3DLRA

Crystal structure of the catalytic core domain from pfv integrase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
186
structure length
155
Chain Sequence
QKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGSLLQEIRTSLYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Functional and structural characterization of the integrase from the prototype foamy virus.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase
total genus 53
structure length 155
sequence length 186
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dlrA00
3K58A 1X9WA 4DQIA 3CG7A 3E01A 3NGYA 4M41A 2Y1IA 1L3SA 1WAFA 3OYGA 3K57A 4PUOA 3TAMA 2F8TA 4W5RA 4ELVA 2Z1IA 5HRRA 4E19A 1DTQA 2DFHA 3D0PA 4HUFA 3EZ5A 5KI6A 3KLGA 1I39A 1REVA 4PY5A 3NCIA 2KZZA 4YFUA 1L3TA 3QNNA 2HHVA 4KB0A 4FCYA 2A1RA 1T03A 3VQAA 3OYDA 4GMJB 1WLJA 4OVLA 3LALA 2X6SA 3O3HA 1RTDA 4FLZA 4M42A 4Z4CA 4ZHRA 1TKXA 4M3ZA 4E1MA 4F3TA 4CFAA 3AO3A 3P5JA 3V81A 4AHCA 3NE6A 3NF9A 3PUFA 4RW9A 1GOBA 2D0AA 1RBUA 1WSEA 2D5RA 3AA5X 3ZT3A 3OJSA 4CEFA 3AVIA 4E7KA 1B9DA 4LSNA 3VA0A 4CEAA 1IG9A 1S1XA 4C8NA 5HP1A 3MEGA 2IOCA 4RW7A 4AH9A 3RTVA 3TAGA 3TABA 3NDKA 1VSKA 3DLHA 4DTJA 1W0HA 1YTUA 2YNGA 4CIEA 3OS1A 4FK0A 3ZSWA 3QEWA 1NK8A 4FK4A 4GW6A 3NGZA 1NK9A 2HHUA 4CE9A 4KKOA 2DY4A 1RT6A 5FDLA 3FFIA 1RTJA 3OYFA 3TARA 1HYVA 1LW0A 1ASWA 4AHRA 3V9WA 1HNIA 1JLGA 3TWHA 1UOCA 1D8YA 2X6NA 4FLVA 3SZ2A 5J2MA 2EHGA 3LZJA 3SUPA 1F21A 2BANA 4KTWA 3F73A 1XC9A 2PYLA 3KD1E 4F2SA 3VQ4A 3V6DA 1JXBA 3S3OA 1LAVA 3AO1A 4LH5A 3THVA 3KKRA 5FROA 1NK5A 3VQPA 1Q9XA 4CIFA 1HJRA 4E0DA 3C95A 2YNFA 3HP9A 4Z4HA 3AO2A 4M3XA 1NJXA 1S6PA 2ITGA 5HRPA 3SI6A 1JXEA 4JS4A 1NJYA 1C0MA 4CJEA 4KTQA 4KHQA 2KTQA 4MFBA 1WSGA 3F9KA 4CJLA 1SL1A 1VSJA 5FRNA 2P1JA 4FK2A 1TVRA 2RN2A 3SCXA 1JLEA 4M3WA 4RW6A 2EX3A 3D45A 4FVMA 4KAZA 3PX6A 1MU2A 4FLWA 3MXMA 2D0BA 3QIPA 3HXMA 2Z1HA 1IKYA 2FBVA 4E1NA 4RW8A 4IFYA 3L2RA 2IC3A 4DQPA 3MXIA 5CZ1A 4OPJA 2YNIA 3LPTA 4CJ5A 4DU3A 4C8LA 3ZT1A 2AJQA 3DLGA 5HBMA 1WNSA 2OPSA 3DLRA 3IG1A 1ZBHA 4NCAA 4FLUA 4KREA 3C94A 1Z26A 1ZBFA 2GUIA 3M8RA 3EY1A 4BDPA 4F8RA 2P5GA 3DLKA 3MAQA 2BGGA 2HNDA 4DTMA 4CHOA 1U49A 4E7HA 3AA4A 4AHVA 1K6YA 4HHTA 1N6QA 4FZXC 5CYQA 3NFAA 4KPYA 4FJHA 3VA3A 3CYMA 3S3MA 5J2NA 5J1EA 2R7YA 3K5OA 1QSLA 3NF8A 4DTPA 1NK0A 4B9SA 3RWUA 4LD0A 4QOZB 1RT2A 4OGEA 1RTIA 1VSEA 3PY8A 4NYNA 5DMRA 4CJWA 4KI4A 1WAJA 1VK0A 1Y97A 2XY6A 3OYHA 1JLCA 2DFEA 1KRPA 3EYZA 4ZTJA 1QTMA 2YNHA 4OKEA 1N5YA 3ZT0A 3T3FA 4J2EA 3OYNA 1L3UA 4K8XA 1KVCA 4FW2A 1D9DA 2X74A 1C0UA 4IG0A 3OYAA 3VQQA 1YTAA 4CF8A 3OYJA 1QHTA 1RDBA 3HPOA 1UA0A 1NJWA 4HCCA 4Z4IA 3AVGA 3HT3A 1BI4A 4CJSA 4CJVA 3AVFA 4BDYA 4CJPA 1RT7A 3QEXA 2XY5A 1JL2A 5FRMA 4FJ7A 3WNEA 1WSIA 4BE0A 2KW4A 4CGGA 3CM6A 3O4QA 4CJUA 4DTOA 3ZSOA 2LSNA 3K5MA 1WSJA 1XHXA 4CJKA 4DLEA 1WSFA 4DQRA 4CHPA 4DSEA 2G8HA 3SPZA 1SL0A 2YV0X 2PYJA 2ZE2A 3VQ6A 3MEDA 1JLAA 1U48A 5DK5A 3QIOA 3AO5A 1S5JA 3LZIA 4FXDA 3CFRA 4OPKA 4B9UA 4GVMA 2KZMA 1I3AA 4Y1CA 1VSMA 5HRNA 1EX4A 4H4MA 3LAKA 4RG8A 4ELUA 1S9EA 1SKWA 1TV6A 4CJQA 4FLTA 3ZSQA 1JKHA 2ZD1A 4W5QA 1BISA 3UIQA 3V9XA 4LH4A 2WONA 4KTZA 3AA2A 1TK5A 4EP4A 4CCHA 1ZYQA 2YHBA 1Q9YA 3LAMA 1CLQA 3P1GA 4O44A 3S9HA 1CZBA 1X9SA 3M8SA 3IRXA 3SJJA 4AHTA 3DRSA 2O4GA 3HSTB 3HVTA 3MXJA 1JL1A 1JLQA 4KFBA 3U3YA 1WN7A 3I0RA 3QLHA 2P5OA 1A5VA 2G8KA 3AVBA 4CK2A 4M3TA 4FM0A 2E4LA 4FJGA 3ALYA 1RBSA 1VSFA 4DQQA 1IO2A 1TAQA 4FJ9A 2KFNA 1RBVA 2Y1JA 1NKCA 1QS4A 2FC0A 3HPGA 3U3GA 2HHWA 4CEEA 3OYLA 4BWJA 3VQDA 4JS5A 3SUQA 5HRSA 2OA8A 2B6AA 1L3VA 2HVHA 3DM2A 4CGDA 1QQCA 4CK3A 3PO4A 2HHTA 1VSIA 4QAGA 1HYSA 1SV5A 2P51A 4I2PA 4HTUA 2VG6A 1BIUA 3CFPA 4RW4A 3VQEA 1LWCA 1U47A 3G10A 4K8ZA 3KLFA 2QKBA 4FJIA 4MQ3A 3M8QA 4B9NA 2FBYA 1VSLA 3DLEA 2ATQA 3V9ZA 3QERA 5JS1A 4CEDA 3V9UA 1BI4B 3L2QA 3LDSA 1TKTA 1X1PA 5KGWA 3LP1A 4Q5VA 1ASUA 3HK2A 3OS0A 4DS4A 1U04A 1KSPA 2QK9A 4Q0BA 4CJFA 3OYCA 1HMVA 4CGIA 5KTQA 4E7IA 1TKZA 4CFCA 5KRTA 2IDOA 1G15A 3AVKA 3V9SA 3LP3A 4AILC 4O0JA 4DTXA 2D0CA 2XHBA 4NYFA 5HROA 3IAYA 1VRUA 3AVAA 5C24A 3ZT4A 5I3UA 4CFBA 4WE1A 3SNNA 1B9FA 4FJXA 3HPHA 3SUNA 3V1QA 4DQSA 4CF0A 3OY9A 3DRPA 4FW1A 3SQ1A 3AVNA 2HW3A 5K14A 4DLGA 1FKOA 2ZQBA 3LP2A 4O4GA 3VQCA 4HVJA 3JYTA 3TANA 2Z1JA 3L8BA 1T7PA 2XO7A 3HL8A 2PY5A 4O0IA 3T1AA 3ZSYA 1A5WA 4HUGA 4DTUA 1D5AA 3ZCMA 2E6LA 1RNHA 4KHYA 1RTHA 3U6FA 2OYQA 4DFMA 4CIGA 3AA3A 5D3GA 2OPPA 1SKSA 4W5NA 1LWEA 2F96A 1DLOA 1LWFA 2IS3A 3DYAA 3SQ2A 1QSSA 3QETA 4ICLA 3RMAA 3DOKA 1RT1A 3LANA 3DLBA 1ZBUA 3QINA 1ITGA 3NHGA 4FJLA 1BQMA 3I8DA 4KV8A 3TAQA 1C0TA 4ID5A 1KLNA 2B4JA 4FM2A 3RMCA 4N56A 4W5TA 2HHSA 1BQNA 2VG5A 4B8CA 4DU1A 3SQ0A 3CFOA 3KD5E 4J2DA 3H08A 2E6MA 4YNQA 1UAXA 1ASVA 1EXQA 4BE2A 4CEOA 1L5UA 4CGHA 3NH2A 2A1SA 3VQ5A 4KB1A 1NK6A 5HLFA 4N76A 4KHSA 4C8MA 1D9FA 3ITHA 4KHNA 4CF9A 3ZSZA 3O3GA 1HRHA 3SQ4A 1J5OA 2G8WA 1VRTA 4Z0UA 3KLHA 3SUOA 4CK1A 3LWMA 4OGCA 2W42A 2HNZA 2WOMA 1O1WA 4KO0A 4F2RA 2HB5A 4J2BA 4CESA 5SZTA 2BDPA 5CYMA 1NOZA 4JLHA 1HPZA 3OJUA 2VWJA 3NH0A 4I2QA 3L2WA 2FBXA 3NH1A 1C6VA 4IDKA 3OS2A 3KK2A 4DTNA 4FLYA 2HHXA 4C8KA 4CJ4A 1S1TA 5J2PA 4FJKA 3ASMA 3DMJA 2HNYA 3KJVA 3G0ZA 1HQEA 4DMNA 1RT4A 1RDCA 3BGRA 1XWLA 2YHAA 1UA1A 3LP0A 3OYEA 4DS5A 4G1QA 3ZSRA 4N5SA 1NK7A 4FJ8A 3ULDA 3QEIA 2PZSA 4DTRA 2DFFA 2X78A 2G8IA 4PQUA 2G8UA 4IKFA 1UWBA 3SV4A 1RT3A 4CECA 1T8EA 3AVCA 5J2QA 3VQBA 4DSIA 3OYKA 3SYZA 1HYZA 4HUEA 4KRFA 1GOCA 2IAJA 3AO4A 3PV8A 4IFVA 4IG3A 2O4IA 5EU7A 1BGXT 4BACA 3T19A 4DSFA 3QEVA 4FLXA 1TL3A 3HYFA 4NCGA 1B92A 4HCBA 4EP5A 2I5JA 4M3YA 1VSHA 1LAWA 4XIUA 4BE1A 4KI6A 2G8VA 3KKSA 4CHZA 3RRGA 3DOLA 1TGOA 1R0AA 2OPRA 3RR7A 5E41A 3PX0A 4H8KA 3CM5A 3HO1A 4B08A 3VQ7A 1JLBA 3NF6A 5KRSA 3L2VA 4EZ6A 3AVLA 3TAFA 1BIZA 1TL1A 1YVUA 2QKKA 3WNGA 2OZSA 4CHYA 4NCBA 4KHUA 3DI6A 4UQGA 2GBZA 3K5NA 2VG7A 3ZSVA 3K2PA 3QESA 4CHQA 1KFSA 4FZZA 5JS2A 4B3OA 1KFDA 2HVIA 4CF1A 4PWDA 3I0SA 1JLFA 2ETJA 1CXQA 1GOAA 4CFDA 3RMDA 3AVHA 4ZTFA 4CHNA 4CERA 1NKEA 5C42A 1NKBA 3HJFA 1EP4A 4CGJA 3B6OA 3KLEA 1T05A 1RCHA 1J54A 1FKPA 1RDAA 1SKRA 2OZMA 3HM9A 2VWKA 4F4KA 4OLAA 1KCFA 1EETA 1KVBA 4LSLA 4O5BA 1Z25A 4BWMA 4CGFA 1TAUA 1RBTA 3L2UA 1KLMA 1IKXA 1A5XA 4AHSA 1TK8A 1IKWA 4DSLA 2GV9A 2HHQA 3S3NA 4DSKA 4E89A 3AVJA 3TR8A 4KHWA 1HQUA 4Z4EA 3OVNA 1QE1A 4N41A 1NOYA 3B6PA 3ISNC 4DTSA 2OPQA 2F8SA 4CJ3A 4B9LA 3RR8A 4FZYA 3WNFA 2RF2A 3VQ8A 3ZT2A 4DFKA 1QSYA 2IGIA 3NBPA 4DF8A 4FJ5A 1CZ9A 2Q3SA 5CZ2A 1NK4A 4Z4FA 4FM1A 1YT3A 2RPIA 3V1OA 4TSXA 4E7LA 4L8RB 1BCOA 3L3UA 4F3OA 1S1VA 3NGIA 1TK0A 4ID1A 4OJRA 3PO5A 3JSMA 2BE2A 4AHUA 3CQ8A 2RKIA 1C1BA 3L3VA 3ZSXA 3BDPA 1S6QA 3AV9A 4CF2A 4M3RA 1HNVA 1IKVA 1BL3A 1S1WA 1XHZA 1LV5A 3KIOA 3RMBA 3HP6A 3VQ9A 3K5LA 4BDZA 3KTQA 3SV3A 3TI0A 3OYMA 3O4NA 1U45A 1C1AA 3LPUA 1RT5A 1BCMA 1J9AA 1IH7A 1X9MA 2G8FA 1RBRA 3P83D 4DWIA 4I9QA 3K59A 2QXFA 5KGXA 4IBNA 3C6UA 4OKJA 4CJTA 4DU4A 3C6TA 3AVMA 1VSDA 4JRQA 4W5OA 4ELTA 4B9TA 2JGUA 4CJRA 4Y1DA 1ZBLA 4DSJA 3QNOA 2XRIA 4M45A 4FYDA 4QCLA 3O3FA 4CEQA 4B9MA 1NJZA 3QEPA 4DG1A 3KK3A 4B9VA 4PA1A 1RDDA 3HVRA 3TAPA 2FBTA 3WNHA 3IS9A 4DF4A 4FJJA 2Z1GA 3KLIA 1WSHA 3M8PA 1C1CA 3MEEA 4LY7A 2YKMA 5SWMA 1FK9A 1J53A 1TKDA 4EZ9A 4OLBA 1CXUA 1LW2A 1S9GA 2XY8A 4FJNA 3OYBA 5T7BA 3KK1A 2JLEA 1EKEA 2YKNA 4I9LA 4N47A 3LWLA 3TAEA 3SPYA 2NUBA 4E7JA 1XI1A 3NAEA 2KFZA 4CEZA 2B5JA 3V4IA 3OYIA 5CY4A 4I7FA 1SUQA 2DTUA 4FJMA 1KTQA 4CEBA 2KQ2A 3V1RA 5I42A 3VN5A 2HMIA 4DFJA 3PX4A 1S1UA 1DTTA 4O55A 4R5PA 3QO9A 4JRPA 4H4OA 2XY7A 4Z4GA 3RRHA 1W9HA 4B8AB 5C25A 1BHLA 1SL2A 1RILA 1KVAA 3MECA 4OKKA 4DFPA 1U4BA 4J2AA 1ZBIA 1Q8IA 3A2FA 3NF7A 3DRRA 4M3UA 4C8OA 4E3SA 1FXXA
chains in the Genus database with same CATH superfamily
