3DLLE

The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect trna positioning
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
171
structure length
171
Chain Sequence
GKQPIAVPSGVTVNAQDGVFKVKGPKGELTVPYNTELTVRQDGDQLLVERPSDAQKHRALHGLTRTLVANAVKGVSDGYTINLELRGVGFRAKLTGKALEMNIGYSHPVIIEPPAGVTFAVPEPTRIDVSGIDKQLVGQVAANVRKVRKPDAYHGKGVRFVGEQIALKAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rRNA-23S ribosomal RNA
publication title The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3dllE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3dllE01
1KD1G 5HL7E 3CF5E 3CCJE 1VQ9E 3OW2E 4U67E 5JVGE 4WFBE 4IO9E 4WFAE 1W2BE 1K8AG 5DM6E 1M90G 3CCRE 1K9MG 3J7ZG 1KQSE 1NJIG 1YHQE 2ZJPE 3I56E 3CMEE 3I55E 1YITE 5MLCH 5H1SI 4WFNE 5AN9B 3CCME 3DLLE 1VQ8E 1QVGE 2ZJQE 1YJWE 1YI2E 3CCSE 4IOCE 1M1KG 5GADG 1N8RG 3CPWE 3CCUE 1VQ6E 1VQME 1VQ4E 3CCLE 3CC4E 1VQOE 5GAHG 2QEXE 3G4SE 3CC2E 5GAEG 3G71E 2QA4E 2ZJRE 1Q82G 3G6EE 1S72E 1YJNE 2CQLA 3CCQE 1VQLE 3CC7E 1VQNE 1VQPE 1VQ7E 1YIJE 1KC8G 4WF9E 5DM7E 3CMAE 3CXCE 5GAGG 2OTLE 1Q81G 4WCEE 1RL6A 1YJ9E 1VQ5E 1QVFE 1VQKE 4UY8G 4IOAE 3PIPE 1Q86G 5JVHE 3CCVE 2OTJE 1K73G 1Q7YG 3CD6E 3CCEE 1JJ2E 3PIOE
chains in the Genus database with same CATH superfamily
5B10O 1KD1G 5HL7E 3CF5E 3CCJE 1VQ9E 2OY1O 3OW2E 2PI3O 4U67E 5JVGE 4WFBE 4IO9E 4WFAE 1W2BE 1K8AG 5DM6E 1M90G 2OL6O 3CCRE 1K9MG 3J7ZG 1KQSE 1NJIG 1YHQE 2ZJPE 3I56E 3CMEE 3I55E 1YITE 5MLCH 5H1SI 4WFNE 5AN9B 3CCME 3IGEA 3DLLE 1VQ8E 3IG9A 1QVGE 5B2AO 2ZJQE 3AUMO 2OY7A 2OYBO 1YJWE 1YI2E 3CCSE 2FKJA 4IOCE 1M1KG 5GADG 1N8RG 2AF5A 3CPWE 3CCUE 1VQ6E 1VQME 1VQ4E 3CCLE 3CC4E 2OL8O 1OSPO 3CKGA 1VQOE 5GAHG 2QEXE 3G4SE 3CC2E 5GAEG 3G71E 2QA4E 2OY8A 2ZJRE 1Q82G 3G6EE 1S72E 1YJNE 3EC5A 2CQLA 3CCQE 1VQLE 3CC7E 1VQNE 1VQPE 1VQ7E 1YIJE 1KC8G 4WF9E 5DM7E 2G8CO 3CMAE 3CXCE 5GAGG 2OTLE 5B11O 1P4PA 2I5VO 1Q81G 4WCEE 1RL6A 1RJLC 1YJ9E 1VQ5E 1QVFE 1VQKE 4UY8G 4IOAE 3PIPE 2HKDA 5B3MO 1Q86G 1FJ1E 3CKFA 2OL7A 5JVHE 2FKGA 3CCVE 2OTJE 1K73G 2OY5O 1Q7YG 3CD6E 3CCEE 2I5ZO 1JJ2E 3PIOE
