3DLRA

Crystal structure of the catalytic core domain from pfv integrase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
186
structure length
155
Chain Sequence
b'QKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGSLLQEIRTSLYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Functional and structural characterization of the integrase from the prototype foamy virus.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase
total genus 53
structure length 155
sequence length 186
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dlrA00
4CIEA 1GOBA 3HJFA 1RT1A 1C0MA 3HPOA 4F8RA 1QQCA 1LAWA 2FBTA 3HSTB 4G1QA 1VSEA 3ZT2A 4DS5A 3QEVA 3BGRA 4E0DA 4FK2A 3D0PA 2Z1IA 1LAVA 3DOLA 5KRTA 4MFBA 4OKKA 4FCYA 3ZT3A 2XY7A 2B5JA 1U49A 3QIOA 1TVRA 4YFUA 4B9VA 4FJMA 4CEAA 2G8UA 4QCLA 3L3UA 4CERA 1DTTA 3LWMA 3UIQA 3V4IA 4N41A 1TK8A 5JS1A 3LZIA 4DQQA 3SUNA 4DTRA 4DSLA 2X6SA 4CEBA 1WAFA 2HW3A 1C1AA 1DTQA 3ASMA 1LV5A 2IOCA 1C0UA 1VSKA 3ZT4A 3QERA 4FM1A 4CJEA 4BWMA 3PY8A 4DWIA 3CYMA 1WSHA 4E7LA 2ZE2A 2IS3A 3QEXA 2HHVA 2I5JA 2RPIA 4CJSA 4JS4A 3DOKA 1VSMA 3VA3A 3QETA 3T19A 3RR7A 3L2VA 4N5SA 1J53A 4HUFA 3O3HA 3QESA 3AVCA 4CK2A 1R0AA 4DLGA 4E7KA 1KRPA 4BDZA 4FJ5A 4PY5A 1VRTA 3CFOA 3IG1A 1RBUA 3M8RA 3AVHA 5SWMA 1D5AA 2FBVA 1RILA 3VQ6A 1BHLA 3F9KA 1QTMA 3B6PA 3AO4A 4FJ8A 4CK3A 3T1AA 4AH9A 4F2SA 2XY5A 4EZ9A 1T05A 3MECA 2HHTA 4BE1A 2DFEA 1ASVA 3NFAA 2OZSA 3DRSA 4M42A 4PUOA 1NJXA 1WSEA 2PYLA 2W42A 1Y97A 3OYMA 4I2PA 2OPPA 4CF0A 2YV0X 4IBNA 3MXMA 1S1XA 3S9HA 3AVGA 3NGZA 4OVLA 3TANA 3M8SA 3TWHA 4OKEA 4FM0A 3RR8A 4M3TA 3LP1A 4NYFA 4NYNA 2OA8A 4CHYA 4OPJA 4RW6A 2X78A 2KQ2A 5T7BA 3KK2A 2G8WA 3OYGA 4E1NA 1J9AA 2ETJA 3NBPA 3V9SA 1HNIA 4Y1CA 1T7PA 3AVBA 4CIFA 3NDKA 4FJGA 4CFCA 2LSNA 1EP4A 1KCFA 5FRNA 4GVMA 1NJZA 2YNGA 4B9SA 1VSLA 3QO9A 4CGJA 3OYCA 1JKHA 1S1TA 1TV6A 2KW4A 4CHZA 3CFRA 3CFPA 4J2DA 3SI6A 4IFYA 4KHQA 4E7JA 1QS4A 5FROA 2B4JA 4CHOA 4O55A 4CJRA 4DU4A 1ZBLA 1EX4A 3ALYA 1BI4B 4FZYA 3JSMA 4FJ9A 3AO3A 4Z4GA 1J54A 3U6FA 4HCBA 2HHQA 2YKMA 1RT6A 1TKXA 1UOCA 2XY6A 1HYSA 4DG1A 2E6LA 4FLXA 5K14A 3OJUA 2OPQA 4KHWA 1JLFA 1MU2A 4IG0A 3PO4A 4AHCA 1ZBUA 3L2WA 3DM2A 3EY1A 3K59A 1Q9YA 1CLQA 4H4OA 2IDOA 5I42A 4W5QA 4W5NA 2DFHA 3KLHA 5J2NA 3SQ4A 3O4NA 2VG7A 1IKVA 3SUQA 1U4BA 2YHAA 4W5TA 4ICLA 1UAXA 3LAKA 3V1RA 4CJLA 1S1UA 1IG9A 5HLFA 1TK5A 4OGEA 1SL1A 3SQ1A 5SZTA 2YNHA 3MAQA 3TAGA 2HHXA 4PQUA 3KD1E 1RT7A 3KLEA 4CJ4A 1WLJA 1WN7A 3OYHA 3ZSZA 3TAQA 2D5RA 3AA4A 1D9FA 3HP9A 3OYNA 1TL1A 3VQCA 2HVIA 1XI1A 2OYQA 3RWUA 4OLAA 1XHXA 3H08A 5HRSA 1NK7A 3LAMA 1CXUA 2E6MA 5CY4A 4KAZA 3OY9A 3NHGA 4DTOA 1QSLA 4BDPA 1IH7A 2F8TA 1RDBA 5C25A 4JLHA 2NUBA 3NH2A 2BDPA 1L5UA 4CHNA 5J2QA 4FJKA 4ZHRA 2QKBA 5CZ2A 4HUEA 3TAPA 4W5RA 3C94A 3SUPA 4DQIA 1SKSA 1UWBA 3RRHA 3AO1A 2X6NA 2WOMA 4Y1DA 3I0RA 2P5OA 4AHRA 5DK5A 1RBTA 4CECA 1EXQA 2QK9A 1RT2A 4W5OA 4CGHA 4DSEA 4CF8A 3SV3A 1TKZA 1NK4A 5KI6A 4CEFA 2RN2A 4M45A 4OLBA 1LWFA 2RKIA 3L3VA 3L2QA 2FBYA 2YNFA 1HNVA 2HB5A 4E19A 3ITHA 3QEPA 3OYAA 1SL2A 1YTUA 2RF2A 1NK6A 5HBMA 4F3OA 2FBXA 3LANA 4O0IA 4PWDA 1JXBA 3NF8A 4CJPA 4CJTA 3TAFA 3CM5A 3V9WA 3PX4A 3HT3A 4DU3A 4AHTA 4LH5A 1JL2A 4I2QA 2A1RA 3HYFA 4M3WA 3AVIA 2VG6A 2XY8A 4CGDA 3NAEA 3QEIA 2P1JA 3SCXA 1HPZA 2XO7A 3K57A 1YVUA 1SUQA 1FKOA 3U3GA 4FLVA 5HRRA 1UA1A 3G10A 1RBSA 1HQUA 1FKPA 1TKDA 3V9XA 2F8SA 3AVFA 1BL3A 1CZ9A 3LP2A 1VSFA 3P1GA 4GMJB 4O4GA 4RG8A 4B9LA 4DFPA 4I9QA 5J2PA 1KSPA 3PV8A 2HNYA 4I9LA 3MEEA 3L2UA 4N56A 5HP1A 1A5XA 1K6YA 1Q8IA 4BWJA 1QHTA 2E4LA 3CG7A 3V9ZA 4FZXC 4B3OA 1KTQA 4UQGA 1QSSA 1XHZA 3LDSA 1S9GA 5KGWA 1F21A 4JRPA 3RRGA 2PY5A 1S6QA 3D45A 1U04A 4FW1A 5FRMA 4XIUA 3VQ9A 4CHPA 1DLOA 3ZT0A 5HRPA 4DFKA 3QNNA 3RMAA 4Q0BA 4OGCA 3L2RA 1W0HA 4CF2A 4DQSA 3VQDA 2YNIA 3V1OA 2HHUA 1VK0A 1IKXA 4KV8A 4Z4IA 4RW9A 4DSKA 4H8KA 4ID1A 3AA5X 1I39A 3DI6A 3KKRA 3VQQA 4AHSA 3DLRA 1HYVA 2IC3A 3B6OA 4EP5A 3F73A 3VA0A 3KD5E 1TAQA 3HPGA 3QINA 3OS1A 1D8YA 1JLQA 1RT5A 3VQBA 1KFDA 3O3FA 3MXIA 1WSIA 4IDKA 4MQ3A 4ZTJA 3KTQA 3VQ8A 3G0ZA 1JLGA 2Y1IA 4OJRA 3AVLA 1T8EA 4PA1A 1TK0A 3VQEA 4K8XA 4FLZA 4DTJA 1ZBHA 5JS2A 1SV5A 1ASWA 2D0AA 3MXJA 4CF9A 3NCIA 3RTVA 1L3SA 4KTQA 2IAJA 3O3GA 1BQMA 4Z4EA 4CJFA 3AO5A 2HVHA 3AVNA 3K5LA 3OYEA 1BQNA 1RTJA 1U48A 4J2EA 2X74A 3HP6A 4R5PA 3HVTA 3WNFA 4DTXA 2JGUA 4CEDA 1C6VA 1NKBA 4FJHA 1RTDA 3ZSVA 1RNHA 1GOCA 4FJLA 3P5JA 1ZYQA 3DRRA 1NK9A 3OYLA 2G8FA 2Z1HA 3TAMA 4CHQA 2WONA 4B9UA 1VRUA 4O0JA 2GBZA 1B9FA 1BIZA 1WSFA 1FK9A 4ID5A 4JRQA 4HHTA 1L3VA 1N6QA 1SKRA 2G8HA 4Z4FA 4DFMA 1EETA 3BDPA 3AO2A 3IS9A 4E7HA 4FLTA 2Z1JA 3M8PA 4B9NA 3ZSYA 4DTMA 3WNEA 2Y1JA 2O4IA 4FLUA 1JLCA 1IO2A 3NGYA 4AHVA 4Z4HA 3OYBA 2HNDA 4J2BA 3LPUA 4DTPA 2PYJA 2BANA 1EKEA 1HRHA 2D0BA 3VN5A 3PX6A 4KRFA 1W9HA 3HK2A 1REVA 4B08A 2P51A 3CQ8A 3WNGA 1D9DA 3OYIA 4CCHA 4L8RB 1LW2A 4CJVA 5KGXA 2VWJA 3HVRA 4FLYA 2KTQA 4CJKA 2A1SA 1X1PA 3K2PA 4E1MA 1X9WA 4B9TA 1JLBA 1S6PA 4DMNA 3HXMA 3SQ0A 4IKFA 3OS0A 3IAYA 3QEWA 2ZD1A 2HHSA 3NE6A 3NF7A 4DU1A 1X9MA 1VSIA 1S1WA 3SV4A 4KREA 2VG5A 4FJJA 4AILC 1XWLA 5CYMA 1A5WA 2OZMA 3DLEA 4QAGA 3SYZA 3T3FA 1VSDA 3OJSA 4OPKA 3RMBA 4KHYA 3EYZA 3MEDA 1SKWA 4DLEA 3S3NA 5J1EA 3AVMA 3PX0A 1G15A 4QOZB 2B6AA 1RCHA 2OPRA 2OPSA 3HM9A 5KTQA 4FYDA 3I0SA 4FJXA 1BIUA 4C8KA 4B8AB 1X9SA 4C8LA 3SNNA 1U47A 1J5OA 1TL3A 3SUOA 3LP3A 1KLMA 4TSXA 1Z25A 3LZJA 1CZBA 4CK1A 4FZZA 4CJWA 2R7YA 3TI0A 3ZSWA 1XC9A 4RW7A 4CFBA 3EZ5A 3L8BA 4C8OA 3V9UA 3SPZA 1C1CA 3OYKA 4F4KA 5KRSA 2DY4A 1QSYA 4BE0A 3OYFA 2KZMA 4FK4A 2HHWA 1GOAA 4KHNA 1B92A 4HCCA 4KKOA 1WAJA 3IRXA 3TR8A 3TAEA 1NKCA 2KFZA 5EU7A 2FC0A 4DF4A 3SPYA 4LH4A 1NK5A 3VQAA 4FLWA 5C42A 3K5MA 1ZBFA 3O4QA 3S3MA 1T03A 2DTUA 3K5NA 4NCBA 1KFSA 1S9EA 4Z0UA 3ZCMA 4CJQA 1WSJA 3NGIA 1NOZA 4DFJA 1RDAA 3VQ7A 3ZSOA 4CE9A 3OYDA 3LWLA 1NJYA 2BGGA 3AVAA 1BCOA 2QXFA 2VWKA 4FW2A 4CJUA 2YHBA 3KJVA 1Q9XA 4KPYA 4E7IA 1RT3A 4EZ6A 3KK3A 1L3UA 4FK0A 4NCGA 4F3TA 4DF8A 3ISNC 4M41A 3KLGA 1ITGA 1CXQA 1JLEA 2ZQBA 3HL8A 4RW4A 4CGIA 3KKSA 4DTUA 4F2RA 5J2MA 4B9MA 2KFNA 3HO1A 1TKTA 2O4GA 3DLGA 5I3UA 4DQPA 3AVJA 4IFVA 4CEOA 3K58A 4YNQA 2G8KA 4ZTFA 2HMIA 2PZSA 1I3AA 1O1WA 1HJRA 4C8MA 5HROA 2EHGA 4KHSA 1NK8A 1JL1A 3PUFA 1RDDA 1NOYA 3A2FA 3AA3A 4FM2A 3NF6A 5E41A 3SZ2A 3HPHA 1BCMA 1VSJA 4FJNA 4CESA 4FXDA 1IKWA 2EX3A 3DLHA 4CGFA 3LP0A 1L3TA 1TAUA 2HNZA 3QNOA 3AV9A 3NH1A 3JYTA 4HTUA 4AHUA 4OKJA 1U45A 1WSGA 4B8CA 4CJ3A 4DS4A 1SL0A 4EP4A 2DFFA 3PO5A 3TABA 4CEQA 1HQEA 1RBVA 3AA2A 5C24A 2IGIA 2KZZA 2ATQA 4FVMA 4M3RA 4BACA 1QE1A 4BE2A 3S3OA 4E89A 4BDYA 4DSFA 5D3GA 1YTAA 3M8QA 1FXXA 1IKYA 2GV9A 4HUGA 3SJJA 2AJQA 4IG3A 4DQRA 1RTHA 1ASUA 4JS5A 4KB0A 3OVNA 3C6TA 5HRNA 2Z1GA 1HMVA 3C95A 1JLAA 1S5JA 3V81A 2XRIA 3E01A 1N5YA 2Q3SA 1WNSA 3QLHA 4CFDA 3SQ2A 4K8ZA 4LSLA 2P5GA 4I7FA 1KVAA 4CJ5A 4H4MA 3THVA 1RT4A 5DMRA 4GW6A 2YKNA 3VQ5A 3VQPA 4CGGA 4M3XA 1BISA 3P83D 2G8IA 4O44A 1S1VA 4LY7A 4ELUA 1TGOA 3QIPA 1HYZA 3LPTA 1BGXT 2D0CA 2QKKA 1C0TA 4CIGA 3DYAA 2G8VA 4DSIA 4LD0A 1KVBA 3KK1A 3C6UA 3I8DA 4DSJA 3MEGA 4KTZA 1KLNA 4KTWA 3VQ4A 1A5VA 3AVKA 4M3UA 1ZBIA 1B9DA 1YT3A 3LALA 4CEEA 3ZSXA 3NH0A 2GUIA 1C1BA 3DMJA 4WE1A 1RTIA 4CEZA 3KIOA 4HVJA 1NK0A 4Q5VA 4FJ7A 3WNHA 3OS2A 3K5OA 3ZSRA 1LW0A 4NCAA 3KLIA 4LSNA 3TARA 4N47A 4J2AA 3DRPA 4KHUA 4RW8A 1NJWA 3RMDA 1NKEA 4Z4CA 3V6DA 3CM6A 4KB1A 4FJIA 1VSHA 5CZ1A 1Z26A 5CYQA 3KLFA 1LWCA 4KO0A 4E3SA 2F96A 2JLEA 2ITGA 4ELVA 4M3YA 1RDCA 1LWEA 4DTNA 4N76A 3U3YA 1RBRA 5FDLA 3ULDA 1JXEA 1KVCA 3V1QA 3NF9A 4ELTA 3FFIA 1BI4A 3ZSQA 4KI4A 3RMCA 3DLKA 4KFBA 4O5BA 4CFAA 4KI6A 2BE2A 4M3ZA 4CF1A 4C8NA 2XHBA 1UA0A 3DLBA 3ZT1A 3OYJA 4DTSA
chains in the Genus database with same CATH superfamily
