3DLRA

Crystal structure of the catalytic core domain from pfv integrase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
186
structure length
155
Chain Sequence
QKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGSLLQEIRTSLYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Functional and structural characterization of the integrase from the prototype foamy virus.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase
total genus 53
structure length 155
sequence length 186
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dlrA00
1BHLA 3DLHA 4DQPA 3ISNC 3OVNA 1LWEA 2YNIA 2E4LA 2YNHA 5EU7A 2G8HA 4M3YA 2IOCA 3V6DA 3AA5X 1JKHA 1TVRA 3C6UA 4I9QA 1ASVA 3MECA 3V4IA 4Q5VA 3OYFA 3P1GA 1QS4A 2EX3A 3K2PA 1NK9A 1C0UA 3QEPA 3TR8A 4IDKA 1T7PA 3HO1A 4CGIA 1ZBUA 3HSTB 1J5OA 4R5PA 4DSKA 2HHXA 4ELVA 1KVCA 4IFYA 1C1AA 4CEEA 3SPZA 3S9HA 4LY7A 3KLHA 1TL1A 1HYZA 3I0RA 3NF8A 3UIQA 4FJLA 4Z4GA 4AHSA 1KLNA 1JXEA 1WN7A 2G8UA 1ASUA 3AO3A 3ZT2A 5HP1A 4C8OA 1XHXA 3QO9A 1JL1A 3L3VA 3OYJA 3NBPA 3V81A 4KV8A 2PY5A 4F3OA 1JLBA 4DTXA 4OLBA 1VSEA 2HNYA 5K14A 1JLCA 1D9DA 3NDKA 2EHGA 4KI6A 3PO5A 3WNFA 3QESA 2A1RA 4B3OA 3LZIA 1NJWA 2AJQA 3L2VA 3HM9A 4KRFA 4CK1A 1RBSA 2Z1HA 4BWMA 1RTDA 4N76A 2HHQA 4OKJA 4NCBA 1S1VA 4B8AB 4E7LA 4DSEA 1NKCA 1B92A 1MU2A 2KFZA 3O3HA 2XY8A 1S1TA 3CM6A 3DRSA 4KKOA 3U3GA 1S6PA 3C95A 1C1BA 3SUOA 4O5BA 3C94A 3ALYA 1BCMA 2HNZA 2KZZA 4KHUA 2W42A 4MFBA 1FXXA 1RCHA 4RW8A 5CZ1A 4E7IA 4DTNA 4DF8A 1RDCA 1VRTA 4OGCA 3K58A 3QEXA 3KTQA 1WNSA 5FRMA 5KI6A 1X9SA 3V1OA 4KTWA 1Q8IA 4CFBA 3NH1A 3AVLA 3O3FA 3QNNA 3SYZA 4FLZA 3TAGA 4I7FA 4I2QA 3HK2A 3PUFA 2HVIA 4OJRA 4O55A 4CJ3A 3KLGA 1L3TA 2ITGA 4KFBA 1NOYA 4DFMA 5J1EA 1KFDA 4BE0A 3EYZA 1RTJA 3JYTA 4G1QA 1CXQA 4CHOA 4CEAA 3VQQA 1HQEA 4CF8A 4CIEA 5C42A 4AHCA 5KRSA 4W5TA 4KAZA 2OPSA 2RPIA 4FLUA 3AVMA 2IAJA 4Z4IA 1C6VA 4I2PA 3TWHA 5CYMA 1KRPA 1BQMA 4IKFA 4CEZA 1VSFA 1R0AA 1C0MA 2I5JA 1U4BA 1S5JA 4FZZA 3SQ2A 2G8WA 4YFUA 1RTHA 3AVJA 3A2FA 1F21A 1TKZA 4Y1DA 4DTPA 1EX4A 1FKOA 1JLFA 1NK0A 1NJZA 4CJKA 3O3GA 2G8KA 1NKEA 4BE2A 1JL2A 4Q0BA 2WONA 4CF9A 4KB0A 4GVMA 3RMCA 4M45A 3KK2A 3NGIA 4FJIA 2P51A 2YKMA 3ZT0A 3VQ6A 2XO7A 3MAQA 4FM2A 3AO1A 4DTSA 3EY1A 4EP5A 2FC0A 3U3YA 3SV3A 4FYDA 3NE6A 3PX4A 2ETJA 4E3SA 3SQ1A 2ATQA 1SKSA 5C24A 3LP0A 1DTQA 1D5AA 1HRHA 3LWMA 3RMDA 4ZTJA 1YTAA 4KHYA 3OYLA 3LZJA 3SNNA 2GBZA 4J2EA 4ID5A 4DQSA 1T05A 3HVRA 5CYQA 3MEGA 3ZSZA 1EKEA 4ELTA 1RDBA 2DFEA 4IG0A 3S3NA 3IAYA 4KI4A 3V9WA 3O4NA 3KD1E 1BI4A 1A5WA 3ITHA 3QEWA 2F8TA 1ZBFA 1L5UA 2KTQA 3TANA 4CGFA 4OKKA 2A1SA 4DTMA 2OZSA 1S9EA 1J9AA 4CFCA 2RKIA 2Z1GA 3TAMA 4CK3A 4DS4A 1I3AA 4CF0A 4HCBA 4HVJA 2KZMA 1XC9A 4OGEA 1LV5A 3AVHA 1S9GA 4C8NA 4FCYA 2KQ2A 3QEIA 4C8KA 1WSEA 3DLGA 4CJVA 3L2QA 1BL3A 3LP1A 1J54A 1C0TA 4JS4A 4FW1A 1L3VA 4QOZB 1X9WA 3LANA 2PYJA 4FW2A 4DMNA 1KFSA 1VSLA 