1X9WA 4DQIA 4M41A 2P9NB 1L3SA 3OYGA 2UU9K 4ELVA 1DTQA 2DFHA 4BR0A 4XEIA 3EZ5A 4KHPK 4JKDA 3NCIA 2GUPA 3R1XA 4CZEA 3VQAA 1Q86O 2HSTA 2A40A 3HOSA 1RTDA 3T1YK 3IKMA 1VQKN 4AHCA 2GWKA 3A5LC 5CE3A 3AA5X 1BUPA 4CEFA 2P9PA 2VCPA 1IG9A 5HP1A 3TAGA 1W0HA 2ZGZA 2YNGA 4CIEA 2E2PA 3AARA 2HHUA 4GW6A 4IXCA 3NGZA 3G4SN 4IWVA 1RT6A 2CGLA 4H0PA 4BRQA 5GAGP 1OH5A 1HYVA 3WXMB 1BA1A 1LW0A 1ASWA 2P9LB 2NNWA 1UOCA 1Z6RA 2PYLA 1F21A 2BANA 4KTWA 3F73A 1XC9A 4F2SA 3VEXA 3C7NA 3VQ4A 1JXBA 1NK5A 3THVA 3AO1A 2KHOA 1Q9XA 3C95A 3HP9A 4IOXA 4MDBA 3SI6A 5HRPA 3J80O 2KTQA 4WQ4C 3A5OC 4NB4A 3QBXA 4M7XA 1QZ5A 5FRNA 1N8RO 4RW6A 4FVMA 3AGKA 4BVPA 2D0BA 3MXMA 4FWKA 2FBVA 2P9SB 4IFYA 2IC3A 4OPJA 3L4IA 4KH4A 2HBMA 1ZBHA 3CJ7A 3C94A 2CH6A 3EY1A 4DTMA 4QS7A 3D2FA 4CZKA 2E5LK 4WFBL 4NLBA 1K6YA 3J7AP 2RE2A 4H0OA 3NFAA 3CYMA 3S3MA 3WEEA 4DTPA 3ZYYX 1RT2A 3O6WA 4U7BA 1RTIA 4JNEA 1VSEA 5DMRA 4CJWA 1WAJA 1Y97A 4YOTA 3G25A 2HMPA 3GL1A 2DFEA 4EHUA 3EYZA 2YNHA 1HPMA 4ISFA 1GLCG 2VQEK 3ZT0A 3T3FA 4J2EA 3P39A 3H3OB 1D9DA 1HNWK 4YHHK 3OYAA 3VQQA 1YTAA 3OYJA 3HRGA 1UA0A 3HT3A 3AAQA 1YAGA 4CJVA 1BO5O 4CJPA 3QEXA 3WNEA 3VEVA 3F9MA 1XMOK 1QQMA 2LSNA 4JKCA 4DSEA 1WSFA 1OH6A 2QWLA 3ZLJA 1SL0A 1U6ZA 4IJNA 3FLCO 3AO5A 3LZIA 3SAHA 2UUCK 2V51B 4B9UA 1I3AA 4Y1CA 4XH1A 3I55N 4ELUA 1SKWA 4CBUA 5F0XA 3CCQN 4FLTA 3T1HK 3SLCA 5AQOA 2EWSA 4LH4A 2WONA 1TK5A 3AA2A 3NMUA 1K73O 4CCHA 2YHBA 3LAMA 3P1GA 3AAPA 3S9HA 1CZBA 2FLOA 4C1NK 3SJJA 3HVTA 1WN7A 2G8KA 2NRHA 4WF9L 4WFAL 2E20A 3VF4A 5KPRA 1RBSA 5BPNA 3W3DA 1Y64A 3CHWA 4K42A 4JS5A 5DM6L 2B6AA 3L6QA 3LDQA 1HYSA 4I2PA 2VG6A 3CFPA 4RW4A 4K8ZA 3EZWA 4GNIA 4BG8A 4MQ3A 2FBYA 1VSLA 3DLEA 4DR6K 4CEDA 2GTDA 2NRXA 3V9UA 1BI4B 2AP1A 3IMXA 2HBKA 3I33A 2ZM6K 3OS0A 1U04A 4E7IA 5AQVA 4CFCA 2NRRA 1G15A 4DTXA 5LL6Z 3CCSN 4WCEL 2XHBA 4NYFA 3GE1A 5M1PA 5HROA 3ZT4A 5C24A 4A5BA 2VYPA 4BR5A 3BZCA 4WE1A 4FJXA 3HPHA 4FWRA 3OY9A 3LP2A 1HJOA 3HL8A 3HI0A 1O13A 3T1AA 3ZCMA 1E4FT 4KHYA 1RTHA 4JKFA 5AZIA 3M6GA 4DFMA 5FPMA 3TPQA 2OPPA 2P9PB 1LWEA 5H1SQ 4W5NA 4JYAK 4BRNA 4JI5K 1XQSC 4BQLA 3CMAN 3DOKA 3NHGA 1BQMA 3TAQA 4GV3A 2Q97A 3WQUA 1KLNA 1C0FA 4CW7B 1IG8A 1BQNA 2BH1A 2E6MA 3H08A 4IJAA 1WBDA 1EXQA 4BE2A 1L5UA 3NH2A 3VQ5A 1M1KO 5HLFA 4H0TB 3O3GA 4FOIA 3CC4N 4Z0UA 4AM6A 3QFUA 4CK1A 4LF8K 2HB5A 5SZTA 1HPZA 3OS2A 1C6VA 4IDKA 3KK2A 4JI2K 4A61A 1S1TA 5J2PA 4FJKA 2A5XA 2F7TA 3G0ZA 4BRHA 1ZXOA 4DMNA 2QI2A 1RDCA 1XWLA 2YHAA 3PSFA 3WXLA 3CQYA 3OYEA 4DS5A 4FJ8A 4H0YB 4BROA 2G8IA 1UWBA 4CECA 4JKAA 4JD2A 3FGUA 3I8BA 3O9QA 1HYZA 1LOTB 3D2EA 2IAJA 2O4IA 2CGJA 5EU7A 4BACA 4CBXA 3D2FB 1BG3A 5JLFA 4M3YA 4XIUA 3RRGA 3Q7BA 4DR1K 2YHYA 5FPNA 3PX0A 1Q7YO 3HO1A 1VQ8N 3QB0A 5KRSA 2VWBA 2W40A 1TL1A 4CI6A 1RFQA 4CD3A 2QA4N 3VEOA 3VF2A 4BR9A 2GBZA 2RHKA 3ID8A 1KFSA 5JS2A 4CJ7A 1NGJA 2W6KA 2O8BB 4AM7A 3HJFA 1EP4A 3BEXA 3KLEA 3HM9A 2VWKA 4OLAA 1KCFA 1EETA 1CZAN 1IKXA 1A5XA 5AJ3K 4DSLA 2NRTA 3O9SA 4E89A 3AVJA 4KHWA 3ATUA 1QE1A 3ISNC 3ZX3A 2F8SA 3EN9A 1Q82O 3ZT2A 2RF2A 3VQ8A 2ZJQL 4FZYA 4B3TK 1NM1A 4FM1A 2VGMA 1YT3A 4NXNK 4L8RB 1BCOA 4F3OA 4JKBA 2FF6A 4DR3K 3JSMA 3UB5A 3CQ8A 2RKIA 3BDPA 4M3RA 1NU0A 4FWQA 3KIOA 3KTQA 1W2BM 3THWB 3OYMA 3O4NA 4JV5K 5GADP 3K59A 2O8DB 1QHAA 3GG4A 4CJTA 3FZLA 1GLFO 1SQKA 4JRQA 4ELTA 4B9TA 4JKEA 4DSJA 1HR0K 3QNOA 4FYDA 5DM7L 5AQNA 4PA1A 3HVRA 2FBTA 3O1WA 4DF4A 1YVNA 2Z1GA 2E2OA 4FJJA 2W6LA 3M8PA 3FZKA 1X3MA 4F9OA 4BVOA 3ZEUB 4A59A 2P9LA 3CPEA 1Z05A 4FJNA 4B1VA 5T7BA 3SPYA 4I9LA 2QTDA 2NUBA 4E7JA 1XI1A 3NAEA 5C10A 4MO4A 3OBYA 4FJMA 3ZETB 4WQ5C 4BC5A 3V1RA 5BPLA 5I42A 1NNEA 2HMIA 3JXUA 2CH5A 1S1UA 4O55A 4B3RK 3A5MC 3KHYA 4B8AB 4B1WB 5C25A 5AFUA 1RILA 3D7EO 1SL2A 1KVAA 3MECA 4DFPA 1U4BA 4J2AA 1M90O 4LFCK 3NF7A 3DRRA 4E3SA 4FWPA 1YUWA 2IVPA 2P9SA 3NGYA 2Y1IA 2F8TA 1WAFA 5FLXO 4W5RA 3AGRA 5HRRA 2Q36A 1XNRK 2KZZA 2HHVA 4FCYA 2A1RA 4PL8A 3OYDA 4OVLA 2ZWHA 3O3HA 5FPEA 4M3ZA 4CFAA 1OH7A 3AO3A 3V81A 1GLJO 2P9IB 3MN9A 3NE6A 5KPZA 4RW9A 4NLCA 1GOBA 3G71N 1RBUA 5M1OA 3ZT3A 3OJSA 1B9DA 1BDGA 4LSNA 3VA0A 4LF9K 2IOCA 4RW7A 5AQQA 3H6EA 3NDKA 4DV1K 1KQSM 2KKZA 1YTUA 3SMSA 3MN7A 3ENOA 3HOTA 3A8YA 3BF3A 3C6HA 4BRFA 1P8ZA 4DCHA 2UUBK 4AHRA 3V9WA 1JLGA 4FLVA 2EHGA 5EXWA 2WTUA 1QTMA 1LAVA 3MCAB 5FROA 4YDUC 5FPDA 1HJRA 3C6AA 1JCGA 3AO2A 1S6PA 1GLBG 3KWGA 4MFBA 1RDUA 3F9KA 3E66A 4FK2A 1TVRA 4M3WA 3EE8A 3UKUB 2EX3A 3CI5A 1GLDG 1IBLK 5LJWA 4L3QA 4DQPA 2F4VK 3MXIA 2D4WA 2YNIA 3LPTA 4CJ5A 4C8LA 2AJQA 1WNSA 3ULEB 3THXA 5AQWA 4KREA 5KQDA 1ZBFA 3M8RA 4F8RA 3DLKA 2QXLA 2HNDA 4WFNL 4CHOA 4CZGA 3IDHA 2H3GX 4A62A 4HHTA 3SMPA 1N6QA 4FZXC 1D4XA 4FJHA 4YY3K 5J2NA 2NRVA 3RWUA 1NK0A 4B9SA 4LD0A 3WQTA 3C0BA 2A41A 3H1QA 1JLCA 4DV3K 1N5YA 1N34K 3OYNA 3U9DA 4O8KA 3CCJN 4FW2A 3EKSA 3CCRN 4HCCA 4DR4K 1NJWA 3O1BA 3AVGA 1BI4A 2Q1NA 4CJSA 2FSNA 3VMFB 3OHRA 2PFUA 1BOTO 1JL2A 3QICA 5FRMA 3SBGA 5AZJB 3W0LA 1WSIA 1XUPO 2KW4A 1XNQK 3CJBA 5AQPA 3VERA 3CM6A 3AY9A 4H5WA 4HTLA 4DTOA 4K43A 1XHXA 5C15A 4DLEA 4DQRA 3KVGA 4PKGA 4CHPA 3SPZA 2YV0X 2PYJA 1DT9A 3MEDA 3CFRA 1EX4A 3LAKA 3VENA 1TV6A 3RVCA 1JKHA 1N32K 4W5QA 3CC7N 1ATRA 1ZYQA 5KQ8A 1X9SA 3IRXA 1QQNA 2O4GA 3HSTB 3U3YA 1JL1A 2P5OA 3I0RA 1OVYA 2E2NA 1A5VA 3QLHA 4M3TA 4CK2A 3SJHA 2W41A 3CJAA 4FJGA 3ALYA 1VSFA 1IO2A 1TAQA 4FL9A 1NKCA 1QS4A 2FC0A 4ISGA 3VQDA 2OA8A 1MA9B 1L3VA 2HVHA 3THYB 4CGDA 1QQCA 3PO4A 2UXDK 4ILHA 1SV5A 3K9JA 2P51A 4HTUA 4BRMA 4GV9A 1LWCA 3M8QA 4IO9L 3SBTA 1KAZA 2ATQA 4H5RA 3EKUA 3L2QA 5A2QO 3N4PA 3CCLN 3HK2A 3BZKA 4BR2A 4DS4A 3LDOA 1ATNA 1HMVA 4CGIA 5KTQA 3SAGA 4IZ9A 4IEEA 3AVKA 4AILC 1NBWA 2D0CA 2E8AA 5I3UA 3SNNA 1B9FA 4CF0A 2I7PA 3DRPA 1XMQK 3AVNA 5K14A 1FKOA 4O4GA 4HVJA 3VQCA 1T7PA 5AQLA 1HKCA 1A5WA 4FWSA 3ZX2A 1JJ2M 3U6FA 3CERA 3DLLL 1VQLN 3AA3A 5D3GA 2GX9A 1SKSA 4ILJA 1QSSA 4ICLA 3RMAA 1RT1A 3QINA 1C0TA 4ID5A 4N56A 4CD1A 3SQ0A 3KD5E 4J2DA 4YNQA 1ASVA 4CEOA 4CGHA 4KB1A 2A1SA 4N76A 2O8BA 3CJ1A 4KHNA 1HRHA 3SQ4A 4DUYK 3LDLA 1VRTA 1VQMN 4MLEA 4BC3A 4FPBA 4BG9A 1NGEA 2W42A 4BRDA 4WYBA 4CESA 4DV4K 4DTNA 4C8KA 5BN8A 3ASMA 3DMJA 2HNYA 3FZFA 1HQEA 4H5TA 4YOXA 1RT4A 2HOEA 3M1FA 3ZSRA 3T69A 3ULDA 4DTRA 4V19S 2HF3A 4PQUA 1RT3A 5M1NA 1MWMA 1R59O 4DSIA 3OYKA 2O8EB 3THXB 4KRFA 4RTFD 3U8XA 3CQXA 3THWA 4X65K 3F2KA 4IO8A 3CC2N 4JI8K 4LC9B 3H45C 5BRHA 4HCBA 4EFHA 2O8DA 2I5JA 2O8FA 4BE1A 4M7YA 1TGOA 2OPRA 5EY4A 5E41A 4B08A 3NF6A 5BPMA 3L2VA 4EZ6A 3IUCA 3AVLA 3EE9A 1BIZA 1YVUA 4NCBA 3HM8A 3BP8A 4YDUA 4UQGA 3K5NA 3ZSVA 4LF6K 2UXCK 1KFDA 3TSPA 4CF1A 4PWDA 2VGNA 2ETJA 3ZEUA 4B1YB 3VESA 4CFDA 4B1XB 5JLHA 4CHNA 5ADXA 2PAVA 1VQPN 1J54A 1RDAA 4FWNA 3ZETA 5HL7L 1VQ6N 4O5BA 4CGFA 4X62K 1RBTA 1KLMA 1TK8A 1VQNN 3VEZA 1H1VA 3O8MA 5ELZA 3MDQA 2OPQA 4CJ3A 1SZ2A 1QSYA 3NBPA 4DF8A 4FJ5A 4Z4FA 1DKGD 3H3NO 2RPIA 4E7LA 1S1VA 4BY9C 1TK0A 4ID1A 4OJRA 4AHUA 4LF7K 4DV5K 2I7NA 3ZSXA 1BL3A 3KZBA 1LV5A 3RMBA 3HP6A 3VQ9A 1U2VB 3VETA 3P38A 2P9IA 4DV6K 2ASPA 2G8FA 4B3MK 4CZMA 5KGXA 4IBNA 4JKHA 2QM1A 4JEPA 3AVMA 4W5OA 2JGUA 4CJRA 4Y1DA 2XRIA 4M45A 4B9MA 1J6ZA 4A2AA 3EO3A 4DG1A 3KK3A 3SAFA 5LMUK 5F1XA 1NGHA 3MEEA 1TKDA 3J8AA 4QS8A 1N36K 1LW2A 2XY8A 3MX5A 2JLEA 3CJ9A 4N47A 2FSJA 1T44A 2WBNA 5CY4A 2DTUA 1V4SA 1KTQA 2WC9A 4BGBA 4H0VB 3VN5A 3HTVA 2IVNA 5BRDA 5IWAK 3PX4A 3MK6A 4JRPA 4H4OA 4PKIA 2OTJN 4Z4GA 1OVQA 1TUUA 3J7YP 1JCEA 3VGLA 3NVMA 4OKKA 3UKUA 3QBWA 4BQZA 4M3UA 4C8OA 3IFRA 1FXXA 4H03B 3KWIA 1IBKK 4DR5K 3E01A 4GVEA 3K57A 4OX9K 3TAMA 4H5NA 2Z1IA 4E19A 2ZJPL 4HUFA 5KI6A 3KLGA 1REVA 4YFUA 1L3TA 3QNNA 5CR4A 4DV2K 1T03A 3ULEA 4GMJB 3ID6A 3LALA 5JICA 4Z4CA 4ZHRA 4E1MA 5LMNK 4F3TA 4B9QA 1VQON 3P5JA 1WB9A 3CMEN 2FSKA 2D0AA 3JAMO 3L4QA 4E7KA 4CEAA 5C2DA 3MEGA 4XH4A 3DLHA 3RTVA 1FW6A 4NXMK 3G6EN 4WQ4A 4FK0A 4K25A 4PL7A 3U4LA 1NK9A 4CE9A 4KKOA 4IDHA 2YHXA 3DAWA 1RTJA 3OYFA 3TARA 3CJCA 2KLAA 1D8YA 2X6NA 1VAZA 3VEWA 3SUPA 3V6DA 3M3ZA 1S22A 3KKRA 1VHXA 3E9PA 4CZIA 4E0DA 3ATVA 4Z4HA 1NJXA 5AZJA 2ITGA 4KTQA 4KHQA 1C0MA 1WSGA 4CJLA 1SL1A 2P1JA 3N4QA 2RN2A 1JLEA 3SK3A 3D45A 1MU2A 4FLWA 4JKGA 3QIPA 1IKYA 4RW8A 5AQHA 1BU6O 3FR0A 4DU3A 2QW9A 3ZT1A 3DLGA 2O8FB 3DLRA 3WUHA 4NCAA 2HBLA 2QWPA 4FLUA 4JI3K 1Z26A 2GUIA 4BDPA 4FOEA 5BN9A 4YOWA 4E7HA 5CYQA 3VA3A 1KC8O 2R7YA 2Q2RA 3R8EA 1QSLA 3TTDA 5AQJA 4QOZB 3PY8A 4KI4A 3LM9A 3MCPA 1VK0A 1YJNN 3THYA 3E9OA 4JK9A 3HBTA 2IIRA 1YJ9N 3KK7A 5HOOA 5GAEP 1IBMK 4FPAA 1KAXA 4CZLA 1KVCA 4KBOA 4IOCL 2X74A 4E1JA 4CF8A 2O8CB 1QHTA 1RDBA 4BRLA 4Z4IA 4A57A 1E3MA 3AVFA 1EO1A 1RT7A 2XY5A 4BE0A 1XC3A 1S72N 4BGAA 3O4QA 4JN4A 5F2RA 1GLEG 5BR9A 1WSJA 3VTIA 4CJKA 2G8HA 1ZC6A 3A5NC 4DKWA 4MO5A 1QZ6A 3VQ6A 5LJVA 1W97L 1U48A 4GY2B 4FSVA 1K9MO 5DK5A 3QIOA 1S5JA 5AQTA 5AQMA 4FXDA 4OPKA 4BRIA 4RG8A 4UY8O 1S9EA 3FZMA 3MWTA 3ZSQA 1BISA 3UIQA 4GV6A 4KTZA 1Q9YA 4O44A 4BC2A 4CZFA 2JWLA 1K8KB 4KAZA 3MXJA 1NG9A 4KFBA 4DQQA 1E4GT 1S3XA 2V7ZA 2KFNA 1RBVA 3HPGA 1WUAA 2WUSA 3U3GA 2HHWA 3SUQA 5HRSA 3VGMA 4ILGB 3DM2A 4CK3A 4LFBK 2HBJA 3CCEN 1BIUA 3VQEA 1U47A 5AQGA 3KLFA 1QVFM 1YI2N 2QKBA 4U67L 5GAHP 5JS1A 4A5AA 3QERA 1N33K 3LDSA 1TKTA 1ATSA 1V4TA 4NO7A 1KSPA 2QK9A 4FO0A 4Q0BA 4DR2K 3EL2A 4CJFA 3OYCA 2OANA 3TSUA 3CCVN 2P9KA 1TKZA 5KRTA 3WT0A 2IDOA 3F5TA 3B8AX 3V9SA 3LP3A 4MLHA 5EX5A 4O0JA 4BC4A 4CFBA 3R9PA 3DXMB 3SUNA 3V1QA 2O8EA 4FW1A 1DGKN 2ZQBA 4IFEA 3JYTA 3CETA 3TANA 1BA0A 2XO7A 2PY5A 4O0IA 5M1QA 3ZSYA 4HUGA 3HZ6A 1RNHA 2F9TA 2OYQA 2ASMA 3ZX0A 4HWIA 1MDUB 1LWFA 2IS3A 3DYAA 4H0XB 1YJWN 3QETA 2D1KA 3DLBA 1ZBUA 1I94K 4IOAL 1ITGA 4FJLA 3I8DA 2B4JA 4JHDB 4FM2A 2HHSA 3CFOA 4K0KK 3DJCA 1T6DA 4B1UB 3GBTA 4C8MA 1D9FA 3ITHA 4CF9A 3ZSZA 1J5OA 1BWFO 2G8WA 5C0YA 3KLHA 2E1ZA 2HNZA 1O1WA 2BDPA 4FWOA 2VWJA 3CF5L 4I2QA 3L2WA 1NGCA 4FLYA 3GDQA 2HHXA 2D0OA 3OA9A 3TSQA 5CHIA 3R6MA 4JKGB 1UA1A 5JVHL 3CD6N 3LP0A 1NK7A 4N5SA 4FVUA 3H46O 5BR8K 3CIPA 2DFFA 1HUXA 2X78A 2G8UA 4IKFA 3SV4A 3BF1A 2ZJRL 1T8EA 3AVCA 4JI4K 3VQBA 3SYZA 2YJEA 4HUEA 1GOCA 4YOYA 3PV8A 4IG3A 1U2VA 4YORA 3T19A 1KD1O 3QEVA 4FLXA 1TL3A 4NCGA 1B92A 4EP5A 1VSHA 1LAWA 4CZJA 3KKSA 4CHZA 2QWOA 1R0AA 4DV0K 2GELA 4DHYA 4H8KA 3VQ7A 1JLBA 5EOYA 2QKKA 3J81O 3WNGA 1NGIA 4KHUA 3R3LA 2QWQA 3QESA 5JVGL 1JLFA 2QWMA 3RMDA 4ZTFA 1NKEA 5C42A 3VPZA 4JI0K 4CGJA 4JK8A 1RCHA 1SAZA 3U9ZA 4F4KA 5AQZA 1Z25A 