4FWRA 3T7ZA 1QQCA 1LAWA 2FBTA 4G1QA 3QEVA 4E0DA 1DKGD 5TKYA 1MWMA 2Z1IA 3D2EB 3DOLA 4ISFA 4FCYA 5KPRA 4UY8O 1VQ9N 3BZCA 1U49A 5KPZA 2BUPA 4B9VA 4DCHA 3AGKA 3UIQA 4DQQA 3SUNA 4DSLA 2HW3A 1DTQA 3CCEN 2IOCA 3Q7BA 2A42A 4CJEA 3MX5A 4CBUA 4WQ5C 3T19A 2VCPA 2ZJQL 1VQLN 5EXWA 4CK2A 4HWIA 3ATUA 5M1NA 3TPQA 4PY5A 1VRTA 3AVHA 5SWMA 1BHLA 5AZJB 3N4PA 2ASOA 1HR0K 4AH9A 2DFEA 1ASVA 1HX1A 3DXKA 1S72N 4YDUC 3QDKA 1BUPA 5AQYA 5E84A 3OYMA 3WEEB 5FPEA 1VQON 1W97L 3VF2A 3AVGA 3NGZA 2O8FA 4BR2A 4BVOA 2GWJA 5AQVA 3P38A 4M3TA 3LP1A 4B3TK 2X78A 5T7BA 2G8WA 4LF5K 1J9AA 3BP8A 2FF3B 1HNIA 3C7NA 4FJGA 2P9NB 2QWLA 2CH6A 5FRNA 3VESA 5M1PA 1JKHA 4O8UA 4CHZA 3CFRA 1XNQK 3FR0A 5AQHA 3A5OC 3HZ6A 4IFYA 4KHQA 3ALYA 4PL7A 4DHYA 2FSJA 3CC2N 1J6ZA 2E20A 1LOTB 1T44A 4GKJK 1RT6A 1TKXA 1HYSA 3IFRA 2CGJA 1JLFA 3PO4A 4ILGB 3IUCA 3L2WA 3H1VX 4FPBA 3CCUN 2KHOA 1Q9YA 4H4OA 5I42A 4EFHA 3O4NA 2VG7A 4BREA 1NMNA 4DV2K 4CJ7A 4W5TA 2A3ZA 3UKRB 5M1FA 4CJLA 5HLFA 1D4XA 1TK5A 3VPZA 1C0FA 3MAQA 4CJ4A 1WLJA 4JKBA 2UUBK 3AA4A 1WOQA 1TL1A 3U8XA 1XI1A 1X3MA 2FXUA 3LAMA 3E9OA 1CXUA 2E6MA 3MK6A 5CY4A 1RDBA 4JLHA 2NUBA 1L5UA 5BN8A 5J2QA 4B3MK 2QKBA 4K43A 4FOEA 4PKHA 1N34K 1SKSA 4B3SK 3DXKB 2KKZA 2OCEA 5AQIA 4CGHA 4CF8A 1TKZA 2ZM6K 4M45A 1LWFA 4NO7A 1HNVA 4H03B 3OYAA 1SL2A 1NK6A 4PWDA 3NF8A 3PX4A 3V9WA 1JL2A 4LFBK 3AVIA 4CGDA 2XY8A 3NAEA 4H5NA 3LDPA 3FZMA 3H3NO 1FKOA 1ATNA 4KH6A 3B8AX 3AVFA 1CZ9A 4RG8A 4O4GA 4DFPA 1VHXA 4I9LA 3ZEUA 1NWKA 1K6YA 1Q8IA 2YX6A 4FZXC 1U6ZA 2Q0RA 5A2QO 1S9GA 2ASMA 3GDQA 3THYA 1U04A 4FW1A 1XQSC 1DLOA 2A40A 4OGCA 4CF2A 5F2RA 3MWPA 1IKXA 3E9PA 1YHQN 4RW9A 5C2DA 2V51B 3CJ1A 4H8KA 4FO0A 3B6OA 4YHHK 3KD5E 5CHIA 3BEXA 3EZWA 1NGJA 2JWLA 1KFDA 1WSIA 4MQ3A 3KTQA 5ADXA 3AVLA 1T8EA 4XH1A 1TK0A 4B3RK 1ZBHA 1HUXA 1SV5A 1ASWA 3EO3A 3MXJA 1YITN 1GLAG 3RTVA 3MX2A 4A2BA 4CBXA 2VWBA 3O3GA 1BQMA 2E2QA 4CJFA 3O9SA 3HSCA 3AO5A 4GY2B 3WQTA 3AVNA 5TKWA 3VENA 4J2EA 3QMLA 4R5PA 4DTXA 1M1KO 1NKBA 1RTDA 3ZSVA 3VTHA 3U9DA 3VEZA 4CHQA 1VRUA 1WSFA 3EEQA 3BDPA 1Z6RA 2QWMA 3ZSYA 4MO4A 2OTLN 3PSFA 2Y1JA 2O4IA 4H5WA 3IKMA 3J81O 3PSIA 4DTPA 3TTDA 1EKEA 3DJCA 2VQEK 1W9HA 4B08A 3WNGA 2VQFK 1BOTO 4FLYA 1P8ZA 1NGBA 1X1PA 4E1MA 1JLBA 2E1ZA 2E88A 4BRKA 3IAYA 1QZ6A 3ENHA 1X9MA 3SV4A 2OZMA 4BC3A 3O1WA 4IZ9A 3R8EA 3EYZA 4V19S 3MEDA 1SKWA 5J1EA 3PX0A 2OPSA 2OPRA 4FYDA 3I0SA 3EE8A 4B8AB 1X9SA 4C8LA 3SNNA 3SUOA 3TU5A 1CZBA 4BR7A 4CK1A 4CJWA 3CPEA 3ZSWA 3L8BA 5GIOA 3V9UA 3OYKA 3EL2A 4C23A 3WUHA 4KHNA 1TUUA 4NXNK 4HCCA 5AQXA 4PKGA 2DPNA 2Q2RA 3CCVN 5EU7A 4LH4A 3VERA 4J8FA 1NK5A 3KHYA 3CCQN 3KWGA 1T03A 3K5NA 4Z0UA 2NRHA 4FVUA 3NGIA 1RDAA 2BGGA 2GTDA 3THXA 3TTCA 4JK9A 4DV3K 4F3TA 1YAGA 3KLGA 4DTUA 4F2RA 3KK7A 4B9MA 3HO1A 1WBDA 4JV5K 2P9PA 5C10A 2W41A 2QWNA 1FW6A 5C0YA 1NK8A 3PUFA 4DR5K 3A2FA 3AA3A 3HPHA 1BCMA 4FXDA 1IKWA 1GLFO 3U9ZA 3NH1A 4OKJA 4B8CA 4B1XB 1HQEA 4H5VA 2IGIA 1Q86O 1OKJA 4E89A 4DSFA 2YCHA 1YTAA 3M8QA 3OA9A 3I8BA 3AGRA 4DQRA 4CZEA 5JVGL 3E01A 4DV6K 4JI6K 4CFDA 1QQNA 3SQ2A 4WQ4A 4CJ5A 3ZYYX 3T1YK 3THVA 3VQ5A 3VQPA 2Q1NA 2OTJN 4M3XA 3J7ZO 1S1VA 1E4FT 4ELUA 1VQNN 2NNWA 2QKKA 1C0TA 1KVBA 1DEJA 4DSJA 4M3UA 3VQ4A 1A5VA 3AVKA 1B9DA 5JS1A 3LALA 3ZSXA 1VQ5N 3OS2A 4IJNA 1W7AA 3TARA 3TSQA 4KHUA 5I9EB 4NXMK 1LWCA 2ITGA 1QQOA 4M3YA 3A5MC 1LWEA 3THXB 1RBRA 5FDLA 4ELTA 1BI4A 3ZSQA 5B8HA 5GAHP 1HNXK 3LL3A 4KI6A 1VAZA 4G9ZA 3O4WA 2QA4N 3HJFA 1GOBA 4JK8A 1RT1A 3HPOA 2YHWA 1IJJA 1RGIA 4MLHA 3ATVA 3D0PA 3TSPA 5JMVA 4DKWA 1KC8O 1LAVA 4H0PA 3VGMA 4OKKA 5KRTA 2P9KA 3ZT3A 2B5JA 3JS6A 2QW9A 1TVRA 4YFUA 4H5TA 2G8UA 3L3UA 4BRNA 3LWMA 3I33A 4PHTX 4FSVA 4BRMA 4DTRA 4JI7K 1C1AA 3J7AP 1C0UA 5AFUH 2BH1A 3PY8A 4A2AA 3CYMA 3CI5A 1WSHA 5AZIA 2IS3A 4IWVA 4NB4A 2HHVA 4CJSA 4CZLA 1X9JA 1WBBA 5CE3A 3QETA 3QBWA 1BG3A 1K8AO 5LY3A 4HUFA 3QESA 4IOAL 2WFBA 1YJWN 1KRPA 3GG4A 4EHTA 4FJ5A 3IG1A 3SAHA 1RBUA 4JI4K 4BG8A 4CK3A 4AM7A 1N32K 2HHTA 4JEPA 4BE1A 2OZSA 3CQYA 4BRQA 1BDGA 4K0KK 3LDNA 3D2EA 1WSEA 1CZAN 3MXMA 5DM6L 3S9HA 4OVLA 3TWHA 5JLHA 4NYFA 2OA8A 4DR6K 4GV6A 2KQ2A 4DR4K 1QVFM 4BRHA 1T7PA 3AVBA 4CFCA 2P9UB 1EP4A 1NJZA 4WYBA 3CCSN 4CGJA 3CFPA 1TV6A 3UE5A 4KH4A 1VQ4N 4CHOA 4CJRA 2QI2A 1BI4B 3O80A 3JSMA 1KAZA 3U4LA 3AO3A 4IOCL 1J54A 1OVYA 4DG1A 3SLCA 4LF6K 4KHWA 4AHCA 1NLVA 3DM2A 4WQ5A 3PIPL 1R59O 4W5QA 2FLOA 2DFHA 5AQGA 2P9KB 2NRTA 5AJ3K 3SUQA 1UAXA 4A61A 1S1UA 4BVPA 4OGEA 3HBTA 4U67L 3SQ1A 3TAGA 4HTLA 1HLUA 2HHXA 4PQUA 2P9NA 4JI3K 1WN7A 2IVNA 3TAQA 5AZIB 4CI6A 4ISEA 2D5RA 4YOYA 4Z94A 1D9FA 3A5LC 4X64K 2HVIA 3RWUA 4YDUA 1XHXA 3BF3A 2F9TA 3ID6A 4DTOA 1QSLA 4EAHD 3WXKA 2QXLA 4FJKA 1N33K 1EQYA 4HUEA 3TAPA 4W5RA 3OBYA 1UWBA 3N4QA 3AO1A 2WOMA 4AHRA 1DGKN 3G6EN 4W5OA 4H0YB 4CEFA 3A5NC 3UKRA 2RKIA 3L2QA 2YNFA 3J80O 2ASPA 1G99A 2RF2A 1YTUA 3L6QA 3CJCA 4AHTA 3EE9A 4I2QA 4M3WA 1ILYA 3QEIA 3GL1A 2P1JA 3ZX0A 1YVUA 3U3GA 4FLVA 3G10A 4DV0K 3M6GA 2F8SA 1VQ6N 4B9LA 3P1GA 4YOVA 4H0VB 4I9QA 4N56A 5HP1A 4PL8A 3D2FA 4FWQA 4JKEA 4BWJA 2E4LA 1GLDG 3V9ZA 1KTQA 1NMDA 1QSSA 3LDSA 3RRGA 4JRPA 1S6QA 5BPMA 3RMAA 4DFKA 1W0HA 3VQDA 4R79A 1J5EK 4NLBA 4FWOA 4OO1J 3VQQA 3F73A 4EP5A 3MN9A 2O8DA 2W40A 3VQBA 3OYJA 4ZTJA 3VQ8A 2Y1IA 3VQEA 4FLZA 5JS2A 4CF9A 2NRZA 4KTQA 5KQDA 2IAJA 3K9JA 1EO1A 1ZBSA 1RTJA 1U48A 2JGUA 4CEDA 3M1FA 4FJHA 1RNHA 1Z05A 2RHKA 2Z1HA 4DV1K 1SZ2A 1M90O 2GBZA 3ZLJA 1L3VA 1N6QA 4HHTA 4JD2A 2G8HA 4LC9B 1EETA 4E7HA 2Z1JA 1NNEA 4DTMA 4FLUA 1BA0A 3KVGA 2UUCK 3LPUA 2BANA 1HRHA 2D0BA 3VN5A 3G4SN 4KRFA 1NGFA 4FWNA 4CCHA 3R9PA 4CD3A 3OYIA 1LW2A 4CZFA 4CJVA 5KGXA 1K73O 4CW7B 4YORA 4CJKA 3K2PA 4CZGA 1X9WA 4B9TA 3CJAA 3Q7CA 3OS0A 4MDBA 3QEWA 2HHSA 1IG8A 1VSIA 4KREA 4FJJA 5CYMA 2P9LB 1A5WA 2VGMA 4QAGA 1JCFA 3D2FB 1VSDA 4B9QA 4QS7A 3OJSA 3RMBA 4KHYA 3IDHA 4GNIA 2ZF5O 5AQQA 1XNRK 1G15A 4QOZB 3HM9A 1RCHA 2HBMA 1Q18A 2JWKA 1U47A 1TL3A 4CZJA 1KLMA 4TSXA 4BRIA 2YHXA 1EWRA 3LZJA 1IBLK 4YOWA 2CGLA 2R7YA 2O8DB 1XC9A 4BRAA 3EZ5A 4C8OA 3SPZA 4A62A 5AQPA 2UXBK 3LM9A 4BE0A 2KZMA 1B92A 3QFUA 3S41A 3IRXA 3H45C 5AQJA 4EHUA 3TR8A 1NKCA 4M7YA 5BREA 3C6AA 3VQAA 5FPDA 4FLWA 3O8MA 4NCBA 5AQOA 1NOZA 5AQTA 1IV0A 1NJYA 2QXFA 2VWKA 4E7IA 2D0OA 4EZ6A 3CHWA 4NCGA 3O1BA 4DF8A 3FGUA 4IFEA 4JD2B 1ITGA 2NRVA 2Q31A 4CGIA 3NMUA 5J2MA 5AQUA 1TKTA 3DLGA 5I3UA 4DQPA 3AVJA 4O8KA 4IFVA 4CEOA 3K58A 4YNQA 2G8KA 1O1WA 1EWQA 4C8MA 5ADXH 3LDQA 4AF1A 1QHAA 4FJNA 4I6MA 1RDUA 2HNZA 2W6KA 4IXCA 4HTUA 1WSGA 1GLBG 2DFFA 3AY9A 4CEQA 2P9SA 3AA2A 5C24A 4M3RA 4A57A 1QE1A 3S3OA 4IG3A 3FZFA 1ASUA 4JS5A 1JJ2M 2Z1GA 1HMVA 2XRIA 1SAZA 4WFBL 1WNSA 4MO5A 3QICA 4K8ZA 2W6LA 4LSLA 3FFKB 4I7FA 4DR1K 2YKNA 4CGGA 5AQRA 4LY7A 1TGOA 4KH5A 1BGXT 4DSIA 3KK1A 3I8DA 3KZBA 4KTZA 3PO5A 2GUIA 2I7PA 4WE1A 4FWSA 1RTIA 4CEZA 4X65K 4FJ7A 4Q5VA 4DUZK 1LW0A 4NCAA 2QM1A 4LSNA 3TSUA 3ZETA 3RMDA 3V6DA 4PKIA 1VSHA 5CZ1A 5CYQA 5F0XA 1YIJN 4KO0A 3WXMB 4BRPA 2NRXA 4E3SA 1JCEA 2JLEA 4ELVA 2O8EA 4CZMA 5BR8K 4YOUA 1JXEA 4CVNE 1NG9A 3AAPA 2BE2A 4CF1A 4C8NA 1UA0A 3CMEN 4JKFA 2UXDK 3OYLA 4JKAA 1OVQA 4DTSA 1NGIA 3W3DA 4F8RA 2FSNA 3L4IA 2AA4A 4JHDB 3VETA 4DS5A 3GE1A 3AAQA 4K42A 4LF7K 4I6MB 3MDQA 4O5FA 3RVCA 3T1HK 4EIAA 4M7XA 4FJMA 4CEAA 3MN7A 1DTTA 1P90A 4CERA 3V4IA 4N41A 3C65A 3LZIA 2X6SA 5AQNA 1WAFA 2QWQA 2P9SB 1VSKA 3BUZB 1VQ7N 4DWIA 3ULEA 3L0QA 3QEXA 2RPIA 2PBDA 3DOKA 1VSMA 1Y64A 4A59A 4N5SA 3O3HA 3AVCA 4DLGA 2WC9A 4BDZA 2HF4A 3CFOA 3VEVA 3M8RA 5BPNA 5CR4A 1D5AA 2FBVA 1RILA 4DR2K 3F9KA 4XH4A 3AO4A 3T1AA 1KAYA 2UUAK 2D1KA 2CGKA 1T05A 3MECA 3C6HA 5M1KA 2ITMA 1S22A 3NFAA 4M42A 1DT9A 2PYLA 3H46O 1K9MO 4CF0A 2VYPA 4RCHA 4IBNA 4BR0A 1NJIO 3O6WA 3PLAA 3TANA 1NBWA 4B1VA 4OKEA 4FM0A 3RR8A 4NYNA 4OPJA 4JKGA 4RW6A 3OYGA 4E1NA 2ETJA 3NBPA 4F9OA 3V9SA 3K9KA 3ZETB 2QWRA 4GVEA 1KCFA 1VQ8N 2YNGA 4B9SA 1VSLA 3ENOA 2O8EB 4J2DA 2GX9A 1YUWA 3NVKA 4E7JA 5FROA 1ZBLA 4O55A 4X66K 3VOVA 3CC4N 4FJ9A 1NGGA 4Z4GA 3U6FA 3VEOA 5KPTA 2YKMA 2XY6A 4FLXA 3OJUA 2EWSA 2GUPA 2Q0UA 3LM2A 3WQUA 1MU2A 4IG0A 5AR0A 3E9LA 4DV5K 1HPMA 2HHHK 3EY1A 1CLQA 4AQYK 3VF6A 4W5NA 5J2NA 5FPMA 3SQ4A 1IKVA 3D6RA 3WXIA 4BQZA 5BRHA 1VQKN 4BRFA 4ICLA 3I55N 3LAKA 4BQLA 3V1RA 1IG9A 4DR7K 2OANA 3H1QA 3M5RA 4JKCA 3KD1E 4LF8K 1RT7A 2P9UA 3KLEA 3F9MA 1ESVA 3ULEB 4ILJA 5BPLA 3UKUA 2Q97A 3J7YP 3HP9A 1TYQA 3VQCA 3H08A 4OX9K 1KAXA 3NHGA 5BR9A 1IH7A 3NH2A 1KD1O 1YJ9N 4DQIA 1T3VA 3FZHA 1SQKA 2F4VK 3RRHA 3HM8A 2X6NA 1WUAA 4Y1DA 3I0RA 2P5OA 1RBTA 1EXQA 2QK9A 2HBLA 3LDLA 3SV3A 1NK4A 4OLBA 3L3VA 2IVOA 2HB5A 3QEPA 4F3OA 4JKGB 4O0IA 4CJPA 4CJTA 4IO9L 3HT3A 3CCMN 4LH5A 2A1RA 1BWFO 2XO7A 3K57A 3O08A 2F7TA 5HRRA 3THWA 1FKPA 1HJOA 3LP2A 1QZ5A 3CMAN 1KSPA 2HNYA 3CJ9A 3MEEA 3L2UA 3AARA 3ZX3A 1U2VA 5JVHL 4B3OA 1XHZA 5KGWA 1F21A 2V52B 3D45A 1LCUA 4XIUA 4B1YB 5HRPA 3L2RA 4DQSA 2YNIA 2HHUA 4IOXA 1VK0A 2KLAA 5M1QA 4Z4IA 4DSKA 1MA9B 2FSKA 3AA5X 3DI6A 4AHSA 2IC3A 2E2NA 1TAQA 5EX5A 3EKSA 3HPGA 5BN9A 3EKUA 1JLQA 1RT5A 2YJFA 3MWTA 4IDKA 2ZJPL 5FLXO 1YJNN 3G0ZA 3UKUB 1JLGA 1TYQB 4PA1A 4K8XA 4DTJA 3ID8A 3MCPA 3NCIA 1S3XA 5GADP 2HVHA 3VMFB 3K5LA 5HL7L 1BQNA 3HP6A 3HVTA 1C6VA 3E66A 1K8KA 3CXCM 1ZYQA 3DRRA 1NK9A 2G8FA 2WONA 1B9FA 4JRQA 2HHWA 3A8YA 4JI1K 1SKRA 4Z4FA 3AO2A 3IS9A 4FWLA 4CZHA 5GIPA 1XC3A 4IEEA 3CCRN 4FLTA 4B9NA 4B1ZA 1JLCA 3NGYA 4Z4HA 3OYBA 3FZKA 4FL9A 3HK2A 2A6AA 3CQ8A 4L3QA 1D9DA 4L8RB 2BTFA 2VWJA 4H0TB 3VGKA 4A5BA 4BRLA 2A1SA 3THWB 1S6PA 2H3GX 1GLCG 2ZD1A 1YF5L 3NF7A 1GLJO 3M3ZA 2VG5A 3IMXA 4JKHA 3DLEA 1U2VB 3SYZA 2O8CA 4H0OA 4KBOA 4CBWA 3P4IA 4DLEA 3S3NA 3AVMA 1HKGA 5KTQA 5LJWA 1BIUA 4WF9L 3R6MA 3CETA 4E1JA 1Z25A 4JNEA 4K41A 1NGAA 3HRGA 3F2KA 3TI0A 1YI2N 5AQWA 4CFBA 1C1CA 3OYFA 4OPAA 1GOAA 4KKOA 3OHRA 3BF1A 4DF4A 3SPYA 4FOIA 5C42A 2ZWHA 5HOOA 3P31A 3O4QA 3K5MA 2DTUA 1S9EA 3ZCMA 2P9LA 1WSJA 3O9RA 4U7BA 3VQ7A 3AVAA 4KPYA 4FW2A 3KJVA 1H1VA 1K8KB 5E26A 2O8BB 4FK0A 4JK7A 3ISNC 1CXQA 1JLEA 2E5LK 2KFNA 2D4WA 3O9UA 2PZSA 5LMUK 4ZTFA 4IDHA 3D7EO 1I3AA 3MN5A 1HJRA 5HROA 2EHGA 2GWKA 3SMPA 1VSJA 2NRWA 2P9IA 2EX3A 4CD1A 3DLHA 4CGFA 3SBTA 3LP0A 1L3TA 1TAUA 4GKKK 3QNOA 5ELZA 2YJEA 3QB0A 1U45A 4CJ3A 4EP4A 3TABA 3RSEA 2E2PA 1RBVA 2QTDA 3OTOK 2ATQA 4BACA 4BE2A 5D3GA 4HUGA 1FXXA 4IO8A 3P39A 2AJQA 2O8CB 1ZC6A 4KB0A 3OVNA 5HRNA 4IJAA 3EN9A 3O9QA 3C95A 1JLAA 