1KCFA 4QAGA 4E7JA 4B9MA 4BDZA 4RW6A 3TAEA 5CZ2A 1SKWA 4B8CA 1ZBHA 1RT4A 1RT7A 4CJWA 5D3GA 1NJXA 2YV0X 4CJRA 3C6TA 1TK0A 5I42A 3K59A 4KB1A 3HJFA 3WNGA 4FLYA 1IG9A 1QHTA 1GOBA 4ICLA 4N56A 4C8MA 2Y1IA 4LH4A 2F96A 3VA0A 1NK6A 2GV9A 3DLEA 5JS2A 1BCOA 4DU3A 5HRPA 4CJSA 4DFPA 3QIOA 3DYAA 3AVFA 1TKDA 1N5YA 4CERA 1W9HA 3M8RA 4CK2A 4FZXC 4JLHA 3NGZA 1S1XA 1VRUA 2OPRA 2X6NA 2JGUA 3DLKA 4CGDA 3OYCA 4DU4A 2IDOA 1IKXA 1GOCA 3TAFA 1X9MA 4FK0A 1JLEA 3ZT3A 1LAVA 4FM1A 4EZ6A 3TI0A 1YTUA 4QCLA 4N47A 4KHSA 4FJJA 2D5RA 3AO4A 3LALA 3U6FA 3VQ4A 1HJRA 2B6AA 4OVLA 3NFAA 2QKKA 2FBXA 3ZCMA 2LSNA 3VQ9A 4OPJA 1U48A 1DLOA 2HW3A 4HHTA 4AILC 2E6LA 3ZSOA 1BI4B 1SV5A 3OS2A 4DTJA 3PX0A 1RTIA 4DWIA 1IO2A 1HMVA 1S6QA 1W0HA 4DF4A 4CHQA 3OYNA 1Q9XA 2DFFA 5KGXA 1KVBA 3SPYA 1IH7A 1WAFA 3ZSQA 4YNQA 4M3TA 4CIGA 4M3XA 4L8RB 3CG7A 3KLEA 1RT5A 1U04A 5HBMA 3HT3A 4DFKA 1D8YA 4XIUA 1QTMA 4F4KA 2FBVA 2IGIA 1EETA 3HPGA 4DQRA 4DU1A 3DLBA 1XHZA 3FFIA 4W5NA 4PQUA 3V9UA 4LH5A 3NHGA 2RN2A 1I39A 2X6SA 4AHVA 4ZTFA 4FJ5A 1HYVA 1TAQA 2NUBA 3B6PA 4CEOA 4IFVA 1RBTA 1TKXA 5E41A 1B9FA 1RT2A 1CZBA 1K6YA 4FZYA 4HUEA 3QIPA 3T1AA 2G8FA 4PY5A 1NJYA 1NK8A 4KHNA 4AHRA 4OPKA 2B4JA 1ZYQA 2RF2A 4DQIA 2IS3A 4M3UA 4FLWA 4J2BA 4E19A 4H4OA 3AVNA 3PY8A 4DSLA 1LW0A 3MXIA 4FJ8A 3NF7A 2X78A 4CEFA 2D0CA 3VQCA 3OYEA 3HP6A 1NK4A 4B9LA 2Y1JA 1RDDA 2VG7A 1BISA 4KTZA 3VQBA 3ZSXA 3OYHA 4DSJA 2ZE2A 3VQ8A 1FK9A 1U45A 1RBUA 1S1UA 3AA4A 3DOLA 2G8VA 3SV4A 4CCHA 5J2NA 3SZ2A 1CZ9A 3VA3A 3HP9A 1JLGA 4Z4FA 4CHPA 4K8ZA 4O0IA 2OPQA 4FK4A 4CHYA 4KHQA 3ZSWA 3KKSA 5J2PA 1RNHA 3V9SA 4B9SA 1TV6A 3LAKA 3SUNA 1N6QA 2BGGA 3VQPA 2HB5A 2BANA 3LDSA 4E0DA 3DLRA 4IBNA 1Z26A 1VSIA 3M8QA 3M8SA 3CQ8A 3NH2A 3HPHA 1SL1A 1SKRA 4FK2A 1X1PA 3DMJA 1HNIA 3H08A 4KO0A 4CIFA 5T7BA 3V9XA 2XY5A 3CFOA 3QEVA 3L2WA 1U47A 4DG1A 4FJMA 1ITGA 2HNDA 3E01A 1RILA 3T19A 4AH9A 5FROA 4M3ZA 4BDYA 3KK3A 4DSIA 1NOZA 4FJKA 4FJGA 3AVAA 1EP4A 1T8EA 3LP3A 2WOMA 3AA3A 3ZT1A 4JRPA 1ASWA 1TGOA 2KW4A 4CFDA 4N5SA 3OS0A 2OYQA 3G10A 1CXUA 5KGWA 4E7KA 1J53A 1LW2A 4CJTA 4RW9A 1WLJA 1QSSA 3V1RA 4DS5A 5HRRA 4C8LA 4FLTA 3ZSRA 2BE2A 3DM2A 1IKVA 1DTTA 4RG8A 1YT3A 2ZQBA 3NF6A 5J2QA 1VSHA 2Z1IA 1WSIA 3LPTA 3LPUA 1XWLA 3MXJA 1WSFA 4CEQA 4FLVA 2XY6A 1REVA 3AV9A 3PO4A 4J2DA 2YKNA 1QSLA 1JXBA 1XI1A 1T03A 3I0SA 3NH0A 3CFPA 4ZHRA 4AHTA 3OYAA 3SQ4A 1RT3A 4CECA 1RBVA 2XY7A 3OYGA 1IKYA 4HUGA 4WE1A 2YNFA 3RMAA 4CGGA 1KTQA 4M42A 1NK7A 1LWCA 4W5OA 1LWFA 4K8XA 3LWLA 4RW4A 3PX6A 4FVMA 4AHUA 4CEBA 3OYDA 4O0JA 1Y97A 2VWKA 4O4GA 3D0PA 1ZBLA 1U49A 3F9KA 3OJUA 2P5GA 3K5MA 5I3UA 1TK8A 1C1CA 4N41A 4KTQA 1NK5A 3RR8A 1HPZA 3AA2A 3EZ5A 4E1MA 3D45A 3TARA 4GW6A 4NYFA 4CFAA 4PWDA 3SCXA 4NYNA 3OYIA 4DFJA 1QSYA 3VQEA 2F8SA 3WNEA 5HRNA 1CLQA 2HHTA 2DY4A 4BACA 3KLIA 4OLAA 4FM0A 3F73A 1ZBIA 1JLAA 4H4MA 5J2MA 4HCCA 3AO5A 5KTQA 4F3TA 3PV8A 5HLFA 1VSKA 4E7HA 4I9LA 4EZ9A 