4BWMA 4AHSA 2HHQA 2GWJA 1IKWA 2ZGYA 2A6AA 3S3NA 1TYQB 3A0IX 2V7YA 3B6PA 4DTSA 4JI7K 3MN5A 3WNFA 4I6MB 2IGIA 2Q3SA 3OTOK 1HLUA 3CCMN 1VQ7N 1NGFA 2JWKA 1HKGA 3V1OA 4AQYK 3L3UA 3NGIA 2AA4A 3PO5A 4OPAA 1C1BA 3L3VA 1EWQA 1S6QA 4CF2A 1HNVA 5AR0A 4BDZA 3TI0A 5B8HA 1C1AA 3RSEB 4X64K 1IH7A 4DWIA 4I9QA 1X9MA 3VEYA 1RBRA 4KPYA 1NMDA 5AQUA 1LCUA 2QXFA 4GKJK 3O80A 3C6UA 4BRCA 4KH6A 4WQ5A 3Q7CA 2BGGA 5JMVA 1YF5L 3CCUN 3O3FA 4DUZK 4CEQA 3QEPA 4C23A 4B9VA 5AQYA 3L0QA 3UKRB 1WSHA 1C1CA 4LY7A 5SWMA 4OLBA 4CZHA 4B3SK 1CXUA 3MWPA 2HHHK 4CVNE 1S9GA 3K0SA 3OYBA 5AQIA 1VQ9N 1HNZK 4CEZA 3V4IA 3OYIA 3PSIA 1SUQA 3WXIA 2ASOA 2KQ2A 4DFJA 2FXUA 4KH5A 3QDKA 1YIJN 3UE5A 1DTTA 4R5PA 2P9KB 3RRHA 1YITN 4JAXA 4RCHA 3FE1A 2YI1A 1ILYA 1ESVA 1Q8IA 3A2FA 5I9EB 1MWKA 3K58A 3CG7A 4PUOA 2Q0RA 1X3NA 3D0PA 4AF1A 1I39A 4PY5A 4YOUA 4KB0A 1K8AO 1NLVA 1WLJA 2X6SA 2WFBA 4FLZA 4M42A 1TKXA 3LDPA 3NF9A 3PUFA 5AFUH 1WSEA 2D5RA 3AVIA 1S1XA 4C8NA 3EEQA 4AH9A 3TABA 1VSKA 2FF3B 4DTJA 4JI1K 1JCFA 3OS1A 3ZSWA 3QEWA 1NK8A 4FK4A 4LFAK 2DY4A 3S41A 5FDLA 3FFIA 1HNIA 5GIOA 3TWHA 3CPWM 3SZ2A 4YOVA 5J2MA 3LZJA 2O8CA 1NGBA 3KD1E 3S3OA 4LH5A 3ENHA 5M1FA 3PIOL 1KAYA 3VQPA 4CIFA 2YNFA 3BY5A 1FJGK 4M3XA 2P9UB 1NJYA 3O5BA 1JXEA 4JS4A 4CJEA 4EIAA 4G9ZA 1VSJA 4BR7A 3SCXA 3WXJA 4OO1J 3PX6A 2YJFA 3O9UA 3HXMA 4EAHD 2Z1HA 4E1NA 5EVZA 5AQKA 3L2RA 3PIPL 5CZ1A 4PKHA 5KPTA 5HBMA 2OPSA 3IG1A 2VQFK 2V52B 5E84A 4Z94A 3CXCM 2P5GA 3MAQA 4BRGA 1K8KA 1U49A 4X66K 2OCEA 3AA4A 4AHVA 4LF5K 1J5EK 5J1EA 3K5OA 3NF8A 3BUZB 3LDNA 4OGEA 3NVKA 2UUAK 4FWMA 4NYNA 4BRKA 2XY6A 3OYHA 1KRPA 3VOVA 4ZTJA 4OKEA 5GIPA 1L3UA 1TUYA 4K8XA 1C0UA 4IG0A 1DEJA 3HPOA 2PBDA 3C7NB 4DR7K 3DXKA 1NJIO 5C12A 2NLXA 4BDYA 1QVGM 3E1YA 4FJ7A 2D0PA 5GINA 4OPHA 2NZTA 4CGGA 1VQ5N 4CJUA 3ZSOA 3K5MA 1WOQA 2ZE2A 1JLAA 3O4WA 3DXMA 2KZMA 4RWTA 2CGKA 4GVMA 1VSMA 5HRNA 4H4MA 4O8UA 3PLAA 1RDWX 4CJQA 1NWKA 4QS9A 2ZD1A 3V9XA 4EP4A 1C0GA 1CLQA 3M8SA 4B9LA 4AHTA 3DRSA 4FJIA 4DQ8A 1JLQA 4Y0WA 3AVBA 4JI6K 4FM0A 2E4LA 3WEEB 3FFKB 4JHDA 4BREA 4FJ9A 2Y1JA 1NGAA 4CEEA 3OYLA 5E26A 4BWJA 1HX1A 3GOIA 2HHTA 1VSIA 4QAGA 1EQYA 2GEMA 3G10A 3H1VX 3VF6A 4B9NA 3V9ZA 2YX6A 1HKBA 3TTCA 2QEXN 2UXBK 1X1PA 5KGWA 4XH5A 3LP1A 4Q5VA 1ASUA 4BR4A 2YHWA 4IEIA 2NRWA 1WBBA 3J7ZO 3OW2M 3IAYA 1VRUA 3AVAA 1Q81O 4BRPA 2A42A 2P9NA 4DQSA 3SQ1A 3DWLA 2E88A 2HW3A 3MN6A 2Q0UA 4DLGA 4MDAA 2Z1JA 3L8BA 1IV0A 3C65A 4DTUA 1D5AA 2E6LA 2A3ZA 3TTFA 4CIGA 1GLAG 2F96A 1DLOA 2YCHA 2E2QA 1RGIA 3SQ2A 4PHTX 3LANA 2QWRA 1YHQN 3JS6A 2QWNA 4KV8A 4J8FA 3LL3A 3RMCA 1NMNA 1SS6A 4W5TA 2E1YA 2VG5A 4CBWA 4B8CA 4DU1A 1UAXA 1W7AA 1NK6A 4KHSA 3K9KA 3I56N 4BRAA 1HNXK 1OH8A 5C2FA 3SUOA 3LWMA 4OGCA 4KO0A 2WOMA 2NRZA 4F2RA 4J2BA 2BUPA 5CYMA 1NOZA 4JLHA 3OJUA 3NH0A 1TYQA 2FBXA 3NH1A 4CJ4A 3KJVA 4LF4K 4I6MA 3BGRA 4G1QA 3QEIA 2PZSA 4H5VA 1KXPA 4O5FA 2IVOA 3O9TA 5J2QA 4R79A 4C1NI 4DV7K 3AO4A 1ZBSA 4IFVA 1BGXT 3RSEA 4DSFA 3VTHA 5AQSA 3HYFA 3VGKA 2G8VA 3QMLA 4KI6A 2HF4A 3DOLA 5AZIB 4DB3A 3RR7A 3T7ZA 3CM5A 5LY3A 2F9WA 3TAFA 1X9JA 2OZSA 4CHYA 5IT9O 3UKRA 3DI6A 1T3VA 2VG7A 3K2PA 1T6CA 4CHQA 4B1ZA 4FZZA 4B3OA 2HVIA 3I0SA 5BRFA 1CXQA 1GOAA 3AVHA 2ZF5O 1GLLO 3D6RA 4CERA 4EHTA 1NKBA 5BREA 1Q18A 1EWRA 3B6OA 5AQXA 3DXKB 1T05A 2OZMA 1SKRA 1FKPA 3TU5A 1KVBA 4LSLA 1TAUA 3P4IA 3L2UA 2GV9A 4DSKA 3TR8A 5AQFA 1HQUA 4Z4EA 3OVNA 4N41A 1NOYA 3RR8A 4DFKA 1YXQA 3OBWA 3P31A 3LM2A 1CZ9A 3QFPA 5CZ2A 5MLCQ 1NK4A 2Q31A 1P90A 4TSXA 5ADXH 3ENBA 1VQ4N 2BE2A 5TKWA 4JD2B 3AV9A 4FWLA 1G99A 4GKKK 1IKVA 1S1WA 1XHZA 2ITMA 3D2EB 3K5LA 3SV3A 3E9LA 1U45A 2J4RA 3LPUA 1RT5A 1BCMA 1J9AA 4M63C 3P83D 1NGDA 3FZHA 4OKJA 3HSCA 4DU4A 3C6TA 1NGGA 1VSDA 5AQRA 1ZBLA 4QCLA 1NJZA 3O08A 1RDDA 5TKYA 3TAPA 3WNHA 3IS9A 3KLIA 4EZ9A 2YKMA 1FK9A 1J53A 2BTFA 3MMVA 3KK1A 1EKEA 2YKNA 3LWLA 3MX2A 3TAEA 2UYTA 4ISEA 2KFZA 2B5JA 3WXKA 1OKJA 4I7FA 1IJJA 3O9RA 4CEBA 3M5RA 2P9UA 5M1KA 3QO9A 4K41A 1QQOA 2XY7A 1W9HA 4JK7A 1BHLA 2DPNA 1ZBIA 2OTLN 4A2BA
chains in the Genus database with same CATH topology
3K58A 1X9WA 4DQIA 3CG7A 3E01A 3NGYA 4M41A 2Y1IA 1L3SA 1WAFA 3OYGA 3K57A 4PUOA 3TAMA 2F8TA 4W5RA 4ELVA 2Z1IA 5HRRA 4E19A 1DTQA 2DFHA 3D0PA 4HUFA 3EZ5A 5KI6A 3KLGA 1I39A 1REVA 4PY5A 3NCIA 2KZZA 4YFUA 1L3TA 3QNNA 2HHVA 4KB0A 4FCYA 2A1RA 1T03A 3VQAA 3OYDA 4GMJB 1WLJA 4OVLA 3LALA 2X6SA 3O3HA 1RTDA 4FLZA 4M42A 4Z4CA 4ZHRA 1TKXA 4M3ZA 4E1MA 4F3TA 4CFAA 3AO3A 3P5JA 3V81A 4AHCA 3NE6A 3NF9A 3PUFA 4RW9A 1GOBA 2D0AA 1RBUA 1WSEA 2D5RA 3AA5X 3ZT3A 3OJSA 4CEFA 3AVIA 4E7KA 1B9DA 4LSNA 3VA0A 4CEAA 1IG9A 1S1XA 4C8NA 5HP1A 3MEGA 2IOCA 4RW7A 4AH9A 3RTVA 3TAGA 3TABA 3NDKA 1VSKA 3DLHA 4DTJA 1W0HA 1YTUA 2YNGA 4CIEA 3OS1A 4FK0A 3ZSWA 3QEWA 1NK8A 4FK4A 4GW6A 3NGZA 1NK9A 2HHUA 4CE9A 4KKOA 2DY4A 1RT6A 5FDLA 3FFIA 1RTJA 3OYFA 3TARA 1HYVA 1LW0A 1ASWA 4AHRA 3V9WA 1HNIA 1JLGA 3TWHA 1UOCA 1D8YA 2X6NA 4FLVA 3SZ2A 5J2MA 2EHGA 3LZJA 3SUPA 1F21A 2BANA 4KTWA 3F73A 1XC9A 2PYLA 3KD1E 4F2SA 3VQ4A 3V6DA 1JXBA 3S3OA 1LAVA 3AO1A 4LH5A 3THVA 3KKRA 5FROA 1NK5A 3VQPA 1Q9XA 4CIFA 1HJRA 4E0DA 3C95A 2YNFA 3HP9A 4Z4HA 3AO2A 4M3XA 1NJXA 1S6PA 2ITGA 5HRPA 3SI6A 1JXEA 4JS4A 1NJYA 1C0MA 4CJEA 4KTQA 4KHQA 2KTQA 4MFBA 1WSGA 3F9KA 4CJLA 1SL1A 1VSJA 5FRNA 2P1JA 4FK2A 1TVRA 2RN2A 3SCXA 1JLEA 4M3WA 4RW6A 2EX3A 3D45A 4FVMA 4KAZA 3PX6A 1MU2A 4FLWA 3MXMA 2D0BA 3QIPA 3HXMA 2Z1HA 1IKYA 2FBVA 4E1NA 4RW8A 4IFYA 3L2RA 2IC3A 4DQPA 3MXIA 5CZ1A 4OPJA 2YNIA 3LPTA 4CJ5A 4DU3A 4C8LA 3ZT1A 2AJQA 3DLGA 5HBMA 1WNSA 2OPSA 3DLRA 3IG1A 1ZBHA 4NCAA 4FLUA 4KREA 3C94A 1Z26A 1ZBFA 2GUIA 3M8RA 3EY1A 4BDPA 4F8RA 2P5GA 3DLKA 3MAQA 2BGGA 2HNDA 4DTMA 4CHOA 1U49A 4E7HA 3AA4A 4AHVA 1K6YA 4HHTA 1N6QA 4FZXC 5CYQA 3NFAA 4KPYA 4FJHA 3VA3A 3CYMA 3S3MA 5J2NA 5J1EA 2R7YA 3K5OA 1QSLA 3NF8A 4DTPA 1NK0A 4B9SA 3RWUA 4LD0A 4QOZB 1RT2A 4OGEA 1RTIA 1VSEA 3PY8A 4NYNA 5DMRA 4CJWA 4KI4A 1WAJA 1VK0A 1Y97A 2XY6A 3OYHA 1JLCA 2DFEA 1KRPA 3EYZA 4ZTJA 1QTMA 2YNHA 4OKEA 1N5YA 3ZT0A 3T3FA 4J2EA 3OYNA 1L3UA 4K8XA 1KVCA 4FW2A 1D9DA 2X74A 1C0UA 4IG0A 3OYAA 3VQQA 1YTAA 4CF8A 3OYJA 1QHTA 1RDBA 3HPOA 1UA0A 1NJWA 4HCCA 4Z4IA 3AVGA 3HT3A 1BI4A 4CJSA 4CJVA 3AVFA 4BDYA 4CJPA 1RT7A 3QEXA 2XY5A 1JL2A 5FRMA 4FJ7A 3WNEA 1WSIA 4BE0A 2KW4A 4CGGA 3CM6A 3O4QA 4CJUA 4DTOA 3ZSOA 2LSNA 3K5MA 1WSJA 1XHXA 4CJKA 4DLEA 1WSFA 4DQRA 4CHPA 4DSEA 2G8HA 3SPZA 1SL0A 2YV0X 2PYJA 2ZE2A 3VQ6A 3MEDA 1JLAA 1U48A 5DK5A 3QIOA 3AO5A 1S5JA 3LZIA 4FXDA 3CFRA 4OPKA 4B9UA 4GVMA 2KZMA 1I3AA 4Y1CA 1VSMA 5HRNA 1EX4A 4H4MA 3LAKA 4RG8A 4ELUA 1S9EA 1SKWA 1TV6A 4CJQA 4FLTA 3ZSQA 1JKHA 2ZD1A 4W5QA 1BISA 3UIQA 3V9XA 4LH4A 2WONA 4KTZA 3AA2A 1TK5A 4EP4A 4CCHA 1ZYQA 2YHBA 1Q9YA 3LAMA 1CLQA 3P1GA 4O44A 3S9HA 1CZBA 1X9SA 3M8SA 3IRXA 3SJJA 4AHTA 3DRSA 2O4GA 3HSTB 3HVTA 3MXJA 1JL1A 1JLQA 4KFBA 3U3YA 1WN7A 3I0RA 3QLHA 2P5OA 1A5VA 2G8KA 3AVBA 4CK2A 4M3TA 4FM0A 2E4LA 4FJGA 3ALYA 1RBSA 1VSFA 4DQQA 1IO2A 1TAQA 4FJ9A 2KFNA 1RBVA 2Y1JA 1NKCA 1QS4A 2FC0A 3HPGA 3U3GA 2HHWA 4CEEA 3OYLA 4BWJA 3VQDA 4JS5A 3SUQA 5HRSA 2OA8A 2B6AA 1L3VA 2HVHA 3DM2A 4CGDA 1QQCA 4CK3A 3PO4A 2HHTA 1VSIA 4QAGA 1HYSA 1SV5A 2P51A 4I2PA 4HTUA 2VG6A 1BIUA 3CFPA 4RW4A 3VQEA 1LWCA 1U47A 3G10A 4K8ZA 3KLFA 2QKBA 4FJIA 4MQ3A 3M8QA 4B9NA 2FBYA 1VSLA 3DLEA 2ATQA 3V9ZA 3QERA 5JS1A 4CEDA 3V9UA 1BI4B 3L2QA 3LDSA 1TKTA 1X1PA 5KGWA 3LP1A 4Q5VA 1ASUA 3HK2A 3OS0A 4DS4A 1U04A 1KSPA 2QK9A 4Q0BA 4CJFA 3OYCA 1HMVA 4CGIA 5KTQA 4E7IA 1TKZA 4CFCA 5KRTA 2IDOA 1G15A 3AVKA 3V9SA 3LP3A 4AILC 4O0JA 4DTXA 2D0CA 2XHBA 4NYFA 5HROA 3IAYA 1VRUA 3AVAA 5C24A 3ZT4A 5I3UA 4CFBA 4WE1A 3SNNA 1B9FA 4FJXA 3HPHA 3SUNA 3V1QA 4DQSA 4CF0A 3OY9A 3DRPA 4FW1A 3SQ1A 3AVNA 2HW3A 5K14A 4DLGA 1FKOA 2ZQBA 3LP2A 4O4GA 3VQCA 4HVJA 3JYTA 3TANA 2Z1JA 3L8BA 1T7PA 2XO7A 3HL8A 2PY5A 4O0IA 3T1AA 3ZSYA 1A5WA 4HUGA 4DTUA 1D5AA 3ZCMA 2E6LA 1RNHA 4KHYA 1RTHA 3U6FA 2OYQA 4DFMA 4CIGA 3AA3A 5D3GA 2OPPA 1SKSA 4W5NA 1LWEA 2F96A 1DLOA 1LWFA 2IS3A 3DYAA 3SQ2A 1QSSA 3QETA 4ICLA 3RMAA 3DOKA 1RT1A 3LANA 3DLBA 1ZBUA 3QINA 1ITGA 3NHGA 4FJLA 1BQMA 3I8DA 4KV8A 3TAQA 1C0TA 4ID5A 1KLNA 2B4JA 4FM2A 3RMCA 4N56A 4W5TA 2HHSA 1BQNA 2VG5A 4B8CA 4DU1A 3SQ0A 3CFOA 3KD5E 4J2DA 3H08A 2E6MA 4YNQA 1UAXA 1ASVA 1EXQA 4BE2A 4CEOA 1L5UA 4CGHA 3NH2A 2A1SA 3VQ5A 4KB1A 1NK6A 5HLFA 4N76A 4KHSA 4C8MA 1D9FA 3ITHA 4KHNA 4CF9A 3ZSZA 3O3GA 1HRHA 3SQ4A 1J5OA 2G8WA 1VRTA 4Z0UA 3KLHA 3SUOA 4CK1A 3LWMA 4OGCA 2W42A 2HNZA 2WOMA 1O1WA 4KO0A 4F2RA 2HB5A 4J2BA 4CESA 5SZTA 2BDPA 5CYMA 1NOZA 4JLHA 1HPZA 3OJUA 2VWJA 3NH0A 4I2QA 3L2WA 2FBXA 3NH1A 1C6VA 4IDKA 3OS2A 3KK2A 4DTNA 4FLYA 2HHXA 4C8KA 4CJ4A 1S1TA 5J2PA 4FJKA 3ASMA 3DMJA 2HNYA 3KJVA 3G0ZA 1HQEA 4DMNA 1RT4A 1RDCA 3BGRA 1XWLA 2YHAA 1UA1A 3LP0A 3OYEA 4DS5A 4G1QA 3ZSRA 4N5SA 1NK7A 4FJ8A 3ULDA 3QEIA 2PZSA 4DTRA 2DFFA 2X78A 2G8IA 4PQUA 2G8UA 4IKFA 1UWBA 3SV4A 1RT3A 4CECA 1T8EA 3AVCA 5J2QA 3VQBA 4DSIA 3OYKA 3SYZA 1HYZA 4HUEA 4KRFA 1GOCA 2IAJA 3AO4A 3PV8A 4IFVA 4IG3A 2O4IA 5EU7A 1BGXT 4BACA 3T19A 4DSFA 3QEVA 4FLXA 