chains in the Genus database with same CATH topology
1KD1G 5HL7E 3CF5E 3CCJE 1VQ9E 3OW2E 4U67E 5JVGE 4WFBE 4IO9E 4WFAE 1W2BE 1K8AG 5DM6E 1M90G 3CCRE 1K9MG 3J7ZG 1KQSE 1NJIG 1YHQE 2ZJPE 3I56E 3CMEE 3I55E 1YITE 5MLCH 5H1SI 4WFNE 5AN9B 3CCME 3DLLE 1VQ8E 1QVGE 2ZJQE 1YJWE 1YI2E 3CCSE 4IOCE 1M1KG 5GADG 1N8RG 3CPWE 3CCUE 1VQ6E 1VQME 1VQ4E 3CCLE 3CC4E 1VQOE 5GAHG 2QEXE 3G4SE 3CC2E 5GAEG 3G71E 2QA4E 2ZJRE 1Q82G 3G6EE 1S72E 1YJNE 2CQLA 3CCQE 1VQLE 3CC7E 1VQNE 1VQPE 1VQ7E 1YIJE 1KC8G 4WF9E 5DM7E 3CMAE 3CXCE 5GAGG 2OTLE 1Q81G 4WCEE 1RL6A 1YJ9E 1VQ5E 1QVFE 1VQKE 4UY8G 4IOAE 3PIPE 1Q86G 5JVHE 3CCVE 2OTJE 1K73G 1Q7YG 3CD6E 3CCEE 1JJ2E 3PIOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 G;  5HL7 E;  3CF5 E;  3CCJ E;  1VQ9 E;  3OW2 E;  4U67 E;  5JVG E;  4WFB E;  4IO9 E;  4WFA E;  1W2B E;  1K8A G;  5DM6 E;  1M90 G;  3CCR E;  1K9M G;  3J7Z G;  1KQS E;  1NJI G;  1YHQ E;  2ZJP E;  3I56 E;  3CME E;  3I55 E;  1YIT E;  5MLC H;  5H1S I;  4WFN E;  5AN9 B;  3CCM E;  3DLL E;  1VQ8 E;  1QVG E;  2ZJQ E;  1YJW E;  1YI2 E;  3CCS E;  4IOC E;  1M1K G;  5GAD G;  1N8R G;  3CPW E;  3CCU E;  1VQ6 E;  1VQM E;  1VQ4 E;  3CCL E;  3CC4 E;  1VQO E;  5GAH G;  2QEX E;  3G4S E;  3CC2 E;  5GAE G;  3G71 E;  2QA4 E;  2ZJR E;  1Q82 G;  3G6E E;  1S72 E;  1YJN E;  2CQL A;  3CCQ E;  1VQL E;  3CC7 E;  1VQN E;  1VQP E;  1VQ7 E;  1YIJ E;  1KC8 G;  4WF9 E;  5DM7 E;  3CMA E;  3CXC E;  5GAG G;  2OTL E;  1Q81 G;  4WCE E;  1RL6 A;  1YJ9 E;  1VQ5 E;  1QVF E;  1VQK E;  4UY8 G;  4IOA E;  3PIP E;  1Q86 G;  5JVH E;  3CCV E;  2OTJ E;  1K73 G;  1Q7Y G;  3CD6 E;  3CCE E;  1JJ2 E;  3PIO E; 
#chains in the Genus database with same CATH topology