3V81A 4ILHA 3JXUA 2Q3SA 3QLHA 3QBXA 2V7YA 2YHYA 2P5GA 1KVAA 4H4MA 5GAGP 1RT4A 5DMRA 4GW6A 3CC7N 3SJHA 1BISA 3C0BA 4YOTA 2G8IA 4O44A 5LMNK 2UXCK 5C12A 3DYAA 2G8VA 4LD0A 4MLEA 3C6UA 3CF5L 4JI5K 1KLNA 1YT3A 4CEEA 1C0GA 1HNWK 2A5XA 3DMJA 4BR4A 1NK0A 3WNHA 3ZSRA 2E1YA 4J2AA 4WCEL 3FZLA 1NJWA 2GEMA 4Z4CA 3HOTA 3KLFA 5GINA 2F96A 1T6CA 5IWAK 4DTNA 5C2FA 3U3YA 3F5TA 3ULDA 3V1QA 3NF9A 3FFIA 4C1NI 3RMCA 3DLKA 4KFBA 4O5BA 2CH5A 5MLCQ 4M3ZA 2XHBA 3SAFA 3ZT1A 2QWOA 1QQMA 4CIEA 1C0MA 1HKCA 3HSTB 3ZT2A 1VSEA 3BGRA 4FK2A 2UYTA 5AQFA 2P9IB 4LF9K 4MFBA 2HBKA 4MDAA 5FPNA 3PIOL 2XY7A 4CZKA 2AP1A 3W0LA 3QIOA 4LFCK 4QCLA 1N36K 1MDUB 2O8FB 4H5RA 1TK8A 3GOIA 4CEBA 3RSEB 3CCLN 3ASMA 1LV5A 3QERA 3ZT4A 4FM1A 4BWMA 3C7NB 4BC2A 4E7LA 2ZE2A 2I5JA 4JS4A 3VA3A 4X62K 3DXMA 3L2VA 2WTUA 3RR7A 1BO5O 1J53A 2IIRA 5AQMA 1NGEA 1R0AA 1VQMN 2QEXN 3WXJA 3CQXA 1OH5A 1GLEG 3R3LA 3VQ6A 1QTMA 3DLLL 3B6PA 4FJ8A 4F2SA 2XY5A 1Q82O 4EZ9A 2HOEA 1IBMK 4JHDA 3DRSA 4KHPK 4PUOA 1NJXA 2YI1A 2W42A 1Y97A 4FWKA 4I2PA 2OPPA 4GV3A 2YV0X 1S1XA 1YVNA 1E3MA 1XUPO 3M8SA 1KXPA 4IEIA 4CHYA 2E2OA 1O13A 3KK2A 1RFQA 4QS8A 1N8RO 4Y1CA 3NDKA 4CIFA 2LSNA 4BROA 2HMPA 3SAGA 4FWPA 4GVMA 2PFUA 3QO9A 3OYCA 1S1TA 2KW4A 3SI6A 3FLCO 3H3OB 1QS4A 2B4JA 4DU4A 1EX4A 4FZYA 2WUSA 1NU0A 2V7ZA 1NGHA 1MWKA 5LL6Z 4HCBA 2HHQA 4DV4K 1UOCA 2ZGZA 2E6LA 5K14A 2OPQA 2WBNA 4JI8K 2E8AA 1ZBUA 3O9TA 3SMSA 3K59A 4Y0WA 2IDOA 3ENBA 3KLHA 3HOSA 1U4BA 2YHAA 5BRFA 5LJVA 4AM6A 1HKBA 1SL1A 5SZTA 2YNHA 3J8AA 5C15A 1VQPN 3OYHA 1BA1A 3ZSZA 3G25A 2ZJRL 4ISGA 3VEYA 3H6EA 4B1WB 3BY5A 2F9WA 3OYNA 3HTVA 3DXMB 4DV7K 4OLAA 2OYQA 2A41A 5DM7L 3MN6A 5HRSA 1NK7A 4KAZA 3OY9A 4JN4A 4BDPA 2F8TA 1FJGK 5C25A 2BDPA 1T6DA 3MCAB 4CHNA 4ZHRA 3VGLA 3OBWA 5EVZA 5CZ2A 3ZEUB 3SUPA 3C94A 3JAMO 4NLCA 3CJBA 4FPAA 5DK5A 4CECA 4DUYK 1RT2A 2IVPA 4DSEA 3THYB 2D0PA 5KI6A 1NM1A 4BGBA 2RN2A 4GV9A 2FBYA 4E19A 3ITHA 5AQLA 5HBMA 2FBXA 3LANA 3T69A 1JXBA 3TAFA 3CM5A 4DU3A 4JKDA 3HYFA 4WFAL 1NGCA 2VG6A 3SCXA 1HPZA 1SUQA 5M1OA 1UA1A 1RBSA 1HQUA 3WT0A 1NGDA 1HNZK 1TKDA 3V9XA 1BL3A 4GMJB 1VSFA 4DQ8A 5J2PA 3PV8A 1XMOK 4BC5A 1A5XA 3NVMA 4DR3K 1QHTA 3CG7A 4UQGA 4BRDA 2PY5A 5FRMA 3VQ9A 4CHPA 3ZT0A 3QNNA 4Q0BA 3V1OA 4KV8A 3QFPA 2FF6A 3O5BA 4A5AA 4BG9A 4ID1A 1I39A 5AQKA 3KKRA 4E7KA 3DLRA 1HYVA 3KWIA 3E1YA 3VA0A 3QINA 3OS1A 1D8YA 5KQ8A 3O3FA 3MXIA 4OJRA 2D0AA 1L3SA 3SBGA 4JYAK 4Z4EA 5JICA 3OYEA 2X74A 1WB9A 3WNFA 5IT9O 4JI2K 3CJ7A 1GOCA 4FJLA 3P5JA 5AQSA 2HBJA 4BR9A 2ZGYA 3TAMA 4B9UA 2NZTA 4O0JA 2KTQA 1BIZA 3CERA 1FK9A 4ID5A 5AQZA 4DFMA 3M8PA 3UB5A 3WXLA 3WNEA 1OH6A 1GLLO 1IO2A 3DWLA 4AHVA 2HNDA 2PYJA 4BRGA 1OH7A 3PX6A 3L4QA 4BRCA 1REVA 1ZXOA 2P51A 2I7NA 5EY4A 3HVRA 2UU9K 2HF3A 4DMNA 3HXMA 3SQ0A 4IKFA 2NRRA 3NE6A 4DU1A 4CZIA 3ZX2A 1S1WA 4AILC 1XWLA 3VEXA 4BGAA 4RTFD 3T3FA 1KQSM 4OPKA 1SS6A 1YXQA 2B6AA 4FJXA 4C8KA 1J5OA 4K25A 3LP3A 2P9PB 4FZZA 4FWMA 3HI0A 4RW7A 1XMQK 4F4KA 3MMVA 5KRSA 3LDOA 2DY4A 1IBKK 1QSYA 4FK4A 4JAXA 1WAJA 3K0SA 4WQ4C 3CIPA 3TAEA 4BR5A 2KFZA 3DAWA 2FC0A 1ZBFA 3S3MA 1KFSA 4CJQA 4DFJA 4BC4A 4CE9A 3ZSOA 5AFUA 3OYDA 1ATRA 3LWLA 5F1XA 4XEIA 1BCOA 4CJUA 1Q9XA 2YHBA 3VTIA 4DB3A 1TUYA 1BU6O 3FE1A 1RT3A 4BY9C 3KK3A 1L3UA 5BRDA 4YOXA 1Q7YO 4M41A 1W2BM 2HSTA 2ZQBA 3HL8A 4RW4A 4J2BA 3KKSA 2O4GA 2HMIA 4QS9A 4KHSA 1JL1A 1I94K 1RDDA 1NOYA 4LF4K 3SZ2A 4FM2A 3NF6A 5E41A 2RE2A 4CESA 1OH8A 1X3NA 3AV9A 3JYTA 4AHUA 4H0XB 3R1XA 1SL0A 4DS4A 3CD6N 3I56N 1JCGA 2KZZA 4FVMA 5H1SQ 1V4SA 4BDYA 3SJJA 1IKYA 2GV9A 1RTHA 3GBTA 3C6TA 2O8BA 1S5JA 3CCJN 2GELA 1N5YA 3BZKA 3VEWA 2Q36A 3G71N 2J4RA 4JI0K 5AZJA 4YY3K 2QWPA 3P83D 4OPHA 1E4GT 4RWTA 3QIPA 4LFAK 1HYZA 5GAEP 3LPTA 1Q81O 2D0CA 1ATSA 3WEEA 4CIGA 3MEGA 1ZBIA 4KTWA 5EOYA 3NH0A 1C1BA 3SK3A 3KIOA 4B1UB 4HVJA 5JLFA 3K5OA 1V4TA 3KLIA 4N47A 3DRPA 4RW8A 4KB1A 4C1NK 1NKEA 3CM6A 1QVGM 4FJIA 1Z26A 4M63C 2VGNA 4WFNL 1RDCA 2PAVA 4N76A 1KVCA 2NLXA 4KI4A 3OW2M 4CFAA 4XH5A 3DLBA 3A0IX 3CPWM 1RDWX 3VF4A 3TTFA
chains in the Genus database with same CATH topology
4CIEA 1GOBA 3HJFA 1RT1A 1C0MA 3HPOA 4F8RA 1QQCA 1LAWA 2FBTA 3HSTB 4G1QA 1VSEA 3ZT2A 4DS5A 3QEVA 3BGRA 4E0DA 4FK2A 3D0PA 2Z1IA 1LAVA 3DOLA 5KRTA 4MFBA 4OKKA 4FCYA 3ZT3A 2XY7A 2B5JA 1U49A 3QIOA 1TVRA 4YFUA 4B9VA 4FJMA 4CEAA 2G8UA 4QCLA 3L3UA 4CERA 1DTTA 3LWMA 3UIQA 3V4IA 4N41A 1TK8A 5JS1A 3LZIA 4DQQA 3SUNA 4DTRA 4DSLA 2X6SA 4CEBA 1WAFA 2HW3A 1C1AA 1DTQA 3ASMA 1LV5A 2IOCA 1C0UA 1VSKA 3ZT4A 3QERA 4FM1A 4CJEA 4BWMA 3PY8A 4DWIA 3CYMA 1WSHA 4E7LA 2ZE2A 2IS3A 3QEXA 2HHVA 2I5JA 2RPIA 4CJSA 4JS4A 3DOKA 1VSMA 3VA3A 3QETA 3T19A 3RR7A 3L2VA 4N5SA 1J53A 4HUFA 3O3HA 3QESA 3AVCA 4CK2A 1R0AA 4DLGA 4E7KA 1KRPA 4BDZA 4FJ5A 4PY5A 1VRTA 3CFOA 3IG1A 1RBUA 3M8RA 3AVHA 5SWMA 1D5AA 2FBVA 1RILA 3VQ6A 1BHLA 3F9KA 1QTMA 3B6PA 3AO4A 4FJ8A 4CK3A 3T1AA 4AH9A 4F2SA 2XY5A 4EZ9A 1T05A 3MECA 2HHTA 4BE1A 2DFEA 1ASVA 3NFAA 2OZSA 3DRSA 4M42A 4PUOA 1NJXA 1WSEA 2PYLA 2W42A 1Y97A 3OYMA 4I2PA 2OPPA 4CF0A 2YV0X 4IBNA 3MXMA 1S1XA 3S9HA 3AVGA 3NGZA 4OVLA 3TANA 3M8SA 3TWHA 4OKEA 4FM0A 3RR8A 4M3TA 3LP1A 4NYFA 4NYNA 2OA8A 4CHYA 4OPJA 4RW6A 2X78A 2KQ2A 5T7BA 3KK2A 2G8WA 3OYGA 4E1NA 1J9AA 2ETJA 3NBPA 3V9SA 1HNIA 4Y1CA 1T7PA 3AVBA 4CIFA 3NDKA 4FJGA 4CFCA 2LSNA 1EP4A 1KCFA 5FRNA 4GVMA 1NJZA 2YNGA 4B9SA 1VSLA 3QO9A 4CGJA 3OYCA 1JKHA 1S1TA 1TV6A 2KW4A 4CHZA 3CFRA 3CFPA 4J2DA 3SI6A 4IFYA 4KHQA 4E7JA 1QS4A 5FROA 2B4JA 4CHOA 4O55A 4CJRA 4DU4A 1ZBLA 1EX4A 3ALYA 1BI4B 4FZYA 3JSMA 4FJ9A 3AO3A 4Z4GA 1J54A 3U6FA 4HCBA 2HHQA 2YKMA 1RT6A 1TKXA 1UOCA 2XY6A 1HYSA 4DG1A 2E6LA 4FLXA 5K14A 3OJUA 2OPQA 4KHWA 1JLFA 1MU2A 4IG0A 3PO4A 4AHCA 1ZBUA 3L2WA 3DM2A 3EY1A 3K59A 1Q9YA 1CLQA 4H4OA 2IDOA 5I42A 4W5QA 4W5NA 2DFHA 3KLHA 5J2NA 3SQ4A 3O4NA 2VG7A 1IKVA 3SUQA 1U4BA 2YHAA 4W5TA 4ICLA 1UAXA 3LAKA 3V1RA 4CJLA 1S1UA 1IG9A 5HLFA 1TK5A 4OGEA 1SL1A 3SQ1A 5SZTA 2YNHA 3MAQA 3TAGA 2HHXA 4PQUA 3KD1E 1RT7A 3KLEA 4CJ4A 1WLJA 1WN7A 3OYHA 3ZSZA 3TAQA 2D5RA 3AA4A 1D9FA 3HP9A 3OYNA 1TL1A 3VQCA 2HVIA 1XI1A 2OYQA 3RWUA 4OLAA 1XHXA 3H08A 5HRSA 1NK7A 3LAMA 1CXUA 2E6MA 5CY4A 4KAZA 3OY9A 3NHGA 4DTOA 1QSLA 4BDPA 1IH7A 2F8TA 1RDBA 5C25A 4JLHA 2NUBA 3NH2A 2BDPA 1L5UA 4CHNA 5J2QA 4FJKA 4ZHRA 2QKBA 5CZ2A 4HUEA 3TAPA 4W5RA 3C94A 3SUPA 4DQIA 1SKSA 1UWBA 3RRHA 3AO1A 2X6NA 2WOMA 4Y1DA 3I0RA 2P5OA 4AHRA 5DK5A 1RBTA 4CECA 1EXQA 2QK9A 1RT2A 4W5OA 4CGHA 4DSEA 4CF8A 3SV3A 1TKZA 1NK4A 5KI6A 4CEFA 2RN2A 4M45A 4OLBA 1LWFA 2RKIA 3L3VA 3L2QA 2FBYA 2YNFA 1HNVA 2HB5A 4E19A 3ITHA 3QEPA 3OYAA 1SL2A 1YTUA 2RF2A 1NK6A 5HBMA 4F3OA 2FBXA 3LANA 4O0IA 4PWDA 1JXBA 3NF8A 4CJPA 4CJTA 3TAFA 3CM5A 3V9WA 3PX4A 3HT3A 4DU3A 4AHTA 4LH5A 1JL2A 4I2QA 2A1RA 3HYFA 4M3WA 3AVIA 2VG6A 2XY8A 4CGDA 3NAEA 3QEIA 2P1JA 3SCXA 1HPZA 2XO7A 3K57A 1YVUA 1SUQA 1FKOA 3U3GA 4FLVA 5HRRA 1UA1A 3G10A 1RBSA 1HQUA 1FKPA 1TKDA 3V9XA 2F8SA 3AVFA 1BL3A 1CZ9A 3LP2A 1VSFA 3P1GA 4GMJB 4O4GA 4RG8A 4B9LA 4DFPA 4I9QA 5J2PA 1KSPA 3PV8A 2HNYA 4I9LA 3MEEA 3L2UA 4N56A 5HP1A 1A5XA 1K6YA 1Q8IA 4BWJA 1QHTA 2E4LA 3CG7A 3V9ZA 4FZXC 4B3OA 1KTQA 4UQGA 1QSSA 1XHZA 3LDSA 1S9GA 5KGWA 1F21A 4JRPA 3RRGA 2PY5A 1S6QA 3D45A 1U04A 4FW1A 5FRMA 4XIUA 3VQ9A 4CHPA 1DLOA 3ZT0A 5HRPA 4DFKA 3QNNA 3RMAA 4Q0BA 4OGCA 3L2RA 1W0HA 4CF2A 4DQSA 3VQDA 2YNIA 3V1OA 2HHUA 1VK0A 1IKXA 4KV8A 4Z4IA 4RW9A 4DSKA 4H8KA 4ID1A 3AA5X 1I39A 3DI6A 3KKRA 3VQQA 4AHSA 3DLRA 1HYVA 2IC3A 3B6OA 4EP5A 3F73A 3VA0A 3KD5E 1TAQA 3HPGA 3QINA 3OS1A 1D8YA 1JLQA 1RT5A 3VQBA 1KFDA 3O3FA 3MXIA 1WSIA 4IDKA 4MQ3A 4ZTJA 3KTQA 3VQ8A 3G0ZA 1JLGA 2Y1IA 4OJRA 3AVLA 1T8EA 4PA1A 1TK0A 3VQEA 4K8XA 4FLZA 4DTJA 1ZBHA 5JS2A 1SV5A 1ASWA 2D0AA 3MXJA 4CF9A 3NCIA 3RTVA 1L3SA 4KTQA 2IAJA 3O3GA 1BQMA 4Z4EA 4CJFA 3AO5A 2HVHA 3AVNA 3K5LA 3OYEA 1BQNA 1RTJA 1U48A 4J2EA 2X74A 3HP6A 4R5PA 3HVTA 3WNFA 4DTXA 2JGUA 4CEDA 1C6VA 1NKBA 4FJHA 1RTDA 3ZSVA 1RNHA 1GOCA 4FJLA 3P5JA 1ZYQA 3DRRA 1NK9A 3OYLA 2G8FA 2Z1HA 3TAMA 4CHQA 2WONA 4B9UA 1VRUA 4O0JA 2GBZA 1B9FA 1BIZA 1WSFA 1FK9A 4ID5A 4JRQA 4HHTA 1L3VA 1N6QA 1SKRA 2G8HA 4Z4FA 4DFMA 1EETA 3BDPA 3AO2A 3IS9A 4E7HA 4FLTA 2Z1JA 3M8PA 4B9NA 3ZSYA 4DTMA 3WNEA 2Y1JA 2O4IA 4FLUA 1JLCA 1IO2A 3NGYA 4AHVA 4Z4HA 3OYBA 2HNDA 4J2BA 3LPUA 4DTPA 2PYJA 2BANA 1EKEA 1HRHA 2D0BA 3VN5A 3PX6A 4KRFA 1W9HA 3HK2A 1REVA 4B08A 2P51A 3CQ8A 3WNGA 1D9DA 3OYIA 4CCHA 4L8RB 1LW2A 4CJVA 5KGXA 2VWJA 3HVRA 4FLYA 2KTQA 4CJKA 2A1SA 1X1PA 3K2PA 4E1MA 1X9WA 4B9TA 1JLBA 1S6PA 4DMNA 3HXMA 3SQ0A 4IKFA 3OS0A 3IAYA 3QEWA 2ZD1A 2HHSA 3NE6A 3NF7A 4DU1A 1X9MA 1VSIA 1S1WA 3SV4A 4KREA 2VG5A 4FJJA 4AILC 1XWLA 5CYMA 1A5WA 2OZMA 3DLEA 4QAGA 3SYZA 3T3FA 1VSDA 3OJSA 4OPKA 3RMBA 4KHYA 3EYZA 3MEDA 1SKWA 4DLEA 3S3NA 5J1EA 3AVMA 3PX0A 1G15A 4QOZB 2B6AA 1RCHA 2OPRA 2OPSA 3HM9A 5KTQA 4FYDA 3I0SA 4FJXA 1BIUA 4C8KA 4B8AB 1X9SA 4C8LA 3SNNA 1U47A 1J5OA 1TL3A 3SUOA 3LP3A 1KLMA 4TSXA 1Z25A 3LZJA 1CZBA 4CK1A 4FZZA 4CJWA 2R7YA 3TI0A 3ZSWA 1XC9A 4RW7A 4CFBA 3EZ5A 3L8BA 4C8OA 3V9UA 3SPZA 1C1CA 3OYKA 4F4KA 5KRSA 2DY4A 1QSYA 