1Z25A 4FJXA 5DK5A 1O1WA 3K5OA 5FRNA 1B9DA 3THVA 4CGJA 4B9UA 4UQGA 4E89A 3P83D 4Z4CA 3RWUA 4BDPA 2HHUA 3NF9A 3IG1A 2D0BA 3HXMA 4O44A 4CE9A 3OYMA 3L2UA 3S3MA 3RR7A 3K57A 4DTRA 1SL0A 3M8PA 4M41A 1RBRA 4HTUA 3SUPA 2QXFA 3OS1A 4ID1A 1KLMA 2IC3A 4IG3A 3VQAA 3K5NA 3KLFA 3CFRA 2X74A 1JLQA 4PUOA 4HUFA 3ZSYA 2YHAA 4CJFA 1UA0A 3IRXA 3CM5A 5HROA 4M3RA 1EXQA 2FBYA 3DRRA 2ZD1A 4BWJA 4CHNA 1Q9YA 4F2SA 2QKBA 3HYFA 1VK0A 1HYSA 2O4GA 4LSNA 2JLEA 2VG6A 3OYKA 2O4IA 4CGHA 4FJHA 3BGRA 3DI6A 4TSXA 3QLHA 4CEDA 3LAMA 1KSPA 2XHBA 2P5OA 4CJUA 3B6OA 1UOCA 3K5LA 3L2RA 4F8RA 4NCAA 2XRIA 3HL8A 4DLEA 3OY9A 3SQ0A 1UA1A 2Z1JA 4OKEA 5DMRA 3DRPA 3O4QA 2B5JA 3VQ5A 1HQUA 3JSMA 3AVIA 2KFNA 2OA8A 4W5QA 3SI6A 4CJQA 4GMJB 3QINA 1VSDA 1WAJA 4CJ5A 2OPPA 3SUQA 4DTOA 3OJSA 1UWBA 4KREA 3ZT4A 3AVGA 3HPOA 3KK1A 1UAXA 4CF2A 2FBTA 4LSLA 5KRTA 4DTUA 3KD5E 1RT6A 2BDPA 3VQDA 2Q3SA 2D0AA 4W5RA 3S3OA 4B9NA 5HRSA 4KPYA 1A5XA 1BQNA 3MXMA 4JRQA 1KVAA 5JS1A 1YVUA 1IKWA 2DTUA 3V1QA 4NCGA 2E6MA 3CYMA 3VQ7A 4CHZA 3NCIA 2HHWA 4FLXA 4DSFA 3QNOA 3QERA 1QQCA 3IS9A 4F2RA 3T3FA 3AO2A 1VSMA 4FJNA 1RT1A 3HVTA 1TK5A 1FKPA 3RMBA 4B08A 4CJPA 1SL2A 1BGXT 3ZSVA 2PYLA 4B9TA 4RW7A 1HNVA 1D9FA 1RDAA 5SZTA 4BE1A 2G8IA 1TKTA 1QE1A 1S1WA 3KJVA 4DLGA 2VG5A 2YNGA 5C25A 1VSJA 3NAEA 2OZMA 3BDPA 3RRGA 1GOAA 4FJ7A 2HVHA 4H8KA 4Y1CA 2HHVA 3ULDA 3VN5A 4PA1A 2DFHA 3G0ZA 4LD0A 4CJEA 3TAPA 3TAQA 1NKBA 2HMIA 1G15A 3AVKA 3L3UA 3RTVA 3QETA 2HHSA 1WSGA 4CJ4A 2VWJA 5CY4A 3AVCA 4M3WA 4MQ3A 3OYBA 3NGYA 3I8DA 1L3UA 3MEDA 3WNHA 3L8BA 2R7YA 3TABA 3SJJA 3MEEA 1TL3A 1LAWA 3V9ZA 2PZSA 4JS5A 4Z4EA 1TAUA 4EP4A 3KKRA 3KIOA 3AVBA 4B9VA 3LP2A 4CJLA 4Z4HA 1L3SA 1A5VA 4CESA 5FDLA 3P5JA 4KHWA 2P1JA 2YHBA 1SUQA 1WSHA 4FJ9A 1WSJA 3ASMA 4FXDA 5SWMA 3RRHA 4DQQA 4J2AA 1BIUA 2GUIA 4ELUA 3DOKA 1BIZA 4E1NA 4CF1A 4Z0UA 2QK9A
chains in the Genus database with same CATH superfamily
3DLHA 2E4LA 2YNHA 2YHXA 3CCEN 3C6UA 3MECA 3V4IA 3EE8A 4BQZA 3P1GA 1J6ZA 3TR8A 1T7PA 3HO1A 3VEOA 4E1JA 5AQZA 4R5PA 3GDQA 1C1AA 4LY7A 1TL1A 1T6CA 2ITMA 3UIQA 1KLNA 3AO3A 3ZT2A 4H0XB 3QO9A 4KH4A 5JICA 4KV8A 2PY5A 4JI1K 4F3OA 1GLCG 5LL6Z 4OLBA 2EHGA 4B3OA 2E20A 2AJQA 4BRGA 2F9WA 3MK6A 2HHQA 1S1VA 4DSEA 1NKCA 2FSKA 2I7NA 2XY8A 5JVHL 4HWIA 3FGUA 3CC2N 5C2DA 4FWLA 4KHUA 2W42A 4MFBA 1RDCA 5AQKA 5KI6A 1Q8IA 3AVLA 3M6GA 3L0QA 4I7FA 2HVIA 4OJRA 4KFBA 2P9UB 4DUYK 4JI4K 1RTJA 3IUCA 1CXQA 4W5TA 4PKIA 1NJIO 2OPSA 2RPIA 2QA4N 2A40A 1QHAA 2QWLA 1BQMA 2E2QA 1R0AA 4FZZA 2P9KA 2G8WA 4DR4K 3QB0A 1EX4A 3ZLJA 3NVMA 3DAWA 4RTFD 3O3GA 1HLUA 2G8KA 1W2BM 1NKEA 3QFUA 2WONA 4IO8A 4KB0A 2UU9K 4FVUA 5IWAK 5AQJA 2XO7A 3MAQA 4EP5A 1R59O 4FYDA 1HKGA 4E3SA 2ATQA 1SKSA 3H45C 4YDUA 1NM1A 4IXCA 1DTQA 1D5AA 3RMDA 3E9OA 3H1VX 4BVPA 5FPEA 3LZJA 5BN8A 1T05A 4X66K 5C2FA 4BR4A 4IG0A 1KD1O 3WUHA 1NGDA 1P8ZA 3AY9A 4KI4A 3O4NA 3KD1E 1A5WA 3SK3A 3A5MC 5JLHA 