3DLQI

Crystal structure of the il-22/il-22r1 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
140
structure length
131
Chain Sequence
ARLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the IL-22/IL-22R1 complex and its implications for the IL-22 signaling mechanism
pubmed doi rcsb
molecule keywords Interleukin-22
molecule tags Cytokine/cytokine receptor
source organism Homo sapiens
total genus 47
structure length 131
sequence length 140
ec nomenclature
pdb deposition date 2008-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF14565 IL22 Interleukin 22 IL-10-related T-cell-derived-inducible factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 3dlqI00
1IJZA 1AX8A 4MHLA 1BUYA 1HIKA 1HZIA 1Y6ML 3N06A 3QT2C 1JLIA 2B8XA 3DLQI 2D9QA 3SE3B 4DOHA 1VLKA 4O6KA 4YPGC 2B90A 1A7MA 3NPZA 2B8YA 1CYLA 3DGCL 1LKIA 4J4LC 1PGRA 4FA8E 5D71A 5D72A 1BBNA 2Q7NB 2L3YA 5E4EA 1PVHB 3N0PA 4X51A 1M47A 3QB1A 3EW3A 5FHXA 1CD9A 3NCBA 1HUWA 3MZGA 3UF2A 1IK0A 3PIWA 2LMSA 1V7MV 1Z92A 2ILKA 2O26A 2B91A 3D48P 1CN4C 1ALUA 5LQBA 1IL6A 2HYMB 1RCBA 3QAZA 4ZS7A 2E9WC 4O9HA 3UF5A 1I1RB 4NKQC 1GNCA 1M48A 2GMFA 1BCNA 1IRLA 3BESL 4WRLB 1CNT1 3BPOA 3NCEA 1BGDA 2IL6A 4YUEC 2CYKA 4YQXA 3UEZE 1EVSA 2B5IA 1LK3A 4NI7A 1M4CA 2D48A 1RHGA 4GRWA 3HHRA 1ITMA 4Z5RD 3VA2A 3QWRB 1Z7CA 3WCYI 3SE4B 3UX9A 1Y6NL 1M4AA 1EERA 5FUCA 3G9VB 1WU3I 1HULA 1F6FA 1QVNA 2O27A 1F45B 2ERJD 3LB6A 1P9MB 3Q1SI 3NCCA 5D28B 1V7NV 5L6YC 1AXIA 1HWGA 4RS1A 4YDYI 3D85C 1LQSL 4ZF7A 1AU1A 2L3OA 5KNHI 4PS4A 1FYHA 3S9DA 1J7VL 3BPNA 4CNIC 2INTA 4NI9A 1EMRA 1RW5A 3D87A 1M4RA 3QB7A 2KZ1A 1YKBA 1HWHA 3BPLA 1HGUA 1D9GA 1ILKA 1N1FA 1PW6A 1Y6KL 5C7XA 1NBPA 1ITLA 4I77Z 4NEJA 1FG9A 1A22A 1INRA 2H24A 1BGCA 1B5LA 2B8ZA 1ITIA 1ETEA 1PY2A 1RFBA 1ITFA 1GA3A 1KF9A 1BP3A 1BGEA 3LB6B 1SCFA 1CSGA 4NEMA 1EXZA 3DUHC 2Q98A 2B8UA 1HIJA 5D70A 1EKUA 3NCFA 3OQ3A 5D22A 2LAGA 3EJJA 3HMXB 3PIVA 3B5KA 3L5WI 1IARA 1M4BA 3G6DA 1M49A 1D9CA 3L5XA 3INKC