1TL3A 3HYFA 4NCGA 1B92A 4HCBA 4EP5A 2I5JA 4M3YA 1VSHA 1LAWA 4XIUA 4BE1A 4KI6A 2G8VA 3KKSA 4CHZA 3RRGA 3DOLA 1TGOA 1R0AA 2OPRA 3RR7A 5E41A 3PX0A 4H8KA 3CM5A 3HO1A 4B08A 3VQ7A 1JLBA 3NF6A 5KRSA 3L2VA 4EZ6A 3AVLA 3TAFA 1BIZA 1TL1A 1YVUA 2QKKA 3WNGA 2OZSA 4CHYA 4NCBA 4KHUA 3DI6A 4UQGA 2GBZA 3K5NA 2VG7A 3ZSVA 3K2PA 3QESA 4CHQA 1KFSA 4FZZA 5JS2A 4B3OA 1KFDA 2HVIA 4CF1A 4PWDA 3I0SA 1JLFA 2ETJA 1CXQA 1GOAA 4CFDA 3RMDA 3AVHA 4ZTFA 4CHNA 4CERA 1NKEA 5C42A 1NKBA 3HJFA 1EP4A 4CGJA 3B6OA 3KLEA 1T05A 1RCHA 1J54A 1FKPA 1RDAA 1SKRA 2OZMA 3HM9A 2VWKA 4F4KA 4OLAA 1KCFA 1EETA 1KVBA 4LSLA 4O5BA 1Z25A 4BWMA 4CGFA 1TAUA 1RBTA 3L2UA 1KLMA 1IKXA 1A5XA 4AHSA 1TK8A 1IKWA 4DSLA 2GV9A 2HHQA 3S3NA 4DSKA 4E89A 3AVJA 3TR8A 4KHWA 1HQUA 4Z4EA 3OVNA 1QE1A 4N41A 1NOYA 3B6PA 3ISNC 4DTSA 2OPQA 2F8SA 4CJ3A 4B9LA 3RR8A 4FZYA 3WNFA 2RF2A 3VQ8A 3ZT2A 4DFKA 1QSYA 2IGIA 3NBPA 4DF8A 4FJ5A 1CZ9A 2Q3SA 5CZ2A 1NK4A 4Z4FA 4FM1A 1YT3A 2RPIA 3V1OA 4TSXA 4E7LA 4L8RB 1BCOA 3L3UA 4F3OA 1S1VA 3NGIA 1TK0A 4ID1A 4OJRA 3PO5A 3JSMA 2BE2A 4AHUA 3CQ8A 2RKIA 1C1BA 3L3VA 3ZSXA 3BDPA 1S6QA 3AV9A 4CF2A 4M3RA 1HNVA 1IKVA 1BL3A 1S1WA 1XHZA 1LV5A 3KIOA 3RMBA 3HP6A 3VQ9A 3K5LA 4BDZA 3KTQA 3SV3A 3TI0A 3OYMA 3O4NA 1U45A 1C1AA 3LPUA 1RT5A 1BCMA 1J9AA 1IH7A 1X9MA 2G8FA 1RBRA 3P83D 4DWIA 4I9QA 3K59A 2QXFA 5KGXA 4IBNA 3C6UA 4OKJA 4CJTA 4DU4A 3C6TA 3AVMA 1VSDA 4JRQA 4W5OA 4ELTA 4B9TA 2JGUA 4CJRA 4Y1DA 1ZBLA 4DSJA 3QNOA 2XRIA 4M45A 4FYDA 4QCLA 3O3FA 4CEQA 4B9MA 1NJZA 3QEPA 4DG1A 3KK3A 4B9VA 4PA1A 1RDDA 3HVRA 3TAPA 2FBTA 3WNHA 3IS9A 4DF4A 4FJJA 2Z1GA 3KLIA 1WSHA 3M8PA 1C1CA 3MEEA 4LY7A 2YKMA 5SWMA 1FK9A 1J53A 1TKDA 4EZ9A 4OLBA 1CXUA 1LW2A 1S9GA 2XY8A 4FJNA 3OYBA 5T7BA 3KK1A 2JLEA 1EKEA 2YKNA 4I9LA 4N47A 3LWLA 3TAEA 3SPYA 2NUBA 4E7JA 1XI1A 3NAEA 2KFZA 4CEZA 2B5JA 3V4IA 3OYIA 5CY4A 4I7FA 1SUQA 2DTUA 4FJMA 1KTQA 4CEBA 2KQ2A 3V1RA 5I42A 3VN5A 2HMIA 4DFJA 3PX4A 1S1UA 1DTTA 4O55A 4R5PA 3QO9A 4JRPA 4H4OA 2XY7A 4Z4GA 3RRHA 1W9HA 4B8AB 5C25A 1BHLA 1SL2A 1RILA 1KVAA 3MECA 4OKKA 4DFPA 1U4BA 4J2AA 1ZBIA 1Q8IA 3A2FA 3NF7A 3DRRA 4M3UA 4C8OA 4E3SA 1FXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K58 A;  1X9W A;  4DQI A;  3CG7 A;  3E01 A;  3NGY A;  4M41 A;  2Y1I A;  1L3S A;  1WAF A;  3OYG A;  3K57 A;  4PUO A;  3TAM A;  2F8T A;  4W5R A;  4ELV A;  2Z1I A;  5HRR A;  4E19 A;  1DTQ A;  2DFH A;  3D0P A;  4HUF A;  3EZ5 A;  5KI6 A;  3KLG A;  1I39 A;  1REV A;  4PY5 A;  3NCI A;  2KZZ A;  4YFU A;  1L3T A;  3QNN A;  2HHV A;  4KB0 A;  4FCY A;  2A1R A;  1T03 A;  3VQA A;  3OYD A;  4GMJ B;  1WLJ A;  4OVL A;  3LAL A;  2X6S A;  3O3H A;  1RTD A;  4FLZ A;  4M42 A;  4Z4C A;  4ZHR A;  1TKX A;  4M3Z A;  4E1M A;  4F3T A;  4CFA A;  3AO3 A;  3P5J A;  3V81 A;  4AHC A;  3NE6 A;  3NF9 A;  3PUF A;  4RW9 A;  1GOB A;  2D0A A;  1RBU A;  1WSE A;  2D5R A;  3AA5 X;  3ZT3 A;  3OJS A;  4CEF A;  3AVI A;  4E7K A;  1B9D A;  4LSN A;  3VA0 A;  4CEA A;  1IG9 A;  1S1X A;  4C8N A;  5HP1 A;  3MEG A;  2IOC A;  4RW7 A;  4AH9 A;  3RTV A;  3TAG A;  3TAB A;  3NDK A;  1VSK A;  3DLH A;  4DTJ A;  1W0H A;  1YTU A;  2YNG A;  4CIE A;  3OS1 A;  4FK0 A;  3ZSW A;  3QEW A;  1NK8 A;  4FK4 A;  4GW6 A;  3NGZ A;  1NK9 A;  2HHU A;  4CE9 A;  4KKO A;  2DY4 A;  1RT6 A;  5FDL A;  3FFI A;  1RTJ A;  3OYF A;  3TAR A;  1HYV A;  1LW0 A;  1ASW A;  4AHR A;  3V9W A;  1HNI A;  1JLG A;  3TWH A;  1UOC A;  1D8Y A;  2X6N A;  4FLV A;  3SZ2 A;  5J2M A;  2EHG A;  3LZJ A;  3SUP A;  1F21 A;  2BAN A;  4KTW A;  3F73 A;  1XC9 A;  2PYL A;  3KD1 E;  4F2S A;  3VQ4 A;  3V6D A;  1JXB A;  3S3O A;  1LAV A;  3AO1 A;  4LH5 A;  3THV A;  3KKR A;  5FRO A;  1NK5 A;  3VQP A;  1Q9X A;  4CIF A;  1HJR A;  4E0D A;  3C95 A;  2YNF A;  3HP9 A;  4Z4H A;  3AO2 A;  4M3X A;  1NJX A;  1S6P A;  2ITG A;  5HRP A;  3SI6 A;  1JXE A;  4JS4 A;  1NJY A;  1C0M A;  4CJE A;  4KTQ A;  4KHQ A;  2KTQ A;  4MFB A;  1WSG A;  3F9K A;  4CJL A;  1SL1 A;  1VSJ A;  5FRN A;  2P1J A;  4FK2 A;  1TVR A;  2RN2 A;  3SCX A;  1JLE A;  4M3W A;  4RW6 A;  2EX3 A;  3D45 A;  4FVM A;  4KAZ A;  3PX6 A;  1MU2 A;  4FLW A;  3MXM A;  2D0B A;  3QIP A;  3HXM A;  2Z1H A;  1IKY A;  2FBV A;  4E1N A;  4RW8 A;  4IFY A;  3L2R A;  2IC3 A;  4DQP A;  3MXI A;  5CZ1 A;  4OPJ A;  2YNI A;  3LPT A;  4CJ5 A;  4DU3 A;  4C8L A;  3ZT1 A;  2AJQ A;  3DLG A;  5HBM A;  1WNS A;  2OPS A;  3DLR A;  3IG1 A;  1ZBH A;  4NCA A;  4FLU A;  4KRE A;  3C94 A;  1Z26 A;  1ZBF A;  2GUI A;  3M8R A;  3EY1 A;  4BDP A;  4F8R A;  2P5G A;  3DLK A;  3MAQ A;  2BGG A;  2HND A;  4DTM A;  4CHO A;  1U49 A;  4E7H A;  3AA4 A;  4AHV A;  1K6Y A;  4HHT A;  1N6Q A;  4FZX C;  5CYQ A;  3NFA A;  4KPY A;  4FJH A;  3VA3 A;  3CYM A;  3S3M A;  5J2N A;  5J1E A;  2R7Y A;  3K5O A;  1QSL A;  3NF8 A;  4DTP A;  1NK0 A;  4B9S A;  3RWU A;  4LD0 A;  4QOZ B;  1RT2 A;  4OGE A;  1RTI A;  1VSE A;  3PY8 A;  4NYN A;  5DMR A;  4CJW A;  4KI4 A;  1WAJ A;  1VK0 A;  1Y97 A;  2XY6 A;  3OYH A;  1JLC A;  2DFE A;  1KRP A;  3EYZ A;  4ZTJ A;  1QTM A;  2YNH A;  4OKE A;  1N5Y A;  3ZT0 A;  3T3F A;  4J2E A;  3OYN A;  1L3U A;  4K8X A;  1KVC A;  4FW2 A;  1D9D A;  2X74 A;  1C0U A;  4IG0 A;  3OYA A;  3VQQ A;  1YTA A;  4CF8 A;  3OYJ A;  1QHT A;  1RDB A;  3HPO A;  1UA0 A;  1NJW A;  4HCC A;  4Z4I A;  3AVG A;  3HT3 A;  1BI4 A;  4CJS A;  4CJV A;  3AVF A;  4BDY A;  4CJP A;  1RT7 A;  3QEX A;  2XY5 A;  1JL2 A;  5FRM A;  4FJ7 A;  3WNE A;  1WSI A;  4BE0 A;  2KW4 A;  4CGG A;  3CM6 A;  3O4Q A;  4CJU A;  4DTO A;  3ZSO A;  2LSN A;  3K5M A;  1WSJ A;  1XHX A;  4CJK A;  4DLE A;  1WSF A;  4DQR A;  4CHP A;  4DSE A;  2G8H A;  3SPZ A;  1SL0 A;  2YV0 X;  2PYJ A;  2ZE2 A;  3VQ6 A;  3MED A;  1JLA A;  1U48 A;  5DK5 A;  3QIO A;  3AO5 A;  1S5J A;  3LZI A;  4FXD A;  3CFR A;  4OPK A;  4B9U A;  4GVM A;  2KZM A;  1I3A A;  4Y1C A;  1VSM A;  5HRN A;  1EX4 A;  4H4M A;  3LAK A;  4RG8 A;  4ELU A;  1S9E A;  1SKW A;  1TV6 A;  4CJQ A;  4FLT A;  3ZSQ A;  1JKH A;  2ZD1 A;  4W5Q A;  1BIS A;  3UIQ A;  3V9X A;  4LH4 A;  2WON A;  4KTZ A;  3AA2 A;  1TK5 A;  4EP4 A;  4CCH A;  1ZYQ A;  2YHB A;  1Q9Y A;  3LAM A;  1CLQ A;  3P1G A;  4O44 A;  3S9H A;  1CZB A;  1X9S A;  3M8S A;  3IRX A;  3SJJ A;  4AHT A;  3DRS A;  2O4G A;  3HST B;  3HVT A;  3MXJ A;  1JL1 A;  1JLQ A;  4KFB A;  3U3Y A;  1WN7 A;  3I0R A;  3QLH A;  2P5O A;  1A5V A;  2G8K A;  3AVB A;  4CK2 A;  4M3T A;  4FM0 A;  2E4L A;  4FJG A;  3ALY A;  1RBS A;  1VSF A;  4DQQ A;  1IO2 A;  1TAQ A;  4FJ9 A;  2KFN A;  1RBV A;  2Y1J A;  1NKC A;  1QS4 A;  2FC0 A;  3HPG A;  3U3G A;  2HHW A;  4CEE A;  3OYL A;  4BWJ A;  3VQD A;  4JS5 A;  3SUQ A;  5HRS A;  2OA8 A;  2B6A A;  1L3V A;  2HVH A;  3DM2 A;  4CGD A;  1QQC A;  4CK3 A;  3PO4 A;  2HHT A;  1VSI A;  4QAG A;  1HYS A;  1SV5 A;  2P51 A;  4I2P A;  4HTU A;  2VG6 A;  1BIU A;  3CFP A;  4RW4 A;  3VQE A;  1LWC A;  1U47 A;  3G10 A;  4K8Z A;  3KLF A;  2QKB A;  4FJI A;  4MQ3 A;  3M8Q A;  4B9N A;  2FBY A;  1VSL A;  3DLE A;  2ATQ A;  3V9Z A;  3QER A;  5JS1 A;  4CED A;  3V9U A;  1BI4 B;  3L2Q A;  3LDS A;  1TKT A;  1X1P A;  5KGW A;  3LP1 A;  4Q5V A;  1ASU A;  3HK2 A;  3OS0 A;  4DS4 A;  1U04 A;  1KSP A;  2QK9 A;  4Q0B A;  4CJF A;  3OYC A;  1HMV A;  4CGI A;  5KTQ A;  4E7I A;  1TKZ A;  4CFC A;  5KRT A;  2IDO A;  1G15 A;  3AVK A;  3V9S A;  3LP3 A;  4AIL C;  4O0J A;  4DTX A;  2D0C A;  2XHB A;  4NYF A;  5HRO A;  3IAY A;  1VRU A;  3AVA A;  5C24 A;  3ZT4 A;  5I3U A;  4CFB A;  4WE1 A;  3SNN A;  1B9F A;  4FJX A;  3HPH A;  3SUN A;  3V1Q A;  4DQS A;  4CF0 A;  3OY9 A;  3DRP A;  4FW1 A;  3SQ1 A;  3AVN A;  2HW3 A;  5K14 A;  4DLG A;  1FKO A;  2ZQB A;  3LP2 A;  4O4G A;  3VQC A;  4HVJ A;  3JYT A;  3TAN A;  2Z1J A;  3L8B A;  1T7P A;  2XO7 A;  3HL8 A;  2PY5 A;  4O0I A;  3T1A A;  3ZSY A;  1A5W A;  4HUG A;  4DTU A;  1D5A A;  3ZCM A;  2E6L A;  1RNH A;  4KHY A;  1RTH A;  3U6F A;  2OYQ A;  4DFM A;  4CIG A;  3AA3 A;  5D3G A;  2OPP A;  1SKS A;  4W5N A;  1LWE A;  2F96 A;  1DLO A;  1LWF A;  2IS3 A;  3DYA A;  3SQ2 A;  1QSS A;  3QET A;  4ICL A;  3RMA A;  3DOK A;  1RT1 A;  3LAN A;  3DLB A;  1ZBU A;  3QIN A;  1ITG A;  3NHG A;  4FJL A;  1BQM A;  3I8D A;  4KV8 A;  3TAQ A;  1C0T A;  4ID5 A;  1KLN A;  2B4J A;  4FM2 A;  3RMC A;  4N56 A;  4W5T A;  2HHS A;  1BQN A;  2VG5 A;  4B8C A;  4DU1 A;  3SQ0 A;  3CFO A;  3KD5 E;  4J2D A;  3H08 A;  2E6M A;  4YNQ A;  1UAX A;  1ASV A;  1EXQ A;  4BE2 A;  4CEO A;  1L5U A;  4CGH A;  3NH2 A;  2A1S A;  3VQ5 A;  4KB1 A;  1NK6 A;  5HLF A;  4N76 A;  4KHS A;  4C8M A;  1D9F A;  3ITH A;  4KHN A;  4CF9 A;  3ZSZ A;  3O3G A;  1HRH A;  3SQ4 A;  1J5O A;  2G8W A;  1VRT A;  4Z0U A;  3KLH A;  3SUO A;  4CK1 A;  3LWM A;  4OGC A;  2W42 A;  2HNZ A;  2WOM A;  1O1W A;  4KO0 A;  4F2R A;  2HB5 A;  4J2B A;  4CES A;  5SZT A;  2BDP A;  5CYM A;  1NOZ A;  4JLH A;  1HPZ A;  3OJU A;  2VWJ A;  3NH0 A;  4I2Q A;  3L2W A;  2FBX A;  3NH1 A;  1C6V A;  4IDK A;  3OS2 A;  3KK2 A;  4DTN A;  4FLY A;  2HHX A;  4C8K A;  