4BE0A 3OYFA 2KZMA 4FK4A 2HHWA 1GOAA 4KHNA 1B92A 4HCCA 4KKOA 1WAJA 3IRXA 3TR8A 3TAEA 1NKCA 2KFZA 5EU7A 2FC0A 4DF4A 3SPYA 4LH4A 1NK5A 3VQAA 4FLWA 5C42A 3K5MA 1ZBFA 3O4QA 3S3MA 1T03A 2DTUA 3K5NA 4NCBA 1KFSA 1S9EA 4Z0UA 3ZCMA 4CJQA 1WSJA 3NGIA 1NOZA 4DFJA 1RDAA 3VQ7A 3ZSOA 4CE9A 3OYDA 3LWLA 1NJYA 2BGGA 3AVAA 1BCOA 2QXFA 2VWKA 4FW2A 4CJUA 2YHBA 3KJVA 1Q9XA 4KPYA 4E7IA 1RT3A 4EZ6A 3KK3A 1L3UA 4FK0A 4NCGA 4F3TA 4DF8A 3ISNC 4M41A 3KLGA 1ITGA 1CXQA 1JLEA 2ZQBA 3HL8A 4RW4A 4CGIA 3KKSA 4DTUA 4F2RA 5J2MA 4B9MA 2KFNA 3HO1A 1TKTA 2O4GA 3DLGA 5I3UA 4DQPA 3AVJA 4IFVA 4CEOA 3K58A 4YNQA 2G8KA 4ZTFA 2HMIA 2PZSA 1I3AA 1O1WA 1HJRA 4C8MA 5HROA 2EHGA 4KHSA 1NK8A 1JL1A 3PUFA 1RDDA 1NOYA 3A2FA 3AA3A 4FM2A 3NF6A 5E41A 3SZ2A 3HPHA 1BCMA 1VSJA 4FJNA 4CESA 4FXDA 1IKWA 2EX3A 3DLHA 4CGFA 3LP0A 1L3TA 1TAUA 2HNZA 3QNOA 3AV9A 3NH1A 3JYTA 4HTUA 4AHUA 4OKJA 1U45A 1WSGA 4B8CA 4CJ3A 4DS4A 1SL0A 4EP4A 2DFFA 3PO5A 3TABA 4CEQA 1HQEA 1RBVA 3AA2A 5C24A 2IGIA 2KZZA 2ATQA 4FVMA 4M3RA 4BACA 1QE1A 4BE2A 3S3OA 4E89A 4BDYA 4DSFA 5D3GA 1YTAA 3M8QA 1FXXA 1IKYA 2GV9A 4HUGA 3SJJA 2AJQA 4IG3A 4DQRA 1RTHA 1ASUA 4JS5A 4KB0A 3OVNA 3C6TA 5HRNA 2Z1GA 1HMVA 3C95A 1JLAA 1S5JA 3V81A 2XRIA 3E01A 1N5YA 2Q3SA 1WNSA 3QLHA 4CFDA 3SQ2A 4K8ZA 4LSLA 2P5GA 4I7FA 1KVAA 4CJ5A 4H4MA 3THVA 1RT4A 5DMRA 4GW6A 2YKNA 3VQ5A 3VQPA 4CGGA 4M3XA 1BISA 3P83D 2G8IA 4O44A 1S1VA 4LY7A 4ELUA 1TGOA 3QIPA 1HYZA 3LPTA 1BGXT 2D0CA 2QKKA 1C0TA 4CIGA 3DYAA 2G8VA 4DSIA 4LD0A 1KVBA 3KK1A 3C6UA 3I8DA 4DSJA 3MEGA 4KTZA 1KLNA 4KTWA 3VQ4A 1A5VA 3AVKA 4M3UA 1ZBIA 1B9DA 1YT3A 3LALA 4CEEA 3ZSXA 3NH0A 2GUIA 1C1BA 3DMJA 4WE1A 1RTIA 4CEZA 3KIOA 4HVJA 1NK0A 4Q5VA 4FJ7A 3WNHA 3OS2A 3K5OA 3ZSRA 1LW0A 4NCAA 3KLIA 4LSNA 3TARA 4N47A 4J2AA 3DRPA 4KHUA 4RW8A 1NJWA 3RMDA 1NKEA 4Z4CA 3V6DA 3CM6A 4KB1A 4FJIA 1VSHA 5CZ1A 1Z26A 5CYQA 3KLFA 1LWCA 4KO0A 4E3SA 2F96A 2JLEA 2ITGA 4ELVA 4M3YA 1RDCA 1LWEA 4DTNA 4N76A 3U3YA 1RBRA 5FDLA 3ULDA 1JXEA 1KVCA 3V1QA 3NF9A 4ELTA 3FFIA 1BI4A 3ZSQA 4KI4A 3RMCA 3DLKA 4KFBA 4O5BA 4CFAA 4KI6A 2BE2A 4M3ZA 4CF1A 4C8NA 2XHBA 1UA0A 3DLBA 3ZT1A 3OYJA 4DTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CIE A;  1GOB A;  3HJF A;  1RT1 A;  1C0M A;  3HPO A;  4F8R A;  1QQC A;  1LAW A;  2FBT A;  3HST B;  4G1Q A;  1VSE A;  3ZT2 A;  4DS5 A;  3QEV A;  3BGR A;  4E0D A;  4FK2 A;  3D0P A;  2Z1I A;  1LAV A;  3DOL A;  5KRT A;  4MFB A;  4OKK A;  4FCY A;  3ZT3 A;  2XY7 A;  2B5J A;  1U49 A;  3QIO A;  1TVR A;  4YFU A;  4B9V A;  4FJM A;  4CEA A;  2G8U A;  4QCL A;  3L3U A;  4CER A;  1DTT A;  3LWM A;  3UIQ A;  3V4I A;  4N41 A;  1TK8 A;  5JS1 A;  3LZI A;  4DQQ A;  3SUN A;  4DTR A;  4DSL A;  2X6S A;  4CEB A;  1WAF A;  2HW3 A;  1C1A A;  1DTQ A;  3ASM A;  1LV5 A;  2IOC A;  1C0U A;  1VSK A;  3ZT4 A;  3QER A;  4FM1 A;  4CJE A;  4BWM A;  3PY8 A;  4DWI A;  3CYM A;  1WSH A;  4E7L A;  2ZE2 A;  2IS3 A;  3QEX A;  2HHV A;  2I5J A;  2RPI A;  4CJS A;  4JS4 A;  3DOK A;  1VSM A;  3VA3 A;  3QET A;  3T19 A;  3RR7 A;  3L2V A;  4N5S A;  1J53 A;  4HUF A;  3O3H A;  3QES A;  3AVC A;  4CK2 A;  1R0A A;  4DLG A;  4E7K A;  1KRP A;  4BDZ A;  4FJ5 A;  4PY5 A;  1VRT A;  3CFO A;  3IG1 A;  1RBU A;  3M8R A;  3AVH A;  5SWM A;  1D5A A;  2FBV A;  1RIL A;  3VQ6 A;  1BHL A;  3F9K A;  1QTM A;  3B6P A;  3AO4 A;  4FJ8 A;  4CK3 A;  3T1A A;  4AH9 A;  4F2S A;  2XY5 A;  4EZ9 A;  1T05 A;  3MEC A;  2HHT A;  4BE1 A;  2DFE A;  1ASV A;  3NFA A;  2OZS A;  3DRS A;  4M42 A;  4PUO A;  1NJX A;  1WSE A;  2PYL A;  2W42 A;  1Y97 A;  3OYM A;  4I2P A;  2OPP A;  4CF0 A;  2YV0 X;  4IBN A;  3MXM A;  1S1X A;  3S9H A;  3AVG A;  3NGZ A;  4OVL A;  3TAN A;  3M8S A;  3TWH A;  4OKE A;  4FM0 A;  3RR8 A;  4M3T A;  3LP1 A;  4NYF A;  4NYN A;  2OA8 A;  4CHY A;  4OPJ A;  4RW6 A;  2X78 A;  2KQ2 A;  5T7B A;  3KK2 A;  2G8W A;  3OYG A;  4E1N A;  1J9A A;  2ETJ A;  3NBP A;  3V9S A;  1HNI A;  4Y1C A;  1T7P A;  3AVB A;  4CIF A;  3NDK A;  4FJG A;  4CFC A;  2LSN A;  1EP4 A;  1KCF A;  5FRN A;  4GVM A;  1NJZ A;  2YNG A;  4B9S A;  1VSL A;  3QO9 A;  4CGJ A;  3OYC A;  1JKH A;  1S1T A;  1TV6 A;  2KW4 A;  4CHZ A;  3CFR A;  3CFP A;  4J2D A;  3SI6 A;  4IFY A;  4KHQ A;  4E7J A;  1QS4 A;  5FRO A;  2B4J A;  4CHO A;  4O55 A;  4CJR A;  4DU4 A;  1ZBL A;  1EX4 A;  3ALY A;  1BI4 B;  4FZY A;  3JSM A;  4FJ9 A;  3AO3 A;  4Z4G A;  1J54 A;  3U6F A;  4HCB A;  2HHQ A;  2YKM A;  1RT6 A;  1TKX A;  1UOC A;  2XY6 A;  1HYS A;  4DG1 A;  2E6L A;  4FLX A;  5K14 A;  3OJU A;  2OPQ A;  4KHW A;  1JLF A;  1MU2 A;  4IG0 A;  3PO4 A;  4AHC A;  1ZBU A;  3L2W A;  3DM2 A;  3EY1 A;  3K59 A;  1Q9Y A;  1CLQ A;  4H4O A;  2IDO A;  5I42 A;  4W5Q A;  4W5N A;  2DFH A;  3KLH A;  5J2N A;  3SQ4 A;  3O4N A;  2VG7 A;  1IKV A;  3SUQ A;  1U4B A;  2YHA A;  4W5T A;  4ICL A;  1UAX A;  3LAK A;  3V1R A;  4CJL A;  1S1U A;  1IG9 A;  5HLF A;  1TK5 A;  4OGE A;  1SL1 A;  3SQ1 A;  5SZT A;  2YNH A;  3MAQ A;  3TAG A;  2HHX A;  4PQU A;  3KD1 E;  1RT7 A;  3KLE A;  4CJ4 A;  1WLJ A;  1WN7 A;  3OYH A;  3ZSZ A;  3TAQ A;  2D5R A;  3AA4 A;  1D9F A;  3HP9 A;  3OYN A;  1TL1 A;  3VQC A;  2HVI A;  1XI1 A;  2OYQ A;  3RWU A;  4OLA A;  1XHX A;  3H08 A;  5HRS A;  1NK7 A;  3LAM A;  1CXU A;  2E6M A;  5CY4 A;  4KAZ A;  3OY9 A;  3NHG A;  4DTO A;  1QSL A;  4BDP A;  1IH7 A;  2F8T A;  1RDB A;  5C25 A;  4JLH A;  2NUB A;  3NH2 A;  2BDP A;  1L5U A;  4CHN A;  5J2Q A;  4FJK A;  4ZHR A;  2QKB A;  5CZ2 A;  4HUE A;  3TAP A;  4W5R A;  3C94 A;  3SUP A;  4DQI A;  1SKS A;  1UWB A;  3RRH A;  3AO1 A;  2X6N A;  2WOM A;  4Y1D A;  3I0R A;  2P5O A;  4AHR A;  5DK5 A;  1RBT A;  4CEC A;  1EXQ A;  2QK9 A;  1RT2 A;  4W5O A;  4CGH A;  4DSE A;  4CF8 A;  3SV3 A;  1TKZ A;  1NK4 A;  5KI6 A;  4CEF A;  2RN2 A;  4M45 A;  4OLB A;  1LWF A;  2RKI A;  3L3V A;  3L2Q A;  2FBY A;  2YNF A;  1HNV A;  2HB5 A;  4E19 A;  3ITH A;  3QEP A;  3OYA A;  1SL2 A;  1YTU A;  2RF2 A;  1NK6 A;  5HBM A;  4F3O A;  2FBX A;  3LAN A;  4O0I A;  4PWD A;  1JXB A;  3NF8 A;  4CJP A;  4CJT A;  3TAF A;  3CM5 A;  3V9W A;  3PX4 A;  3HT3 A;  4DU3 A;  4AHT A;  4LH5 A;  1JL2 A;  4I2Q A;  2A1R A;  3HYF A;  4M3W A;  3AVI A;  2VG6 A;  2XY8 A;  4CGD A;  3NAE A;  3QEI A;  2P1J A;  3SCX A;  1HPZ A;  2XO7 A;  3K57 A;  1YVU A;  1SUQ A;  1FKO A;  3U3G A;  4FLV A;  5HRR A;  1UA1 A;  3G10 A;  1RBS A;  1HQU A;  1FKP A;  1TKD A;  3V9X A;  2F8S A;  3AVF A;  1BL3 A;  1CZ9 A;  3LP2 A;  1VSF A;  3P1G A;  4GMJ B;  4O4G A;  4RG8 A;  4B9L A;  4DFP A;  4I9Q A;  5J2P A;  1KSP A;  3PV8 A;  2HNY A;  4I9L A;  3MEE A;  3L2U A;  4N56 A;  5HP1 A;  1A5X A;  1K6Y A;  1Q8I A;  4BWJ A;  1QHT A;  2E4L A;  3CG7 A;  3V9Z A;  4FZX C;  4B3O A;  1KTQ A;  4UQG A;  1QSS A;  1XHZ A;  3LDS A;  1S9G A;  5KGW A;  1F21 A;  4JRP A;  3RRG A;  2PY5 A;  1S6Q A;  3D45 A;  1U04 A;  4FW1 A;  5FRM A;  4XIU A;  3VQ9 A;  4CHP A;  1DLO A;  3ZT0 A;  5HRP A;  4DFK A;  3QNN A;  3RMA A;  4Q0B A;  4OGC A;  3L2R A;  1W0H A;  4CF2 A;  4DQS A;  3VQD A;  2YNI A;  3V1O A;  2HHU A;  1VK0 A;  1IKX A;  4KV8 A;  4Z4I A;  4RW9 A;  4DSK A;  4H8K A;  4ID1 A;  3AA5 X;  1I39 A;  3DI6 A;  3KKR A;  3VQQ A;  4AHS A;  3DLR A;  1HYV A;  2IC3 A;  3B6O A;  4EP5 A;  3F73 A;  3VA0 A;  3KD5 E;  1TAQ A;  3HPG A;  3QIN A;  3OS1 A;  1D8Y A;  1JLQ A;  1RT5 A;  3VQB A;  1KFD A;  3O3F A;  3MXI A;  1WSI A;  4IDK A;  4MQ3 A;  4ZTJ A;  3KTQ A;  3VQ8 A;  3G0Z A;  1JLG A;  2Y1I A;  4OJR A;  3AVL A;  1T8E A;  4PA1 A;  1TK0 A;  3VQE A;  4K8X A;  4FLZ A;  4DTJ A;  1ZBH A;  5JS2 A;  1SV5 A;  1ASW A;  2D0A A;  3MXJ A;  4CF9 A;  3NCI A;  3RTV A;  1L3S A;  4KTQ A;  2IAJ A;  3O3G A;  1BQM A;  4Z4E A;  4CJF A;  3AO5 A;  2HVH A;  3AVN A;  3K5L A;  3OYE A;  1BQN A;  1RTJ A;  1U48 A;  4J2E A;  2X74 A;  3HP6 A;  4R5P A;  3HVT A;  3WNF A;  4DTX A;  2JGU A;  4CED A;  1C6V A;  1NKB A;  4FJH A;  1RTD A;  3ZSV A;  1RNH A;  1GOC A;  4FJL A;  3P5J A;  1ZYQ A;  3DRR A;  1NK9 A;  3OYL A;  2G8F A;  2Z1H A;  3TAM A;  4CHQ A;  2WON A;  4B9U A;  1VRU A;  4O0J A;  2GBZ A;  1B9F A;  1BIZ A;  1WSF A;  1FK9 A;  4ID5 A;  4JRQ A;  4HHT A;  1L3V A;  1N6Q A;  1SKR A;  2G8H A;  4Z4F A;  4DFM A;  1EET A;  3BDP A;  3AO2 A;  3IS9 A;  4E7H A;  4FLT A;  2Z1J A;  3M8P A;  4B9N A;  3ZSY A;  4DTM A;  3WNE A;  2Y1J A;  2O4I A;  4FLU A;  1JLC A;  1IO2 A;  3NGY A;  4AHV A;  4Z4H A;  3OYB A;  2HND A;  4J2B A;  3LPU A;  4DTP A;  2PYJ A;  2BAN A;  1EKE A;  1HRH A;  2D0B A;  3VN5 A;  3PX6 A;  4KRF A;  1W9H A;  3HK2 A;  1REV A;  4B08 A;  2P51 A;  3CQ8 A;  3WNG A;  1D9D A;  3OYI A;  4CCH A;  4L8R B;  1LW2 A;  4CJV A;  5KGX A;  2VWJ A;  3HVR A;  4FLY A;  2KTQ A;  4CJK A;  2A1S A;  1X1P A;  3K2P A;  4E1M A;  1X9W A;  4B9T A;  1JLB A;  1S6P A;  4DMN A;  3HXM A;  3SQ0 A;  4IKF A;  3OS0 A;  3IAY A;  3QEW A;  2ZD1 A;  2HHS A;  3NE6 A;  3NF7 A;  4DU1 A;  1X9M A;  1VSI A;  1S1W A;  3SV4 A;  4KRE A;  2VG5 A;  4FJJ A;  4AIL C;  1XWL A;  5CYM A;  1A5W A;  2OZM A;  3DLE A;  