4LF9K 3R6MA 1V4SA 1EWQA 2A1SA 2OZSA 3EZWA 3KK7A 3TAMA 4CF0A 3I33A 3AVHA 4DV1K 4FCYA 1LCUA 2JWLA 4C8KA 1WSEA 3L2QA 3HTVA 3WXMB 4E7JA 4B9MA 4BDZA 4RW6A 3TAEA 4ISEA 5JMVA 1WBDA 4B8CA 2QWRA 4CBXA 4B3MK 5LJWA 2ZF5O 1XUPO 1JJ2M 3J7YP 2HBJA 1QHTA 4N56A 2Y1IA 1IV0A 4LH4A 1NK6A 3VEVA 2QM1A 4CJSA 4DFPA 3DYAA 2NRVA 1N32K 3IKMA 3NGZA 5AQXA 1S1XA 4CGDA 1YI2N 3DLKA 3ENBA 1LAVA 5AZJB 4QCLA 2A41A 4KHSA 3AO4A 3U6FA 3VQ4A 1HJRA 5C12A 4CI6A 1W97L 3A5OC 5LJVA 5AFUA 2HW3A 4AILC 3C6AA 1BDGA 4CHQA 2AA4A 3SPYA 3T7ZA 1IH7A 5FPDA 3VEXA 4M3XA 4NLBA 4YOUA 3FZMA 3A0IX 4DFKA 4Z94A 4EAHD 4JHDA 4BR0A 3HPGA 4B1UB 1XHZA 4GV3A 4PQUA 3I56N 3V9UA 4AHVA 4CEOA 4IFVA 5E41A 3SLCA 4BR5A 3AGRA 1NLVA 1TUUA 3UKRA 4GVEA 4J2BA 2OANA 4H4OA 3AVNA 3PY8A 3MXIA 4FJ8A 3NF7A 4IO9L 3LM9A 3VQCA 4BRDA 4B9LA 1NK4A 5GAHP 3JAMO 2VG7A 1BISA 4KTZA 3OYHA 3VQ8A 2G8VA 1FK9A 1RBUA 1DT9A 3GOIA 3DOLA 2ZM6K 3SV4A 4AM7A 3SZ2A 5J2NA 1CZ9A 3QBWA 3ULEA 3HP9A 4CHPA 4F9OA 5AQWA 5AFUH 2D4WA 3IFRA 1RNHA 3V9SA 2BGGA 2HB5A 3LDSA 3CQXA 4IBNA 4FPBA 3CQ8A 4BRAA 4WFNL 1RFQA 3CFOA 1U47A 4DG1A 1SAZA 1ITGA 3E01A 4X65K 5LMUK 3RVCA 3KK3A 3HRGA 3CCJN 2OYQA 4WCEL 3J80O 3G10A 1CXUA 1HNZK 1KC8O 3CJBA 2BE2A 3MCAB 1DTTA 2ZQBA 4UY8O 3CETA 2GUPA 2XY6A 2YKNA 1XI1A 2VQEK 4H0TB 1ZBSA 4ZHRA 4AHTA 3SQ4A 4CECA 2KHOA 1IKYA 1SQKA 4MO5A 1LWCA 5EXWA 4AHUA 2YHYA 4CEBA 4DB3A 3OYDA 1Y97A 1U49A 4B1VA 3TTFA 3CERA 2GWKA 3ULEB 1TK8A 4N41A 4KTQA 4GKKK 4WQ5A 5E84A 4GW6A 4PWDA 3OYIA 3O8MA 1QSYA 3KVGA 5HRNA 1CLQA 2DY4A 2QWQA 1NGBA 3VEYA 1JLAA 4H4MA 4HCCA 3AO5A 3PV8A 4FJXA 5FRNA 1YVNA 4ILJA 4CZJA 4FO0A 2BUPA 3NF9A 3IG1A 3HXMA 4O44A 4CE9A 3OYMA 3RR7A 3K57A 4DTRA 3M8PA 3VF2A 5F2RA 1RBRA 4M41A 4HTUA 5BRDA 4IG3A 3KLFA 3CFRA 1JLQA 4HUFA 3ZSYA 4CJFA 1UA0A 3N4PA 3IRXA 1N8RO 4BY9C 4M3RA 1EXQA 2FBYA 4BWJA 4FWPA 4LSNA 2FLOA 2HBLA 4CGHA 3BGRA 4TSXA 4CEDA 1QZ6A 2XHBA 2P5OA 4A5AA 3HM8A 4F8RA 1MDUB 4DLEA 3SQ0A 4BG8A 4LC9B 3DRPA 2FSJA 1HQUA 5EX5A 2KFNA 1XMQK 4BGAA 3QINA 1VSDA 1WAJA 2OPPA 1MA9B 4CD1A 4IJAA 4KREA 3ZT4A 4BROA 5AQMA 3SBTA 3SMPA 3EL2A 4LSLA 3TPQA 3CCMN 2Q3SA 4B9NA 5HRSA 4KPYA 1A5XA 1ATNA 2D1KA 1KVAA 5JS1A 4WFAL 4H0OA 4NCGA 2CGKA 1HX1A 2YX6A 4DCHA 2HHWA 3T3FA 3AO2A 4G9ZA 3HVTA 4RCHA 5BRFA 2PYLA 4FWKA 2UXCK 3TU5A 1QE1A 5LY3A 3KJVA 2CH5A 5C25A 4CZEA 4OO1J 1IJJA 4Y1CA 2HHVA 1NMDA 3VN5A 1NKBA 3AVKA 4O5FA 3QETA 1OVYA 1WSGA 3AVCA 4M3WA 4JI8K 3OYBA 3TTCA 3HZ6A 2PBDA 2R7YA 1TL3A 4Z4EA 3KKRA 3LP2A 5FDLA 3O1BA 3LDQA 3P5JA 4IJNA 4BVOA 4KHWA 3ASMA 3MWPA 3K9JA 3H3OB 1BIZA 4PL7A 4Z0UA 2AP1A 4DQPA 3BUZB 2G8HA 4M3YA 4DUZK 1TVRA 3D6RA 3FZHA 2KLAA 3K2PA 1NK9A 1HNXK 1C0UA 1K8KA 3T69A 2NRRA 4NXMK 1ZBUA 4KH5A 4ELVA 3P31A 4B9QA 3KLHA 1Q7YO 1HYZA 1NGIA 2G8UA 1ASUA 5HP1A 2Q0UA 1XHXA 3SJHA 3O9TA 4JKGA 3NBPA 3V81A 2ASPA 4JK9A 1NNEA 2ZJQL 1VSEA 2HNYA 1JLCA 4KI6A 3O4WA 4JK7A 3ZETA 4N76A 4NCBA 4B8AB 4E7LA 1B92A 2KFZA 5BPMA 