4LFBF 2QFJA 5CYMB 4QWCA 5DM6Q 2R7XA 1MN9A 1SJ4P 1Q5YA 4CLTA 1LWFA 2ZVSA 5U47A 2M4MA 3SV3A 2ASLA 4N76A 5F41A 2KRBA 1Y10A 4DL3A 3R1HA 2B4PA 4A8XA 1YI2S 4RW8B 3S8SA 2EFGA 4BC7A 1O8BA 3K2YA 1YSJA 2EFNA 3BGUA 4DR2J 3MMBB 4ZVRB 1X4CA 2K7JA 2ZH9A 2ZH2A 3JS9A 4F02A 2ZZNA 5BYSA 1F6TA 2CQPA 2OEKA 1RWWB 3IGVA 4OYWA 2EC0A 4DFKA 4IFVA 3EE3A 1YK9A 2IYIA 4DBQA 3K59A 1QLNA 2EC2A 1W2IA 1R7IA 2C3YA 4RBTA 2V9KA 3MMJA 1CQNA 1K9MT 5E3AA 1PJ7A 2NZCA 3AQPA 4ZKAA 3IS9A 5C5JA 4TU7A 2CQ2A 2V8VA 4TN2A 3Q8QB 3PO4A 1KWMA 1X4HA 5B0DA 1Y11A 3DLEB 3DM2B 3ITHA 1IR0A 3EXYA 5AE2A 2F65A 4LF4J 2KN4A 3C3LA 5B0AA 3GPAA 2AJ1A 1Z1ZA 4DQPA 5J2PB 4DHVA 2ATCB 4G1PA 1G4CA 5EWEA 3ET6A 1VQSA 1ZA2B 2RVJA 4MMOA 3ZTRA 4YB1P 1TUVA 4A4JA 1VBYA 1BWVA 4J9LA 4K4VA 3BS9A 3PACA 2G13A 1N0VC 2V5HG 2FD2A 1U25A 1UWBB 5IXUA 1U2FA 3RYLA 5DG9A 2BACA 3IN5A 4JI3F 3UWTA 4LF5J 2MQNA 3OQ2A 4FDFA 5B0CA 2ABYA 1AZSB 1TZ0A 2J7UA 5FIIA 2XLJA 3RTVA 4JI2J 1NH8A 3BGRA 3JTNA 5FLXY 3LWLA 1AT1B 3PVXA 3FFIB 1JLGB 4KTQA 3DOMB 4M94A 2Y1RI 3R5GA 4OJ3A 4YB6A 3W1YC 4ED7A 3GYGA 1HQ2A 2XS7A 2DNYA 2QSFA 3LH2S 5HSPA 3CWJA 1X31C 1N54B 2NUUG 2DKOB 4DJBA 1C1BB 2QLJB 3MM6A 1SVDA 4WCEQ 4J9MA 4N41A 5HMWA 3PIOQ 1H2VZ 4R5PB 3MI7X 5DGAA 3VZHA 5F8GA 1VDHA 1VLOA 3FNNA 4J7CA 3RAXA 1XMBA 3E01A 1HHTP 4O3QA 2XLIA 1JK9B 1RLCL 4JI8F 3OBIA 1QAXA 1HHQA 1HBUA 2DK2A 4FNHA 3UDVA 5LSRA 2PI4A 2B9XA 5FDLB 1EAYC 1ZBTA 3TNVA 4R5PA 1LWCB 5K8OA 3QO9B 4UZBA 4LF8J 3MDFA 5GMKa 1T8EA 3ZZRA 3BKUA 4I4BA 1PGZA 2H4WB 2IC3A 1H3DA 4LVOP 2XO7A 4JI4J 5A2QU 2BDPA 1U7LA 2WVFA 3MFIA 3CIZA 1BGXT 2E5JA 2WBRA 3IO1A 4ZVSB 4IOCQ 1GMWA 2AZ1A 1N5YA 2DGSA 4M8LA 4DPWA 1CC8A 1FDBA 2RJZA 2DNGA 3MD3A 2YXLA 3KHHA 1KQSR 1UVNA 2HEKA 1B7FA 1I3OB 4LFAJ 4RNMA 5M2RA 2VG5A 5JJBA 4OI0A 2UVVA 2KTQA 3ELHA 1N5VA 2C2NA 4FYYB 2FYXA 3TRGA 4BC9A 1APSA 3OV7A 4Q45A 3HZEA 2J9EA 4N77A 4EFAC 5CA5A 3ET6B 4C8MA 1L5UA 2WK4A 1N5TA 3VZIA 2YNIB 1U6ZA 2GMLA 3AA9A 2H51B 3I96A 4DR7J 3C14A 4ITSA 3ZZUA 2V50A 2CQ1A 2PFDA 3AOCA 3N4WA 3PCOB 1YZ7A 2RUSA 2P9CA 1YG0A 2PFFB 3GE9A 5H9EJ 2A1BA 2ZNYA 1X7VA 1TUGB 5A0YB 2ZH1A 2LXFA 3W5XA 4RPFA 5KG7A 2O66A 1NSPA 3V6JA 2JLGA 3TUPA 2Z4PA 1W2BR 1HBOA 1T02A 1M1HA 1RADB 1SC6A 1YJVA 2AW0A 2POKA 4YDDB 5A76A 2PC6A 2RDIA 3SZ2A 3RR7A 4EUVA 1BXNA 4NCBA 4B3RJ 4NYOA 3TVKA 2PI5A 3EUNA 3V4IB 2CYYA 1KTVA 1IKYA 2XNQA 3AD7C 3BGOP 3IMQJ 4KIAA 2N3LA 3SDEB 2M7SA 4JV0A 1IBKJ 3KG1A 2ZHBA 1S76D 5EN1A 1WG1A 2Q6CA 3U02A 4EZ6A 2RD5C 4J37A 2GHPA 2YWEA 5GAEU 2ZKTA 3MECB 1TVRA 4P7TA 1FJ7A 5E3PA 3BBCA 3W9JA 4IFYA 4YHHF 2IIHA 3O44A 2DCLA 4NLSA 1UEUA 4WIQA 4RNOA 4C3KA 1N6QA 3D1OA 2CZ4A 5KFQA 2OI2A 1UVIA 5F9LA 4QWDA 2Y9HA 2JH3A 2LU2A 3EDRB 4LVNP 4P6QA 4KHPJ 2AYBA 4UTGA 2BOPA 4JOUA 1RT6A 5J2NA 3VCDA 3ZXWA 4YS2A 1VQ5S 1HMVB 4ZCLA 3TP2A 2HHVA 4G1IA 4HDHA 2DGXA 2KFZA 1E6YB 2G1HA 2E5IA 1QD1A 5HLFB 1SC4B 3CJRA 1RAFB 1JLBA 2CDQA 3LPYA 1RISA 3R3TA 1SL2A 4WF9Q 1T9UA 1WHVA 1WTBA 1RKJA 1VC5A 5LMNF 5K20B 1D9DA 2DNRA 4RR5A 1EZZB 4NYPA 4OV1A 3IP0A 5D4OA 3QIPB 1NU4A 3HJVA 4WFAQ 1FD2A 3IWXA 3NS7B 3P5TL 4ZLJA 1C0UB 4R0EA 1LWFB 1NUEA 2M8DB 1XTZA 1HARA 4RO0A 1NH7A 3RW7A 2IY5B 4GRSA 2DHXA 3OD2A 2RH3A 4JBCA 2E9RX 3LQVA 4FPRA 3HHKA 1FRKA 2GV1A 5C24A 2VPZB 4O4GA 2E5HA 2Z2YB 1RT3B 