chains in the Genus database with same CATH superfamily
4IKXA 1AX8A 5C65A 3HOWD 1HZIA 1Y6ML 2B8XA 5IYDD 2D9QA 1VLKA 1BBNA 4TPGA 4BBRD 1PVHB 3MZGA 3PIWA 4JA3A 2ILKA 1IL6A 3O7QA 1I1RB 4NKQC 1IRLA 2IL6A 4A3CD 4LEPA 4YUEC 4YQXA 2B5IA 2R93D 4NI7A 1M4CA 4GC0A 4GRWA 1Z7CA 3WCYI 2O6IA 1M4AA 5FUCA 3HHCA 2O27A 3Q1SI 4A3LD 1V7NV 1AXIA 4RS1A 3D85C 5KNHI 1AU1A 4A3MD 4IKZA 4CNIC 4PYPA 4NI9A 1RW5A 1M4RA 1PW4A 3QB7A 3BPLA 1N1FA 4NEJA 4DKEA 1FG9A 1Y1WD 2JA8D 2JA7D 1ITIA 5EQHA 4A93D 4ZWCA 2OQPA 1BGEA 2VUMD 4LDSA 3HOUD 3DUHC 1HIJA 5D70A 5IYCD 3B5KA 3L5WI 1M49A 3INKC 2Z3RA 4BBSD 3QT2C 4U4TA 1JLIA 3DLQI 2B63D 3AYHA 1CYLA 4J4LC 4Q65A 5D71A 2L3YA 5E4EA 2XUTA 1Y1VD 3EW3A 5FHXA 1CD9A 1IK0A 5D59A 2LMSA 2Y5YA 1Z92A 4EXPA 1CN4C 2Z3QA 5LQBA 3I4ND 3QAZA 2V8NA 3UF5A 5IYBD 1M48A 5IP7D 4U4WA 4EXNA 3UEZE 1EVSA 4D2DA 3HOVD 1RHGA 1ITMA 3VA2A 3HOYD 4XNIA 1Y6NL 5EQIA 1WU3I 3PO3D 1F6FA 4TPHA 1Y14A 4ZYRA 4PS4A 4QIQA 3S9DA 2INTA 1EMRA 1Y6KL 1ILKA 1PV7A 4DKFA 4A3BD 1A22A 1BGCA 2B8ZA 4J05A 4ZWBA 1PY2A 3DI3A 1KF9A 1BP3A 3OG4A 2CFQA 3LB6B 4OAAA 4A3KD 1CSGA 1EXZA 1EKUA 5D22A 2LAGA 2Q14A 4YBQA 3G6DA 1D9CA 4OH3A 5IP9D 3SE3B 4O6KA 1A7MA 4ZW9A 5C3ED 2B8YA 4FA8E 5D72A 3N0PA 4X51A 1M47A 3QB1A 5GXBA 2XQBA 3NCBA 1HUWA 4A3ID 1V7MV 3FKID 3D48P 4A3ED 3HOZD 1ALUA 4ZS7A 4O9HA 1GNCA 4A3JD 1CNT1 3BPOA 4NN7A 3TGXB 3H0GD 1LK3A 2D48A 4Z5RD 3QWRB 1HULA 1QVNA 1F45B 3LB6A 1WCMD 4IU8A 3NCCA 5L6YC 2R7ZD 4YB9D 4YDYI 1LQSL 4APSA 1J7VL 3BPNA 3D87A 2JA5D 2KZ1A 4D2BA 1HGUA 1PW6A 5C7XA 5A2NA 1ITLA 3I4MD 3PO2D 4I77Z 1INRA 2H24A 4TPJA 4A3GD 5A2OA 1ETEA 1ITFA 2R92D 1GA3A 4NEMA 5EQGA 2B8UA 3OG6A 3NCFA 3HMXB 4JR9A 1M4BA 3L5XA 2PSMA 4IU9A 1IJZA 4MHLA 1BUYA 2C35A 1HIKA 3N06A 4DOHA 4NN5A 4YPGC 2B90A 4BY1D 3NPZA 3DGCL 1LKIA 1PGRA 4BY7D 2Q7NB 4IKWA 3UF2A 2O26A 2B91A 4JREA 2HYMB 1RCBA 3IRHA 2E9WC 4LRLA 2GMFA 1BCNA 3BESL 4A3FD 4U4VA 2CFPA 4WRLB 3NCEA 3WDOA 1BGDA 4NN6A 4BXXD 2CYKA 3HHRA 3SE4B 3UX9A 1EERA 4DKCA 4D2CA 3G9VB 1PV6A 2ERJD 1P9MB 5D28B 5D6KA 5D58A 1HWGA 4ZF7A 2L3OA 1FYHA 5C4XD 2JA6D 1YKBA 1HWHA 4UVMA 4A3DD 1D9GA 4W6VA 1NBPA 4IKYA 3H3VE 4GBYA 5TS9A 1B5LA 3O7PA 5C44D 1RFBA 5FLMD 3DI2A 1SCFA 4XNJA 4GS7A 2Q98A 4DKDA 4IKVA 3OQ3A 4GBZA 3EJJA 3PIVA 3HOXD 1IARA