4QAG A;  3SYZ A;  3T3F A;  1VSD A;  3OJS A;  4OPK A;  3RMB A;  4KHY A;  3EYZ A;  3MED A;  1SKW A;  4DLE A;  3S3N A;  5J1E A;  3AVM A;  3PX0 A;  1G15 A;  4QOZ B;  2B6A A;  1RCH A;  2OPR A;  2OPS A;  3HM9 A;  5KTQ A;  4FYD A;  3I0S A;  4FJX A;  1BIU A;  4C8K A;  4B8A B;  1X9S A;  4C8L A;  3SNN A;  1U47 A;  1J5O A;  1TL3 A;  3SUO A;  3LP3 A;  1KLM A;  4TSX A;  1Z25 A;  3LZJ A;  1CZB A;  4CK1 A;  4FZZ A;  4CJW A;  2R7Y A;  3TI0 A;  3ZSW A;  1XC9 A;  4RW7 A;  4CFB A;  3EZ5 A;  3L8B A;  4C8O A;  3V9U A;  3SPZ A;  1C1C A;  3OYK A;  4F4K A;  5KRS A;  2DY4 A;  1QSY A;  4BE0 A;  3OYF A;  2KZM A;  4FK4 A;  2HHW A;  1GOA A;  4KHN A;  1B92 A;  4HCC A;  4KKO A;  1WAJ A;  3IRX A;  3TR8 A;  3TAE A;  1NKC A;  2KFZ A;  5EU7 A;  2FC0 A;  4DF4 A;  3SPY A;  4LH4 A;  1NK5 A;  3VQA A;  4FLW A;  5C42 A;  3K5M A;  1ZBF A;  3O4Q A;  3S3M A;  1T03 A;  2DTU A;  3K5N A;  4NCB A;  1KFS A;  1S9E A;  4Z0U A;  3ZCM A;  4CJQ A;  1WSJ A;  3NGI A;  1NOZ A;  4DFJ A;  1RDA A;  3VQ7 A;  3ZSO A;  4CE9 A;  3OYD A;  3LWL A;  1NJY A;  2BGG A;  3AVA A;  1BCO A;  2QXF A;  2VWK A;  4FW2 A;  4CJU A;  2YHB A;  3KJV A;  1Q9X A;  4KPY A;  4E7I A;  1RT3 A;  4EZ6 A;  3KK3 A;  1L3U A;  4FK0 A;  4NCG A;  4F3T A;  4DF8 A;  3ISN C;  4M41 A;  3KLG A;  1ITG A;  1CXQ A;  1JLE A;  2ZQB A;  3HL8 A;  4RW4 A;  4CGI A;  3KKS A;  4DTU A;  4F2R A;  5J2M A;  4B9M A;  2KFN A;  3HO1 A;  1TKT A;  2O4G A;  3DLG A;  5I3U A;  4DQP A;  3AVJ A;  4IFV A;  4CEO A;  3K58 A;  4YNQ A;  2G8K A;  4ZTF A;  2HMI A;  2PZS A;  1I3A A;  1O1W A;  1HJR A;  4C8M A;  5HRO A;  2EHG A;  4KHS A;  1NK8 A;  1JL1 A;  3PUF A;  1RDD A;  1NOY A;  3A2F A;  3AA3 A;  4FM2 A;  3NF6 A;  5E41 A;  3SZ2 A;  3HPH A;  1BCM A;  1VSJ A;  4FJN A;  4CES A;  4FXD A;  1IKW A;  2EX3 A;  3DLH A;  4CGF A;  3LP0 A;  1L3T A;  1TAU A;  2HNZ A;  3QNO A;  3AV9 A;  3NH1 A;  3JYT A;  4HTU A;  4AHU A;  4OKJ A;  1U45 A;  1WSG A;  4B8C A;  4CJ3 A;  4DS4 A;  1SL0 A;  4EP4 A;  2DFF A;  3PO5 A;  3TAB A;  4CEQ A;  1HQE A;  1RBV A;  3AA2 A;  5C24 A;  2IGI A;  2KZZ A;  2ATQ A;  4FVM A;  4M3R A;  4BAC A;  1QE1 A;  4BE2 A;  3S3O A;  4E89 A;  4BDY A;  4DSF A;  5D3G A;  1YTA A;  3M8Q A;  1FXX A;  1IKY A;  2GV9 A;  4HUG A;  3SJJ A;  2AJQ A;  4IG3 A;  4DQR A;  1RTH A;  1ASU A;  4JS5 A;  4KB0 A;  3OVN A;  3C6T A;  5HRN A;  2Z1G A;  1HMV A;  3C95 A;  1JLA A;  1S5J A;  3V81 A;  2XRI A;  3E01 A;  1N5Y A;  2Q3S A;  1WNS A;  3QLH A;  4CFD A;  3SQ2 A;  4K8Z A;  4LSL A;  2P5G A;  4I7F A;  1KVA A;  4CJ5 A;  4H4M A;  3THV A;  1RT4 A;  5DMR A;  4GW6 A;  2YKN A;  3VQ5 A;  3VQP A;  4CGG A;  4M3X A;  1BIS A;  3P83 D;  2G8I A;  4O44 A;  1S1V A;  4LY7 A;  4ELU A;  1TGO A;  3QIP A;  1HYZ A;  3LPT A;  1BGX T;  2D0C A;  2QKK A;  1C0T A;  4CIG A;  3DYA A;  2G8V A;  4DSI A;  4LD0 A;  1KVB A;  3KK1 A;  3C6U A;  3I8D A;  4DSJ A;  3MEG A;  4KTZ A;  1KLN A;  4KTW A;  3VQ4 A;  1A5V A;  3AVK A;  4M3U A;  1ZBI A;  1B9D A;  1YT3 A;  3LAL A;  4CEE A;  3ZSX A;  3NH0 A;  2GUI A;  1C1B A;  3DMJ A;  4WE1 A;  1RTI A;  4CEZ A;  3KIO A;  4HVJ A;  1NK0 A;  4Q5V A;  4FJ7 A;  3WNH A;  3OS2 A;  3K5O A;  3ZSR A;  1LW0 A;  4NCA A;  3KLI A;  4LSN A;  3TAR A;  4N47 A;  4J2A A;  3DRP A;  4KHU A;  4RW8 A;  1NJW A;  3RMD A;  1NKE A;  4Z4C A;  3V6D A;  3CM6 A;  4KB1 A;  4FJI A;  1VSH A;  5CZ1 A;  1Z26 A;  5CYQ A;  3KLF A;  1LWC A;  4KO0 A;  4E3S A;  2F96 A;  2JLE A;  2ITG A;  4ELV A;  4M3Y A;  1RDC A;  1LWE A;  4DTN A;  4N76 A;  3U3Y A;  1RBR A;  5FDL A;  3ULD A;  1JXE A;  1KVC A;  3V1Q A;  3NF9 A;  4ELT A;  3FFI A;  1BI4 A;  3ZSQ A;  4KI4 A;  3RMC A;  3DLK A;  4KFB A;  4O5B A;  4CFA A;  4KI6 A;  2BE2 A;  4M3Z A;  4CF1 A;  4C8N A;  2XHB A;  1UA0 A;  3DLB A;  3ZT1 A;  3OYJ A;  4DTS A; 
#chains in the Genus database with same CATH topology
 4FWR A;  3T7Z A;  1QQC A;  1LAW A;  2FBT A;  4G1Q A;  3QEV A;  4E0D A;  1DKG D;  5TKY A;  1MWM A;  2Z1I A;  3D2E B;  3DOL A;  4ISF A;  4FCY A;  5KPR A;  4UY8 O;  1VQ9 N;  3BZC A;  1U49 A;  5KPZ A;  2BUP A;  4B9V A;  4DCH A;  3AGK A;  3UIQ A;  4DQQ A;  3SUN A;  4DSL A;  2HW3 A;  1DTQ A;  3CCE N;  2IOC A;  3Q7B A;  2A42 A;  4CJE A;  3MX5 A;  4CBU A;  4WQ5 C;  3T19 A;  2VCP A;  2ZJQ L;  1VQL N;  5EXW A;  4CK2 A;  4HWI A;  3ATU A;  5M1N A;  3TPQ A;  4PY5 A;  1VRT A;  3AVH A;  5SWM A;  1BHL A;  5AZJ B;  3N4P A;  2ASO A;  1HR0 K;  4AH9 A;  2DFE A;  1ASV A;  1HX1 A;  3DXK A;  1S72 N;  4YDU C;  3QDK A;  1BUP A;  5AQY A;  5E84 A;  3OYM A;  3WEE B;  5FPE A;  1VQO N;  1W97 L;  3VF2 A;  3AVG A;  3NGZ A;  2O8F A;  4BR2 A;  4BVO A;  2GWJ A;  5AQV A;  3P38 A;  4M3T A;  3LP1 A;  4B3T K;  2X78 A;  5T7B A;  2G8W A;  4LF5 K;  1J9A A;  3BP8 A;  2FF3 B;  1HNI A;  3C7N A;  4FJG A;  2P9N B;  2QWL A;  2CH6 A;  5FRN A;  3VES A;  5M1P A;  1JKH A;  4O8U A;  4CHZ A;  3CFR A;  1XNQ K;  3FR0 A;  5AQH A;  3A5O C;  3HZ6 A;  4IFY A;  4KHQ A;  3ALY A;  4PL7 A;  4DHY A;  2FSJ A;  3CC2 N;  1J6Z A;  2E20 A;  1LOT B;  1T44 A;  4GKJ K;  1RT6 A;  1TKX A;  1HYS A;  3IFR A;  2CGJ A;  1JLF A;  3PO4 A;  4ILG B;  3IUC A;  3L2W A;  3H1V X;  4FPB A;  3CCU N;  2KHO A;  1Q9Y A;  4H4O A;  5I42 A;  4EFH A;  3O4N A;  2VG7 A;  4BRE A;  1NMN A;  4DV2 K;  4CJ7 A;  4W5T A;  2A3Z A;  3UKR B;  5M1F A;  4CJL A;  5HLF A;  1D4X A;  1TK5 A;  3VPZ A;  1C0F A;  3MAQ A;  4CJ4 A;  1WLJ A;  4JKB A;  2UUB K;  3AA4 A;  1WOQ A;  1TL1 A;  3U8X A;  1XI1 A;  1X3M A;  2FXU A;  3LAM A;  3E9O A;  1CXU A;  2E6M A;  3MK6 A;  5CY4 A;  1RDB A;  4JLH A;  2NUB A;  1L5U A;  5BN8 A;  5J2Q A;  4B3M K;  2QKB A;  4K43 A;  4FOE A;  4PKH A;  1N34 K;  1SKS A;  4B3S K;  3DXK B;  2KKZ A;  2OCE A;  5AQI A;  4CGH A;  4CF8 A;  1TKZ A;  2ZM6 K;  4M45 A;  1LWF A;  4NO7 A;  1HNV A;  4H03 B;  3OYA A;  1SL2 A;  1NK6 A;  4PWD A;  3NF8 A;  3PX4 A;  3V9W A;  1JL2 A;  4LFB K;  3AVI A;  4CGD A;  2XY8 A;  3NAE A;  4H5N A;  3LDP A;  3FZM A;  3H3N O;  1FKO A;  1ATN A;  4KH6 A;  3B8A X;  3AVF A;  1CZ9 A;  4RG8 A;  4O4G A;  4DFP A;  1VHX A;  4I9L A;  3ZEU A;  1NWK A;  1K6Y A;  1Q8I A;  2YX6 A;  4FZX C;  1U6Z A;  2Q0R A;  5A2Q O;  1S9G A;  2ASM A;  3GDQ A;  3THY A;  1U04 A;  4FW1 A;  1XQS C;  1DLO A;  2A40 A;  4OGC A;  4CF2 A;  5F2R A;  3MWP A;  1IKX A;  3E9P A;  1YHQ N;  4RW9 A;  5C2D A;  2V51 B;  3CJ1 A;  4H8K A;  4FO0 A;  3B6O A;  4YHH K;  3KD5 E;  5CHI A;  3BEX A;  3EZW A;  1NGJ A;  2JWL A;  1KFD A;  1WSI A;  4MQ3 A;  3KTQ A;  5ADX A;  3AVL A;  1T8E A;  4XH1 A;  1TK0 A;  4B3R K;  1ZBH A;  1HUX A;  1SV5 A;  1ASW A;  3EO3 A;  3MXJ A;  1YIT N;  1GLA G;  3RTV A;  3MX2 A;  4A2B A;  4CBX A;  2VWB A;  3O3G A;  1BQM A;  2E2Q A;  4CJF A;  3O9S A;  3HSC A;  3AO5 A;  4GY2 B;  3WQT A;  3AVN A;  5TKW A;  3VEN A;  4J2E A;  3QML A;  4R5P A;  4DTX A;  1M1K O;  1NKB A;  1RTD A;  3ZSV A;  3VTH A;  3U9D A;  3VEZ A;  4CHQ A;  1VRU A;  1WSF A;  3EEQ A;  3BDP A;  1Z6R A;  2QWM A;  3ZSY A;  4MO4 A;  2OTL N;  3PSF A;  2Y1J A;  2O4I A;  4H5W A;  3IKM A;  3J81 O;  3PSI A;  4DTP A;  3TTD A;  1EKE A;  3DJC A;  2VQE K;  1W9H A;  4B08 A;  3WNG A;  2VQF K;  1BOT O;  4FLY A;  1P8Z A;  1NGB A;  1X1P A;  4E1M A;  1JLB A;  2E1Z A;  2E88 A;  4BRK A;  3IAY A;  1QZ6 A;  3ENH A;  1X9M A;  3SV4 A;  2OZM A;  4BC3 A;  3O1W A;  4IZ9 A;  3R8E A;  3EYZ A;  4V19 S;  3MED A;  1SKW A;  5J1E A;  3PX0 A;  2OPS A;  2OPR A;  4FYD A;  3I0S A;  3EE8 A;  4B8A B;  1X9S A;  4C8L A;  3SNN A;  3SUO A;  3TU5 A;  1CZB A;  4BR7 A;  4CK1 A;  4CJW A;  3CPE A;  3ZSW A;  3L8B A;  5GIO A;  3V9U A;  3OYK A;  3EL2 A;  4C23 A;  3WUH A;  4KHN A;  1TUU A;  4NXN K;  4HCC A;  5AQX A;  4PKG A;  2DPN A;  2Q2R A;  3CCV N;  5EU7 A;  4LH4 A;  3VER A;  4J8F A;  1NK5 A;  3KHY A;  3CCQ N;  3KWG A;  1T03 A;  3K5N A;  4Z0U A;  2NRH A;  4FVU A;  3NGI A;  1RDA A;  2BGG A;  2GTD A;  3THX A;  3TTC A;  4JK9 A;  4DV3 K;  4F3T A;  1YAG A;  3KLG A;  4DTU A;  4F2R A;  3KK7 A;  4B9M A;  3HO1 A;  1WBD A;  4JV5 K;  2P9P A;  5C10 A;  2W41 A;  2QWN A;  1FW6 A;  5C0Y A;  1NK8 A;  3PUF A;  4DR5 K;  3A2F A;  3AA3 A;  3HPH A;  1BCM A;  4FXD A;  1IKW A;  1GLF O;  3U9Z A;  3NH1 A;  4OKJ A;  4B8C A;  4B1X B;  1HQE A;  4H5V A;  2IGI A;  1Q86 O;  1OKJ A;  4E89 A;  4DSF A;  2YCH A;  1YTA A;  3M8Q A;  3OA9 A;  3I8B A;  3AGR A;  4DQR A;  4CZE A;  5JVG L;  3E01 A;  4DV6 K;  4JI6 K;  4CFD A;  1QQN A;  3SQ2 A;  4WQ4 A;  4CJ5 A;  3ZYY X;  3T1Y K;  3THV A;  3VQ5 A;  3VQP A;  2Q1N A;  2OTJ N;  4M3X A;  3J7Z O;  1S1V A;  1E4F T;  4ELU A;  1VQN N;  2NNW A;  2QKK A;  1C0T A;  1KVB A;  1DEJ A;  4DSJ A;  4M3U A;  3VQ4 A;  1A5V A;  3AVK A;  1B9D A;  5JS1 A;  3LAL A;  3ZSX A;  1VQ5 N;  3OS2 A;  4IJN A;  1W7A A;  3TAR A;  3TSQ A;  4KHU A;  5I9E B;  4NXM K;  1LWC A;  2ITG A;  1QQO A;  4M3Y A;  3A5M C;  1LWE A;  3THX B;  1RBR A;  5FDL A;  4ELT A;  1BI4 A;  3ZSQ A;  5B8H A;  5GAH P;  1HNX K;  3LL3 A;  4KI6 A;  1VAZ A;  4G9Z A;  3O4W A;  2QA4 