3FMWA 2RKIB 2FHJD 1T9XA 3RZAA 3HI9A 4F67A 4CO3A 1DZ5A 4OHYA 1JXLA 1LFPA 3GR0A 1NM2A 2GVDA 1N33J 3U1LA 3O2IA 3J7Z5 2BOAA 4H4KA 4BWMA 1M1GA 2FJEB 4K0KF 2WOMB 4WFZA 4N56A 3ONQA 3I5BA 2ACMA 2NXJA 2YH1A 1R6YA 1WHWA 2WB1D 1JXVA 3Q2TC 1KS2A 4PEOA 3QJPA 2SXLA 1K47A 2N82B 5B0EA 2XZTB 4B3OA 2AJ4A 2CKWA 2XULA 2DT9A 4KGZB 5CZXA 1GK8A 3E8OA 1OS5A 3NWGA 4ZLLA 3TX0A 1VHFA 3VGUA 4NRUA 4PXCA 2BBEA 5GADU 4PUOA 1WOPA 2CNKB 3DNCA 4KC5A 4DCOB 3GJQB 1S7HA 3WBZA 5LSOA 3WQPA 2J0WA 3SV4A 2RDJA 2RRAA 3AB2B 2J6TA 1FD8A 4YHHJ 3HT0A 2DY9A 3KLHA 2H5JB 2UUBJ 4M5KA 2E1RA 4A8KA 3T1YJ 2XY7A 3UQSA 1X5OA 4RW9A 1QVGR 5HROB 3IRXB 4C8OA 3EWGA 2VD3A 4OX6A 1RSCA 1RTDB 2JNJA 5LMUJ 2DPJA 1TP7A 1OY8A 4YR0A 5DGBA 3G82A 4ENOA 4DCPB 3EMTA 2N7CA 4DV5J 1IBKF 2UXDF 1HLWA 2KT5A 5F8MA 1WF1A 2XWXA 3DLBA 3MM8A 1VJWA 3HSZA 5KOWA 4TY8A 1BQNB 1XN9A 3LAMA 1PCAA 3N6NA 4F0MA 3OHBA 4ECQA 3IM8A 1HR0F 2ZZMA 1HNXF 3DDNA 4LFCJ 5KFJA 2MQ8A 2DISA 3OL8A 3VAGA 1XEZA 1FJEB 4J9VA 4DPTA 2QE5A 5C7PA 3MEEB 2KI2A 3NAIA 2HQGA 4CNYA 2KH9A 1N5SA 2P5VA 1FXDA 2WVDA 1IKWA 3MPVA 5K8MA 3QLHB 4JI3J 1X4EA 5CCLA 4ZN3A 2MQPA 1K8AT 2R9LA 1A7GE 4USHA 4B9LA 3M6VA 2XYGB 2MLZA 1YJWS 1RTHA 2WCXA 1L3UA 3QAUA 3V6DA 2HLUA 1ZPVA 1U49A 1DQAA 2CQHA 2D69A 2GVZB 2I0XA 2VQFF 4TKTA 2EFVA 2C3MA 3B6BA 2C2ZB 1DLOA 3VV2B 4QPXA 3UPFA 3KMSA 3DRRB 2A18A 2BVZA 3CUNA 2BE2B 2HHHJ 6AT1B 1C1CA 2GIRA 2VC1A 4OZNA 4ZVFA 1RT4A 5HANA 4DV1F 4IRCA 5DDPC 4A47A 3J7A1 2HFUA 3R2CJ 3MEEA 2MLXA 2W2PP 4GO5X 4GVBA 3UCGA 2JHEA 4A8QA 2DR7A 4A8FA 2IBKA 1WOSA 3Q22A 1NEEA 3VVTA 4MKYA 2B7CB 1LWEA 2O5DA 2HBZB 4OI1A 3QT6A 1FRXA 2QGFB 2IAJA 3W61A 3QJLA 2B5JA 2IA0A 4LBPA 3HCXA 4LSNA 3OTDA 4IYQA 1VC0A 4USTA 2W4PA 3HULA 1IJEB 5HMYA 2R3VA 2PMHA 2V2VA 1VRTB 2DR6A 4JI8J 3WC0A 2VH7A 3BH6B 2R8GA 1UL3A 1VBXA 3DMJA 4XPEA 3A8KA 4DSFA 1OJ4A 1TL3A 2RAQA 4ID5A 3QNWB 5D0EA 3Q89A 3D4JA 2NYHA 3W8PA 5SZTA 1YJNS 1UP1A 1OYEA 1OYDA 2XMMA 1J2VA 1Z2LA 1HNVB 5LM7E 3MD1A 1FKOA 3L09A 3EGNA 3Q8YA 3VWSA 5EWFA 2AYGA 5L9XA 2CNOB 4O4GB 4KH0B 3H2UB 3PNIA 3ZZYA 1DQ8A 4YUDA 3GFHA 4NRTA 2KT3A 4XAKA 2CUYA 2G1DA 3UI3A 2PMWA 3QGPA 3QSIA 2M52A 3DHXA 1CJTB 2HNDB 1FO1A 1SCJB 4OHZA 2U1AA 2VC0A 3CJ8A 3CULA 5DLFA 3I56S 2K7KA 3SCKE 4CH1A 4DX7A 1I94J 1UVMA 5EDWA 2H5EA 4X66F 3MWBA 3IM9A 3THTA 3TJ8A 1S99A 5AJ3J 3SYZA 1U1PA 4IOAQ 4P9SA 1LXNA 2Z57B 5AXMA 5KFRA 2ZH6A 2CG8A 3PJ9A 4ZP7A 5KG0A 4DPUA 2R2SA 2DHAA 3B82A 1M90T 2JEFA 1N52B 2QO3A 4X4OA 2D3OR 4MIWA 3R5AA 9RUBA 3ULHA 2FB0A 4GVLA 4USUA 5KFLA 2MDAA 3MOJB 1NZ8A 4DUYJ 5ETKA 3DCAA 1PJ6A 2FTRA 2RKIA 4YR3A 2HS0A 3M8QB 4DF8A 4JV5J 3VAFA 5CAAA 4IR9A 4Q0BA 1WG5A 1R6VA 4AE5A 2RNEA 2EXUA 3V4MA 3GONA 5C42A 3NLCA 3HHLA 3P5BP 4TNOA 4Z2XA 2Y1JA 2IJNA 1X9SA 3UO0A 3K0JA 1FWLA 2DR8A 1LK7A 4Y28C 2XB2D 3BYRA 3ADAC 5FJ4A 3DYAA 3NY0A 3KG0A 2VFUA 3POTA 1NPRA 5KT4A 3GIIA 1ZAWA 2BM0A 3HLUA 3K8WA 4YMEA 2XI2A 3HK2A 1U0SA 2FC9A 2IVMA 4M5GA 4OZ3A 3C46A 4K50A 5F8HA 8AT1B 2IM1A 4QW8A 3RB4A 1HWIA 2B9WA 4F2RA 4RJVA 2VJUA 2KFNA 2CZ9A 2ASYA 1FNMA 1X4DA 2IJRA 2J5AA 1YTYA 1RAHB 4OYPA 4Q5VA 2W1BA 2VG7A 3QZ8A 3PR4A 2MQOA 5D8HB 2N3OA 1WOOA 1WC6A 3W7BA 2ZWPA 2CPEA 2H1YA 4CO2A 5EX0A 1SB6A 3MTKA 4ELVA 1HNWF 4FN5A 4M5NA 4QCLA 1EQ0A 3DI6B 3OFGA 2E1AA 3TW0A 1FXLA 