4CJ4 A;  1S1T A;  5J2P A;  4FJK A;  3ASM A;  3DMJ A;  2HNY A;  3KJV A;  3G0Z A;  1HQE A;  4DMN A;  1RT4 A;  1RDC A;  3BGR A;  1XWL A;  2YHA A;  1UA1 A;  3LP0 A;  3OYE A;  4DS5 A;  4G1Q A;  3ZSR A;  4N5S A;  1NK7 A;  4FJ8 A;  3ULD A;  3QEI A;  2PZS A;  4DTR A;  2DFF A;  2X78 A;  2G8I A;  4PQU A;  2G8U A;  4IKF A;  1UWB A;  3SV4 A;  1RT3 A;  4CEC A;  1T8E A;  3AVC A;  5J2Q A;  3VQB A;  4DSI A;  3OYK A;  3SYZ A;  1HYZ A;  4HUE A;  4KRF A;  1GOC A;  2IAJ A;  3AO4 A;  3PV8 A;  4IFV A;  4IG3 A;  2O4I A;  5EU7 A;  1BGX T;  4BAC A;  3T19 A;  4DSF A;  3QEV A;  4FLX A;  1TL3 A;  3HYF A;  4NCG A;  1B92 A;  4HCB A;  4EP5 A;  2I5J A;  4M3Y A;  1VSH A;  1LAW A;  4XIU A;  4BE1 A;  4KI6 A;  2G8V A;  3KKS A;  4CHZ A;  3RRG A;  3DOL A;  1TGO A;  1R0A A;  2OPR A;  3RR7 A;  5E41 A;  3PX0 A;  4H8K A;  3CM5 A;  3HO1 A;  4B08 A;  3VQ7 A;  1JLB A;  3NF6 A;  5KRS A;  3L2V A;  4EZ6 A;  3AVL A;  3TAF A;  1BIZ A;  1TL1 A;  1YVU A;  2QKK A;  3WNG A;  2OZS A;  4CHY A;  4NCB A;  4KHU A;  3DI6 A;  4UQG A;  2GBZ A;  3K5N A;  2VG7 A;  3ZSV A;  3K2P A;  3QES A;  4CHQ A;  1KFS A;  4FZZ A;  5JS2 A;  4B3O A;  1KFD A;  2HVI A;  4CF1 A;  4PWD A;  3I0S A;  1JLF A;  2ETJ A;  1CXQ A;  1GOA A;  4CFD A;  3RMD A;  3AVH A;  4ZTF A;  4CHN A;  4CER A;  1NKE A;  5C42 A;  1NKB A;  3HJF A;  1EP4 A;  4CGJ A;  3B6O A;  3KLE A;  1T05 A;  1RCH A;  1J54 A;  1FKP A;  1RDA A;  1SKR A;  2OZM A;  3HM9 A;  2VWK A;  4F4K A;  4OLA A;  1KCF A;  1EET A;  1KVB A;  4LSL A;  4O5B A;  1Z25 A;  4BWM A;  4CGF A;  1TAU A;  1RBT A;  3L2U A;  1KLM A;  1IKX A;  1A5X A;  4AHS A;  1TK8 A;  1IKW A;  4DSL A;  2GV9 A;  2HHQ A;  3S3N A;  4DSK A;  4E89 A;  3AVJ A;  3TR8 A;  4KHW A;  1HQU A;  4Z4E A;  3OVN A;  1QE1 A;  4N41 A;  1NOY A;  3B6P A;  3ISN C;  4DTS A;  2OPQ A;  2F8S A;  4CJ3 A;  4B9L A;  3RR8 A;  4FZY A;  3WNF A;  2RF2 A;  3VQ8 A;  3ZT2 A;  4DFK A;  1QSY A;  2IGI A;  3NBP A;  4DF8 A;  4FJ5 A;  1CZ9 A;  2Q3S A;  5CZ2 A;  1NK4 A;  4Z4F A;  4FM1 A;  1YT3 A;  2RPI A;  3V1O A;  4TSX A;  4E7L A;  4L8R B;  1BCO A;  3L3U A;  4F3O A;  1S1V A;  3NGI A;  1TK0 A;  4ID1 A;  4OJR A;  3PO5 A;  3JSM A;  2BE2 A;  4AHU A;  3CQ8 A;  2RKI A;  1C1B A;  3L3V A;  3ZSX A;  3BDP A;  1S6Q A;  3AV9 A;  4CF2 A;  4M3R A;  1HNV A;  1IKV A;  1BL3 A;  1S1W A;  1XHZ A;  1LV5 A;  3KIO A;  3RMB A;  3HP6 A;  3VQ9 A;  3K5L A;  4BDZ A;  3KTQ A;  3SV3 A;  3TI0 A;  3OYM A;  3O4N A;  1U45 A;  1C1A A;  3LPU A;  1RT5 A;  1BCM A;  1J9A A;  1IH7 A;  1X9M A;  2G8F A;  1RBR A;  3P83 D;  4DWI A;  4I9Q A;  3K59 A;  2QXF A;  5KGX A;  4IBN A;  3C6U A;  4OKJ A;  4CJT A;  4DU4 A;  3C6T A;  3AVM A;  1VSD A;  4JRQ A;  4W5O A;  4ELT A;  4B9T A;  2JGU A;  4CJR A;  4Y1D A;  1ZBL A;  4DSJ A;  3QNO A;  2XRI A;  4M45 A;  4FYD A;  4QCL A;  3O3F A;  4CEQ A;  4B9M A;  1NJZ A;  3QEP A;  4DG1 A;  3KK3 A;  4B9V A;  4PA1 A;  1RDD A;  3HVR A;  3TAP A;  2FBT A;  3WNH A;  3IS9 A;  4DF4 A;  4FJJ A;  2Z1G A;  3KLI A;  1WSH A;  3M8P A;  1C1C A;  3MEE A;  4LY7 A;  2YKM A;  5SWM A;  1FK9 A;  1J53 A;  1TKD A;  4EZ9 A;  4OLB A;  1CXU A;  1LW2 A;  1S9G A;  2XY8 A;  4FJN A;  3OYB A;  5T7B A;  3KK1 A;  2JLE A;  1EKE A;  2YKN A;  4I9L A;  4N47 A;  3LWL A;  3TAE A;  3SPY A;  2NUB A;  4E7J A;  1XI1 A;  3NAE A;  2KFZ A;  4CEZ A;  2B5J A;  3V4I A;  3OYI A;  5CY4 A;  4I7F A;  1SUQ A;  2DTU A;  4FJM A;  1KTQ A;  4CEB A;  2KQ2 A;  3V1R A;  5I42 A;  3VN5 A;  2HMI A;  4DFJ A;  3PX4 A;  1S1U A;  1DTT A;  4O55 A;  4R5P A;  3QO9 A;  4JRP A;  4H4O A;  2XY7 A;  4Z4G A;  3RRH A;  1W9H A;  4B8A B;  5C25 A;  1BHL A;  1SL2 A;  1RIL A;  1KVA A;  3MEC A;  4OKK A;  4DFP A;  1U4B A;  4J2A A;  1ZBI A;  1Q8I A;  3A2F A;  3NF7 A;  3DRR A;  4M3U A;  4C8O A;  4E3S A;  1FXX A; 
#chains in the Genus database with same CATH topology
 1X9W A;  4DQI A;  4M41 A;  2P9N B;  1L3S A;  3OYG A;  2UU9 K;  4ELV A;  1DTQ A;  2DFH A;  4BR0 A;  4XEI A;  3EZ5 A;  4KHP K;  4JKD A;  3NCI A;  2GUP A;  3R1X A;  4CZE A;  3VQA A;  1Q86 O;  2HST A;  2A40 A;  3HOS A;  1RTD A;  3T1Y K;  3IKM A;  1VQK N;  4AHC A;  2GWK A;  3A5L C;  5CE3 A;  3AA5 X;  1BUP A;  4CEF A;  2P9P A;  2VCP A;  1IG9 A;  5HP1 A;  3TAG A;  1W0H A;  2ZGZ A;  2YNG A;  4CIE A;  2E2P A;  3AAR A;  2HHU A;  4GW6 A;  4IXC A;  3NGZ A;  3G4S N;  4IWV A;  1RT6 A;  2CGL A;  4H0P A;  4BRQ A;  5GAG P;  1OH5 A;  1HYV A;  3WXM B;  1BA1 A;  1LW0 A;  1ASW A;  2P9L B;  2NNW A;  1UOC A;  1Z6R A;  2PYL A;  1F21 A;  2BAN A;  4KTW A;  3F73 A;  1XC9 A;  4F2S A;  3VEX A;  3C7N A;  3VQ4 A;  1JXB A;  1NK5 A;  3THV A;  3AO1 A;  2KHO A;  1Q9X A;  3C95 A;  3HP9 A;  4IOX A;  4MDB A;  3SI6 A;  5HRP A;  3J80 O;  2KTQ A;  4WQ4 C;  3A5O C;  4NB4 A;  3QBX A;  4M7X A;  1QZ5 A;  5FRN A;  1N8R O;  4RW6 A;  4FVM A;  3AGK A;  4BVP A;  2D0B A;  3MXM A;  4FWK A;  2FBV A;  2P9S B;  4IFY A;  2IC3 A;  4OPJ A;  3L4I A;  4KH4 A;  2HBM A;  1ZBH A;  3CJ7 A;  3C94 A;  2CH6 A;  3EY1 A;  4DTM A;  4QS7 A;  3D2F A;  4CZK A;  2E5L K;  4WFB L;  4NLB A;  1K6Y A;  3J7A P;  2RE2 A;  4H0O A;  3NFA A;  3CYM A;  3S3M A;  3WEE A;  4DTP A;  3ZYY X;  1RT2 A;  3O6W A;  4U7B A;  1RTI A;  4JNE A;  1VSE A;  5DMR A;  4CJW A;  1WAJ A;  1Y97 A;  4YOT A;  3G25 A;  2HMP A;  3GL1 A;  2DFE A;  4EHU A;  3EYZ A;  2YNH A;  1HPM A;  4ISF A;  1GLC G;  2VQE K;  3ZT0 A;  3T3F A;  4J2E A;  3P39 A;  3H3O B;  1D9D A;  1HNW K;  4YHH K;  3OYA A;  3VQQ A;  1YTA A;  3OYJ A;  3HRG A;  1UA0 A;  3HT3 A;  3AAQ A;  1YAG A;  4CJV A;  1BO5 O;  4CJP A;  3QEX A;  3WNE A;  3VEV A;  3F9M A;  1XMO K;  1QQM A;  2LSN A;  4JKC A;  4DSE A;  1WSF A;  1OH6 A;  2QWL A;  3ZLJ A;  1SL0 A;  1U6Z A;  4IJN A;  3FLC O;  3AO5 A;  3LZI A;  3SAH A;  2UUC K;  2V51 B;  4B9U A;  1I3A A;  4Y1C A;  4XH1 A;  3I55 N;  4ELU A;  1SKW A;  4CBU A;  5F0X A;  3CCQ N;  4FLT A;  3T1H K;  3SLC A;  5AQO A;  2EWS A;  4LH4 A;  2WON A;  1TK5 A;  3AA2 A;  3NMU A;  1K73 O;  4CCH A;  2YHB A;  3LAM A;  3P1G A;  3AAP A;  3S9H A;  1CZB A;  2FLO A;  4C1N K;  3SJJ A;  3HVT A;  1WN7 A;  2G8K A;  2NRH A;  4WF9 L;  4WFA L;  2E20 A;  3VF4 A;  5KPR A;  1RBS A;  5BPN A;  3W3D A;  1Y64 A;  3CHW A;  4K42 A;  4JS5 A;  5DM6 L;  2B6A A;  3L6Q A;  3LDQ A;  1HYS A;  4I2P A;  2VG6 A;  3CFP A;  4RW4 A;  4K8Z A;  3EZW A;  4GNI A;  4BG8 A;  4MQ3 A;  2FBY A;  1VSL A;  3DLE A;  4DR6 K;  4CED A;  2GTD A;  2NRX A;  3V9U A;  1BI4 B;  2AP1 A;  3IMX A;  2HBK A;  3I33 A;  2ZM6 K;  3OS0 A;  1U04 A;  4E7I A;  5AQV A;  4CFC A;  2NRR A;  1G15 A;  4DTX A;  5LL6 Z;  3CCS N;  4WCE L;  2XHB A;  4NYF A;  3GE1 A;  5M1P A;  5HRO A;  3ZT4 A;  5C24 A;  4A5B A;  2VYP A;  4BR5 A;  3BZC A;  4WE1 A;  4FJX A;  3HPH A;  4FWR A;  3OY9 A;  3LP2 A;  1HJO A;  3HL8 A;  3HI0 A;  1O13 A;  3T1A A;  3ZCM A;  1E4F T;  4KHY A;  1RTH A;  4JKF A;  5AZI A;  3M6G A;  4DFM A;  5FPM A;  3TPQ A;  2OPP A;  2P9P B;  1LWE A;  5H1S Q;  4W5N A;  4JYA K;  4BRN A;  4JI5 K;  1XQS C;  4BQL A;  3CMA N;  3DOK A;  3NHG A;  1BQM A;  3TAQ A;  4GV3 A;  2Q97 A;  3WQU A;  1KLN A;  1C0F A;  4CW7 B;  1IG8 A;  1BQN A;  2BH1 A;  2E6M A;  3H08 A;  4IJA A;  1WBD A;  1EXQ A;  4BE2 A;  1L5U A;  3NH2 A;  3VQ5 A;  1M1K O;  5HLF A;  4H0T B;  3O3G A;  4FOI A;  3CC4 N;  4Z0U A;  4AM6 A;  3QFU A;  4CK1 A;  4LF8 K;  2HB5 A;  5SZT A;  1HPZ A;  3OS2 A;  1C6V A;  4IDK A;  3KK2 A;  4JI2 K;  4A61 A;  1S1T A;  5J2P A;  4FJK A;  2A5X A;  2F7T A;  3G0Z A;  4BRH A;  1ZXO A;  4DMN A;  2QI2 A;  1RDC A;  1XWL A;  2YHA A;  3PSF A;  3WXL A;  3CQY A;  3OYE A;  4DS5 A;  4FJ8 A;  4H0Y B;  4BRO A;  2G8I A;  1UWB A;  4CEC A;  4JKA A;  4JD2 A;  3FGU A;  3I8B A;  3O9Q A;  1HYZ A;  1LOT B;  3D2E A;  2IAJ A;  2O4I A;  2CGJ A;  5EU7 A;  4BAC A;  4CBX A;  3D2F B;  1BG3 A;  5JLF A;  4M3Y A;  4XIU A;  3RRG A;  3Q7B A;  4DR1 K;  2YHY A;  5FPN A;  3PX0 A;  1Q7Y O;  3HO1 A;  1VQ8 N;  3QB0 A;  5KRS A;  2VWB A;  2W40 A;  1TL1 A;  4CI6 A;  1RFQ A;  4CD3 A;  2QA4 N;  3VEO A;  3VF2 A;  4BR9 A;  2GBZ A;  2RHK A;  3ID8 A;  1KFS A;  5JS2 A;  4CJ7 A;  1NGJ A;  2W6K A;  2O8B B;  4AM7 A;  3HJF A;  1EP4 A;  3BEX A;  3KLE A;  3HM9 A;  2VWK A;  4OLA A;  1KCF A;  1EET A;  1CZA N;  1IKX A;  1A5X A;  5AJ3 K;  4DSL A;  2NRT A;  3O9S A;  4E89 A;  3AVJ A;  4KHW A;  3ATU A;  1QE1 A;  3ISN C;  3ZX3 A;  2F8S A;  3EN9 A;  1Q82 O;  3ZT2 A;  2RF2 A;  3VQ8 A;  2ZJQ L;  4FZY A;  4B3T K;  1NM1 A;  4FM1 A;  2VGM A;  1YT3 A;  4NXN K;  4L8R B;  1BCO A;  4F3O A;  4JKB A;  2FF6 A;  4DR3 K;  3JSM A;  3UB5 A;  3CQ8 A;  2RKI A;  3BDP A;  4M3R A;  1NU0 A;  4FWQ A;  3KIO A;  3KTQ A;  1W2B M;  3THW B;  3OYM A;  3O4N A;  4JV5 K;  5GAD P;  3K59 A;  2O8D B;  1QHA A;  3GG4 A;  4CJT A;  3FZL A;  1GLF O;  1SQK A;  4JRQ A;  4ELT A;  4B9T A;  4JKE A;  4DSJ A;  1HR0 K;  3QNO A;  4FYD A;  5DM7 L;  5AQN A;  4PA1 A;  3HVR A;  2FBT A;  3O1W A;  4DF4 A;  1YVN A;  2Z1G A;  2E2O A;  4FJJ A;  2W6L A;  3M8P A;  3FZK