chains in the Genus database with same CATH topology
1IJZA 1AX8A 3HOWD 4MHLA 4BBSD 1BUYA 2C35A 1HIKA 1HZIA 1Y6ML 3N06A 3QT2C 5IP9D 1JLIA 2B8XA 5IYDD 3DLQI 2D9QA 3SE3B 4DOHA 1VLKA 4O6KA 4NN5A 4YPGC 2B90A 1A7MA 5C3ED 4BY1D 3NPZA 2B63D 3AYHA 2B8YA 1CYLA 3DGCL 1LKIA 4J4LC 1PGRA 4FA8E 5D71A 5D72A 1BBNA 4BY7D 4BBRD 2Q7NB 2L3YA 5E4EA 1PVHB 3N0PA 4X51A 1Y1VD 1M47A 3QB1A 3EW3A 5FHXA 2XQBA 1CD9A 3NCBA 1HUWA 4A3ID 3MZGA 3UF2A 1IK0A 3PIWA 2LMSA 1V7MV 1Z92A 3FKID 2ILKA 2O26A 2B91A 3D48P 4EXPA 1CN4C 4A3ED 2Z3QA 1ALUA 5LQBA 1IL6A 3HOZD 2HYMB 1RCBA 3I4ND 3IRHA 3QAZA 4ZS7A 2E9WC 4O9HA 4LRLA 3UF5A 1I1RB 4NKQC 1GNCA 5IYBD 1M48A 2GMFA 4A3JD 1BCNA 1IRLA 3BESL 4A3FD 5IP7D 4WRLB 1CNT1 3BPOA 3NCEA 1BGDA 2IL6A 4NN6A 4NN7A 4EXNA 4A3CD 4YUEC 2CYKA 4YQXA 3TGXB 3UEZE 4BXXD 1EVSA 2B5IA 3H0GD 1LK3A 2R93D 4NI7A 1M4CA 2D48A 3HOVD 1RHGA 4GRWA 3HHRA 1ITMA 4Z5RD 3VA2A 3QWRB 1Z7CA 3WCYI 3HOYD 2O6IA 3SE4B 3UX9A 1Y6NL 1M4AA 1EERA 5FUCA 3HHCA 4DKCA 3G9VB 1WU3I 3PO3D 1HULA 1F6FA 1QVNA 2O27A 1F45B 2ERJD 1WCMD 1P9MB 3LB6A 3Q1SI 3NCCA 5D28B 4A3LD 1V7NV 5L6YC 2R7ZD 1AXIA 1HWGA 4RS1A 4YDYI 1Y14A 3D85C 1LQSL 4ZF7A 1AU1A 2L3OA 5KNHI 4PS4A 1FYHA 4A3MD 5C4XD 3S9DA 1J7VL 3BPNA 4CNIC 2JA6D 2INTA 4NI9A 1EMRA 1RW5A 3D87A 1M4RA 2JA5D 3QB7A 2KZ1A 1YKBA 1HWHA 3BPLA 1HGUA 1D9GA 1ILKA 1N1FA 1PW6A 1Y6KL 5C7XA 4A3DD 1NBPA 1ITLA 3I4MD 3PO2D 4I77Z 4NEJA 4DKEA 1FG9A 4DKFA 4A3BD 1A22A 1INRA 2H24A 1Y1WD 2JA8D 1BGCA 3H3VE 4A3GD 5TS9A 1B5LA 2B8ZA 2JA7D 5C44D 1ITIA 1ETEA 1PY2A 1RFBA 3DI3A 2R92D 1ITFA 1GA3A 4A93D 1KF9A 5FLMD 3DI2A 1BP3A 2OQPA 3OG4A 1BGEA 3LB6B 4A3KD 1SCFA 1CSGA 4GS7A 4NEMA 2VUMD 1EXZA 3HOUD 3DUHC 2Q98A 2B8UA 1HIJA 3OG6A 4DKDA 5D70A 1EKUA 5IYCD 3NCFA 3OQ3A 5D22A 2LAGA 3EJJA 3HMXB 3PIVA 3B5KA 3HOXD 3L5WI 2Q14A 1IARA 1M4BA 3G6DA 1M49A 1D9CA 3L5XA 3INKC 2PSMA 