4XPCA 2GNKA 5F8NA 3R97A 4ZPVR 1FNOA 1OY6A 4KSEB 1S4FA 4P7VA 5HMXA 3CB4A 3T5HA 3JSYA 2B9YA 2BE7D 2ADBA 4DUZJ 4U8VA 1HQEB 2Z2ZA 4F3OA 4URGA 3GP9A 1HQUA 2ALYB 1S79A 3TZWA 1R0AA 2X7IA 3G6VA 3M2UB 5KFFA 2JC1A 2OIHA 2PT0A 1R3NA 5FD1A 4FYDA 4QIFA 5KG3A 5AJ3F 5M2UA 2XMWA 1VJQA 3PYDA 3M8QA 4IH6A 3KLIA 3HSJA 5E2QA 3HZGA 3S7RA 3OVBA 1L3VA 4GC6A 1Q81T 3FMBA 2F1FA 1EQMA 4DV7F 3I31A 2HVEA 1RWUA 1SKUB 3CDUA 2XY6A 1MMLA 4X4NA 4M5MA 1S48A 4W4MA 3LP1A 1U0HB 2UXBJ 4PKDB 3LF0A 4FF4A 3DMJB 1Q95G 4Q2MA 4PZVA 2HSEB 4X4RA 1S72S 1F0XA 4DR5J 1YBUA 4JI0J 2CQ0A 4F4AA 5ADZA 2QLFB 4NZ6A 2M88A 4ECYA 3GSIA 1M1KT 3W8GA 4X62J 3W9HA 4DU8A 4ERDA 3I0RB 2RIJA 4DOZA 2DH7A 2IRYA 2NUHA 3R7SB 2GO9A 1CJVB 3GMGA 4OJ1A 2WVEA 4F36A 3FUYA 5J2QB 4GKJJ 1N8RT 2AHOB 1KHWA 1XR6A 4ZP6A 2X51A 2AP6A 2XHCA 4DV2F 4Z7CA 3R27A 3HX9A 2V69A 2BXJA 2J9DA 1AZSA 4JV2A 1DJ0A 2VBYA 2OPPA 2ZITA 4I6AA 2R2UA 4DV4F 1YJUA 1UWBA 2DHSA 3H8YA 4PG6A 3ENWA 2VB6A 3ZFVA 4DEZA 4ER8A 1QSYA 4ZJQA 4K4TA 4PWUA 5GAHI 3KDNA 2VBWA 2HGNA 3QGGA 2HHQA 3HVWA 3FBEA 4OYZA 5K8NA 1FDDA 2GQCA 2RQKA 2PMZD 1NK4A 3E2EA 1PO6A 2H48B 3FSYA 1U8WA 3VALA 4RUHA 2D3UA 4GC7A 3Q8UA 1RGVA 2ZDPA 2GW8A 3DLEA 3DM2A 1J27A 2QLWA 4O3OA 3WX4A 2HVZA 3BQ2A 3MEDB 3Q8PB 1NKEA 4NLUA 2MZTA 3G4SS 2I2YA 2E44A 2K3IA 1SQEA 3ZZTA 4DDFA 4ILLA 3QFWA 4KQZA 2KFYA 1HPZB 2MKYA 1GTHA 1SC3B 3JQMA 3JSBA 5ETMA 3QZ7A 3L3CA 4DR3J 2LFVA 4EBEA 4IR1A 1IM4A 2HZVA 1QTNB 2G0CA 2HYIB 1WKLA 3PW0A 3HHNB 1SXLA 1VQMS 2FJDB 2OPQB 4PQAA 1P1TA 4JI5J 4Y2KA 1UWAA 2VBXA 2Z56B 4G6VB 2R8HA 3T5JA 3H0PA 1UW9A 4O0NA 3HKWA 1KVKA 4DX5A 4CO5A 2YQ0A 3I4PA 2B4VA 2X1GA 2V8GA 3HFZB 3NAHA 4UW2A 3WZ0A 4RUCA 4UQGA 3IRXA 1KC8T 5E41A 4ED4A 1NO8A 4Y2MA 4P73A 3MFHA 2R7WA 3T5KA 1Q8KA 3L7PA 3JYTB 5C25A 5HQ8A 2DVIA 2XMUA 4DUTA 3R5BA 3KJVA 4J90A 3QRPA 1GEHA 1QSLA 1KR4A 1DTQA 3A3NB 5CYMA 5CZVA 3MR3A 4G1QB 1Q86T 3MMAA 3KOAA 4PQUB 2BJ8A 4ED6A 2ZC3A 2HBRB 4DN9A 1ZA1B 5HP1A 1VK3A 3PYFA 3LP0A 4B9VA 5A8WA 1YQHA 3U1NA 1UZDA 2YX1A 3A1YG 4F3QA 2ERRA 3MAHA 4EI2A 2V8HA 2W2MP 4CYUA 4OZ5A 5IFMA 2E1PA 1ZZNA 1BQNA 1QUPA 2XHWA 2HQCA 1RWMB 5ETNA 1B99A 3C16B 1B3TA 2EK6A 2VV5A 5CABA 3PX0A 2MKHA 1WD6A 2ZUGA 1OO0B 4HTJA 2LEPA 3DRSA 1FEEA 4QR0A 2Y3YA 4ZP9A 2R8JA 2KKHA 3CJ2A 1NB2A 2F8EX 4L6V3 3KDOA 4ZIVA 3DLKA 1RWPB 3T1AA 2QMUB 3DRYA 1LEOA 2QG9B 3W5YA 4CTAB 3HM9A 3HHEA 1M5PC 3W2VB 4KB7A 4WU3A 4KGMA 5GVQA 2OEMA 4WE1B 1Z4UA 1SUQA 2AYMA 3MTJA 1GXLA 3J80U 3CTRA 2CG4A 1CG2A 5L38A 3VAJA 1I5OB 1JNRB 4CLSA 4ED1A 4RW6A 3CJ5A 3DDKA 4ELUA 3AOAA 3SFUA 2AT1B 2PEBA 4K0KJ 1FXRA 4I7FA 2HRTA 5FLXU 4HTIA 3EGZA 1N33F 2IA6A 2H5IB 2XSJA 4RKUC 5KFKA 4L72B 3A8IA 2WW8A 3M30B 3PX4A 3LALA 2MJNA 2R8IA 1N34F 3W60A 3NXZA 5SUHA 4MK8A 2ZJRQ 4NLTA 5G0RA 1SUQB 2AQ4A 1H38A 3MHYA 3UDEA 5EX3A 4LSLB 4OLPA 4BS2A 1JLEB 1GXUA 3BN7A 3P96A 1D3WA 4TXSA 5DDQC 2DGTA 4NA3A 1S1VA 2A2DA 2E7XA 1G7CB 1S1UB 3EDQB 5ETLA 5GMDA 2BABA 3HT3A 2BJDA 3CEDA 3AY0A 4ZN1A 4F2SA 5C42B 1PJ5A 5I3UA 2EKNA 4UOHA 3HKZD 1F1BB 3M9OB 1RA6A 2KRRA 1KRPA 2J0SD 2JEGA 1FFWB 4X66J 5ETRA 4D3HA 5GMEA 3H90A 2ZM6F 3TI0A 1NDPA 5IWAJ 4KRWA 1P9QC 1Y0HA 3O3LA 3IXQA 4AT1B 1UFLA 3OTOJ 2FHJA 2HHWA 1FK9B 1RTZA 2MKCA 5HL7Q 3CDBA 4YN3B 3RR8A 1QY7A 2HS3A 1S1TA 4KYZA 3OVAA 4C11B 