1S1TA 3CM6A 3DRSA 3K0SA 1C1BA 3C94A 2HNZA 2KZZA 3H3NO 4DF8A 1VRTA 3FE1A 3QDKA 4OGCA 1U2VA 4IEEA 3J7AP 1JCFA 4KTWA 1QZ5A 4CJ3A 4JK8A 1L3TA 4BRPA 1NOYA 5J1EA 4CF8A 4W5NA 4CIEA 5C42A 3U9ZA 1HNWK 1C0FA 2Q36A 4IZ9A 3ENHA 2IAJA 4IKFA 2HF3A 1KAYA 2I5JA 3F9MA 1RTHA 3AVJA 1NWKA 1QVFM 3EE9A 1NJZA 2IIRA 4BE2A 1JL2A 4Q0BA 4LFBK 3NGIA 4FWMA 3VEWA 2IVNA 4FM2A 1KAZA 2NLXA 3O80A 1YUWA 5C24A 3HBTA 3ZETB 5AQUA 1HRHA 3PSFA 1RDUA 3R8EA 1XQSC 3MEGA 2A5XA 3SMSA 2GEMA 4M63C 3QEWA 4PKGA 1J5EK 1U2VB 2QWNA 4DTMA 1S9EA 1J9AA 1YHQN 3VESA 3KZBA 1I3AA 4HCBA 5AR0A 4HVJA 1WB9A 1XC9A 4OGEA 1LV5A 2EWSA 4WFBL 3DLGA 4B1WB 1BL3A 2WBNA 3BZCA 3JS6A 4FW2A 1KFSA 2O8FB 1KCFA 4GV9A 5CZ2A 1SKWA 1ZBHA 1RT4A 1RT7A 5D3GA 4CJRA 4CBWA 5AQSA 2KKZA 5KPZA 1CZAN 1BO5O 3R9PA 2GELA 2F96A 3VA0A 3M1FA 3QIOA 1TKDA 3M8RA 4CK2A 1NGFA 1VRUA 5J2QA 2OCEA 1NU0A 1EQYA 1JLEA 2W40A 1XNQK 4EZ6A 3E1YA 5GINA 4N47A 2CH6A 4O8KA 4OVLA 4H03B 1XC3A 2FBXA 2P9IA 3ZCMA 2HF4A 4WF9L 1TYQB 1DLOA 3ZSOA 3OS2A 2VYPA 1Q9XA 1W0HA 5KGXA 1KVBA 3ZSQA 4M3TA 3CJ9A 4GKJK 5KPTA 1U04A 2FBVA 3GG4A 4FOEA 3DLBA 3OA9A 4FWOA 4LH5A 5M1OA 1BA0A 1I39A 2NUBA 4JI2K 3WXKA 4JI6K 1TKXA 4DR3K 1QQMA 4AHRA 1ZYQA 2IS3A 4FLWA 3G4SN 1X3MA 1VQMN 1HJOA 3PLAA 3G6EN 1GLLO 1KXPA 2X78A 2D0CA 3VGMA 1YJ9N 1RDDA 3ZSXA 5FPMA 1U45A 3O08A 3AA4A 4KBOA 3VF6A 3THWB 4CCHA 4MLEA 4CZMA 2HSTA 3C65A 4FWQA 4DV5K 4KHQA 5J2PA 3LAKA 1N6QA 4J8FA 5AZJA 3DLRA 1Z26A 1VSIA 3M8QA 2P9IB 1SL1A 1VQNN 1X1PA 2YJEA 3DMJA 4V19S 3H08A 4KO0A 3I55N 3QEVA 1M1KO 3VETA 2FSNA 2NNWA 3L2WA 4A2BA 4XH5A 4FJMA 3L4IA 2HNDA 1Q18A 3DXKA 3T19A 5FROA 4FJKA 4FJGA 1EP4A 3RSEA 3AA3A 1ASWA 4CFDA 3MX2A 4QS7A 1K8AO 4RW9A 4C8LA 2FF3B 4DS5A 4DKWA 4FLTA 3DM2A 4LFCK 3ATUA 4WQ5C 3DJCA 3NF6A 1VQPN 1VSHA 3LPTA 1WSIA 5AQOA 1WSFA 4O8UA 4FLVA 4J2DA 2PAVA 1WUAA 3TSPA 5H1SQ 1QSLA 4DV6K 1HKBA 3I0SA 3NH0A 3OYAA 3O9RA 3P38A 2XY7A 3VF4A 3VPZA 4MO4A 4WE1A 3RMAA 4CGGA 1KTQA 4BRLA 4W5OA 2GX9A 2RHKA 4RW4A 3LWLA 4FVMA 3PX6A 1ZBLA 3O9QA 3OJUA 5I3UA 2YCHA 5HOOA 3S41A 3EZ5A 2O8DA 4CFAA 4NYNA 3VQEA 2F8SA 1ATRA 3WNEA 3LM2A 4WQ4A 1ZBIA 4OPHA 5KTQA 4E7HA 4I9LA 4FOIA 4DV0K 3BY5A 4BGBA 1KAXA 1O1WA 3K5OA 4JKEA 4B9UA 3DXKB 4UQGA 3RWUA 3ZEUB 4Z4CA 3CJCA 5TKYA 4LFAK 4BC4A 1SL0A 1NGHA 3RSEB 3GL1A 3O5BA 3QBXA 3SUPA 5EVZA 3OS1A 1KLMA 2IC3A 5C10A 1U6ZA 4PUOA 2YHAA 5HROA 4F2SA 1Q9YA 4JEPA 2ZD1A 4X64K 2QKBA 3HYFA 1HYSA 2O4GA 3VGLA 3DI6A 2V52B 3M5RA 3LAMA 3B6OA 5AQYA 2F4VK 3K5LA 4NCAA 4KHPK 3HL8A 3VGKA 4A61A 2Z1JA 1GLEG 1SZ2A 4OKEA 5DMRA 3CJ1A 1QQOA 3VQ5A 3JSMA 4HTLA 3SI6A 4CJQA 4GMJB 4BR7A 4YY3K 4K43A 3AVGA 3OBYA 1UAXA 3C0BA 2FBTA 5KRTA 3H6EA 1EWRA 2O8DB 2D0AA 5M1QA 3MXMA 3VMFB 1IKWA 1Z6RA 3V1QA 3NCIA 3OHRA 4NO7A 3JXUA 1VSMA 4CZHA 1Z05A 1N36K 4B08A 1BGXT 3ZSVA 3DLLL 4B9TA 4CZGA 4RW7A 1RDAA 4BE1A 1S1WA 4DLGA 3TTDA 3KHYA 5GIOA 1VSJA 3RRGA 1GOAA 4FJ7A 2HVHA 3ULDA 5AQGA 4LD0A 4CJEA 