N;  3HJF A;  1GOB A;  4JK8 A;  1RT1 A;  3HPO A;  2YHW A;  1IJJ A;  1RGI A;  4MLH A;  3ATV A;  3D0P A;  3TSP A;  5JMV A;  4DKW A;  1KC8 O;  1LAV A;  4H0P A;  3VGM A;  4OKK A;  5KRT A;  2P9K A;  3ZT3 A;  2B5J A;  3JS6 A;  2QW9 A;  1TVR A;  4YFU A;  4H5T A;  2G8U A;  3L3U A;  4BRN A;  3LWM A;  3I33 A;  4PHT X;  4FSV A;  4BRM A;  4DTR A;  4JI7 K;  1C1A A;  3J7A P;  1C0U A;  5AFU H;  2BH1 A;  3PY8 A;  4A2A A;  3CYM A;  3CI5 A;  1WSH A;  5AZI A;  2IS3 A;  4IWV A;  4NB4 A;  2HHV A;  4CJS A;  4CZL A;  1X9J A;  1WBB A;  5CE3 A;  3QET A;  3QBW A;  1BG3 A;  1K8A O;  5LY3 A;  4HUF A;  3QES A;  4IOA L;  2WFB A;  1YJW N;  1KRP A;  3GG4 A;  4EHT A;  4FJ5 A;  3IG1 A;  3SAH A;  1RBU A;  4JI4 K;  4BG8 A;  4CK3 A;  4AM7 A;  1N32 K;  2HHT A;  4JEP A;  4BE1 A;  2OZS A;  3CQY A;  4BRQ A;  1BDG A;  4K0K K;  3LDN A;  3D2E A;  1WSE A;  1CZA N;  3MXM A;  5DM6 L;  3S9H A;  4OVL A;  3TWH A;  5JLH A;  4NYF A;  2OA8 A;  4DR6 K;  4GV6 A;  2KQ2 A;  4DR4 K;  1QVF M;  4BRH A;  1T7P A;  3AVB A;  4CFC A;  2P9U B;  1EP4 A;  1NJZ A;  4WYB A;  3CCS N;  4CGJ A;  3CFP A;  1TV6 A;  3UE5 A;  4KH4 A;  1VQ4 N;  4CHO A;  4CJR A;  2QI2 A;  1BI4 B;  3O80 A;  3JSM A;  1KAZ A;  3U4L A;  3AO3 A;  4IOC L;  1J54 A;  1OVY A;  4DG1 A;  3SLC A;  4LF6 K;  4KHW A;  4AHC A;  1NLV A;  3DM2 A;  4WQ5 A;  3PIP L;  1R59 O;  4W5Q A;  2FLO A;  2DFH A;  5AQG A;  2P9K B;  2NRT A;  5AJ3 K;  3SUQ A;  1UAX A;  4A61 A;  1S1U A;  4BVP A;  4OGE A;  3HBT A;  4U67 L;  3SQ1 A;  3TAG A;  4HTL A;  1HLU A;  2HHX A;  4PQU A;  2P9N A;  4JI3 K;  1WN7 A;  2IVN A;  3TAQ A;  5AZI B;  4CI6 A;  4ISE A;  2D5R A;  4YOY A;  4Z94 A;  1D9F A;  3A5L C;  4X64 K;  2HVI A;  3RWU A;  4YDU A;  1XHX A;  3BF3 A;  2F9T A;  3ID6 A;  4DTO A;  1QSL A;  4EAH D;  3WXK A;  2QXL A;  4FJK A;  1N33 K;  1EQY A;  4HUE A;  3TAP A;  4W5R A;  3OBY A;  1UWB A;  3N4Q A;  3AO1 A;  2WOM A;  4AHR A;  1DGK N;  3G6E N;  4W5O A;  4H0Y B;  4CEF A;  3A5N C;  3UKR A;  2RKI A;  3L2Q A;  2YNF A;  3J80 O;  2ASP A;  1G99 A;  2RF2 A;  1YTU A;  3L6Q A;  3CJC A;  4AHT A;  3EE9 A;  4I2Q A;  4M3W A;  1ILY A;  3QEI A;  3GL1 A;  2P1J A;  3ZX0 A;  1YVU A;  3U3G A;  4FLV A;  3G10 A;  4DV0 K;  3M6G A;  2F8S A;  1VQ6 N;  4B9L A;  3P1G A;  4YOV A;  4H0V B;  4I9Q A;  4N56 A;  5HP1 A;  4PL8 A;  3D2F A;  4FWQ A;  4JKE A;  4BWJ A;  2E4L A;  1GLD G;  3V9Z A;  1KTQ A;  1NMD A;  1QSS A;  3LDS A;  3RRG A;  4JRP A;  1S6Q A;  5BPM A;  3RMA A;  4DFK A;  1W0H A;  3VQD A;  4R79 A;  1J5E K;  4NLB A;  4FWO A;  4OO1 J;  3VQQ A;  3F73 A;  4EP5 A;  3MN9 A;  2O8D A;  2W40 A;  3VQB A;  3OYJ A;  4ZTJ A;  3VQ8 A;  2Y1I A;  3VQE A;  4FLZ A;  5JS2 A;  4CF9 A;  2NRZ A;  4KTQ A;  5KQD A;  2IAJ A;  3K9J A;  1EO1 A;  1ZBS A;  1RTJ A;  1U48 A;  2JGU A;  4CED A;  3M1F A;  4FJH A;  1RNH A;  1Z05 A;  2RHK A;  2Z1H A;  4DV1 K;  1SZ2 A;  1M90 O;  2GBZ A;  3ZLJ A;  1L3V A;  1N6Q A;  4HHT A;  4JD2 A;  2G8H A;  4LC9 B;  1EET A;  4E7H A;  2Z1J A;  1NNE A;  4DTM A;  4FLU A;  1BA0 A;  3KVG A;  2UUC K;  3LPU A;  2BAN A;  1HRH A;  2D0B A;  3VN5 A;  3G4S N;  4KRF A;  1NGF A;  4FWN A;  4CCH A;  3R9P A;  4CD3 A;  3OYI A;  1LW2 A;  4CZF A;  4CJV A;  5KGX A;  1K73 O;  4CW7 B;  4YOR A;  4CJK A;  3K2P A;  4CZG A;  1X9W A;  4B9T A;  3CJA A;  3Q7C A;  3OS0 A;  4MDB A;  3QEW A;  2HHS A;  1IG8 A;  1VSI A;  4KRE A;  4FJJ A;  5CYM A;  2P9L B;  1A5W A;  2VGM A;  4QAG A;  1JCF A;  3D2F B;  1VSD A;  4B9Q A;  4QS7 A;  3OJS A;  3RMB A;  4KHY A;  3IDH A;  4GNI A;  2ZF5 O;  5AQQ A;  1XNR K;  1G15 A;  4QOZ B;  3HM9 A;  1RCH A;  2HBM A;  1Q18 A;  2JWK A;  1U47 A;  1TL3 A;  4CZJ A;  1KLM A;  4TSX A;  4BRI A;  2YHX A;  1EWR A;  3LZJ A;  1IBL K;  4YOW A;  2CGL A;  2R7Y A;  2O8D B;  1XC9 A;  4BRA A;  3EZ5 A;  4C8O A;  3SPZ A;  4A62 A;  5AQP A;  2UXB K;  3LM9 A;  4BE0 A;  2KZM A;  1B92 A;  3QFU A;  3S41 A;  3IRX A;  3H45 C;  5AQJ A;  4EHU A;  3TR8 A;  1NKC A;  4M7Y A;  5BRE A;  3C6A A;  3VQA A;  5FPD A;  4FLW A;  3O8M A;  4NCB A;  5AQO A;  1NOZ A;  5AQT A;  1IV0 A;  1NJY A;  2QXF A;  2VWK A;  4E7I A;  2D0O A;  4EZ6 A;  3CHW A;  4NCG A;  3O1B A;  4DF8 A;  3FGU A;  4IFE A;  4JD2 B;  1ITG A;  2NRV A;  2Q31 A;  4CGI A;  3NMU A;  5J2M A;  5AQU A;  1TKT A;  3DLG A;  5I3U A;  4DQP A;  3AVJ A;  4O8K A;  4IFV A;  4CEO A;  3K58 A;  4YNQ A;  2G8K A;  1O1W A;  1EWQ A;  4C8M A;  5ADX H;  3LDQ A;  4AF1 A;  1QHA A;  4FJN A;  4I6M A;  1RDU A;  2HNZ A;  2W6K A;  4IXC A;  4HTU A;  1WSG A;  1GLB G;  2DFF A;  3AY9 A;  4CEQ A;  2P9S A;  3AA2 A;  5C24 A;  4M3R A;  4A57 A;  1QE1 A;  3S3O A;  4IG3 A;  3FZF A;  1ASU A;  4JS5 A;  1JJ2 M;  2Z1G A;  1HMV A;  2XRI A;  1SAZ A;  4WFB L;  1WNS A;  4MO5 A;  3QIC A;  4K8Z A;  2W6L A;  4LSL A;  3FFK B;  4I7F A;  4DR1 K;  2YKN A;  4CGG A;  5AQR A;  4LY7 A;  1TGO A;  4KH5 A;  1BGX T;  4DSI A;  3KK1 A;  3I8D A;  3KZB A;  4KTZ A;  3PO5 A;  2GUI A;  2I7P A;  4WE1 A;  4FWS A;  1RTI A;  4CEZ A;  4X65 K;  4FJ7 A;  4Q5V A;  4DUZ K;  1LW0 A;  4NCA A;  2QM1 A;  4LSN A;  3TSU A;  3ZET A;  3RMD A;  3V6D A;  4PKI A;  1VSH A;  5CZ1 A;  5CYQ A;  5F0X A;  1YIJ N;  4KO0 A;  3WXM B;  4BRP A;  2NRX A;  4E3S A;  1JCE A;  2JLE A;  4ELV A;  2O8E A;  4CZM A;  5BR8 K;  4YOU A;  1JXE A;  4CVN E;  1NG9 A;  3AAP A;  2BE2 A;  4CF1 A;  4C8N A;  1UA0 A;  3CME N;  4JKF A;  2UXD K;  3OYL A;  4JKA A;  1OVQ A;  4DTS A;  1NGI A;  3W3D A;  4F8R A;  2FSN A;  3L4I A;  2AA4 A;  4JHD B;  3VET A;  4DS5 A;  3GE1 A;  3AAQ A;  4K42 A;  4LF7 K;  4I6M B;  3MDQ A;  4O5F A;  3RVC A;  3T1H K;  4EIA A;  4M7X A;  4FJM A;  4CEA A;  3MN7 A;  1DTT A;  1P90 A;  4CER A;  3V4I A;  4N41 A;  3C65 A;  3LZI A;  2X6S A;  5AQN A;  1WAF A;  2QWQ A;  2P9S B;  1VSK A;  3BUZ B;  1VQ7 N;  4DWI A;  3ULE A;  3L0Q A;  3QEX A;  2RPI A;  2PBD A;  3DOK A;  1VSM A;  1Y64 A;  4A59 A;  4N5S A;  3O3H A;  3AVC A;  4DLG A;  2WC9 A;  4BDZ A;  2HF4 A;  3CFO A;  3VEV A;  3M8R A;  5BPN A;  5CR4 A;  1D5A A;  2FBV A;  1RIL A;  4DR2 K;  3F9K A;  4XH4 A;  3AO4 A;  3T1A A;  1KAY A;  2UUA K;  2D1K A;  2CGK A;  1T05 A;  3MEC A;  3C6H A;  5M1K A;  2ITM A;  1S22 A;  3NFA A;  4M42 A;  1DT9 A;  2PYL A;  3H46 O;  1K9M O;  4CF0 A;  2VYP A;  4RCH A;  4IBN A;  4BR0 A;  1NJI O;  3O6W A;  3PLA A;  3TAN A;  1NBW A;  4B1V A;  4OKE A;  4FM0 A;  3RR8 A;  4NYN A;  4OPJ A;  4JKG A;  4RW6 A;  3OYG A;  4E1N A;  2ETJ A;  3NBP A;  4F9O A;  3V9S A;  3K9K A;  3ZET B;  2QWR A;  4GVE A;  1KCF A;  1VQ8 N;  2YNG A;  4B9S A;  1VSL A;  3ENO A;  2O8E B;  4J2D A;  2GX9 A;  1YUW A;  3NVK A;  4E7J A;  5FRO A;  1ZBL A;  4O55 A;  4X66 K;  3VOV A;  3CC4 N;  4FJ9 A;  1NGG A;  4Z4G A;  3U6F A;  3VEO A;  5KPT A;  2YKM A;  2XY6 A;  4FLX A;  3OJU A;  2EWS A;  2GUP A;  2Q0U A;  3LM2 A;  3WQU A;  1MU2 A;  4IG0 A;  5AR0 A;  3E9L A;  4DV5 K;  1HPM A;  2HHH K;  3EY1 A;  1CLQ A;  4AQY K;  3VF6 A;  4W5N A;  5J2N A;  5FPM A;  3SQ4 A;  1IKV A;  3D6R A;  3WXI A;  4BQZ A;  5BRH A;  1VQK N;  4BRF A;  4ICL A;  3I55 N;  3LAK A;  4BQL A;  3V1R A;  1IG9 A;  4DR7 K;  2OAN A;  3H1Q A;  3M5R A;  4JKC A;  3KD1 E;  4LF8 K;  1RT7 A;  2P9U A;  3KLE A;  3F9M A;  1ESV A;  3ULE B;  4ILJ A;  5BPL A;  3UKU A;  2Q97 A;  3J7Y P;  3HP9 A;  1TYQ A;  3VQC A;  3H08 A;  4OX9 K;  1KAX A;  3NHG A;  5BR9 A;  1IH7 A;  3NH2 A;  1KD1 O;  1YJ9 N;  4DQI A;  1T3V A;  3FZH A;  1SQK A;  2F4V K;  3RRH A;  3HM8 A;  2X6N A;  1WUA A;  4Y1D A;  3I0R A;  2P5O A;  1RBT A;  1EXQ A;  2QK9 A;  2HBL A;  3LDL A;  3SV3 A;  1NK4 A;  4OLB A;  3L3V A;  2IVO A;  2HB5 A;  3QEP A;  4F3O A;  4JKG B;  4O0I A;  4CJP A;  4CJT A;  4IO9 L;  3HT3 A;  3CCM N;  4LH5 A;  2A1R A;  1BWF O;  2XO7 A;  3K57 A;  3O08 A;  2F7T A;  5HRR A;  3THW A;  1FKP A;  1HJO A;  3LP2 A;  1QZ5 A;  3CMA N;  1KSP A;  2HNY A;  3CJ9 A;  3MEE A;  3L2U A;  3AAR A;  3ZX3 A;  1U2V A;  5JVH L;  4B3O A;  1XHZ A;  5KGW A;  1F21 A;  2V52 B;  3D45 A;  1LCU A;  4XIU A;  4B1Y B;  5HRP A;  3L2R A;  4DQS A;  2YNI A;  2HHU A;  4IOX A;  1VK0 A;  2KLA A;  5M1Q A;  4Z4I A;  4DSK A;  1MA9 B;  2FSK A;  3AA5 X;  3DI6 A;  4AHS A;  2IC3 A;  2E2N A;  1TAQ A;  5EX5 A;  3EKS A;  3HPG A;  5BN9 A;  3EKU A;  1JLQ A;  1RT5 A;  2YJF A;  3MWT A;  4IDK A;  2ZJP L;  5FLX O;  1YJN N;  3G0Z A;  3UKU B;  1JLG A;  1TYQ B;  4PA1 A;  4K8X A;  4DTJ A;  3ID8 A;  3MCP A;  3NCI A;  1S3X A;  5GAD P;  2HVH A;  3VMF B;  3K5L A;  5HL7 L;  1BQN A;  3HP6 A;  3HVT A;  1C6V A;  3E66 A;  1K8K A;  3CXC M;  1ZYQ A;  3DRR A;  1NK9 A;  2G8F A;  2WON A;  1B9F A;  4JRQ A;  2HHW A;  3A8Y A;  4JI1 K;  1SKR A;  4Z4F A;  3AO2 A;  3IS9 A;  4FWL A;  4CZH A;  5GIP A;  1XC3 A;  4IEE A;  3CCR N;  4FLT A;  4B9N A;  4B1Z A;  1JLC A;  3NGY A;  4Z4H A;  3OYB A;  3FZK A;  4FL9 A;  3HK2 A;  2A6A A;  3CQ8 A;  4L3Q A;  1D9D A;  4L8R B;  2BTF A;  2VWJ A;  4H0T B;  3VGK A;  4A5B A;  4BRL A;  2A1S A;  3THW B;  1S6P A;  2H3G X;  1GLC G;  2ZD1 A;  1YF5 L;  