2Z3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJZ A;  1AX8 A;  4MHL A;  1BUY A;  1HIK A;  1HZI A;  1Y6M L;  3N06 A;  3QT2 C;  1JLI A;  2B8X A;  3DLQ I;  2D9Q A;  3SE3 B;  4DOH A;  1VLK A;  4O6K A;  4YPG C;  2B90 A;  1A7M A;  3NPZ A;  2B8Y A;  1CYL A;  3DGC L;  1LKI A;  4J4L C;  1PGR A;  4FA8 E;  5D71 A;  5D72 A;  1BBN A;  2Q7N B;  2L3Y A;  5E4E A;  1PVH B;  3N0P A;  4X51 A;  1M47 A;  3QB1 A;  3EW3 A;  5FHX A;  1CD9 A;  3NCB A;  1HUW A;  3MZG A;  3UF2 A;  1IK0 A;  3PIW A;  2LMS A;  1V7M V;  1Z92 A;  2ILK A;  2O26 A;  2B91 A;  3D48 P;  1CN4 C;  1ALU A;  5LQB A;  1IL6 A;  2HYM B;  1RCB A;  3QAZ A;  4ZS7 A;  2E9W C;  4O9H A;  3UF5 A;  1I1R B;  4NKQ C;  1GNC A;  1M48 A;  2GMF A;  1BCN A;  1IRL A;  3BES L;  4WRL B;  1CNT 1;  3BPO A;  3NCE A;  1BGD A;  2IL6 A;  4YUE C;  2CYK A;  4YQX A;  3UEZ E;  1EVS A;  2B5I A;  1LK3 A;  4NI7 A;  1M4C A;  2D48 A;  1RHG A;  4GRW A;  3HHR A;  1ITM A;  4Z5R D;  3VA2 A;  3QWR B;  1Z7C A;  3WCY I;  3SE4 B;  3UX9 A;  1Y6N L;  1M4A A;  1EER A;  5FUC A;  3G9V B;  1WU3 I;  1HUL A;  1F6F A;  1QVN A;  2O27 A;  1F45 B;  2ERJ D;  3LB6 A;  1P9M B;  3Q1S I;  3NCC A;  5D28 B;  1V7N V;  5L6Y C;  1AXI A;  1HWG A;  4RS1 A;  4YDY I;  3D85 C;  1LQS L;  4ZF7 A;  1AU1 A;  2L3O A;  5KNH I;  4PS4 A;  1FYH A;  3S9D A;  1J7V L;  3BPN A;  4CNI C;  2INT A;  4NI9 A;  1EMR A;  1RW5 A;  3D87 A;  1M4R A;  3QB7 A;  2KZ1 A;  1YKB A;  1HWH A;  3BPL A;  1HGU A;  1D9G A;  1ILK A;  1N1F A;  1PW6 A;  1Y6K L;  5C7X A;  1NBP A;  1ITL A;  4I77 Z;  4NEJ A;  1FG9 A;  1A22 A;  1INR A;  2H24 A;  1BGC A;  1B5L A;  2B8Z A;  1ITI A;  1ETE A;  1PY2 A;  1RFB A;  1ITF A;  1GA3 A;  1KF9 A;  1BP3 A;  1BGE A;  3LB6 B;  1SCF A;  1CSG A;  4NEM A;  1EXZ A;  3DUH C;  2Q98 A;  2B8U A;  1HIJ A;  5D70 A;  1EKU A;  3NCF A;  3OQ3 A;  5D22 A;  2LAG A;  3EJJ A;  3HMX B;  3PIV A;  3B5K A;  3L5W I;  1IAR A;  1M4B A;  3G6D A;  1M49 A;  1D9C A;  3L5X A;  3INK C; 
#chains in the Genus database with same CATH topology