4KHPF 1TVRB 4JB8B 1BQMB 2ZE2A 2MGZA 2FJVA 2C22A 2F4VJ 3PHEA 4QR1A 5T7LA 4DPOA 4ZVUB 4FYVB 4K2JA 3EZ5A 3TR5A 1N36J 3DLKB 3GCXP 4LUBA 4OZ0A 3MUMP 4NI2A 1IKYB 4CCHA 1AA1B 2IM2A 1QAIA 3CJSA 4AUKA 4WYWA 5A8RA 3C16A 4HVZA 4FZVA 5GAEI 1NNDA 3D68A 2DNHA 5HI7A 2N7YA 4DZDA 5E0OA 4MYTA 3VHQA 2DNMA 2J7WA 3QFHA 2B6AA 1CSJA 2X3DA 2YKNA 5IQQA 4OX9F 1GH8A 1JLCB 1FE4A 4ICLB 2UXCF 5IT9U 1K0VA 2C3OA 2L08A 2OO4A 3H20A 3GV8B 3M2VB 3R9LA 4IUFA 3IGNA 2ZBRA 4OJGA 3RW6A 3GG1A 4QR2A 3CJKB 1WNEA 2FJAB 2H3EB 3HF5A 5I4MA 1C0TB 3ILLA 3KJVB 4A8MP 1IBMJ 1T94A 2RF2B 3EX7B 2GZOA 1RAGB 1TL1B 2RQMA 4AD6A 1R8PA 2CA9A 4MFBB 1F3VA 2VQFJ 3LANA 1TL4A 3TA1A 3PRDA 4DL4A 1G3OA 5HBMA 1D9AA 3S1TA 3ETOA 1IBLF 2A3JA 3KK1A 4OZ1A 2CJKA 4DSLA 1MMNA 3T3FA 4ANEA 2HVDA 4XTTA 3UCUP 4GVBB 2J0QD 1RCXB 2Z2MA 3FEXB 4KPCA 4DLGA 2HBYB 4DFPA 2E7VA 2YWGA 4LT6A 4RNFA 1V3SA 2ZOGA 2FY8A 1T03B 5KFYA 3ZTOA 4CQ1A 2MLYA 1S9EB 1R8CA 2OAUA 4ECZA 4B3MJ 1XIQA 3RJMB 2XSFA 3C19A 3CCJS 3TAMA 2EEYA 4LFCF 1A6LA 2HAFA 2HBQB 5J1EB 2QV6A 2HFVA 3CD0A 3BJYA 4DR7F 1ZYQA 3IBWA 3KTQA 1VOMA 1XBWA 4IQXA 4HHHA 4QYZJ 3I32A 4F7VA 1FT8A 4QWAA 3CCQS 1S10A 4ZMMA 2DGWA 3QJJA 2X1AA 3V81A 1GMWD 2EG2A 3CDWA 3DXBA 3NMRA 5L9NA 1VIXA 4DMZA 3U7JA 4F4YA 1OIAA 1JLFA 3DOLA 2A6MA 3MR7A 4KGVB 5B0BA 4UOCA 2FJXA 3SQGA 4U7CA 4FF3A 1UVLA 2KZZA 4CLUA 4KKOA 3D6TB 2V4JA 1AYEA 3KWMA 1B7YB 1XQIA 1HWJA 4P52A 3ZTPA 2NXCA 2UUBF 1HIYA 1YRXA 1REVA 1N36F 3TAMB 1S0NA 1MSWD 2EK1A 3OFFA 4P71A 5D77A 3DDIA 5M2PA 2F4VF 3Q24A 1NHKL 2QC3A 1U1KA 2FLOA 3ICLA 2XMTA 1JXEA 5HQMA 4ZCIA 1V5IB 4NI2B 5LXYA 2EFOA 3DXSX 1SKWA 4KV8A 5ETTA 1RTJB 3G82B 1ZTWA 2GS8A 3ISNC 2HRYA 1RJJA 3QO9A 2CPDA 5HROA 5K9FA 2ZH7A 4X4SA 2Q1LA 1VQ8S 4B3MF 2KM8C 2UVUA 1H0HB 5KFIA 4ZLPA 3OLBA 2E5LJ 4IG3B 2DPIA 3T19A 4JI2F 3TQEA 3PR5B 1S6UA 5H9FJ 1IR2A 1F9HA 2AEFA 4RU9A 4DQIA 2NPIA 1EP4B 2WONB 3A13A 2JFDA 4QIEA 3D3BJ 2RDDA 2L3MA 2BMBA 2LDIA 3GCWP 5D4LA 5ETOA 4DZ6A 1JJ2R 1Q8IA 4GKKJ 3WIVA 3OPKA 1C1BA 3M6WA 3NKYA 4KT0C 4PCQA 2HMIA 1TFWA 1NCLA 4OYBA 3G8QA 5HMZA 3SCIE 2PD1A 3GU0A 5DO2A 1X0FA 1Y5NB 1RHJB 2J9CA 1VISA 3I5CA 1N48A 5L39A 1HNZJ 3T9ZA 4LF4F 2KXHA 1FVQA 4MH8A 1LK5A 1UJ6A 3EZUA 3GSDA 5DZ7A 5DQIA 1TMMA 1VBKA 3QRRA 3FRZA 3PW4A 1RP5A 2HWHA 1RCOB 2W9CB 3B4DA 1TFYA 1H7XA 4ECTA 2RMLA 4CO0A 4LF1A 1WI6A 4CT8A 3K58A 5G0RB 3J7YU 1UETA 1LQ9A 5B7WA 3D66A 2V9WA 1WKKA 3NBPA 4PWDA 3FBCA 2LQJA 5J2PA 4L75A 4OFZA 2QLBB 2BR0A 4M1KA 1E6VB 4B3SF 4ECSA 4IQMA 2CPFA 4JYAF 2CWKA 4K5RA 3VTIA 2GO8A 2ZUAA 1TELA 3AHPA 3PEHA 3OXFA 3A3PB 4LR8A 1RABB 2W25A 2C2MB 1S9FA 4M95A 3P45B 2HKEA 5KFOA 1XMOF 4M5LA 3W2VA 3GV7B 2VG7B 2COLA 2YNHB 4CTAA 5IZHA 1TKXA 2VL1A 5E7OB 1G2EA 1VYAA 3V2UC 4LFBJ 1S6PB 4ED3A 1UEVA 3H59A 2GIFA 4FVMA 1NRKA 1VQ6S 1KDNA 1WDDA 3CC7S 3OL9A 1E6YA 1F3FA 1S1XB 2HK3A 2W4DA 2AMCB 2CPHA 3A12A 3AT1B 2VZ9A 3NOGA 2ZM6J 4J9NA 2VA3A 7AT1B 1D1UA 3PKYA 3U27A 5BR8F 5J2NB 3SFGA 4JI7F 1RAEB 2UVWA 2DRAA 2MY7A 2QL7B 2VUGA 4Y3CA 3X1LB 8ATCB 4FNIA 4DPXA 3M2RA 2R7VA 4URSA 4K4SA 3MMAB 4XK8C 4KAIA 1YLXA 5T41A 3HXMA 4QU7A 1KONA 2F63A 1WF2A 2V8PA 2LXUA 1WHXA 1Y9OA 1IKXA 3P4UB 1BC6A 1PG5B 2RUGA 2YX4A 3D3CJ 3K8VA 4K5SA 1P8GA 1U48A 5HATA 3KXDA 1GFWB 1GTEA 1Q5VA 1R89A 3IFEA 4NLDA 4B08A 1RLDA 