3NF7 A;  1GLJ O;  3M3Z A;  2VG5 A;  3IMX A;  4JKH A;  3DLE A;  1U2V B;  3SYZ A;  2O8C A;  4H0O A;  4KBO A;  4CBW A;  3P4I A;  4DLE A;  3S3N A;  3AVM A;  1HKG A;  5KTQ A;  5LJW A;  1BIU A;  4WF9 L;  3R6M A;  3CET A;  4E1J A;  1Z25 A;  4JNE A;  4K41 A;  1NGA A;  3HRG A;  3F2K A;  3TI0 A;  1YI2 N;  5AQW A;  4CFB A;  1C1C A;  3OYF A;  4OPA A;  1GOA A;  4KKO A;  3OHR A;  3BF1 A;  4DF4 A;  3SPY A;  4FOI A;  5C42 A;  2ZWH A;  5HOO A;  3P31 A;  3O4Q A;  3K5M A;  2DTU A;  1S9E A;  3ZCM A;  2P9L A;  1WSJ A;  3O9R A;  4U7B A;  3VQ7 A;  3AVA A;  4KPY A;  4FW2 A;  3KJV A;  1H1V A;  1K8K B;  5E26 A;  2O8B B;  4FK0 A;  4JK7 A;  3ISN C;  1CXQ A;  1JLE A;  2E5L K;  2KFN A;  2D4W A;  3O9U A;  2PZS A;  5LMU K;  4ZTF A;  4IDH A;  3D7E O;  1I3A A;  3MN5 A;  1HJR A;  5HRO A;  2EHG A;  2GWK A;  3SMP A;  1VSJ A;  2NRW A;  2P9I A;  2EX3 A;  4CD1 A;  3DLH A;  4CGF A;  3SBT A;  3LP0 A;  1L3T A;  1TAU A;  4GKK K;  3QNO A;  5ELZ A;  2YJE A;  3QB0 A;  1U45 A;  4CJ3 A;  4EP4 A;  3TAB A;  3RSE A;  2E2P A;  1RBV A;  2QTD A;  3OTO K;  2ATQ A;  4BAC A;  4BE2 A;  5D3G A;  4HUG A;  1FXX A;  4IO8 A;  3P39 A;  2AJQ A;  2O8C B;  1ZC6 A;  4KB0 A;  3OVN A;  5HRN A;  4IJA A;  3EN9 A;  3O9Q A;  3C95 A;  1JLA A;  3V81 A;  4ILH A;  3JXU A;  2Q3S A;  3QLH A;  3QBX A;  2V7Y A;  2YHY A;  2P5G A;  1KVA A;  4H4M A;  5GAG P;  1RT4 A;  5DMR A;  4GW6 A;  3CC7 N;  3SJH A;  1BIS A;  3C0B A;  4YOT A;  2G8I A;  4O44 A;  5LMN K;  2UXC K;  5C12 A;  3DYA A;  2G8V A;  4LD0 A;  4MLE A;  3C6U A;  3CF5 L;  4JI5 K;  1KLN A;  1YT3 A;  4CEE A;  1C0G A;  1HNW K;  2A5X A;  3DMJ A;  4BR4 A;  1NK0 A;  3WNH A;  3ZSR A;  2E1Y A;  4J2A A;  4WCE L;  3FZL A;  1NJW A;  2GEM A;  4Z4C A;  3HOT A;  3KLF A;  5GIN A;  2F96 A;  1T6C A;  5IWA K;  4DTN A;  5C2F A;  3U3Y A;  3F5T A;  3ULD A;  3V1Q A;  3NF9 A;  3FFI A;  4C1N I;  3RMC A;  3DLK A;  4KFB A;  4O5B A;  2CH5 A;  5MLC Q;  4M3Z A;  2XHB A;  3SAF A;  3ZT1 A;  2QWO A;  1QQM A;  4CIE A;  1C0M A;  1HKC A;  3HST B;  3ZT2 A;  1VSE A;  3BGR A;  4FK2 A;  2UYT A;  5AQF A;  2P9I B;  4LF9 K;  4MFB A;  2HBK A;  4MDA A;  5FPN A;  3PIO L;  2XY7 A;  4CZK A;  2AP1 A;  3W0L A;  3QIO A;  4LFC K;  4QCL A;  1N36 K;  1MDU B;  2O8F B;  4H5R A;  1TK8 A;  3GOI A;  4CEB A;  3RSE B;  3CCL N;  3ASM A;  1LV5 A;  3QER A;  3ZT4 A;  4FM1 A;  4BWM A;  3C7N B;  4BC2 A;  4E7L A;  2ZE2 A;  2I5J A;  4JS4 A;  3VA3 A;  4X62 K;  3DXM A;  3L2V A;  2WTU A;  3RR7 A;  1BO5 O;  1J53 A;  2IIR A;  5AQM A;  1NGE A;  1R0A A;  1VQM N;  2QEX N;  3WXJ A;  3CQX A;  1OH5 A;  1GLE G;  3R3L A;  3VQ6 A;  1QTM A;  3DLL L;  3B6P A;  4FJ8 A;  4F2S A;  2XY5 A;  1Q82 O;  4EZ9 A;  2HOE A;  1IBM K;  4JHD A;  3DRS A;  4KHP K;  4PUO A;  1NJX A;  2YI1 A;  2W42 A;  1Y97 A;  4FWK A;  4I2P A;  2OPP A;  4GV3 A;  2YV0 X;  1S1X A;  1YVN A;  1E3M A;  1XUP O;  3M8S A;  1KXP A;  4IEI A;  4CHY A;  2E2O A;  1O13 A;  3KK2 A;  1RFQ A;  4QS8 A;  1N8R O;  4Y1C A;  3NDK A;  4CIF A;  2LSN A;  4BRO A;  2HMP A;  3SAG A;  4FWP A;  4GVM A;  2PFU A;  3QO9 A;  3OYC A;  1S1T A;  2KW4 A;  3SI6 A;  3FLC O;  3H3O B;  1QS4 A;  2B4J A;  4DU4 A;  1EX4 A;  4FZY A;  2WUS A;  1NU0 A;  2V7Z A;  1NGH A;  1MWK A;  5LL6 Z;  4HCB A;  2HHQ A;  4DV4 K;  1UOC A;  2ZGZ A;  2E6L A;  5K14 A;  2OPQ A;  2WBN A;  4JI8 K;  2E8A A;  1ZBU A;  3O9T A;  3SMS A;  3K59 A;  4Y0W A;  2IDO A;  3ENB A;  3KLH A;  3HOS A;  1U4B A;  2YHA A;  5BRF A;  5LJV A;  4AM6 A;  1HKB A;  1SL1 A;  5SZT A;  2YNH A;  3J8A A;  5C15 A;  1VQP N;  3OYH A;  1BA1 A;  3ZSZ A;  3G25 A;  2ZJR L;  4ISG A;  3VEY A;  3H6E A;  4B1W B;  3BY5 A;  2F9W A;  3OYN A;  3HTV A;  3DXM B;  4DV7 K;  4OLA A;  2OYQ A;  2A41 A;  5DM7 L;  3MN6 A;  5HRS A;  1NK7 A;  4KAZ A;  3OY9 A;  4JN4 A;  4BDP A;  2F8T A;  1FJG K;  5C25 A;  2BDP A;  1T6D A;  3MCA B;  4CHN A;  4ZHR A;  3VGL A;  3OBW A;  5EVZ A;  5CZ2 A;  3ZEU B;  3SUP A;  3C94 A;  3JAM O;  4NLC A;  3CJB A;  4FPA A;  5DK5 A;  4CEC A;  4DUY K;  1RT2 A;  2IVP A;  4DSE A;  3THY B;  2D0P A;  5KI6 A;  1NM1 A;  4BGB A;  2RN2 A;  4GV9 A;  2FBY A;  4E19 A;  3ITH A;  5AQL A;  5HBM A;  2FBX A;  3LAN A;  3T69 A;  1JXB A;  3TAF A;  3CM5 A;  4DU3 A;  4JKD A;  3HYF A;  4WFA L;  1NGC A;  2VG6 A;  3SCX A;  1HPZ A;  1SUQ A;  5M1O A;  1UA1 A;  1RBS A;  1HQU A;  3WT0 A;  1NGD A;  1HNZ K;  1TKD A;  3V9X A;  1BL3 A;  4GMJ B;  1VSF A;  4DQ8 A;  5J2P A;  3PV8 A;  1XMO K;  4BC5 A;  1A5X A;  3NVM A;  4DR3 K;  1QHT A;  3CG7 A;  4UQG A;  4BRD A;  2PY5 A;  5FRM A;  3VQ9 A;  4CHP A;  3ZT0 A;  3QNN A;  4Q0B A;  3V1O A;  4KV8 A;  3QFP A;  2FF6 A;  3O5B A;  4A5A A;  4BG9 A;  4ID1 A;  1I39 A;  5AQK A;  3KKR A;  4E7K A;  3DLR A;  1HYV A;  3KWI A;  3E1Y A;  3VA0 A;  3QIN A;  3OS1 A;  1D8Y A;  5KQ8 A;  3O3F A;  3MXI A;  4OJR A;  2D0A A;  1L3S A;  3SBG A;  4JYA K;  4Z4E A;  5JIC A;  3OYE A;  2X74 A;  1WB9 A;  3WNF A;  5IT9 O;  4JI2 K;  3CJ7 A;  1GOC A;  4FJL A;  3P5J A;  5AQS A;  2HBJ A;  4BR9 A;  2ZGY A;  3TAM A;  4B9U A;  2NZT A;  4O0J A;  2KTQ A;  1BIZ A;  3CER A;  1FK9 A;  4ID5 A;  5AQZ A;  4DFM A;  3M8P A;  3UB5 A;  3WXL A;  3WNE A;  1OH6 A;  1GLL O;  1IO2 A;  3DWL A;  4AHV A;  2HND A;  2PYJ A;  4BRG A;  1OH7 A;  3PX6 A;  3L4Q A;  4BRC A;  1REV A;  1ZXO A;  2P51 A;  2I7N A;  5EY4 A;  3HVR A;  2UU9 K;  2HF3 A;  4DMN A;  3HXM A;  3SQ0 A;  4IKF A;  2NRR A;  3NE6 A;  4DU1 A;  4CZI A;  3ZX2 A;  1S1W A;  4AIL C;  1XWL A;  3VEX A;  4BGA A;  4RTF D;  3T3F A;  1KQS M;  4OPK A;  1SS6 A;  1YXQ A;  2B6A A;  4FJX A;  4C8K A;  1J5O A;  4K25 A;  3LP3 A;  2P9P B;  4FZZ A;  4FWM A;  3HI0 A;  4RW7 A;  1XMQ K;  4F4K A;  3MMV A;  5KRS A;  3LDO A;  2DY4 A;  1IBK K;  1QSY A;  4FK4 A;  4JAX A;  1WAJ A;  3K0S A;  4WQ4 C;  3CIP A;  3TAE A;  4BR5 A;  2KFZ A;  3DAW A;  2FC0 A;  1ZBF A;  3S3M A;  1KFS A;  4CJQ A;  4DFJ A;  4BC4 A;  4CE9 A;  3ZSO A;  5AFU A;  3OYD A;  1ATR A;  3LWL A;  5F1X A;  4XEI A;  1BCO A;  4CJU A;  1Q9X A;  2YHB A;  3VTI A;  4DB3 A;  1TUY A;  1BU6 O;  3FE1 A;  1RT3 A;  4BY9 C;  3KK3 A;  1L3U A;  5BRD A;  4YOX A;  1Q7Y O;  4M41 A;  1W2B M;  2HST A;  2ZQB A;  3HL8 A;  4RW4 A;  4J2B A;  3KKS A;  2O4G A;  2HMI A;  4QS9 A;  4KHS A;  1JL1 A;  1I94 K;  1RDD A;  1NOY A;  4LF4 K;  3SZ2 A;  4FM2 A;  3NF6 A;  5E41 A;  2RE2 A;  4CES A;  1OH8 A;  1X3N A;  3AV9 A;  3JYT A;  4AHU A;  4H0X B;  3R1X A;  1SL0 A;  4DS4 A;  3CD6 N;  3I56 N;  1JCG A;  2KZZ A;  4FVM A;  5H1S Q;  1V4S A;  4BDY A;  3SJJ A;  1IKY A;  2GV9 A;  1RTH A;  3GBT A;  3C6T A;  2O8B A;  1S5J A;  3CCJ N;  2GEL A;  1N5Y A;  3BZK A;  3VEW A;  2Q36 A;  3G71 N;  2J4R A;  4JI0 K;  5AZJ A;  4YY3 K;  2QWP A;  3P83 D;  4OPH A;  1E4G T;  4RWT A;  3QIP A;  4LFA K;  1HYZ A;  5GAE P;  3LPT A;  1Q81 O;  2D0C A;  1ATS A;  3WEE A;  4CIG A;  3MEG A;  1ZBI A;  4KTW A;  5EOY A;  3NH0 A;  1C1B A;  3SK3 A;  3KIO A;  4B1U B;  4HVJ A;  5JLF A;  3K5O A;  1V4T A;  3KLI A;  4N47 A;  3DRP A;  4RW8 A;  4KB1 A;  4C1N K;  1NKE A;  3CM6 A;  1QVG M;  4FJI A;  1Z26 A;  4M63 C;  2VGN A;  4WFN L;  1RDC A;  2PAV A;  4N76 A;  1KVC A;  2NLX A;  4KI4 A;  3OW2 M;  4CFA A;  4XH5 A;  3DLB A;  3A0I X;  3CPW M;  1RDW X;  3VF4 A;  3TTF A; 
#chains in the Genus database with same CATH homology
 4CIE A;  1GOB A;  3HJF A;  1RT1 A;  1C0M A;  3HPO A;  4F8R A;  1QQC A;  1LAW A;  2FBT A;  3HST B;  4G1Q A;  1VSE A;  3ZT2 A;  4DS5 A;  3QEV A;  3BGR A;  4E0D A;  4FK2 A;  3D0P A;  2Z1I A;  1LAV A;  3DOL A;  5KRT A;  4MFB A;  4OKK A;  4FCY A;  3ZT3 A;  2XY7 A;  2B5J A;  1U49 A;  3QIO A;  1TVR A;  4YFU A;  4B9V A;  4FJM A;  4CEA A;  2G8U A;  4QCL A;  3L3U A;  4CER A;  1DTT A;  3LWM A;  3UIQ A;  3V4I A;  4N41 A;  1TK8 A;  5JS1 A;  3LZI A;  4DQQ A;  3SUN A;  4DTR A;  4DSL A;  2X6S A;  4CEB A;  1WAF A;  2HW3 A;  1C1A A;  1DTQ A;  3ASM A;  1LV5 A;  2IOC A;  1C0U A;  1VSK A;  3ZT4 A;  3QER A;  4FM1 A;  4CJE A;  4BWM A;  3PY8 A;  4DWI A;  3CYM A;  1WSH A;  4E7L A;  2ZE2 A;  2IS3 A;  3QEX A;  2HHV A;  2I5J A;  2RPI A;  4CJS A;  4JS4 A;  3DOK A;  1VSM A;  3VA3 A;  3QET A;  3T19 A;  3RR7 A;  3L2V A;  4N5S A;  1J53 A;  4HUF A;  3O3H A;  3QES A;  3AVC A;  4CK2 A;  1R0A A;  4DLG A;  4E7K A;  1KRP A;  4BDZ A;  4FJ5 A;  4PY5 A;  1VRT A;  3CFO A;  3IG1 A;  1RBU A;  3M8R A;  3AVH A;  5SWM A;  1D5A A;  2FBV A;  1RIL A;  3VQ6 A;  1BHL A;  3F9K A;  1QTM A;  3B6P A;  3AO4 A;  4FJ8 A;  4CK3 A;  3T1A A;  4AH9 A;  4F2S A;  2XY5 A;  4EZ9 A;  1T05 A;  3MEC A;  2HHT A;  4BE1 A;  2DFE A;  1ASV A;  3NFA A;  2OZS A;  3DRS A;  4M42 A;  4PUO A;  1NJX A;  1WSE A;  2PYL A;  2W42 A;  1Y97 A;  3OYM A;  4I2P A;  2OPP A;  4CF0 A;  2YV0 X;  4IBN A;  3MXM A;  1S1X A;  3S9H A;  3AVG A;  3NGZ A;  4OVL A;  3TAN A;  3M8S A;  3TWH A;  4OKE A;  4FM0 A;  3RR8 A;  4M3T A;  3LP1 A;  4NYF A;  4NYN A;  2OA8 A;  4CHY A;  4OPJ A;  4RW6 A;  2X78 A;  2KQ2 A;  5T7B A;  3KK2 A;  2G8W A;  3OYG A;  