A;  1X3M A;  4F9O A;  4BVO A;  3ZEU B;  4A59 A;  2P9L A;  3CPE A;  1Z05 A;  4FJN A;  4B1V A;  5T7B A;  3SPY A;  4I9L A;  2QTD A;  2NUB A;  4E7J A;  1XI1 A;  3NAE A;  5C10 A;  4MO4 A;  3OBY A;  4FJM A;  3ZET B;  4WQ5 C;  4BC5 A;  3V1R A;  5BPL A;  5I42 A;  1NNE A;  2HMI A;  3JXU A;  2CH5 A;  1S1U A;  4O55 A;  4B3R K;  3A5M C;  3KHY A;  4B8A B;  4B1W B;  5C25 A;  5AFU A;  1RIL A;  3D7E O;  1SL2 A;  1KVA A;  3MEC A;  4DFP A;  1U4B A;  4J2A A;  1M90 O;  4LFC K;  3NF7 A;  3DRR A;  4E3S A;  4FWP A;  1YUW A;  2IVP A;  2P9S A;  3NGY A;  2Y1I A;  2F8T A;  1WAF A;  5FLX O;  4W5R A;  3AGR A;  5HRR A;  2Q36 A;  1XNR K;  2KZZ A;  2HHV A;  4FCY A;  2A1R A;  4PL8 A;  3OYD A;  4OVL A;  2ZWH A;  3O3H A;  5FPE A;  4M3Z A;  4CFA A;  1OH7 A;  3AO3 A;  3V81 A;  1GLJ O;  2P9I B;  3MN9 A;  3NE6 A;  5KPZ A;  4RW9 A;  4NLC A;  1GOB A;  3G71 N;  1RBU A;  5M1O A;  3ZT3 A;  3OJS A;  1B9D A;  1BDG A;  4LSN A;  3VA0 A;  4LF9 K;  2IOC A;  4RW7 A;  5AQQ A;  3H6E A;  3NDK A;  4DV1 K;  1KQS M;  2KKZ A;  1YTU A;  3SMS A;  3MN7 A;  3ENO A;  3HOT A;  3A8Y A;  3BF3 A;  3C6H A;  4BRF A;  1P8Z A;  4DCH A;  2UUB K;  4AHR A;  3V9W A;  1JLG A;  4FLV A;  2EHG A;  5EXW A;  2WTU A;  1QTM A;  1LAV A;  3MCA B;  5FRO A;  4YDU C;  5FPD A;  1HJR A;  3C6A A;  1JCG A;  3AO2 A;  1S6P A;  1GLB G;  3KWG A;  4MFB A;  1RDU A;  3F9K A;  3E66 A;  4FK2 A;  1TVR A;  4M3W A;  3EE8 A;  3UKU B;  2EX3 A;  3CI5 A;  1GLD G;  1IBL K;  5LJW A;  4L3Q A;  4DQP A;  2F4V K;  3MXI A;  2D4W A;  2YNI A;  3LPT A;  4CJ5 A;  4C8L A;  2AJQ A;  1WNS A;  3ULE B;  3THX A;  5AQW A;  4KRE A;  5KQD A;  1ZBF A;  3M8R A;  4F8R A;  3DLK A;  2QXL A;  2HND A;  4WFN L;  4CHO A;  4CZG A;  3IDH A;  2H3G X;  4A62 A;  4HHT A;  3SMP A;  1N6Q A;  4FZX C;  1D4X A;  4FJH A;  4YY3 K;  5J2N A;  2NRV A;  3RWU A;  1NK0 A;  4B9S A;  4LD0 A;  3WQT A;  3C0B A;  2A41 A;  3H1Q A;  1JLC A;  4DV3 K;  1N5Y A;  1N34 K;  3OYN A;  3U9D A;  4O8K A;  3CCJ N;  4FW2 A;  3EKS A;  3CCR N;  4HCC A;  4DR4 K;  1NJW A;  3O1B A;  3AVG A;  1BI4 A;  2Q1N A;  4CJS A;  2FSN A;  3VMF B;  3OHR A;  2PFU A;  1BOT O;  1JL2 A;  3QIC A;  5FRM A;  3SBG A;  5AZJ B;  3W0L A;  1WSI A;  1XUP O;  2KW4 A;  1XNQ K;  3CJB A;  5AQP A;  3VER A;  3CM6 A;  3AY9 A;  4H5W A;  4HTL A;  4DTO A;  4K43 A;  1XHX A;  5C15 A;  4DLE A;  4DQR A;  3KVG A;  4PKG A;  4CHP A;  3SPZ A;  2YV0 X;  2PYJ A;  1DT9 A;  3MED A;  3CFR A;  1EX4 A;  3LAK A;  3VEN A;  1TV6 A;  3RVC A;  1JKH A;  1N32 K;  4W5Q A;  3CC7 N;  1ATR A;  1ZYQ A;  5KQ8 A;  1X9S A;  3IRX A;  1QQN A;  2O4G A;  3HST B;  3U3Y A;  1JL1 A;  2P5O A;  3I0R A;  1OVY A;  2E2N A;  1A5V A;  3QLH A;  4M3T A;  4CK2 A;  3SJH A;  2W41 A;  3CJA A;  4FJG A;  3ALY A;  1VSF A;  1IO2 A;  1TAQ A;  4FL9 A;  1NKC A;  1QS4 A;  2FC0 A;  4ISG A;  3VQD A;  2OA8 A;  1MA9 B;  1L3V A;  2HVH A;  3THY B;  4CGD A;  1QQC A;  3PO4 A;  2UXD K;  4ILH A;  1SV5 A;  3K9J A;  2P51 A;  4HTU A;  4BRM A;  4GV9 A;  1LWC A;  3M8Q A;  4IO9 L;  3SBT A;  1KAZ A;  2ATQ A;  4H5R A;  3EKU A;  3L2Q A;  5A2Q O;  3N4P A;  3CCL N;  3HK2 A;  3BZK A;  4BR2 A;  4DS4 A;  3LDO A;  1ATN A;  1HMV A;  4CGI A;  5KTQ A;  3SAG A;  4IZ9 A;  4IEE A;  3AVK A;  4AIL C;  1NBW A;  2D0C A;  2E8A A;  5I3U A;  3SNN A;  1B9F A;  4CF0 A;  2I7P A;  3DRP A;  1XMQ K;  3AVN A;  5K14 A;  1FKO A;  4O4G A;  4HVJ A;  3VQC A;  1T7P A;  5AQL A;  1HKC A;  1A5W A;  4FWS A;  3ZX2 A;  1JJ2 M;  3U6F A;  3CER A;  3DLL L;  1VQL N;  3AA3 A;  5D3G A;  2GX9 A;  1SKS A;  4ILJ A;  1QSS A;  4ICL A;  3RMA A;  1RT1 A;  3QIN A;  1C0T A;  4ID5 A;  4N56 A;  4CD1 A;  3SQ0 A;  3KD5 E;  4J2D A;  4YNQ A;  1ASV A;  4CEO A;  4CGH A;  4KB1 A;  2A1S A;  4N76 A;  2O8B A;  3CJ1 A;  4KHN A;  1HRH A;  3SQ4 A;  4DUY K;  3LDL A;  1VRT A;  1VQM N;  4MLE A;  4BC3 A;  4FPB A;  4BG9 A;  1NGE A;  2W42 A;  4BRD A;  4WYB A;  4CES A;  4DV4 K;  4DTN A;  4C8K A;  5BN8 A;  3ASM A;  3DMJ A;  2HNY A;  3FZF A;  1HQE A;  4H5T A;  4YOX A;  1RT4 A;  2HOE A;  3M1F A;  3ZSR A;  3T69 A;  3ULD A;  4DTR A;  4V19 S;  2HF3 A;  4PQU A;  1RT3 A;  5M1N A;  1MWM A;  1R59 O;  4DSI A;  3OYK A;  2O8E B;  3THX B;  4KRF A;  4RTF D;  3U8X A;  3CQX A;  3THW A;  4X65 K;  3F2K A;  4IO8 A;  3CC2 N;  4JI8 K;  4LC9 B;  3H45 C;  5BRH A;  4HCB A;  4EFH A;  2O8D A;  2I5J A;  2O8F A;  4BE1 A;  4M7Y A;  1TGO A;  2OPR A;  5EY4 A;  5E41 A;  4B08 A;  3NF6 A;  5BPM A;  3L2V A;  4EZ6 A;  3IUC A;  3AVL A;  3EE9 A;  1BIZ A;  1YVU A;  4NCB A;  3HM8 A;  3BP8 A;  4YDU A;  4UQG A;  3K5N A;  3ZSV A;  4LF6 K;  2UXC K;  1KFD A;  3TSP A;  4CF1 A;  4PWD A;  2VGN A;  2ETJ A;  3ZEU A;  4B1Y B;  3VES A;  4CFD A;  4B1X B;  5JLH A;  4CHN A;  5ADX A;  2PAV A;  1VQP N;  1J54 A;  1RDA A;  4FWN A;  3ZET A;  5HL7 L;  1VQ6 N;  4O5B A;  4CGF A;  4X62 K;  1RBT A;  1KLM A;  1TK8 A;  1VQN N;  3VEZ A;  1H1V A;  3O8M A;  5ELZ A;  3MDQ A;  2OPQ A;  4CJ3 A;  1SZ2 A;  1QSY A;  3NBP A;  4DF8 A;  4FJ5 A;  4Z4F A;  1DKG D;  3H3N O;  2RPI A;  4E7L A;  1S1V A;  4BY9 C;  1TK0 A;  4ID1 A;  4OJR A;  4AHU A;  4LF7 K;  4DV5 K;  2I7N A;  3ZSX A;  1BL3 A;  3KZB A;  1LV5 A;  3RMB A;  3HP6 A;  3VQ9 A;  1U2V B;  3VET A;  3P38 A;  2P9I A;  4DV6 K;  2ASP A;  2G8F A;  4B3M K;  4CZM A;  5KGX A;  4IBN A;  4JKH A;  2QM1 A;  4JEP A;  3AVM A;  4W5O A;  2JGU A;  4CJR A;  4Y1D A;  2XRI A;  4M45 A;  4B9M A;  1J6Z A;  4A2A A;  3EO3 A;  4DG1 A;  3KK3 A;  3SAF A;  5LMU K;  5F1X A;  1NGH A;  3MEE A;  1TKD A;  3J8A A;  4QS8 A;  1N36 K;  1LW2 A;  2XY8 A;  3MX5 A;  2JLE A;  3CJ9 A;  4N47 A;  2FSJ A;  1T44 A;  2WBN A;  5CY4 A;  2DTU A;  1V4S A;  1KTQ A;  2WC9 A;  4BGB A;  4H0V B;  3VN5 A;  3HTV A;  2IVN A;  5BRD A;  5IWA K;  3PX4 A;  3MK6 A;  4JRP A;  4H4O A;  4PKI A;  2OTJ N;  4Z4G A;  1OVQ A;  1TUU A;  3J7Y P;  1JCE A;  3VGL A;  3NVM A;  4OKK A;  3UKU A;  3QBW A;  4BQZ A;  4M3U A;  4C8O A;  3IFR A;  1FXX A;  4H03 B;  3KWI A;  1IBK K;  4DR5 K;  3E01 A;  4GVE A;  3K57 A;  4OX9 K;  3TAM A;  4H5N A;  2Z1I A;  4E19 A;  2ZJP L;  4HUF A;  5KI6 A;  3KLG A;  1REV A;  4YFU A;  1L3T A;  3QNN A;  5CR4 A;  4DV2 K;  1T03 A;  3ULE A;  4GMJ B;  3ID6 A;  3LAL A;  5JIC A;  4Z4C A;  4ZHR A;  4E1M A;  5LMN K;  4F3T A;  4B9Q A;  1VQO N;  3P5J A;  1WB9 A;  3CME N;  2FSK A;  2D0A A;  3JAM O;  3L4Q A;  4E7K A;  4CEA A;  5C2D A;  3MEG A;  4XH4 A;  3DLH A;  3RTV A;  1FW6 A;  4NXM K;  3G6E N;  4WQ4 A;  4FK0 A;  4K25 A;  4PL7 A;  3U4L A;  1NK9 A;  4CE9 A;  4KKO A;  4IDH A;  2YHX A;  3DAW A;  1RTJ A;  3OYF A;  3TAR A;  3CJC A;  2KLA A;  1D8Y A;  2X6N A;  1VAZ A;  3VEW A;  3SUP A;  3V6D A;  3M3Z A;  1S22 A;  3KKR A;  1VHX A;  3E9P A;  4CZI A;  4E0D A;  3ATV A;  4Z4H A;  1NJX A;  5AZJ A;  2ITG A;  4KTQ A;  4KHQ A;  1C0M A;  1WSG A;  4CJL A;  1SL1 A;  2P1J A;  3N4Q A;  2RN2 A;  1JLE A;  3SK3 A;  3D45 A;  1MU2 A;  4FLW A;  4JKG A;  3QIP A;  1IKY A;  4RW8 A;  5AQH A;  1BU6 O;  3FR0 A;  4DU3 A;  2QW9 A;  3ZT1 A;  3DLG A;  2O8F B;  3DLR A;  3WUH A;  4NCA A;  2HBL A;  2QWP A;  4FLU A;  4JI3 K;  1Z26 A;  2GUI A;  4BDP A;  4FOE A;  5BN9 A;  4YOW A;  4E7H A;  5CYQ A;  3VA3 A;  1KC8 O;  2R7Y A;  2Q2R A;  3R8E A;  1QSL A;  3TTD A;  5AQJ A;  4QOZ B;  3PY8 A;  4KI4 A;  3LM9 A;  3MCP A;  1VK0 A;  1YJN N;  3THY A;  3E9O A;  4JK9 A;  3HBT A;  2IIR A;  1YJ9 N;  3KK7 A;  5HOO A;  5GAE P;  1IBM K;  4FPA A;  1KAX A;  4CZL A;  1KVC A;  4KBO A;  4IOC L;  2X74 A;  4E1J A;  4CF8 A;  2O8C B;  1QHT A;  1RDB A;  4BRL A;  4Z4I A;  4A57 A;  1E3M A;  3AVF A;  1EO1 A;  1RT7 A;  2XY5 A;  4BE0 A;  1XC3 A;  1S72 N;  4BGA A;  3O4Q A;  4JN4 A;  5F2R A;  1GLE G;  5BR9 A;  1WSJ A;  3VTI A;  4CJK A;  2G8H A;  1ZC6 A;  3A5N C;  4DKW A;  4MO5 A;  1QZ6 A;  3VQ6 A;  5LJV A;  1W97 L;  1U48 A;  4GY2 B;  4FSV A;  1K9M O;  5DK5 A;  3QIO A;  1S5J A;  5AQT A;  5AQM A;  4FXD A;  4OPK A;  4BRI A;  4RG8 A;  4UY8 O;  1S9E A;  3FZM A;  3MWT A;  3ZSQ A;  1BIS A;  3UIQ A;  4GV6 A;  4KTZ A;  1Q9Y A;  4O44 A;  4BC2 A;  4CZF A;  2JWL A;  1K8K B;  4KAZ A;  3MXJ A;  1NG9 A;  4KFB A;  4DQQ A;  1E4G T;  1S3X A;  2V7Z A;  2KFN A;  1RBV A;  3HPG A;  1WUA A;  2WUS A;  3U3G A;  2HHW A;  3SUQ A;  5HRS A;  3VGM A;  4ILG B;  3DM2 A;  4CK3 A;  4LFB K;  2HBJ A;  3CCE N;  1BIU A;  3VQE A;  1U47 A;  5AQG A;  3KLF A;  1QVF M;  1YI2 N;  2QKB A;  4U67 L;  5GAH P;  5JS1 A;  4A5A A;  3QER A;  1N33 K;  3LDS A;  1TKT A;  1ATS A;  1V4T A;  4NO7 A;  1KSP A;  2QK9 A;  4FO0 A;  4Q0B A;  4DR2 K;  3EL2 A;  4CJF A;  3OYC A;  2OAN A;  3TSU A;  3CCV N;  2P9K A;  1TKZ A;  5KRT A;  3WT0 A;  2IDO A;  3F5T A;  3B8A X;  3V9S A;  3LP3 A;  4MLH A;  5EX5 A;  4O0J A;  4BC4 A;  4CFB A;  3R9P A;  3DXM B;  3SUN A;  3V1Q A;  2O8E A;  4FW1 A;  1DGK N;  2ZQB A;  4IFE A;  3JYT A;  3CET A;  3TAN A;  1BA0 A;  2XO7 A;  2PY5 A;  4O0I A;  5M1Q A;  3ZSY A;  4HUG A;  3HZ6 A;  1RNH A;  2F9T A;  2OYQ A;  2ASM A;  3ZX0 A;  4HWI A;  