3TAQA 1G15A 3RTVA 4AM6A 2HOEA 4CJ4A 4AF1A 5CY4A 3NGYA 3L6QA 3WQTA 2P9SB 4LF8K 1V4TA 1TAUA 1ATSA 3KIOA 4CJLA 1L3SA 4CESA 4H0YB 2QXLA 3MCPA 3MMVA 4FWSA 2YHBA 4JNEA 5EY4A 4A57A 3RRHA 5MLCQ 1BIUA 4KH6A 4DR6K 1HKCA 1BHLA 3OVNA 5BR8K 2IOCA 4I9QA 1JKHA 5C0YA 3BF3A 2BTFA 3W3DA 1QS4A 2EX3A 4ISFA 2OTLN 1Y64A 4CGIA 3EN9A 3CMEN 4IWVA 4BREA 4DSKA 2HHXA 4CEEA 3SPZA 5F1XA 4C1NI 3D7EO 4Z4GA 4XH1A 4C8OA 5AQFA 3OYJA 1JL1A 3L3VA 4XEIA 3THYA 3U4LA 4DTXA 3ID8A 1D9DA 4L3QA 5AZIA 3FFKB 4BRIA 2HMPA 1TUYA 3QESA 2A1RA 4GNIA 3J81O 4H5NA 3LZIA 4BC5A 3L2VA 1T3VA 4KRFA 3UB5A 4CK1A 2Z1HA 1RTDA 4YOYA 4OKJA 2D0OA 1MU2A 2P9PA 3O3HA 1JCEA 3U3GA 3SUOA 4O5BA 5BPNA 1VHXA 4DR2K 4DV3K 1YITN 4DTNA 4PL8A 3QFPA 3QEXA 2UUAK 1X9SA 3V1OA 3QNNA 4FLZA 3HK2A 4I2QA 2Q1NA 4DFMA 3ATVA 1KFDA 1ZXOA 3VQQA 4KAZA 5KRSA 5AQPA 4AHCA 1Q86O 3MN9A 3AVMA 3UKUA 4Z4IA 1C6VA 1IBKK 3G71N 4CEZA 1WBBA 1C0MA 1U4BA 3ZX3A 1K9MO 3MN7A 3A2FA 1TKZA 5TKWA 1JLFA 1E4GT 4A2AA 4MLHA 1NK0A 1NGCA 5AJ3K 4CJKA 1BOTO 4CF9A 3A8YA 4CVNE 4GVMA 4FJIA 3THYB 1VQ7N 3VQ6A 2WC9A 5AZIB 2UYTA 4DTSA 3WXJA 3U3YA 3NE6A 3SQ1A 5KQ8A 4GY2B 2YI1A 5IT9O 5B8HA 4ZTJA 4U67L 2P9PB 4JKHA 3SNNA 4ID5A 3HVRA 3QICA 5CYQA 1C0GA 3P4IA 1EKEA 4NB4A 1RDBA 2DFEA 3S3NA 3IAYA 4M7XA 1ZBFA 1L5UA 3FZFA 4CGFA 1VQ9N 4A5BA 2Z1GA 3CJ7A 2KZMA 4H5TA 1S9GA 2KQ2A 3QEIA 5E26A 4CJVA 5GADP 4B1YB 3LP1A 3A5LC 1J54A 1C0TA 4JS4A 4FW1A 3OW2M 3BEXA 3HI0A 2PYJA 3UKUB 4DMNA 1VSLA 3PIPL 3H46O 4IFEA 4CJWA 1NJXA 2YV0X 1TK0A 5I42A 3CHWA 3I8BA 2Q0RA 5AQLA 4CBUA 1GOBA 3NMUA 2GV9A 5M1PA 1GLJO 1BCOA 4DU3A 5HRPA 3CIPA 4CERA 1W9HA 1IBLK 3M3ZA 5M1KA 4FZXC 4JLHA 2O8CB 2JGUA 4FK0A 2IDOA 3TAFA 1GOCA 1YTUA 3BP8A 5ADXA 2Q31A 4DR1K 4FJJA 5LMNK 3NFAA 5AQQA 3VQ9A 4OPJA 1U48A 2CGLA 4HHTA 3DXMA 1SV5A 4GV6A 1RTIA 1HMVA 1S6QA 2W6KA 3OYNA 2FXUA 1WAFA 1BA1A 2ZWHA 4YNQA 4CZIA 4JKAA 3CG7A 3KLEA 1RT5A 2W6LA 4F4KA 1QTMA 3NHGA 2RN2A 1VQ4N 3E9LA 3B6PA 1NBWA 4YDUC 3EEQA 1RBTA 2O8FA 1RT2A 1CZBA 2YHWA 1K6YA 4FZYA 1YAGA 4HUEA 3QIPA 2NRHA 2G8FA 1NJYA 1NK8A 3BZKA 4KHNA 4OPKA 4DQIA 3R3LA 2RF2A 4M3UA 4H5VA 2IVPA 1GLDG 3WXLA 1YXQA 3IDHA 2E5LK 4BRHA 1LW0A 2DPNA 3VERA 4CEFA 3OYEA 5AQTA 5ADXH 2Y1JA 1IG8A 4DSJA 2A3ZA 4JV5K 2ZE2A 1S1UA 4BQLA 3VA3A 3T1HK 1YJNN 1JLGA 4K8ZA 4O0IA 4FK4A 4CHYA 3ZSWA 3VQPA 3QMLA 2F7TA 5CHIA 5GAEP 1N34K 3J7ZO 4NXNK 3HPHA 2A6AA 3E9PA 5GAGP 4FK2A 4CIFA 1HNIA 3V9XA 2XY5A 4QS9A 4BC3A 1TYQA 3U9DA 1X9JA 3DXMB 4CW7B 4M7YA 3NVKA 4AH9A 4B3SK 4M3ZA 4U7BA 4BR2A 1NGJA 3LP3A 2WOMA 4JRPA 1T44A 3ZX0A 4CJTA 1WLJA 3V1RA 3F2KA 2WUSA 1YT3A 5AQRA 4BC2A 1Q82O 1XWLA 3PO4A 3N4QA 3VOVA 1H1VA 3CFPA 3FZKA 4A62A 3H1QA 4HUGA 5DM6L 2YNFA 4H5RA 1LWFA 2UXBK 4O0JA 2VWKA 3MN6A 4H5WA 5CR4A 5KQDA 3F9KA 2P5GA 4BRKA 3K5MA 3THWA 1NK5A 3RR8A 1OVQA 1HPZA 3AA2A 4E1MA 3D45A 2NRXA 3TARA 1XNRK 5FPNA 3WQUA 3CJAA 2HHHK 4DV2K 2HHTA 4BACA 3KLIA 4OLAA 4FM0A 3F73A 1E3MA 4F3TA 