 4IKX A;  1AX8 A;  5C65 A;  3HOW D;  1HZI A;  1Y6M L;  2B8X A;  5IYD D;  2D9Q A;  1VLK A;  1BBN A;  4TPG A;  4BBR D;  1PVH B;  3MZG A;  3PIW A;  4JA3 A;  2ILK A;  1IL6 A;  3O7Q A;  1I1R B;  4NKQ C;  1IRL A;  2IL6 A;  4A3C D;  4LEP A;  4YUE C;  4YQX A;  2B5I A;  2R93 D;  4NI7 A;  1M4C A;  4GC0 A;  4GRW A;  1Z7C A;  3WCY I;  2O6I A;  1M4A A;  5FUC A;  3HHC A;  2O27 A;  3Q1S I;  4A3L D;  1V7N V;  1AXI A;  4RS1 A;  3D85 C;  5KNH I;  1AU1 A;  4A3M D;  4IKZ A;  4CNI C;  4PYP A;  4NI9 A;  1RW5 A;  1M4R A;  1PW4 A;  3QB7 A;  3BPL A;  1N1F A;  4NEJ A;  4DKE A;  1FG9 A;  1Y1W D;  2JA8 D;  2JA7 D;  1ITI A;  5EQH A;  4A93 D;  4ZWC A;  2OQP A;  1BGE A;  2VUM D;  4LDS A;  3HOU D;  3DUH C;  1HIJ A;  5D70 A;  5IYC D;  3B5K A;  3L5W I;  1M49 A;  3INK C;  2Z3R A;  4BBS D;  3QT2 C;  4U4T A;  1JLI A;  3DLQ I;  2B63 D;  3AYH A;  1CYL A;  4J4L C;  4Q65 A;  5D71 A;  2L3Y A;  5E4E A;  2XUT A;  1Y1V D;  3EW3 A;  5FHX A;  1CD9 A;  1IK0 A;  5D59 A;  2LMS A;  2Y5Y A;  1Z92 A;  4EXP A;  1CN4 C;  2Z3Q A;  5LQB A;  3I4N D;  3QAZ A;  2V8N A;  3UF5 A;  5IYB D;  1M48 A;  5IP7 D;  4U4W A;  4EXN A;  3UEZ E;  1EVS A;  4D2D A;  3HOV D;  1RHG A;  1ITM A;  3VA2 A;  3HOY D;  4XNI A;  1Y6N L;  5EQI A;  1WU3 I;  3PO3 D;  1F6F A;  4TPH A;  1Y14 A;  4ZYR A;  4PS4 A;  4QIQ A;  3S9D A;  2INT A;  1EMR A;  1Y6K L;  1ILK A;  1PV7 A;  4DKF A;  4A3B D;  1A22 A;  1BGC A;  2B8Z A;  4J05 A;  4ZWB A;  1PY2 A;  3DI3 A;  1KF9 A;  1BP3 A;  3OG4 A;  2CFQ A;  3LB6 B;  4OAA A;  4A3K D;  1CSG A;  1EXZ A;  1EKU A;  5D22 A;  2LAG A;  2Q14 A;  4YBQ A;  3G6D A;  1D9C A;  4OH3 A;  5IP9 D;  3SE3 B;  4O6K A;  1A7M A;  4ZW9 A;  5C3E D;  2B8Y A;  4FA8 E;  5D72 A;  3N0P A;  4X51 A;  1M47 A;  3QB1 A;  5GXB A;  2XQB A;  3NCB A;  1HUW A;  4A3I D;  1V7M V;  3FKI D;  3D48 P;  4A3E D;  3HOZ D;  1ALU A;  4ZS7 A;  4O9H A;  1GNC A;  4A3J D;  1CNT 1;  3BPO A;  4NN7 A;  3TGX B;  3H0G D;  1LK3 A;  2D48 A;  4Z5R D;  3QWR B;  1HUL A;  1QVN A;  1F45 B;  