1MDU B;  1LWF A;  2IS3 A;  3DYA A;  4H0X B;  1YJW N;  3QET A;  2D1K A;  3DLB A;  1ZBU A;  1I94 K;  4IOA L;  1ITG A;  4FJL A;  3I8D A;  2B4J A;  4JHD B;  4FM2 A;  2HHS A;  3CFO A;  4K0K K;  3DJC A;  1T6D A;  4B1U B;  3GBT A;  4C8M A;  1D9F A;  3ITH A;  4CF9 A;  3ZSZ A;  1J5O A;  1BWF O;  2G8W A;  5C0Y A;  3KLH A;  2E1Z A;  2HNZ A;  1O1W A;  2BDP A;  4FWO A;  2VWJ A;  3CF5 L;  4I2Q A;  3L2W A;  1NGC A;  4FLY A;  3GDQ A;  2HHX A;  2D0O A;  3OA9 A;  3TSQ A;  5CHI A;  3R6M A;  4JKG B;  1UA1 A;  5JVH L;  3CD6 N;  3LP0 A;  1NK7 A;  4N5S A;  4FVU A;  3H46 O;  5BR8 K;  3CIP A;  2DFF A;  1HUX A;  2X78 A;  2G8U A;  4IKF A;  3SV4 A;  3BF1 A;  2ZJR L;  1T8E A;  3AVC A;  4JI4 K;  3VQB A;  3SYZ A;  2YJE A;  4HUE A;  1GOC A;  4YOY A;  3PV8 A;  4IG3 A;  1U2V A;  4YOR A;  3T19 A;  1KD1 O;  3QEV A;  4FLX A;  1TL3 A;  4NCG A;  1B92 A;  4EP5 A;  1VSH A;  1LAW A;  4CZJ A;  3KKS A;  4CHZ A;  2QWO A;  1R0A A;  4DV0 K;  2GEL A;  4DHY A;  4H8K A;  3VQ7 A;  1JLB A;  5EOY A;  2QKK A;  3J81 O;  3WNG A;  1NGI A;  4KHU A;  3R3L A;  2QWQ A;  3QES A;  5JVG L;  1JLF A;  2QWM A;  3RMD A;  4ZTF A;  1NKE A;  5C42 A;  3VPZ A;  4JI0 K;  4CGJ A;  4JK8 A;  1RCH A;  1SAZ A;  3U9Z A;  4F4K A;  5AQZ A;  1Z25 A;  4BWM A;  4AHS A;  2HHQ A;  2GWJ A;  1IKW A;  2ZGY A;  2A6A A;  3S3N A;  1TYQ B;  3A0I X;  2V7Y A;  3B6P A;  4DTS A;  4JI7 K;  3MN5 A;  3WNF A;  4I6M B;  2IGI A;  2Q3S A;  3OTO K;  1HLU A;  3CCM N;  1VQ7 N;  1NGF A;  2JWK A;  1HKG A;  3V1O A;  4AQY K;  3L3U A;  3NGI A;  2AA4 A;  3PO5 A;  4OPA A;  1C1B A;  3L3V A;  1EWQ A;  1S6Q A;  4CF2 A;  1HNV A;  5AR0 A;  4BDZ A;  3TI0 A;  5B8H A;  1C1A A;  3RSE B;  4X64 K;  1IH7 A;  4DWI A;  4I9Q A;  1X9M A;  3VEY A;  1RBR A;  4KPY A;  1NMD A;  5AQU A;  1LCU A;  2QXF A;  4GKJ K;  3O80 A;  3C6U A;  4BRC A;  4KH6 A;  4WQ5 A;  3Q7C A;  2BGG A;  5JMV A;  1YF5 L;  3CCU N;  3O3F A;  4DUZ K;  4CEQ A;  3QEP A;  4C23 A;  4B9V A;  5AQY A;  3L0Q A;  3UKR B;  1WSH A;  1C1C A;  4LY7 A;  5SWM A;  4OLB A;  4CZH A;  4B3S K;  1CXU A;  3MWP A;  2HHH K;  4CVN E;  1S9G A;  3K0S A;  3OYB A;  5AQI A;  1VQ9 N;  1HNZ K;  4CEZ A;  3V4I A;  3OYI A;  3PSI A;  1SUQ A;  3WXI A;  2ASO A;  2KQ2 A;  4DFJ A;  2FXU A;  4KH5 A;  3QDK A;  1YIJ N;  3UE5 A;  1DTT A;  4R5P A;  2P9K B;  3RRH A;  1YIT N;  4JAX A;  4RCH A;  3FE1 A;  2YI1 A;  1ILY A;  1ESV A;  1Q8I A;  3A2F A;  5I9E B;  1MWK A;  3K58 A;  3CG7 A;  4PUO A;  2Q0R A;  1X3N A;  3D0P A;  4AF1 A;  1I39 A;  4PY5 A;  4YOU A;  4KB0 A;  1K8A O;  1NLV A;  1WLJ A;  2X6S A;  2WFB A;  4FLZ A;  4M42 A;  1TKX A;  3LDP A;  3NF9 A;  3PUF A;  5AFU H;  1WSE A;  2D5R A;  3AVI A;  1S1X A;  4C8N A;  3EEQ A;  4AH9 A;  3TAB A;  1VSK A;  2FF3 B;  4DTJ A;  4JI1 K;  1JCF A;  3OS1 A;  3ZSW A;  3QEW A;  1NK8 A;  4FK4 A;  4LFA K;  2DY4 A;  3S41 A;  5FDL A;  3FFI A;  1HNI A;  5GIO A;  3TWH A;  3CPW M;  3SZ2 A;  4YOV A;  5J2M A;  3LZJ A;  2O8C A;  1NGB A;  3KD1 E;  3S3O A;  4LH5 A;  3ENH A;  5M1F A;  3PIO L;  1KAY A;  3VQP A;  4CIF A;  2YNF A;  3BY5 A;  1FJG K;  4M3X A;  2P9U B;  1NJY A;  3O5B A;  1JXE A;  4JS4 A;  4CJE A;  4EIA A;  4G9Z A;  1VSJ A;  4BR7 A;  3SCX A;  3WXJ A;  4OO1 J;  3PX6 A;  2YJF A;  3O9U A;  3HXM A;  4EAH D;  2Z1H A;  4E1N A;  5EVZ A;  5AQK A;  3L2R A;  3PIP L;  5CZ1 A;  4PKH A;  5KPT A;  5HBM A;  2OPS A;  3IG1 A;  2VQF K;  2V52 B;  5E84 A;  4Z94 A;  3CXC M;  2P5G A;  3MAQ A;  4BRG A;  1K8K A;  1U49 A;  4X66 K;  2OCE A;  3AA4 A;  4AHV A;  4LF5 K;  1J5E K;  5J1E A;  3K5O A;  3NF8 A;  3BUZ B;  3LDN A;  4OGE A;  3NVK A;  2UUA K;  4FWM A;  4NYN A;  4BRK A;  2XY6 A;  3OYH A;  1KRP A;  3VOV A;  4ZTJ A;  4OKE A;  5GIP A;  1L3U A;  1TUY A;  4K8X A;  1C0U A;  4IG0 A;  1DEJ A;  3HPO A;  2PBD A;  3C7N B;  4DR7 K;  3DXK A;  1NJI O;  5C12 A;  2NLX A;  4BDY A;  1QVG M;  3E1Y A;  4FJ7 A;  2D0P A;  5GIN A;  4OPH A;  2NZT A;  4CGG A;  1VQ5 N;  4CJU A;  3ZSO A;  3K5M A;  1WOQ A;  2ZE2 A;  1JLA A;  3O4W A;  3DXM A;  2KZM A;  4RWT A;  2CGK A;  4GVM A;  1VSM A;  5HRN A;  4H4M A;  4O8U A;  3PLA A;  1RDW X;  4CJQ A;  1NWK A;  4QS9 A;  2ZD1 A;  3V9X A;  4EP4 A;  1C0G A;  1CLQ A;  3M8S A;  4B9L A;  4AHT A;  3DRS A;  4FJI A;  4DQ8 A;  1JLQ A;  4Y0W A;  3AVB A;  4JI6 K;  4FM0 A;  2E4L A;  3WEE B;  3FFK B;  4JHD A;  4BRE A;  4FJ9 A;  2Y1J A;  1NGA A;  4CEE A;  3OYL A;  5E26 A;  4BWJ A;  1HX1 A;  3GOI A;  2HHT A;  1VSI A;  4QAG A;  1EQY A;  2GEM A;  3G10 A;  3H1V X;  3VF6 A;  4B9N A;  3V9Z A;  2YX6 A;  1HKB A;  3TTC A;  2QEX N;  2UXB K;  1X1P A;  5KGW A;  4XH5 A;  3LP1 A;  4Q5V A;  1ASU A;  4BR4 A;  2YHW A;  4IEI A;  2NRW A;  1WBB A;  3J7Z O;  3OW2 M;  3IAY A;  1VRU A;  3AVA A;  1Q81 O;  4BRP A;  2A42 A;  2P9N A;  4DQS A;  3SQ1 A;  3DWL A;  2E88 A;  2HW3 A;  3MN6 A;  2Q0U A;  4DLG A;  4MDA A;  2Z1J A;  3L8B A;  1IV0 A;  3C65 A;  4DTU A;  1D5A A;  2E6L A;  2A3Z A;  3TTF A;  4CIG A;  1GLA G;  2F96 A;  1DLO A;  2YCH A;  2E2Q A;  1RGI A;  3SQ2 A;  4PHT X;  3LAN A;  2QWR A;  1YHQ N;  3JS6 A;  2QWN A;  4KV8 A;  4J8F A;  3LL3 A;  3RMC A;  1NMN A;  1SS6 A;  4W5T A;  2E1Y A;  2VG5 A;  4CBW A;  4B8C A;  4DU1 A;  1UAX A;  1W7A A;  1NK6 A;  4KHS A;  3K9K A;  3I56 N;  4BRA A;  1HNX K;  1OH8 A;  5C2F A;  3SUO A;  3LWM A;  4OGC A;  4KO0 A;  2WOM A;  2NRZ A;  4F2R A;  4J2B A;  2BUP A;  5CYM A;  1NOZ A;  4JLH A;  3OJU A;  3NH0 A;  1TYQ A;  2FBX A;  3NH1 A;  4CJ4 A;  3KJV A;  4LF4 K;  4I6M A;  3BGR A;  4G1Q A;  3QEI A;  2PZS A;  4H5V A;  1KXP A;  4O5F A;  2IVO A;  3O9T A;  5J2Q A;  4R79 A;  4C1N I;  4DV7 K;  3AO4 A;  1ZBS A;  4IFV A;  1BGX T;  3RSE A;  4DSF A;  3VTH A;  5AQS A;  3HYF A;  3VGK A;  2G8V A;  3QML A;  4KI6 A;  2HF4 A;  3DOL A;  5AZI B;  4DB3 A;  3RR7 A;  3T7Z A;  3CM5 A;  5LY3 A;  2F9W A;  3TAF A;  1X9J A;  2OZS A;  4CHY A;  5IT9 O;  3UKR A;  3DI6 A;  1T3V A;  2VG7 A;  3K2P A;  1T6C A;  4CHQ A;  4B1Z A;  4FZZ A;  4B3O A;  2HVI A;  3I0S A;  5BRF A;  1CXQ A;  1GOA A;  3AVH A;  2ZF5 O;  1GLL O;  3D6R A;  4CER A;  4EHT A;  1NKB A;  5BRE A;  1Q18 A;  1EWR A;  3B6O A;  5AQX A;  3DXK B;  1T05 A;  2OZM A;  1SKR A;  1FKP A;  3TU5 A;  1KVB A;  4LSL A;  1TAU A;  3P4I A;  3L2U A;  2GV9 A;  4DSK A;  3TR8 A;  5AQF A;  1HQU A;  4Z4E A;  3OVN A;  4N41 A;  1NOY A;  3RR8 A;  4DFK A;  1YXQ A;  3OBW A;  3P31 A;  3LM2 A;  1CZ9 A;  3QFP A;  5CZ2 A;  5MLC Q;  1NK4 A;  2Q31 A;  1P90 A;  4TSX A;  5ADX H;  3ENB A;  1VQ4 N;  2BE2 A;  5TKW A;  4JD2 B;  3AV9 A;  4FWL A;  1G99 A;  4GKK K;  1IKV A;  1S1W A;  1XHZ A;  2ITM A;  3D2E B;  3K5L A;  3SV3 A;  3E9L A;  1U45 A;  2J4R A;  3LPU A;  1RT5 A;  1BCM A;  1J9A A;  4M63 C;  3P83 D;  1NGD A;  3FZH A;  4OKJ A;  3HSC A;  4DU4 A;  3C6T A;  1NGG A;  1VSD A;  5AQR A;  1ZBL A;  4QCL A;  1NJZ A;  3O08 A;  1RDD A;  5TKY A;  3TAP A;  3WNH A;  3IS9 A;  3KLI A;  4EZ9 A;  2YKM A;  1FK9 A;  1J53 A;  2BTF A;  3MMV A;  3KK1 A;  1EKE A;  2YKN A;  3LWL A;  3MX2 A;  3TAE A;  2UYT A;  4ISE A;  2KFZ A;  2B5J A;  3WXK A;  1OKJ A;  4I7F A;  1IJJ A;  3O9R A;  4CEB A;  3M5R A;  2P9U A;  5M1K A;  3QO9 A;  4K41 A;  1QQO A;  2XY7 A;  1W9H A;  4JK7 A;  1BHL A;  2DPN A;  1ZBI A;  2OTL N;  4A2B A; 
#chains in the Genus database with same CATH homology
 3K58 A;  1X9W A;  4DQI A;  3CG7 A;  3E01 A;  3NGY A;  4M41 A;  2Y1I A;  1L3S A;  1WAF A;  3OYG A;  3K57 A;  4PUO A;  3TAM A;  2F8T A;  4W5R A;  4ELV A;  2Z1I A;  5HRR A;  4E19 A;  1DTQ A;  2DFH A;  3D0P A;  4HUF A;  3EZ5 A;  5KI6 A;  3KLG A;  1I39 A;  1REV A;  4PY5 A;  3NCI A;  2KZZ A;  4YFU A;  1L3T A;  3QNN A;  2HHV A;  4KB0 A;  4FCY A;  2A1R A;  1T03 A;  3VQA A;  3OYD A;  4GMJ B;  1WLJ A;  4OVL A;  3LAL A;  2X6S A;  3O3H A;  1RTD A;  4FLZ A;  4M42 A;  4Z4C A;  4ZHR A;  1TKX A;  4M3Z A;  4E1M A;  4F3T A;  4CFA A;  3AO3 A;  3P5J A;  3V81 A;  4AHC A;  3NE6 A;  3NF9 A;  3PUF A;  4RW9 A;  1GOB A;  2D0A A;  1RBU A;  1WSE A;  2D5R A;  3AA5 X;  3ZT3 A;  3OJS A;  4CEF A;  3AVI A;  4E7K A;  1B9D A;  4LSN A;  3VA0 A;  4CEA A;  1IG9 A;  1S1X A;  4C8N A;  5HP1 A;  3MEG A;  2IOC A;  4RW7 A;  4AH9 A;  3RTV A;  3TAG A;  3TAB A;  3NDK A;  1VSK A;  3DLH A;  4DTJ A;  1W0H A;  1YTU A;  2YNG A;  4CIE A;  3OS1 A;  4FK0 A;  3ZSW A;  3QEW A;  1NK8 A;  4FK4 A;  4GW6 A;  3NGZ A;  1NK9 A;  2HHU A;  4CE9 A;  4KKO A;  2DY4 A;  1RT6 A;  5FDL A;  3FFI A;  1RTJ A;  3OYF A;  3TAR A;  1HYV A;  1LW0 A;  1ASW A;  4AHR A;  3V9W A;  1HNI A;  1JLG A;  3TWH A;  1UOC A;  1D8Y A;  2X6N A;  4FLV A;  3SZ2 A;  5J2M A;  2EHG A;  3LZJ A;  3SUP A;  1F21 A;  2BAN A;  4KTW A;  3F73 A;  1XC9 A;  2PYL A;  3KD1 E;  4F2S A;  3VQ4 A;  3V6D A;  1JXB A;  3S3O A;  1LAV A;  3AO1 A;  4LH5 A;  3THV A;  3KKR A;  5FRO A;  1NK5 A;  3VQP A;  1Q9X A;  4CIF A;  1HJR A;  4E0D A;  3C95 A;  2YNF A;  3HP9 A;  4Z4H A;  3AO2 A;  4M3X A;  1NJX A;  1S6P A;  2ITG A;  5HRP A;  3SI6 A;  1JXE A;  4JS4 A;  1NJY A;  