 5B10 O;  1KD1 G;  5HL7 E;  3CF5 E;  3CCJ E;  1VQ9 E;  2OY1 O;  3OW2 E;  2PI3 O;  4U67 E;  5JVG E;  4WFB E;  4IO9 E;  4WFA E;  1W2B E;  1K8A G;  5DM6 E;  1M90 G;  2OL6 O;  3CCR E;  1K9M G;  3J7Z G;  1KQS E;  1NJI G;  1YHQ E;  2ZJP E;  3I56 E;  3CME E;  3I55 E;  1YIT E;  5MLC H;  5H1S I;  4WFN E;  5AN9 B;  3CCM E;  3IGE A;  3DLL E;  1VQ8 E;  3IG9 A;  1QVG E;  5B2A O;  2ZJQ E;  3AUM O;  2OY7 A;  2OYB O;  1YJW E;  1YI2 E;  3CCS E;  2FKJ A;  4IOC E;  1M1K G;  5GAD G;  1N8R G;  2AF5 A;  3CPW E;  3CCU E;  1VQ6 E;  1VQM E;  1VQ4 E;  3CCL E;  3CC4 E;  2OL8 O;  1OSP O;  3CKG A;  1VQO E;  5GAH G;  2QEX E;  3G4S E;  3CC2 E;  5GAE G;  3G71 E;  2QA4 E;  2OY8 A;  2ZJR E;  1Q82 G;  3G6E E;  1S72 E;  1YJN E;  3EC5 A;  2CQL A;  3CCQ E;  1VQL E;  3CC7 E;  1VQN E;  1VQP E;  1VQ7 E;  1YIJ E;  1KC8 G;  4WF9 E;  5DM7 E;  2G8C O;  3CMA E;  3CXC E;  5GAG G;  2OTL E;  5B11 O;  1P4P A;  2I5V O;  1Q81 G;  4WCE E;  1RL6 A;  1RJL C;  1YJ9 E;  1VQ5 E;  1QVF E;  1VQK E;  4UY8 G;  4IOA E;  3PIP E;  2HKD A;  5B3M O;  1Q86 G;  1FJ1 E;  3CKF A;  2OL7 A;  5JVH E;  2FKG A;  3CCV E;  2OTJ E;  1K73 G;  2OY5 O;  1Q7Y G;  3CD6 E;  3CCE E;  2I5Z O;  1JJ2 E;  3PIO E; 
#chains in the Genus database with same CATH homology
 1KD1 G;  5HL7 E;  3CF5 E;  3CCJ E;  1VQ9 E;  3OW2 E;  4U67 E;  5JVG E;  4WFB E;  4IO9 E;  4WFA E;  1W2B E;  1K8A G;  5DM6 E;  1M90 G;  3CCR E;  1K9M G;  3J7Z G;  1KQS E;  1NJI G;  1YHQ E;  2ZJP E;  3I56 E;  3CME E;  3I55 E;  1YIT E;  5MLC H;  5H1S I;  4WFN E;  5AN9 B;  3CCM E;  3DLL E;  1VQ8 E;  1QVG E;  2ZJQ E;  1YJW E;  1YI2 E;  3CCS E;  4IOC E;  1M1K G;  5GAD G;  1N8R G;  3CPW E;  3CCU E;  1VQ6 E;  1VQM E;  1VQ4 E;  3CCL E;  3CC4 E;  1VQO E;  5GAH G;  2QEX E;  3G4S E;  3CC2 E;  5GAE G;  3G71 E;  2QA4 E;  2ZJR E;  1Q82 G;  3G6E E;  1S72 E;  1YJN E;  2CQL A;  3CCQ E;  1VQL E;  3CC7 E;  1VQN E;  1VQP E;  1VQ7 E;  1YIJ E;  1KC8 G;  4WF9 E;  5DM7 E;  3CMA E;  3CXC E;  5GAG G;  2OTL E;  1Q81 G;  4WCE E;  1RL6 A;  1YJ9 E;  1VQ5 E;  1QVF E;  1VQK E;  4UY8 G;  4IOA E;  3PIP E;  1Q86 G;  5JVH E;  3CCV E;  2OTJ E;  1K73 G;  1Q7Y G;  3CD6 E;  3CCE E;  1JJ2 E;  3PIO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...