4M5DB 4OZJA 2AGPA 5DM7Q 3NGDA 3UDCA 2MKIA 4OI2A 1VMBA 2RHSB 1CS4B 2H54B 3M8ZA 2KXFA 2JL9A 3BBFA 3R8YA 3DKDA 4OZ2A 4N8NA 2U2FA 3SDEA 1Q53A 2IFXA 4IG0A 3CCWA 3CJ3A 2F3JA 3F0NA 3OTEA 1HWUA 1QJHA 3DOKB 4QIWD 3UN3A 5KFBA 3MUTP 2DH8A 2KVQE 2FLLA 2R7UA 1ZM2A 4OX8A 3G6ES 1BMQB 2OSQA 3LP2A 2F9DA 2DNNA 2DO0A 2YVSA 4L3KA 1S59A 3CCTA 1H6KX 2D74B 4ZA1A 2I5JA 1L3SA 1LFWA 2HHSA 1HI1A 4I68A 3KHLA 4AL7A 4Y2AA 2YPYA 1R0BG 4TYAA 3N9UC 1LW0B 1RT1B 3H5YA 1JLQA 2LA4A 4FP9A 1S6QA 4NYZA 4NXMF 2C3UA 3BEGB 3OLAA 4PQUA 1VRUA 1UPMB 1W26A 2AJ0A 2R4FA 3BF4A 2QT7A 1FKPB 2B43A 4L73A 3UD4P 4O3RA 4DG1B 4O0IA 3BM7A 2AEJA 3UNGC 3PKMA 3OSPA 4LF8F 2HNZB 2LLZA 2LA6A 1NK5A 3G6YA 3HPOA 1RHKB 4DV2J 4X4VA 3NRBA 2MKJA 4GO7X 2GVZA 4ZVOB 4C8KA 4GKJF 1AFJA 1RWXB 4IH7A 1FI4A 1SV5B 2RQCA 3T6JA 5DDRC 5KFXA 3BO4A 4ED0A 4OYXA 3K5MA 2HK2A 3MEGA 3N6MA 4PPZA 2DR5A 1N5YB 1VC6A 5DRKA 1Y5IB 4CRJA 2VPXB 2K06A 2JDJA 2RRBA 3GR1A 3LA0A 5D0HA 1JJCB 4QJVA 7FDRA 4Q44A 2UUCJ 1FE0A 3AODA 2UU9J 1HPZA 4LR7A 5K8PA 2VU5A 1LWEB 1KTQA 3KG4A 5DLGA 4J9PA 3DGPA 4A8WA 1B0TA 1WUUA 2RQ4A 1SH2A 3GYNA 4DX8H 1OWXA 3D2WA 1IWAA 5ETPA 1NDCA 3MEDA 3RBDA 4DR1F 2LEBA 2CDRB 1YJRA 2HFNA 4ALZA 3CMQA 2NZ4A 3IBCB 3ILOA 1T9TA 4LF5F 1HYSA 2B56A 1RT5B 2CPJA 1TL1A 1ICEB 1RHUB 2WVCA 4PG7A 1CULB 2P9EA 4F0KA 2LDYA 4LQ9A 2Z8QA 3RRKA 1TKDA 3J7ZT 2ZZTA 3M8RA 2DGVA 4ZK7M 1N32F 3THPA 2YKPA 1T9VA 4MKBA 3FSIA 4D3GA 1QTMA 1SPBP 4DQQA 1XNQF 2Q66A 4LRDA 2AGQA 4ICLA 4Y2IA 4QIVA 4OLOA 5LOQA 3GIKA 3M8PA 3W63A 1SL0A 1S9EA 2OPPB 2CPZA 5I3QA 3QLHA 2DNOA 3D28A 3QIDA 3N5BA 5EHHA 2HURA 1FRMA 1ZAXA 3W66A 1HBMB 3QGIA 5DS7A 5KT6A 2VQEF 5A8RB 4MT1A 4CLKA 2PN6A 3PFEA 3M2UA 2BV3A 1Q8BA 1OSDA 2PEHA 3UR3C 5IC6B 4DV4J 1NKCA 1QE1A 2YQ3A 3LPEA 3AD8C 2CWXA 4C8LA 3KLGA 1U1MA 2FVSA 1R8HA 2XCAA 4KE5A 3ENVA 5J1NA 4C7QA 3Q86A 2CNNB 2D3ZA 4FXVA 4MFBA 2YNFA 1Y7PA 2DHGA 3D6HB 4Q8FA 2UV8A 4DL0C 1RT7B 2PGCA 4CZCA 4BDPA 4DR6J 1V5VA 3Q0AA 8RUCA 5HAOA 3ZZOA 3DI6A 1FK9A 2DGUA 4DV3F 2XWYA 3SQOP 2APOA 5THWA 2QIFA 5I42A 5KG6A 1FWKA 1P6TA 1QM9A 1YX2A 4MTPA 2JFKA 4JI0F 4BLGA 3CCSS 4KPYA 2KT2A 2ASJA 2EBEA 1NHUA 3T6BA 1LW2B 3BR8A 1P1LA 3MCSA 2W4CA 3JQJA 3MM7B 4NMXA 4WPAA 4YB5A 5A6WA 2ZDOA 3OFHA 4WXOA 4CLFA 4EWTA 3SCJE 2RILA 4GMKA 1VK8A 3D5MA 4PR6A 2MZQA 4ZDNA 5KG4A 2OPRB 3UN2A 3QAEA 3KLVA 4LF6J 2QN6B 4C97A 2EPIA 4DV7J 1ZZFA 1Q7LB 2ZNZA 5LT5A 1S1VB 4I1TA 1OQ3A 3M1VB 2GHWA 2JX2A 3QQCD 5T7LB 3DYAB 1GMUA 1RYRA 2OELA 1VCTA 3R5DA 5ITHA 1U6FA 2VA2A 1XNQJ 2UUTA 3QT8A 1GQEA 2L9WA 1ZOTA 2K1RB 2FGCA 4WFNQ 4AQYJ 3WC2A 1NK6A 2NQPA 1GX5A 2ATLA 3J80Y 4LJMA 2EFPA 2VJVA 1JLBB 1MNEA 2LEAA 4DUYF 1Q7YT 1FX2A 5K14A 3DRXA 4HHUA 2NXUA 4ZVQB 3MXHP 1YHQS 4UY85 1IQTA 1T11A 1NXIA 2K3KA 3FC9A 3Q8RB 3IAM9 3G9CA 2UVRA 4WKRA 1NK7A 2LXIA 5HK4A 3W62A 3QPIA 5CH7B 3GV5B 2YNHA 1RAIB 2QMWA 3VQSA 4Y2CA 2HZCA 1LW2A 1DBDA 2GVDB 2QTWA 2AJFE 3A8EA 2DXFA 4ZPWR 2MHNA 3V6KA 1RWNB 3MCNA 2JC0A 3G96A 3DHWC 1TMJA 3UDLA 4ILMA 3KK2B 1WSVA 2JOQA 1N6QB 3KKFA 4IOBA 1JQGA 4PPDA 4QIGA 5KT7A 3I4HX 4X4TA 4I2PA 2GGPA 1NMEB 4OI4A 3AJDA 2CQBA 3I0SA 2DNKA 4K2XA 2YNFB 1QAJA 1F5AA 3ENQA 1WSRA 3HDSA 1S9GA 2VFRA 3CJ4A 5KFGA 3BO3A 5AXKA 2W2OP 2AX1A 4NX9A 1RU2A 2ZBIA 1KLNA 1KHVA 3CO9A 4E2FB 2JSXA 1DARA 