1C0M A;  4CJE A;  4KTQ A;  4KHQ A;  2KTQ A;  4MFB A;  1WSG A;  3F9K A;  4CJL A;  1SL1 A;  1VSJ A;  5FRN A;  2P1J A;  4FK2 A;  1TVR A;  2RN2 A;  3SCX A;  1JLE A;  4M3W A;  4RW6 A;  2EX3 A;  3D45 A;  4FVM A;  4KAZ A;  3PX6 A;  1MU2 A;  4FLW A;  3MXM A;  2D0B A;  3QIP A;  3HXM A;  2Z1H A;  1IKY A;  2FBV A;  4E1N A;  4RW8 A;  4IFY A;  3L2R A;  2IC3 A;  4DQP A;  3MXI A;  5CZ1 A;  4OPJ A;  2YNI A;  3LPT A;  4CJ5 A;  4DU3 A;  4C8L A;  3ZT1 A;  2AJQ A;  3DLG A;  5HBM A;  1WNS A;  2OPS A;  3DLR A;  3IG1 A;  1ZBH A;  4NCA A;  4FLU A;  4KRE A;  3C94 A;  1Z26 A;  1ZBF A;  2GUI A;  3M8R A;  3EY1 A;  4BDP A;  4F8R A;  2P5G A;  3DLK A;  3MAQ A;  2BGG A;  2HND A;  4DTM A;  4CHO A;  1U49 A;  4E7H A;  3AA4 A;  4AHV A;  1K6Y A;  4HHT A;  1N6Q A;  4FZX C;  5CYQ A;  3NFA A;  4KPY A;  4FJH A;  3VA3 A;  3CYM A;  3S3M A;  5J2N A;  5J1E A;  2R7Y A;  3K5O A;  1QSL A;  3NF8 A;  4DTP A;  1NK0 A;  4B9S A;  3RWU A;  4LD0 A;  4QOZ B;  1RT2 A;  4OGE A;  1RTI A;  1VSE A;  3PY8 A;  4NYN A;  5DMR A;  4CJW A;  4KI4 A;  1WAJ A;  1VK0 A;  1Y97 A;  2XY6 A;  3OYH A;  1JLC A;  2DFE A;  1KRP A;  3EYZ A;  4ZTJ A;  1QTM A;  2YNH A;  4OKE A;  1N5Y A;  3ZT0 A;  3T3F A;  4J2E A;  3OYN A;  1L3U A;  4K8X A;  1KVC A;  4FW2 A;  1D9D A;  2X74 A;  1C0U A;  4IG0 A;  3OYA A;  3VQQ A;  1YTA A;  4CF8 A;  3OYJ A;  1QHT A;  1RDB A;  3HPO A;  1UA0 A;  1NJW A;  4HCC A;  4Z4I A;  3AVG A;  3HT3 A;  1BI4 A;  4CJS A;  4CJV A;  3AVF A;  4BDY A;  4CJP A;  1RT7 A;  3QEX A;  2XY5 A;  1JL2 A;  5FRM A;  4FJ7 A;  3WNE A;  1WSI A;  4BE0 A;  2KW4 A;  4CGG A;  3CM6 A;  3O4Q A;  4CJU A;  4DTO A;  3ZSO A;  2LSN A;  3K5M A;  1WSJ A;  1XHX A;  4CJK A;  4DLE A;  1WSF A;  4DQR A;  4CHP A;  4DSE A;  2G8H A;  3SPZ A;  1SL0 A;  2YV0 X;  2PYJ A;  2ZE2 A;  3VQ6 A;  3MED A;  1JLA A;  1U48 A;  5DK5 A;  3QIO A;  3AO5 A;  1S5J A;  3LZI A;  4FXD A;  3CFR A;  4OPK A;  4B9U A;  4GVM A;  2KZM A;  1I3A A;  4Y1C A;  1VSM A;  5HRN A;  1EX4 A;  4H4M A;  3LAK A;  4RG8 A;  4ELU A;  1S9E A;  1SKW A;  1TV6 A;  4CJQ A;  4FLT A;  3ZSQ A;  1JKH A;  2ZD1 A;  4W5Q A;  1BIS A;  3UIQ A;  3V9X A;  4LH4 A;  2WON A;  4KTZ A;  3AA2 A;  1TK5 A;  4EP4 A;  4CCH A;  1ZYQ A;  2YHB A;  1Q9Y A;  3LAM A;  1CLQ A;  3P1G A;  4O44 A;  3S9H A;  1CZB A;  1X9S A;  3M8S A;  3IRX A;  3SJJ A;  4AHT A;  3DRS A;  2O4G A;  3HST B;  3HVT A;  3MXJ A;  1JL1 A;  1JLQ A;  4KFB A;  3U3Y A;  1WN7 A;  3I0R A;  3QLH A;  2P5O A;  1A5V A;  2G8K A;  3AVB A;  4CK2 A;  4M3T A;  4FM0 A;  2E4L A;  4FJG A;  3ALY A;  1RBS A;  1VSF A;  4DQQ A;  1IO2 A;  1TAQ A;  4FJ9 A;  2KFN A;  1RBV A;  2Y1J A;  1NKC A;  1QS4 A;  2FC0 A;  3HPG A;  3U3G A;  2HHW A;  4CEE A;  3OYL A;  4BWJ A;  3VQD A;  4JS5 A;  3SUQ A;  5HRS A;  2OA8 A;  2B6A A;  1L3V A;  2HVH A;  3DM2 A;  4CGD A;  1QQC A;  4CK3 A;  3PO4 A;  2HHT A;  1VSI A;  4QAG A;  1HYS A;  1SV5 A;  2P51 A;  4I2P A;  4HTU A;  2VG6 A;  1BIU A;  3CFP A;  4RW4 A;  3VQE A;  1LWC A;  1U47 A;  3G10 A;  4K8Z A;  3KLF A;  2QKB A;  4FJI A;  4MQ3 A;  3M8Q A;  4B9N A;  2FBY A;  1VSL A;  3DLE A;  2ATQ A;  3V9Z A;  3QER A;  5JS1 A;  4CED A;  3V9U A;  1BI4 B;  3L2Q A;  3LDS A;  1TKT A;  1X1P A;  5KGW A;  3LP1 A;  4Q5V A;  1ASU A;  3HK2 A;  3OS0 A;  4DS4 A;  1U04 A;  1KSP A;  2QK9 A;  4Q0B A;  4CJF A;  3OYC A;  1HMV A;  4CGI A;  5KTQ A;  4E7I A;  1TKZ A;  4CFC A;  5KRT A;  2IDO A;  1G15 A;  3AVK A;  3V9S A;  3LP3 A;  4AIL C;  4O0J A;  4DTX A;  2D0C A;  2XHB A;  4NYF A;  5HRO A;  3IAY A;  1VRU A;  3AVA A;  5C24 A;  3ZT4 A;  5I3U A;  4CFB A;  4WE1 A;  3SNN A;  1B9F A;  4FJX A;  3HPH A;  3SUN A;  3V1Q A;  4DQS A;  4CF0 A;  3OY9 A;  3DRP A;  4FW1 A;  3SQ1 A;  3AVN A;  2HW3 A;  5K14 A;  4DLG A;  1FKO A;  2ZQB A;  3LP2 A;  4O4G A;  3VQC A;  4HVJ A;  3JYT A;  3TAN A;  2Z1J A;  3L8B A;  1T7P A;  2XO7 A;  3HL8 A;  2PY5 A;  4O0I A;  3T1A A;  3ZSY A;  1A5W A;  4HUG A;  4DTU A;  1D5A A;  3ZCM A;  2E6L A;  1RNH A;  4KHY A;  1RTH A;  3U6F A;  2OYQ A;  4DFM A;  4CIG A;  3AA3 A;  5D3G A;  2OPP A;  1SKS A;  4W5N A;  1LWE A;  2F96 A;  1DLO A;  1LWF A;  2IS3 A;  3DYA A;  3SQ2 A;  1QSS A;  3QET A;  4ICL A;  3RMA A;  3DOK A;  1RT1 A;  3LAN A;  3DLB A;  1ZBU A;  3QIN A;  1ITG A;  3NHG A;  4FJL A;  1BQM A;  3I8D A;  4KV8 A;  3TAQ A;  1C0T A;  4ID5 A;  1KLN A;  2B4J A;  4FM2 A;  3RMC A;  4N56 A;  4W5T A;  2HHS A;  1BQN A;  2VG5 A;  4B8C A;  4DU1 A;  3SQ0 A;  3CFO A;  3KD5 E;  4J2D A;  3H08 A;  2E6M A;  4YNQ A;  1UAX A;  1ASV A;  1EXQ A;  4BE2 A;  4CEO A;  1L5U A;  4CGH A;  3NH2 A;  2A1S A;  3VQ5 A;  4KB1 A;  1NK6 A;  5HLF A;  4N76 A;  4KHS A;  4C8M A;  1D9F A;  3ITH A;  4KHN A;  4CF9 A;  3ZSZ A;  3O3G A;  1HRH A;  3SQ4 A;  1J5O A;  2G8W A;  1VRT A;  4Z0U A;  3KLH A;  3SUO A;  4CK1 A;  3LWM A;  4OGC A;  2W42 A;  2HNZ A;  2WOM A;  1O1W A;  4KO0 A;  4F2R A;  2HB5 A;  4J2B A;  4CES A;  5SZT A;  2BDP A;  5CYM A;  1NOZ A;  4JLH A;  1HPZ A;  3OJU A;  2VWJ A;  3NH0 A;  4I2Q A;  3L2W A;  2FBX A;  3NH1 A;  1C6V A;  4IDK A;  3OS2 A;  3KK2 A;  4DTN A;  4FLY A;  2HHX A;  4C8K A;  4CJ4 A;  1S1T A;  5J2P A;  4FJK A;  3ASM A;  3DMJ A;  2HNY A;  3KJV A;  3G0Z A;  1HQE A;  4DMN A;  1RT4 A;  1RDC A;  3BGR A;  1XWL A;  2YHA A;  1UA1 A;  3LP0 A;  3OYE A;  4DS5 A;  4G1Q A;  3ZSR A;  4N5S A;  1NK7 A;  4FJ8 A;  3ULD A;  3QEI A;  2PZS A;  4DTR A;  2DFF A;  2X78 A;  2G8I A;  4PQU A;  2G8U A;  4IKF A;  1UWB A;  3SV4 A;  1RT3 A;  4CEC A;  1T8E A;  3AVC A;  5J2Q A;  3VQB A;  4DSI A;  3OYK A;  3SYZ A;  1HYZ A;  4HUE A;  4KRF A;  1GOC A;  2IAJ A;  3AO4 A;  3PV8 A;  4IFV A;  4IG3 A;  2O4I A;  5EU7 A;  1BGX T;  4BAC A;  3T19 A;  4DSF A;  3QEV A;  4FLX A;  1TL3 A;  3HYF A;  4NCG A;  1B92 A;  4HCB A;  4EP5 A;  2I5J A;  4M3Y A;  1VSH A;  1LAW A;  4XIU A;  4BE1 A;  4KI6 A;  2G8V A;  3KKS A;  4CHZ A;  3RRG A;  3DOL A;  1TGO A;  1R0A A;  2OPR A;  3RR7 A;  5E41 A;  3PX0 A;  4H8K A;  3CM5 A;  3HO1 A;  4B08 A;  3VQ7 A;  1JLB A;  3NF6 A;  5KRS A;  3L2V A;  4EZ6 A;  3AVL A;  3TAF A;  1BIZ A;  1TL1 A;  1YVU A;  2QKK A;  3WNG A;  2OZS A;  4CHY A;  4NCB A;  4KHU A;  3DI6 A;  4UQG A;  2GBZ A;  3K5N A;  2VG7 A;  3ZSV A;  3K2P A;  3QES A;  4CHQ A;  1KFS A;  4FZZ A;  5JS2 A;  4B3O A;  1KFD A;  2HVI A;  4CF1 A;  4PWD A;  3I0S A;  1JLF A;  2ETJ A;  1CXQ A;  1GOA A;  4CFD A;  3RMD A;  3AVH A;  4ZTF A;  4CHN A;  4CER A;  1NKE A;  5C42 A;  1NKB A;  3HJF A;  1EP4 A;  4CGJ A;  3B6O A;  3KLE A;  1T05 A;  1RCH A;  1J54 A;  1FKP A;  1RDA A;  1SKR A;  2OZM A;  3HM9 A;  2VWK A;  4F4K A;  4OLA A;  1KCF A;  1EET A;  1KVB A;  4LSL A;  4O5B A;  1Z25 A;  4BWM A;  4CGF A;  1TAU A;  1RBT A;  3L2U A;  1KLM A;  1IKX A;  1A5X A;  4AHS A;  1TK8 A;  1IKW A;  4DSL A;  2GV9 A;  2HHQ A;  3S3N A;  4DSK A;  4E89 A;  3AVJ A;  3TR8 A;  4KHW A;  1HQU A;  4Z4E A;  3OVN A;  1QE1 A;  4N41 A;  1NOY A;  3B6P A;  3ISN C;  4DTS A;  2OPQ A;  2F8S A;  4CJ3 A;  4B9L A;  3RR8 A;  4FZY A;  3WNF A;  2RF2 A;  3VQ8 A;  3ZT2 A;  4DFK A;  1QSY A;  2IGI A;  3NBP A;  4DF8 A;  4FJ5 A;  1CZ9 A;  2Q3S A;  5CZ2 A;  1NK4 A;  4Z4F A;  4FM1 A;  1YT3 A;  2RPI A;  3V1O A;  4TSX A;  4E7L A;  4L8R B;  1BCO A;  3L3U A;  4F3O A;  1S1V A;  3NGI A;  1TK0 A;  4ID1 A;  4OJR A;  3PO5 A;  3JSM A;  2BE2 A;  4AHU A;  3CQ8 A;  2RKI A;  1C1B A;  3L3V A;  3ZSX A;  3BDP A;  1S6Q A;  3AV9 A;  4CF2 A;  4M3R A;  1HNV A;  1IKV A;  1BL3 A;  1S1W A;  1XHZ A;  1LV5 A;  3KIO A;  3RMB A;  3HP6 A;  3VQ9 A;  3K5L A;  4BDZ A;  3KTQ A;  3SV3 A;  3TI0 A;  3OYM A;  3O4N A;  1U45 A;  1C1A A;  3LPU A;  1RT5 A;  1BCM A;  1J9A A;  1IH7 A;  1X9M A;  2G8F A;  1RBR A;  3P83 D;  4DWI A;  4I9Q A;  3K59 A;  2QXF A;  5KGX A;  4IBN A;  3C6U A;  4OKJ A;  4CJT A;  4DU4 A;  3C6T A;  3AVM A;  1VSD A;  4JRQ A;  4W5O A;  4ELT A;  4B9T A;  2JGU A;  4CJR A;  4Y1D A;  1ZBL A;  4DSJ A;  3QNO A;  2XRI A;  4M45 A;  4FYD A;  4QCL A;  3O3F A;  4CEQ A;  4B9M A;  1NJZ A;  3QEP A;  4DG1 A;  3KK3 A;  4B9V A;  4PA1 A;  1RDD A;  3HVR A;  3TAP A;  2FBT A;  3WNH A;  3IS9 A;  4DF4 A;  4FJJ A;  2Z1G A;  3KLI A;  1WSH A;  3M8P A;  1C1C A;  3MEE A;  4LY7 A;  2YKM A;  5SWM A;  1FK9 A;  1J53 A;  1TKD A;  4EZ9 A;  4OLB A;  1CXU A;  1LW2 A;  1S9G A;  2XY8 A;  4FJN A;  3OYB A;  5T7B A;  3KK1 A;  2JLE A;  1EKE A;  2YKN A;  4I9L A;  4N47 A;  3LWL A;  3TAE A;  3SPY A;  2NUB A;  4E7J A;  1XI1 A;  3NAE A;  2KFZ A;  4CEZ A;  2B5J A;  3V4I A;  3OYI A;  5CY4 A;  4I7F A;  1SUQ A;  2DTU A;  4FJM A;  1KTQ A;  4CEB A;  2KQ2 A;  3V1R A;  5I42 A;  3VN5 A;  2HMI A;  4DFJ A;  3PX4 A;  1S1U A;  1DTT A;  4O55 A;  4R5P A;  3QO9 A;  4JRP A;  4H4O A;  2XY7 A;  4Z4G A;  3RRH A;  1W9H A;  4B8A B;  5C25 A;  1BHL A;  1SL2 A;  1RIL A;  1KVA A;  3MEC A;  4OKK A;  4DFP A;  1U4B A;  4J2A A;  1ZBI A;  1Q8I A;  3A2F A;  3NF7 A;  3DRR A;  4M3U A;  4C8O A;  4E3S A;  1FXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...