1VSKA 2NRTA 5DK5A 5C15A 3CCLN 4DQ8A 1B9DA 2BH1A 2J4RA 4CGJA 4ILGB 4AQYK 3P83D 3R1XA 4EHUA 3D2FA 1E4FT 2D0BA 3A5NC 3S3MA 3L2UA 4R79A 3MWTA 2VQFK 1T8EA 4ID1A 3VQAA 2VCPA 3DRRA 4FWNA 5CE3A 1IBMK 1VK0A 4BRMA 1BG3A 4K41A 2JLEA 4MDAA 4JI3K 2O4IA 4FJHA 4BRNA 4CJUA 3LDOA 3MX5A 1UOCA 2E88A 3KWIA 2V7YA 4JAXA 2OTJN 3B8AX 4DV7K 3W0LA 3E66A 3VEZA 3OBWA 4WYBA 4W5QA 2P9NA 4CJ5A 3SUQA 4DTOA 3OJSA 3MDQA 1UWBA 4QS8A 3KK1A 4CF2A 3KD5E 1RT6A 2BDPA 3VQDA 4W5RA 3S3OA 2PFUA 3EKSA 2RE2A 4JRQA 3HOTA 1S22A 2DTUA 2E6MA 3CPEA 3CYMA 3VQ7A 4CHZA 4FLXA 3QNOA 4F2RA 1QQCA 4YOWA 4FJNA 3RMBA 4CJPA 1ZC6A 3OTOK 1YJWN 3D2EA 5SZTA 1MWMA 2G8IA 3D2FB 3ZEUA 2VG5A 2YNGA 3NAEA 2OZMA 3CCRN 3LDLA 4H8KA 4PA1A 2DFHA 2HHSA 5GIPA 1GLFO 5A2QO 2ZJRL 1L3UA 3MEDA 3WNHA 3IMXA 1GLAG 3C6HA 3TABA 1MWKA 3MEEA 3V9ZA 3UE5A 2PZSA 5BRHA 2WFBA 4YORA 4EP4A 3TSQA 3VTHA 3WEEA 3EO3A 3WT0A 2HBMA 1A5VA 4YOVA 1WSHA 4IOAL 2VWBA 4FXDA 1OH8A 4J2AA 2UUBK 2GUIA 4ELUA 4E1NA 4CF1A 2E1ZA 2QK9A 2P9NB 3CC7N 3ISNC 1LWEA 2YNIA 5EU7A 3V6DA 3AA5X 2D0PA 1ASVA 3FZLA 4Q5VA 4A59A 1OH6A 3OYFA 3QEPA 4IDKA 3DWLA 2P9KB 3HSTB 1GLBG 1J5OA 1Q81O 2UUCK 1KVCA 4IFYA 1HR0K 3S9HA 3CCVN 3I0RA 3NF8A 4FJLA 4AHSA 1JXEA 1WN7A 1P90A 3CCSN 1O13A 1S72N 3D2EB 1S3XA 4K42A 1JLBA 4FWRA 5K14A 3NDKA 3Q7BA 3PO5A 3WNFA 1NJWA 2QI2A 5AQIA 3HM9A 1FW6A 3CF5L 1RBSA 2E1YA 3SAHA 4BWMA 2Q2RA 3K9KA 4YOTA 2CGJA 4KKOA 1S6PA 3C95A 2P9SA 3ALYA 1BCMA 4FSVA 3WEEB 3LDPA 4MDBA 5CZ1A 1FXXA 1HUXA 1RCHA 4RW8A 4E7IA 2H3GX 3K58A 3KTQA 1WNSA 4K25A 5FRMA 2E2PA 3TAGA 1NGAA 3P39A 4CFBA 3NH1A 3O3FA 3SYZA 2ZJPL 1BWFO 3PUFA 3CXCM 4O55A 3KLGA 3AAQA 2ITGA 3MN5A 4BE0A 3JYTA 4G1QA 4CHOA 4CEAA 3EYZA 1HQEA 3CI5A 1RGIA 4FLUA 2VGMA 5AQHA 4I2PA 2E2NA 3TWHA 5CYMA 4JKCA 3Q7CA 1KRPA 4OX9K 1VSFA 3CCUN 4JYAK 1S5JA 3SQ2A 4YFUA 4DTPA 1F21A 4Y1DA 1ESVA 2QWOA 1FKOA 3CQYA 3VENA 1K73O 3RMCA 4EIAA 4M45A 3KK2A 2P51A 2YKMA 3ZT0A 3AO1A 3GE1A 4XH4A 3EY1A 1VQ5N 2FC0A 3SV3A 3PX4A 2ETJA 3AARA 1OH5A 3LP0A 3LWMA 4RWTA 4IEIA 3O9SA 1YTAA 4KHYA 3OYLA 2GBZA 4J2EA 4DQSA 3ZSZA 4ELTA 3FR0A 1OH7A 3V9WA 5F0XA 1BI4A 3ITHA 2V7ZA 2F8TA 5BREA 2KTQA 3TANA 3ID6A 4OKKA 3ZX2A 3EKUA 5AQVA 4H0PA 4CFCA 2RKIA 4CK3A 4DS4A 4JHDB 1X3NA 4C8NA 3ZYYX 4JD2A 1L3VA 4QOZB 1X9WA 3LANA 4DV4K 1D4XA 4QAGA 2P9LA 4CJ7A 1FJGK 3UKRB 3C6TA 4ISGA 3U8XA 3K59A 4KB1A 3HJFA 3WNGA 4FLYA 1IG9A 3SBGA 4ICLA 2O8BA 4B1XB 4C8MA 3AGKA 3DLEA 5JS2A 1N5YA 3AVFA 1M90O 4IOXA 2OPRA 3OYCA 2X6NA 4DU4A 1VQ8N 1IKXA 1X9MA 3ZT3A 4FM1A 3TI0A 4YOXA 1VQ6N 2D5RA 3LALA 3FLCO 2B6AA 2QKKA 2LSNA 3ENOA 2E6LA 1BI4B 4DTJA 3PX0A 2QEXN 4DWIA 2NRZA 1IO2A 4DF4A 2DFFA 5KPRA 1G99A 4B3RK 4CIGA 5BN9A 4L8RB 3HT3A 5HBMA 1D8YA 4XIUA 2A42A 5JVGL 4H0VB 2IGIA 1EETA 4DQRA 3O1WA 4DU1A 2E2OA 3FFIA 4ZTFA 2X6SA 4JD2B 3CC4N 4FJ5A 1HYVA 1TAQA 1NMNA 2Q97A 1YIJN 1B9FA 4C1NK 2P9LB 3SAFA 3T1AA 4PY5A 2ZGYA 4JKBA 2V51B 2B4JA 4IDHA 1BU6O 3BF1A 