3LB6 A;  1WCM D;  4IU8 A;  3NCC A;  5L6Y C;  2R7Z D;  4YB9 D;  4YDY I;  1LQS L;  4APS A;  1J7V L;  3BPN A;  3D87 A;  2JA5 D;  2KZ1 A;  4D2B A;  1HGU A;  1PW6 A;  5C7X A;  5A2N A;  1ITL A;  3I4M D;  3PO2 D;  4I77 Z;  1INR A;  2H24 A;  4TPJ A;  4A3G D;  5A2O A;  1ETE A;  1ITF A;  2R92 D;  1GA3 A;  4NEM A;  5EQG A;  2B8U A;  3OG6 A;  3NCF A;  3HMX B;  4JR9 A;  1M4B A;  3L5X A;  2PSM A;  4IU9 A;  1IJZ A;  4MHL A;  1BUY A;  2C35 A;  1HIK A;  3N06 A;  4DOH A;  4NN5 A;  4YPG C;  2B90 A;  4BY1 D;  3NPZ A;  3DGC L;  1LKI A;  1PGR A;  4BY7 D;  2Q7N B;  4IKW A;  3UF2 A;  2O26 A;  2B91 A;  4JRE A;  2HYM B;  1RCB A;  3IRH A;  2E9W C;  4LRL A;  2GMF A;  1BCN A;  3BES L;  4A3F D;  4U4V A;  2CFP A;  4WRL B;  3NCE A;  3WDO A;  1BGD A;  4NN6 A;  4BXX D;  2CYK A;  3HHR A;  3SE4 B;  3UX9 A;  1EER A;  4DKC A;  4D2C A;  3G9V B;  1PV6 A;  2ERJ D;  1P9M B;  5D28 B;  5D6K A;  5D58 A;  1HWG A;  4ZF7 A;  2L3O A;  1FYH A;  5C4X D;  2JA6 D;  1YKB A;  1HWH A;  4UVM A;  4A3D D;  1D9G A;  4W6V A;  1NBP A;  4IKY A;  3H3V E;  4GBY A;  5TS9 A;  1B5L A;  3O7P A;  5C44 D;  1RFB A;  5FLM D;  3DI2 A;  1SCF A;  4XNJ A;  4GS7 A;  2Q98 A;  4DKD A;  4IKV A;  3OQ3 A;  4GBZ A;  3EJJ A;  3PIV A;  3HOX D;  1IAR A; 
#chains in the Genus database with same CATH homology
 1IJZ A;  1AX8 A;  3HOW D;  4MHL A;  4BBS D;  1BUY A;  2C35 A;  1HIK A;  1HZI A;  1Y6M L;  3N06 A;  3QT2 C;  5IP9 D;  1JLI A;  2B8X A;  5IYD D;  3DLQ I;  2D9Q A;  3SE3 B;  4DOH A;  1VLK A;  4O6K A;  4NN5 A;  4YPG C;  2B90 A;  1A7M A;  5C3E D;  4BY1 D;  3NPZ A;  2B63 D;  3AYH A;  2B8Y A;  1CYL A;  3DGC L;  1LKI A;  4J4L C;  1PGR A;  4FA8 E;  5D71 A;  5D72 A;  1BBN A;  4BY7 D;  4BBR D;  2Q7N B;  2L3Y A;  5E4E A;  1PVH B;  3N0P A;  4X51 A;  1Y1V D;  1M47 A;  3QB1 A;  3EW3 A;  5FHX A;  2XQB A;  1CD9 A;  3NCB A;  1HUW A;  4A3I D;  3MZG A;  3UF2 A;  1IK0 A;  3PIW A;  2LMS A;  1V7M V;  1Z92 A;  3FKI D;  2ILK A;  2O26 A;  2B91 A;  3D48 P;  4EXP A;  1CN4 C;  4A3E D;  2Z3Q