1KD1T 3CNQP 3FSXA 2W01A 3DC2A 4NWBA 1PC5A 3O1LA 3SSSA 1JB0C 1UJ4A 1DTQB 3NP5A 4EK2A 2VF3A 1FJGF 2OKQA 3HFVA 3OR1A 4O4RA 1X4BA 1AROP 3D6MB 3E3XA 3MM7A 2JJ4D 2ROGA 4WFXA 4B3SJ 3H5XA 4P74A 5C25B 3TQ1A 1BD6A 3HHDA 3KK3A 2LMIA 2F9JA 3L9ZA 4ZVTB 2HMIB 2V94A 4C0HA 4ECRA 1N0UA 2V2QA 1QSSA 3FEYB 3I55S 2MHEA 2F5GA 4F4XA 3VGSA 5HQLA 5H1SV 1N5QA 3H4BA 3RB6A 2JLFA 2YPZA 1RTIB 1N56A 4TY9A 3CO0P 3CDAA 1VRTA 3DRSB 4F0HA 1KSPA 2BKOA 3BBBA 4CH7A 2YNIA 2W9AA 2VQEJ 2B5JB 4DXLA 3BV8A 1V9OA 2ZHOA 4QQBA 7FD1A 3VQTA 4DV1J 2CJQA 4K4WA 4K4XA 3H25A 4NPOA 4Y6IA 2BM1A 2OGUA 2BANA 2QYCA 3C6UB 5AT1B 3SIPB 2E9TA 4B3TF 4W98A 4FBUA 2Y0BB 3GIMA 4USWA 2WRMA 2LVWA 5KT2A 3JYTA 4R8UA 2B7BB 5A0YA 2O01C 1PAUB 2LU1A 1XMQJ 1RHMB 4RW4B 1C2PA 2KDOA 3NGSA 5KFPA 4TU8A 3JB9k 2VG6B 3ZZPA 5FDLA 3TUJC 4Q8EA 4ECXA 5H9FK 1JLFB 3DOLB 2IJFA 1ZPWX 1JJHA 1YGYA 2IYGA 1RT5A 2QMXA 2HQDA 4FBTA 2AEMA 2UUCF 3HVTA 1O0PA 4U7UD 2EI5A 1M5SA 1S6QB 3FGVA 4QYRA 5D0RA 4RL1A 2FDNA 1IKVA 4USIA 1OPZA 4M5HA 2IM0A 2O3DA 5IT0A 3UFCX 3M9MB 2WB4A 1HL6A 4K4UA 2XGQA 2FZGB 1O6XA 1PILA 1NKBA 4HKQA 2XY5A 4C9DA 1FFGB 1FDAA 2YKQA 2IRXA 3NNHA 2OD4A 4DQSA 3VR1A 4O44A 3FJ2A 2MQQA 4F8RA 4NCGB 5IT9Y 5C2GA 3CCRS 3MURP 1HWLA 4A46A 1W7WA 1NJIT 2ILYA 2JVRA 2IDLA 1GMVA 2FUG9 3DLLQ 1AW0A 3MM5B 3IAS9 2HGMA 2W2QP 4K7QA 4U95A 3KK1B 3BSOA 1M5VC 2KJWA 2VG6A 2CJBA 4WXWA 1LWCA 2DNZA 2OUGA 5KFEA 4NLGA 1VQPS 2OPSA 1WACA 4ETZA 3BSNA 2E9ZA 2HHTA 5DJBA 3FZ2A 1HNXJ 1LV5A 2DO4A 3M8WA 2HHHF 3E01B 1R0CB 4LF7F 2MQLA 4NCGA 1BQXA 1ZM3A 4F26A 3CC4S 1VRUB 1IKWB 4HEA9 5HO4A 1Y4ZB 2L41A 2C2KB 1GX6A 2MYFA 2NXNA 1LNQA 1WKJA 1JLQB 2OLWA 2ZEJA 3CJKA 4EYIB 2FHMA 2FLNA 3IS9B 3OL7A 1P27B 1JLCA 3HHLC 2CQ3A 4ZVEA 4N47A 1IWGA 4PG4A 3DOMA 5KFVA 3GIJA 2FLPA 4FXWA 4ZPAA 1YJ9S 3D54A 2L9NA 3HP6A 1EIYB 1CJKB 1U1QA 3IG1A 1NK8A 3P8BB 3DLJA 3ENAA 2HZAA 1W25A 4NLWA 1A0OB 5HVHA 2VBZA 1YJTA 4I64A 3T1HJ 1SKSA 2HQ3A 1IBMF 4RW4A 1JLAB 2PO4A 2B8PA 3TJAA 1BQMA 1J5EF 4DSJA 3FK4A 4XDDA 3HMJG 2YKMB 3MF5A 3PDNA 4WU2A 1VHIA 3KHRA 2UXDJ 1S1TB 2F4FA 4OYMA 2W9BA 4OX9J 4OYAA 2MZSA 1RWOB 3IA0A 2YNGB 3OR1B 2GMJA 4JI7J 1U2CA 5CHCB 2VKZG 5DG8A 1V3ZA 2V34A 1Y3KA 2OTJS 2AV5A 3T1YF 2XEXA 1R0AB 3PRVA 2LECA 1TQLA 2C1EB 3KNGA 2LQBA 2RSQA 1QDUB 2B9EA 3MZIA 2EKYA 4QWBA 5IV3A 1YDLA 2Z2LA 4UOGA 3POTB 3Q8VA 3M7VA 4FYWB 5D4PA 2CVIA 1S9GB 2E7WA 1S1XA 3UCZP 1XMOJ 2X3GA 2P6SA 5HLFA 2J6SA 3IWNC 3BPSP 4I56A 1JWWA 1NJWA 1WEYA 1RHRB 2BRKA 5CCMA 1S1UA 1OPIA 3ZTQA 5GADI 5D3GA 3HHLD 2P9GA 2W8LA 1Y00A 4DS4A 4DV0J 1SKRA 2UUAJ 2VONA 4OI6A 3D6FB 2BQUA 3TAPA 5IM0A 3H40A 1FDNA 4WFBQ 3C6TB 1D09B 1AB8A 2DXEA 3AXMA 2GX8A 2J8AA 4M5JA 2D1CA 5F3TA 4E8UA 5RUBA 2RU3A 1WC0A 3MAQA 4EMDA 4UUWA 2XMJA 1S12A 2YX7A 1I1GA 2IVFB 2DR9A 2B8QA 3MEKA 3SCLE 1LXJA 4XO0A 4X65F 4C8ZA 3MECA 4RW6B 2AX0A 1EKSA 1OMSA 1Y5LB 3I9ZA 4HACB 5GAGU 4TU9A 1J5EJ 4NZ7A 4FF1A 4FF2A 4B3RF 2WHOA 2K1RA 2XMVA 4C2MA 5KFNA 2C2RA 2G2YA 4RX6A 4NLYA 3D7SB 3F56A 2YWFA 3H2LA 5E3CA 2MXYA 4CLLA 3T1HF 1HNZF 2YH0A 2ACYA 4J5OA 5A8KB 1PSDA 5KG2A 4TQSA 4LF9F 3CD6S 2D3O1 4KV8B 3HJFA 1N34J 3DLHA 4I2PB 1ULRA 3KUHA 1FA0A 2C3PA 2RRNA 2XGPA 3HFKA 5BJRA 3RGIA 1EKRA 4OX7A 1C4CA 2GQQA 3KK2A 2XS2A 2Z58B 1MWYA 4OL8A 4USKA 5LMNJ 4Y34A 4G3IA 