4E1N A;  1J9A A;  2ETJ A;  3NBP A;  3V9S A;  1HNI A;  4Y1C A;  1T7P A;  3AVB A;  4CIF A;  3NDK A;  4FJG A;  4CFC A;  2LSN A;  1EP4 A;  1KCF A;  5FRN A;  4GVM A;  1NJZ A;  2YNG A;  4B9S A;  1VSL A;  3QO9 A;  4CGJ A;  3OYC A;  1JKH A;  1S1T A;  1TV6 A;  2KW4 A;  4CHZ A;  3CFR A;  3CFP A;  4J2D A;  3SI6 A;  4IFY A;  4KHQ A;  4E7J A;  1QS4 A;  5FRO A;  2B4J A;  4CHO A;  4O55 A;  4CJR A;  4DU4 A;  1ZBL A;  1EX4 A;  3ALY A;  1BI4 B;  4FZY A;  3JSM A;  4FJ9 A;  3AO3 A;  4Z4G A;  1J54 A;  3U6F A;  4HCB A;  2HHQ A;  2YKM A;  1RT6 A;  1TKX A;  1UOC A;  2XY6 A;  1HYS A;  4DG1 A;  2E6L A;  4FLX A;  5K14 A;  3OJU A;  2OPQ A;  4KHW A;  1JLF A;  1MU2 A;  4IG0 A;  3PO4 A;  4AHC A;  1ZBU A;  3L2W A;  3DM2 A;  3EY1 A;  3K59 A;  1Q9Y A;  1CLQ A;  4H4O A;  2IDO A;  5I42 A;  4W5Q A;  4W5N A;  2DFH A;  3KLH A;  5J2N A;  3SQ4 A;  3O4N A;  2VG7 A;  1IKV A;  3SUQ A;  1U4B A;  2YHA A;  4W5T A;  4ICL A;  1UAX A;  3LAK A;  3V1R A;  4CJL A;  1S1U A;  1IG9 A;  5HLF A;  1TK5 A;  4OGE A;  1SL1 A;  3SQ1 A;  5SZT A;  2YNH A;  3MAQ A;  3TAG A;  2HHX A;  4PQU A;  3KD1 E;  1RT7 A;  3KLE A;  4CJ4 A;  1WLJ A;  1WN7 A;  3OYH A;  3ZSZ A;  3TAQ A;  2D5R A;  3AA4 A;  1D9F A;  3HP9 A;  3OYN A;  1TL1 A;  3VQC A;  2HVI A;  1XI1 A;  2OYQ A;  3RWU A;  4OLA A;  1XHX A;  3H08 A;  5HRS A;  1NK7 A;  3LAM A;  1CXU A;  2E6M A;  5CY4 A;  4KAZ A;  3OY9 A;  3NHG A;  4DTO A;  1QSL A;  4BDP A;  1IH7 A;  2F8T A;  1RDB A;  5C25 A;  4JLH A;  2NUB A;  3NH2 A;  2BDP A;  1L5U A;  4CHN A;  5J2Q A;  4FJK A;  4ZHR A;  2QKB A;  5CZ2 A;  4HUE A;  3TAP A;  4W5R A;  3C94 A;  3SUP A;  4DQI A;  1SKS A;  1UWB A;  3RRH A;  3AO1 A;  2X6N A;  2WOM A;  4Y1D A;  3I0R A;  2P5O A;  4AHR A;  5DK5 A;  1RBT A;  4CEC A;  1EXQ A;  2QK9 A;  1RT2 A;  4W5O A;  4CGH A;  4DSE A;  4CF8 A;  3SV3 A;  1TKZ A;  1NK4 A;  5KI6 A;  4CEF A;  2RN2 A;  4M45 A;  4OLB A;  1LWF A;  2RKI A;  3L3V A;  3L2Q A;  2FBY A;  2YNF A;  1HNV A;  2HB5 A;  4E19 A;  3ITH A;  3QEP A;  3OYA A;  1SL2 A;  1YTU A;  2RF2 A;  1NK6 A;  5HBM A;  4F3O A;  2FBX A;  3LAN A;  4O0I A;  4PWD A;  1JXB A;  3NF8 A;  4CJP A;  4CJT A;  3TAF A;  3CM5 A;  3V9W A;  3PX4 A;  3HT3 A;  4DU3 A;  4AHT A;  4LH5 A;  1JL2 A;  4I2Q A;  2A1R A;  3HYF A;  4M3W A;  3AVI A;  2VG6 A;  2XY8 A;  4CGD A;  3NAE A;  3QEI A;  2P1J A;  3SCX A;  1HPZ A;  2XO7 A;  3K57 A;  1YVU A;  1SUQ A;  1FKO A;  3U3G A;  4FLV A;  5HRR A;  1UA1 A;  3G10 A;  1RBS A;  1HQU A;  1FKP A;  1TKD A;  3V9X A;  2F8S A;  3AVF A;  1BL3 A;  1CZ9 A;  3LP2 A;  1VSF A;  3P1G A;  4GMJ B;  4O4G A;  4RG8 A;  4B9L A;  4DFP A;  4I9Q A;  5J2P A;  1KSP A;  3PV8 A;  2HNY A;  4I9L A;  3MEE A;  3L2U A;  4N56 A;  5HP1 A;  1A5X A;  1K6Y A;  1Q8I A;  4BWJ A;  1QHT A;  2E4L A;  3CG7 A;  3V9Z A;  4FZX C;  4B3O A;  1KTQ A;  4UQG A;  1QSS A;  1XHZ A;  3LDS A;  1S9G A;  5KGW A;  1F21 A;  4JRP A;  3RRG A;  2PY5 A;  1S6Q A;  3D45 A;  1U04 A;  4FW1 A;  5FRM A;  4XIU A;  3VQ9 A;  4CHP A;  1DLO A;  3ZT0 A;  5HRP A;  4DFK A;  3QNN A;  3RMA A;  4Q0B A;  4OGC A;  3L2R A;  1W0H A;  4CF2 A;  4DQS A;  3VQD A;  2YNI A;  3V1O A;  2HHU A;  1VK0 A;  1IKX A;  4KV8 A;  4Z4I A;  4RW9 A;  4DSK A;  4H8K A;  4ID1 A;  3AA5 X;  1I39 A;  3DI6 A;  3KKR A;  3VQQ A;  4AHS A;  3DLR A;  1HYV A;  2IC3 A;  3B6O A;  4EP5 A;  3F73 A;  3VA0 A;  3KD5 E;  1TAQ A;  3HPG A;  3QIN A;  3OS1 A;  1D8Y A;  1JLQ A;  1RT5 A;  3VQB A;  1KFD A;  3O3F A;  3MXI A;  1WSI A;  4IDK A;  4MQ3 A;  4ZTJ A;  3KTQ A;  3VQ8 A;  3G0Z A;  1JLG A;  2Y1I A;  4OJR A;  3AVL A;  1T8E A;  4PA1 A;  1TK0 A;  3VQE A;  4K8X A;  4FLZ A;  4DTJ A;  1ZBH A;  5JS2 A;  1SV5 A;  1ASW A;  2D0A A;  3MXJ A;  4CF9 A;  3NCI A;  3RTV A;  1L3S A;  4KTQ A;  2IAJ A;  3O3G A;  1BQM A;  4Z4E A;  4CJF A;  3AO5 A;  2HVH A;  3AVN A;  3K5L A;  3OYE A;  1BQN A;  1RTJ A;  1U48 A;  4J2E A;  2X74 A;  3HP6 A;  4R5P A;  3HVT A;  3WNF A;  4DTX A;  2JGU A;  4CED A;  1C6V A;  1NKB A;  4FJH A;  1RTD A;  3ZSV A;  1RNH A;  1GOC A;  4FJL A;  3P5J A;  1ZYQ A;  3DRR A;  1NK9 A;  3OYL A;  2G8F A;  2Z1H A;  3TAM A;  4CHQ A;  2WON A;  4B9U A;  1VRU A;  4O0J A;  2GBZ A;  1B9F A;  1BIZ A;  1WSF A;  1FK9 A;  4ID5 A;  4JRQ A;  4HHT A;  1L3V A;  1N6Q A;  1SKR A;  2G8H A;  4Z4F A;  4DFM A;  1EET A;  3BDP A;  3AO2 A;  3IS9 A;  4E7H A;  4FLT A;  2Z1J A;  3M8P A;  4B9N A;  3ZSY A;  4DTM A;  3WNE A;  2Y1J A;  2O4I A;  4FLU A;  1JLC A;  1IO2 A;  3NGY A;  4AHV A;  4Z4H A;  3OYB A;  2HND A;  4J2B A;  3LPU A;  4DTP A;  2PYJ A;  2BAN A;  1EKE A;  1HRH A;  2D0B A;  3VN5 A;  3PX6 A;  4KRF A;  1W9H A;  3HK2 A;  1REV A;  4B08 A;  2P51 A;  3CQ8 A;  3WNG A;  1D9D A;  3OYI A;  4CCH A;  4L8R B;  1LW2 A;  4CJV A;  5KGX A;  2VWJ A;  3HVR A;  4FLY A;  2KTQ A;  4CJK A;  2A1S A;  1X1P A;  3K2P A;  4E1M A;  1X9W A;  4B9T A;  1JLB A;  1S6P A;  4DMN A;  3HXM A;  3SQ0 A;  4IKF A;  3OS0 A;  3IAY A;  3QEW A;  2ZD1 A;  2HHS A;  3NE6 A;  3NF7 A;  4DU1 A;  1X9M A;  1VSI A;  1S1W A;  3SV4 A;  4KRE A;  2VG5 A;  4FJJ A;  4AIL C;  1XWL A;  5CYM A;  1A5W A;  2OZM A;  3DLE A;  4QAG A;  3SYZ A;  3T3F A;  1VSD A;  3OJS A;  4OPK A;  3RMB A;  4KHY A;  3EYZ A;  3MED A;  1SKW A;  4DLE A;  3S3N A;  5J1E A;  3AVM A;  3PX0 A;  1G15 A;  4QOZ B;  2B6A A;  1RCH A;  2OPR A;  2OPS A;  3HM9 A;  5KTQ A;  4FYD A;  3I0S A;  4FJX A;  1BIU A;  4C8K A;  4B8A B;  1X9S A;  4C8L A;  3SNN A;  1U47 A;  1J5O A;  1TL3 A;  3SUO A;  3LP3 A;  1KLM A;  4TSX A;  1Z25 A;  3LZJ A;  1CZB A;  4CK1 A;  4FZZ A;  4CJW A;  2R7Y A;  3TI0 A;  3ZSW A;  1XC9 A;  4RW7 A;  4CFB A;  3EZ5 A;  3L8B A;  4C8O A;  3V9U A;  3SPZ A;  1C1C A;  3OYK A;  4F4K A;  5KRS A;  2DY4 A;  1QSY A;  4BE0 A;  3OYF A;  2KZM A;  4FK4 A;  2HHW A;  1GOA A;  4KHN A;  1B92 A;  4HCC A;  4KKO A;  1WAJ A;  3IRX A;  3TR8 A;  3TAE A;  1NKC A;  2KFZ A;  5EU7 A;  2FC0 A;  4DF4 A;  3SPY A;  4LH4 A;  1NK5 A;  3VQA A;  4FLW A;  5C42 A;  3K5M A;  1ZBF A;  3O4Q A;  3S3M A;  1T03 A;  2DTU A;  3K5N A;  4NCB A;  1KFS A;  1S9E A;  4Z0U A;  3ZCM A;  4CJQ A;  1WSJ A;  3NGI A;  1NOZ A;  4DFJ A;  1RDA A;  3VQ7 A;  3ZSO A;  4CE9 A;  3OYD A;  3LWL A;  1NJY A;  2BGG A;  3AVA A;  1BCO A;  2QXF A;  2VWK A;  4FW2 A;  4CJU A;  2YHB A;  3KJV A;  1Q9X A;  4KPY A;  4E7I A;  1RT3 A;  4EZ6 A;  3KK3 A;  1L3U A;  4FK0 A;  4NCG A;  4F3T A;  4DF8 A;  3ISN C;  4M41 A;  3KLG A;  1ITG A;  1CXQ A;  1JLE A;  2ZQB A;  3HL8 A;  4RW4 A;  4CGI A;  3KKS A;  4DTU A;  4F2R A;  5J2M A;  4B9M A;  2KFN A;  3HO1 A;  1TKT A;  2O4G A;  3DLG A;  5I3U A;  4DQP A;  3AVJ A;  4IFV A;  4CEO A;  3K58 A;  4YNQ A;  2G8K A;  4ZTF A;  2HMI A;  2PZS A;  1I3A A;  1O1W A;  1HJR A;  4C8M A;  5HRO A;  2EHG A;  4KHS A;  1NK8 A;  1JL1 A;  3PUF A;  1RDD A;  1NOY A;  3A2F A;  3AA3 A;  4FM2 A;  3NF6 A;  5E41 A;  3SZ2 A;  3HPH A;  1BCM A;  1VSJ A;  4FJN A;  4CES A;  4FXD A;  1IKW A;  2EX3 A;  3DLH A;  4CGF A;  3LP0 A;  1L3T A;  1TAU A;  2HNZ A;  3QNO A;  3AV9 A;  3NH1 A;  3JYT A;  4HTU A;  4AHU A;  4OKJ A;  1U45 A;  1WSG A;  4B8C A;  4CJ3 A;  4DS4 A;  1SL0 A;  4EP4 A;  2DFF A;  3PO5 A;  3TAB A;  4CEQ A;  1HQE A;  1RBV A;  3AA2 A;  5C24 A;  2IGI A;  2KZZ A;  2ATQ A;  4FVM A;  4M3R A;  4BAC A;  1QE1 A;  4BE2 A;  3S3O A;  4E89 A;  4BDY A;  4DSF A;  5D3G A;  1YTA A;  3M8Q A;  1FXX A;  1IKY A;  2GV9 A;  4HUG A;  3SJJ A;  2AJQ A;  4IG3 A;  4DQR A;  1RTH A;  1ASU A;  4JS5 A;  4KB0 A;  3OVN A;  3C6T A;  5HRN A;  2Z1G A;  1HMV A;  3C95 A;  1JLA A;  1S5J A;  3V81 A;  2XRI A;  3E01 A;  1N5Y A;  2Q3S A;  1WNS A;  3QLH A;  4CFD A;  3SQ2 A;  4K8Z A;  4LSL A;  2P5G A;  4I7F A;  1KVA A;  4CJ5 A;  4H4M A;  3THV A;  1RT4 A;  5DMR A;  4GW6 A;  2YKN A;  3VQ5 A;  3VQP A;  4CGG A;  4M3X A;  1BIS A;  3P83 D;  2G8I A;  4O44 A;  1S1V A;  4LY7 A;  4ELU A;  1TGO A;  3QIP A;  1HYZ A;  3LPT A;  1BGX T;  2D0C A;  2QKK A;  1C0T A;  4CIG A;  3DYA A;  2G8V A;  4DSI A;  4LD0 A;  1KVB A;  3KK1 A;  3C6U A;  3I8D A;  4DSJ A;  3MEG A;  4KTZ A;  1KLN A;  4KTW A;  3VQ4 A;  1A5V A;  3AVK A;  4M3U A;  1ZBI A;  1B9D A;  1YT3 A;  3LAL A;  4CEE A;  3ZSX A;  3NH0 A;  2GUI A;  1C1B A;  3DMJ A;  4WE1 A;  1RTI A;  4CEZ A;  3KIO A;  4HVJ A;  1NK0 A;  4Q5V A;  4FJ7 A;  3WNH A;  3OS2 A;  3K5O A;  3ZSR A;  1LW0 A;  4NCA A;  3KLI A;  4LSN A;  3TAR A;  4N47 A;  4J2A A;  3DRP A;  4KHU A;  4RW8 A;  1NJW A;  3RMD A;  1NKE A;  4Z4C A;  3V6D A;  3CM6 A;  4KB1 A;  4FJI A;  1VSH A;  5CZ1 A;  1Z26 A;  5CYQ A;  3KLF A;  1LWC A;  4KO0 A;  4E3S A;  2F96 A;  2JLE A;  2ITG A;  4ELV A;  4M3Y A;  1RDC A;  1LWE A;  4DTN A;  4N76 A;  3U3Y A;  1RBR A;  5FDL A;  3ULD A;  1JXE A;  1KVC A;  3V1Q A;  3NF9 A;  4ELT A;  3FFI A;  1BI4 A;  3ZSQ A;  4KI4 A;  3RMC A;  3DLK A;  4KFB A;  4O5B A;  4CFA A;  4KI6 A;  2BE2 A;  4M3Z A;  4CF1 A;  4C8N A;  2XHB A;  1UA0 A;  3DLB A;  3ZT1 A;  3OYJ A;  4DTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...