A;  1ALU A;  5LQB A;  1IL6 A;  3HOZ D;  2HYM B;  1RCB A;  3I4N D;  3IRH A;  3QAZ A;  4ZS7 A;  2E9W C;  4O9H A;  4LRL A;  3UF5 A;  1I1R B;  4NKQ C;  1GNC A;  5IYB D;  1M48 A;  2GMF A;  4A3J D;  1BCN A;  1IRL A;  3BES L;  4A3F D;  5IP7 D;  4WRL B;  1CNT 1;  3BPO A;  3NCE A;  1BGD A;  2IL6 A;  4NN6 A;  4NN7 A;  4EXN A;  4A3C D;  4YUE C;  2CYK A;  4YQX A;  3TGX B;  3UEZ E;  4BXX D;  1EVS A;  2B5I A;  3H0G D;  1LK3 A;  2R93 D;  4NI7 A;  1M4C A;  2D48 A;  3HOV D;  1RHG A;  4GRW A;  3HHR A;  1ITM A;  4Z5R D;  3VA2 A;  3QWR B;  1Z7C A;  3WCY I;  3HOY D;  2O6I A;  3SE4 B;  3UX9 A;  1Y6N L;  1M4A A;  1EER A;  5FUC A;  3HHC A;  4DKC A;  3G9V B;  1WU3 I;  3PO3 D;  1HUL A;  1F6F A;  1QVN A;  2O27 A;  1F45 B;  2ERJ D;  1WCM D;  1P9M B;  3LB6 A;  3Q1S I;  3NCC A;  5D28 B;  4A3L D;  1V7N V;  5L6Y C;  2R7Z D;  1AXI A;  1HWG A;  4RS1 A;  4YDY I;  1Y14 A;  3D85 C;  1LQS L;  4ZF7 A;  1AU1 A;  2L3O A;  5KNH I;  4PS4 A;  1FYH A;  4A3M D;  5C4X D;  3S9D A;  1J7V L;  3BPN A;  4CNI C;  2JA6 D;  2INT A;  4NI9 A;  1EMR A;  1RW5 A;  3D87 A;  1M4R A;  2JA5 D;  3QB7 A;  2KZ1 A;  1YKB A;  1HWH A;  3BPL A;  1HGU A;  1D9G A;  1ILK A;  1N1F A;  1PW6 A;  1Y6K L;  5C7X A;  4A3D D;  1NBP A;  1ITL A;  3I4M D;  3PO2 D;  4I77 Z;  4NEJ A;  4DKE A;  1FG9 A;  4DKF A;  4A3B D;  1A22 A;  1INR A;  2H24 A;  1Y1W D;  2JA8 D;  1BGC A;  3H3V E;  4A3G D;  5TS9 A;  1B5L A;  2B8Z A;  2JA7 D;  5C44 D;  1ITI A;  1ETE A;  1PY2 A;  1RFB A;  3DI3 A;  2R92 D;  1ITF A;  1GA3 A;  4A93 D;  1KF9 A;  5FLM D;  3DI2 A;  1BP3 A;  2OQP A;  3OG4 A;  1BGE A;  3LB6 B;  4A3K D;  1SCF A;  1CSG A;  4GS7 A;  4NEM A;  2VUM D;  1EXZ A;  3HOU D;  3DUH C;  2Q98 A;  2B8U A;  1HIJ A;  3OG6 A;  4DKD A;  5D70 A;  1EKU A;  5IYC D;  3NCF A;  3OQ3 A;  5D22 A;  2LAG A;  3EJJ A;  3HMX B;  3PIV A;  3B5K A;  3HOX D;  3L5W I;  2Q14 A;  1IAR A;  1M4B A;  3G6D A;  1M49 A;  1D9C A;  3L5X A;  3INK C;  2PSM A;  2Z3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...