3KYLA 1F9EB 3OUYB 3GG0A 3R6GB 4NE9C 3ETMA 3HVRA 1K73T 5A8WB 2O67A 1RK8A 5HP1B 1HWKA 2D9OA 2QX0A 4A48A 3Q23A 4KKOB 3PXGa 2HIYA 1TKZB 1KKHA 4C0OC 1WHYA 2GAGC 3AAWB 5F3ZA 4X4UA 4NASA 2E29A 4IFYB 2BRLA 3PW7A 4B02A 3P49B 1WEXA 3QSYB 4MIBA 3VGTA 1CBKA 2VASA 3FKBA 2YQ1A 3NMAA 2HS4A 3CMES 4N7TA 4YDXA 4AXIA 3J81Y 1KOOA 4KJIA 1KVIA 1S77D 1KQFB 2IAJB 5CQGA 3KLGB 1YRUA 3CCZA 5J1EA 1QE1B 4YY3J 2HW3A 3EGWB 2OFHX 4DV6F 2W8KA 1NSQA 1TR0A 4CO4A 4E0DA 5L46A 1RHQB 4WK1A 4RU2A 1T03A 4FPIA 1HBNB 1FEHA 2M8HA 5AXNA 2KG0A 1M5KC 2HRUA 4CLPA 2IMWP 4LIRA 4LRFA 3THVA 3CDEA 1HBOB 1UFKA 5EGYA 4RLEA 3VAMA 4WP8A 3TO8A 2KB2A 2QL9B 3KNAA 3T41A 5I42B 1HA1A 3EICA 3PG9A 2OJ3A 4L76A 2R7QA 4LRBA 4MKAA 1R43A 1RTHB 3AFGA 4PYAA 2VIHA 3V6HA 3BB5A 2DCUB 2FC8A 2NREA 5MAOA 1RAOA 1ZETA 3R5JB 1UVKA 3V81B 3FQKA 2BUNA 4DI6A 2W7AA 4YFUA 2RF2A 4ED2A 4HR2A 4JI5F 3AXKA 3TYTA 4LMZA 3MM9B 2HIQA 3ZO7A 4QOTA 4C48A 4DF4A 1FRJA 1D9FA 4ZJLA 2FQQB 3QRQA 3EPIA 3CGIA 1ROFA 4RWWA 3PEJA 2DTJA 5IOLA 3PYGA 2DRDA 2RB7A 1F9FA 3IR6B 3LGMA 4NXNF 4WZMA 2QRRA 4HYKA 2KJVA 1XNRF 2CIMA 3KLEB 1IXKA 1IUJA 1NLKL 1PKUA 3NGUA 4QPTA 4ZVGA 5J2QA 4U6PA 4J91A 3TARA 2ROEA 3K5PA 3G71S 2AJQA 1KBRA 1SV5A 5HBMB 3I0RA 1TKTB 1MWQA 4YP3A 2AKWB 3CD5A 3PV8A 2MPUA 2CZVC 2ZE2B 2PE8A 2MGZB 3MAAB 4PXEA 2R7RA 4IO9Q 4J9QA 2C2DA 1AUSL 1O5JA 2BEFA 2QA1A 4C8NA 4WBFA 2UXCJ 4I67A 1MWZA 3M8YA 1NJZA 3KJQB 3ITHB 1JKHA 3NG8A 3BKFA 1B70B 1X9MA 4DWIA 4P10A 3M2VA 3LP1B 2CQ4A 3TA0A 3TUIC 1LW0A 4FS2A 1WC1A 2B6AB 1FHTA 4DFJA 2WVBA 2W9CA 3T5LA 4YEAA 2HWIA 3JSMB 3OR2A 3KLIB 2BZ2A 2KO1A 5AE1A 5C2CA 4IRDA 4NLXA 3BSCA 1JLGA 2R42A 4J9UE 3Q83A 1R27B 1URNA 4JI1J 2HPUA 4DR5F 3EVOA 3KHGA 1UKUA 2XZDB 3RBZA 5KT3A 4X62F 2H9ZA 3SI8A 1SL1A 1U6BA 5DZ6A 4NLRA 2E66A 4XIUA 1PYOB 3J81U 1M0SA 1DHMA 2HAIA 3B4MA 3CVKA 3K89A 3PJXA 4RUBA 5BYQA 3CF5Q 3PJWA 2DH9A 5B0GA 1U1NA 1YWXA 3TVZA 2AJ2A 3UNYA 3EPGA 2BX6A 2OSRA 4M5DA 3JAMU 2ZVIA 3SSRA 5IWAF 4DR4F 1PIEA 3MMCA 2MQMA 4ZPCA 3TUZC 4LF6F 3N6LA 1TKZA 4DLEA 1U8SA 1DFDA 2F8MA 2XBPA 3RG6A 1MU2A 2BJ9A 4TLQA 4PUOB 4WKYA 2Z30B 4OJHA 2CQGA 3IR7B 1I51B 1H2UX 1FVSA 3C6TA 4M63A 3WDOA 2KL8A 3GFXA 3PO5A 3R7NB 5D6GA 1XWLA 2KYZA 3W5ZA 4K4YA 1HKAA 3LP2B 2ROPA 1XJWB 2LYVA 4I6WA 1NAQA 4U8YA 3L95X 4K8RA 2E1CA 3TEGA 5A8KA 3PX6A 3I5AA 1S6PA 9ATCB 4QYZK 1JLEA 1NHVA 1FTCA 3EJMA 4UQTA 5D4NA 2KU7A 1QUVA 1I6JA 1GT8A 4EGLA 5D78A 4C4WA 2YY3A 3TZXA 1ZS6A 3IWLA 1MROB 2G4BA 2LQ8A 1RT3A 4LSZB 3HO1A 3VAHA 4DU7A 4DR2F 1IKXB 2HFZA 3A8JA 2V68A 2YKAA 4RNHA 2E1MC 2JVOA 4IH5A 5GAHU 1E6VA 2FGOA 3SSQA 4DL6A 2QYGA 3PW5A 1TV6B 2VOPA 2HG4A 1HFEL 2AD9A 3EXCX 4HI2A 1F60B 4PAAA 3HVAA 1KNZA 2J76E 3LGHA 1ZH5A 4DV3J 2R2RA 3IC1A 1VQ9S 3BGFA 4MIAA 5L1IA 1G6BA 2DGOA 1DTTB 2E5GA 4W92B 1XR7A 4Y0FA 4LQ3A 1B0VA 2B4UA 3UVJA 1H72C 2G2OA 2I1RA 5KFZA 2I8EA 2G9OA 3OL6A 2IVYA 2XC9A 3IG1B 4DFMA 1TL7A 4WWSA 4FS1A 2QEXS 1IBLJ 3P6YC 1TKXB 2Y0SD 4FVCA 2VODA 1BUXA 1FCAA 4OIXA 2NR0A 2WSEC 4P2XA 2W7PA 4OHVA 3AB4B 5BXIA 2XI3A 2CQIA 1KQGB 3AQOA 3GFZA 5F8LA 2V4QA 2HGLA 1ACMB 3IR5B 1RQ0A 2HFOA 2FHOB 3CE8A 3J7AN 3TX8A 4G1QA 3D9BA 2RT3A 1VFJA 2CJAA 3GJTB 3EVWA 4DN0A 2OH2A 4DS5A 1MU2B 1RXOB 2C2OB 3AA8A 4OQJA 3UE2A 5A2QY 1FJCA 5L1JA 4RZRA 2OMLA 4LRCA 1YZ6A 4NOHA 3M4XA 4UZCA 3NBPB 4PWDB 3H2VE 5T14A 2EG1A 3JSRA 4DPYA 4FXDA 3GZ7A 1H73A 4AQYF 4NLOA 2OPSB 2RS8A 1MG7A 4DR3F 5B08A 1YBTA 4NA1A 1VR6A 6FD1A 3QYYA 1TL3B 1EHWA 2VG5B 2GMHA 4HT7A 1UAWA 4XDCA 2OPQA 1KQKA 3F41A 1RTJA 4ED5A 2B3TB 2PDAA 2OP5A 2CFXA 2MSTA 3HD1A 2ZC4A 3TANA 1AFIA 4I69A 3K5OA 1ZTTA 4ATNA 2DB1A 2CAJA 3AJ1A 3QT5A 1Q8LA 3EGVA 5KAKA 1JX4A 1CC7A 1U1OA 4RWXA 1BHNA 1RDRA 2MTLA 1VS3A 5KFSA 1EETB 3KJFB 2A2CA 2DJWA 2K2PA 2G2ZA 3SXLA 1KP6A 1PAEX 2IBOA 4OYIA 4RUAA 1NJXA 3K7RA 1QVFR 2QSWA 1S57A 2Y1IA 5IT4A 4MYUA 3CCVS 1T7PA 1F5BA 4OHXA 2F40A 3LUYA 4B17A 3MMCB 3ZZZA 5CYQA 5DETA 1M5OC 2Z0GA 3BREA 3PZPA 1IR1A 2J0XA 3DRRA 4PABA 1Q78A 1RE1B 1U0HA 5EWGA 1U45A 4ETXA 2MZRA 4X64F 3KMQA 1TKTA 1FFSB 3V6DB 2BW2A 1IVZA 1WI8A 4UUXA 2BYCA 4WZQA 1AUDA 3KLFA 4A8SA 4C8YA 1SJFA 1REGX 1Q82T 4MK7A 2HFSA 4NXMJ 2BANB 1KEKA 3OJUA 1RAJA 5LL6d 3JSMA 3OR2B 3ZC4A 1X5PA 1CJVA 3PW2A 1REVB 4KR0B 1H2TZ 2CJYB 1H74A 1WELA 3J7YI 1ZM9A 5CD4H 1IKVB 3O6QA 2XM3A 2XYHB 4QZVB 4MJKA 4RBVA 3FRYA 2HHPA 2E5LF 2UXBF 3EYZA 4HL9A 4ZCMA 4NXNJ 2M0GB 1JKHB 3KFWX 1HBUB 2VFTA 3HVTB 2AYEA 5HN0A 1N32J 1UVJA 1S1WA 5CYQB 3G2XA 3M32B 4DSKA 3FBFA 2XZWA 1UJ5A 3C66A 4EO6A 2XTJP 1T9WA 3DGVA 3K57A 4V19J 4IDKB 2EFQA 3CCES 1JJ4A 1RTDA 3MM6B 2M5YA 4DR1J 4F50A
chains in the Genus database with same CATH topology
3F44A 4R8UB 1FRHA 1SJRA 2XCPA 2YKNB 1ZM4A 2ZH5A 2HQIA 2Q79A 3NS6A 2YWKA 4MAKA 5DQHA 2JEJA 4DL7A 4HH0A 3UR0A 5E33A 3BGRB 4ZCKA 4F4KA 1SI9A 2DIVA 3K5LA 4IKAA 1VQLS 4HHJA 3RRGA 4Y65A 4DV5F 1XC9A 2L48A 3MMBA 3OTCA 3M6XA 1VI7A 2WAQD 3QMQA 4ED8A 4NMLA 5LMUF 1UFWA 4I2QA 2FVPA 2XG8A 1RYSA 5LSLA 1RKIA 4I0WA 1KFDA 3C2PA 4F4WA 4YY3F 3TA2A 1RTIA 4EBDA 4ES3A 4Q0BB 1FERA 3BN4A 3TOQA 1HI8A 2FVCA 3BDPA 2CVEA 3KK3B 2I38A 3W2WB 1S0MA 1R8BA 5GAGI 2GIQA 1RT2A 4H54A 5F8JA 2D9PA 4TLRA 2ZZMA 2GQ2A 5I3UB 2FVQA 2FPHX 4R0JA 4NZ0A 4Y00A 3MPYA 2R7SA 4W90B 2N4DA 1FRLA 4HLBA 4Q43A 5LJ5Y 1NB7A 2PSZA 2JWNA 4C98A 1S0VA 4JV5F 3RAMA 5LXRA 3M1VA 1YIJS 3T9NA 4AFFA 1WTFA 2FIUA 2DRBA 2HNYB 4O23A 5KT5A 2FHKA 1LKZA 2V8DA 2XMKA 1MW7A 3D1HA 3FQLA 3LWMA 1HMVA 1L3KA 1GAOA 1IJFB 4J9KA 1RI7A 2R7OA 3G6XA 1OSCA 3QWUA 1VQKS 4GKKF 4L3NA 5IM0B 1GXTA 1JNZB 2EVZA 2YTCA 4CNZA 5DQGA 3NNCA 5D3GB 2NYIA 4AYBD 5F8IA 1KVJA 3NL0A 1URRA 3MPWA 1V6HA 1RT7A 2WBMA 3C8YA 2GA7A 3D0GE 2ADCA 1T3NA 4I2QB 2KHDA 4LSLA 5F9NA 4DV0F 2UUAF 4YOEA 5KG5A 3U1MA 3FEZA 1T3OA 4DL5A 4ZPTR 3M30A 3LP0B 5LJ3Y 3O8WA 1NJYA 4JI1F 4K4ZA 1WWHA 2ZOMA 3V4IA 2HVHA 2AU0A 1X8DA 5J1PA 2ZJQQ 1CPZA 4WFYA 2NS1B 3CJ0A 2YNGA 1T05B 1Q79A 3BQ1A 1C1CB 1FTRA 3M8PB 2WSFC 4F4ZA 1ZAVA 2YKMA 2QA4G 4P2SA 3GQCA 4WE1A 4ZHRA 3MR5A 5JVGQ 3F73A 3BDEA 1FRIA 1CLFA 3G8SA 4BWJA 1VIOA 2OMOA 4J9RA 4ECWA 1HI0P 1TK8A 3OVSA 5L1KA 4OI3A 1SIZA 4LSNB 2ZHAA 3BQ0A 4KGKA 2UZAA 1KFSA 2ZOFA 5K5MA 3LO3A 2J9DE 3NCRA 4JV1A 1R31A 6FDRA 2ASDA 3DU5A 3MUVP 1MMDA 2GJIA 4C0BA 2LCWA 1XR5A 4JUZA 4KFBA 2DBBA 4O3SA 4NLVA 4KBIA 3JTPA 4AL6A 1RT4B 3N79A 1N4LA 2MZ1A 5L1LA 3MOZA 2FY1A 4HI1A 4Q7AA 1YVFA 4ECUA 3I6PA 4ZPBA 4EYHB 1JLAA 1JIHA 4NL5A 4X4QA 3DRPA 3M9NB 4RW9B 4YB7A 4E98A 3UD3P 1H98A 2R8IA 4RW7A 3TQ1A 2HNZA 3ISZA 3MM5A 5KFUA 2JZ5A 1S1WB 4PXDA 1Y3JA 4H4MB 1J5OA 1FKPA 4IO1A 2YWHA 5I3PA 2F8HA