4E19A 5BR9A 3KWGA 4DSLA 4OPAA 2O8BB 4ILHA 5DM7L 3HP6A 3VQBA 4Z4FA 2QTDA 2NRWA 4PKHA 4IOCL 2OPQA 4JKFA 2O8CA 1DGKN 3KKSA 4B9SA 1TV6A 3SUNA 2BANA 4E0DA 1VQLN 4BR9A 3M8SA 2IVOA 3NH2A 3CMAN 1NG9A 3WXIA 1SKRA 2F9TA 1VQON 5T7BA 2I7PA 4K0KK 1NGGA 2VGNA 4FPAA 1RILA 4PHTX 4BDYA 4B1ZA 1YF5L 4DSIA 1NOZA 3AVAA 4CZFA 3ZT1A 4N5SA 1TGOA 2KW4A 3OS0A 4E7KA 5KGWA 1J53A 1LW2A 1QSSA 5HRRA 4CD3A 3ZSRA 1ILYA 1IKVA 3THXA 4RG8A 4JI0K 2Z1IA 3LPUA 1DEJA 4I6MA 3MXJA 4CEQA 1REVA 3AV9A 4X62K 1JXBA 1T03A 4B3TK 2E8AA 1RT3A 1RBVA 3OYGA 2ASMA 4JN4A 5JLFA 4BRQA 4M42A 3HSCA 1NK7A 4K8XA 3D0PA 4O4GA 1NGEA 1T6DA 1C1CA 1SS6A 3T1YK 2QWPA 2JWKA 2NZTA 5BPLA 4NYFA 5HL7L 2HBKA 3SCXA 4DFJA 4EHTA 3PIOL 3LDNA 2O8EA 4C23A 4Y0WA 5J2MA 5HLFA 4EZ9A 3SAGA 1Z25A 4BRCA 1WOQA 2ZGZA 3THVA 3CPWM 4E89A 4BDPA 2HHUA 5FLXO 4DR5K 3VTIA 2GWJA 4EFHA 3L4QA 1DKGD 2QXFA 3K5NA 1VQKN 2X74A 4NLCA 3CM5A 4LF7K 4CHNA 1KQSM 3THXB 3AAPA 3OYKA 2VG6A 4I6MB 4LF6K 4FL9A 3QLHA 2UXDK 1KSPA 3C7NA 3O6WA 1EO1A 2ASOA 1N33K 2QWMA 3L2RA 2XRIA 3OY9A 4BRFA 1UA1A 2GTDA 3O4QA 2B5JA 4JKDA 3AVIA 2OA8A 3HOSA 5M1FA 1LOTB 3F5TA 3J8AA 3O9UA 5AQNA 2FF6A 1HPMA 4CZLA 3PSIA 3HPOA 4YHHK 4DTUA 1QVGM 1JCGA 1K8KB 4DHYA 1BQNA 1I94K 1YVUA 2O8EB 4DSFA 3QERA 3IS9A 1RT1A 1TK5A 1FKPA 1SL2A 1XMOK 4JKGB 4LF4K 1HNVA 1D9FA 1TKTA 4DR7K 4LF5K 3GBTA 3CD6N 3BDPA 3LL3A 4CZKA 3G0ZA 3TAPA 2HMIA 1W7AA 3L3UA 4BG9A 2W41A 5ELZA 2VWJA 3CCQN 4MQ3A 1OKJA 5EOYA 3I8DA 4JI5K 3L8BA 1VAZA 3SJJA 1BUPA 1LAWA 4JS5A 5I9EB 1RDWX 5M1NA 2YJFA 3AVBA 4B9VA 4JI7K 3C7NB 4Z4HA 2QW9A 3TSUA 4WQ4C 2P1JA 1SUQA 4FJ9A 1WSJA 5SWMA 4DQQA 2WTUA 3DOKA 3G25A 1QQNA 2P9UA
chains in the Genus database with same CATH topology
1BHLA 3DLHA 4DQPA 3ISNC 3OVNA 1LWEA 2YNIA 2E4LA 2YNHA 5EU7A 2G8HA 4M3YA 2IOCA 3V6DA 3AA5X 1JKHA 1TVRA 3C6UA 4I9QA 1ASVA 3MECA 3V4IA 4Q5VA 3OYFA 3P1GA 1QS4A 2EX3A 3K2PA 1NK9A 1C0UA 3QEPA 3TR8A 4IDKA 1T7PA 3HO1A 4CGIA 1ZBUA 3HSTB 1J5OA 4R5PA 4DSKA 2HHXA 4ELVA 1KVCA 4IFYA 1C1AA 4CEEA 3SPZA 3S9HA 4LY7A 3KLHA 1TL1A 1HYZA 3I0RA 3NF8A 3UIQA 4FJLA 4Z4GA 4AHSA 1KLNA 1JXEA 1WN7A 2G8UA 1ASUA 3AO3A 3ZT2A 5HP1A 4C8OA 1XHXA 3QO9A 1JL1A 3L3VA 3OYJA 3NBPA 3V81A 4KV8A 2PY5A 4F3OA 1JLBA 4DTXA 4OLBA 1VSEA 2HNYA 5K14A 1JLCA 1D9DA 3NDKA 2EHGA 4KI6A 3PO5A 3WNFA 3QESA 2A1RA 4B3OA 3LZIA 1NJWA 2AJQA 3L2VA 3HM9A 4KRFA 4CK1A 1RBSA 2Z1HA 4BWMA 1RTDA 4N76A 2HHQA 4OKJA 4NCBA 1S1VA 4B8AB 4E7LA 4DSEA 1NKCA 1B92A 1MU2A 2KFZA 3O3HA 2XY8A 1S1TA 3CM6A 3DRSA 4KKOA 3U3GA 1S6PA 3C95A 1C1BA 3SUOA 4O5BA 3C94A 3ALYA 1BCMA 2HNZA 2KZZA 4KHUA 2W42A 4MFBA 1FXXA 1RCHA 4RW8A 5CZ1A 4E7IA 4DTNA 4DF8A 1RDCA 1VRTA 4OGCA 3K58A 3QEXA 3KTQA 1WNSA 5FRMA 5KI6A 1X9SA 3V1OA 4KTWA 1Q8IA 4CFBA 3NH1A 3AVLA 3O3FA 3QNNA 3SYZA 4FLZA 3TAGA 4I7FA 4I2QA 3HK2A 3PUFA 2HVIA 4OJRA 4O55A 4CJ3A 3KLGA 1L3TA 2ITGA 4KFBA 1NOYA 4DFMA 5J1EA 1KFDA 4BE0A 3EYZA 1RTJA 3JYTA 4G1QA 1CXQA 4CHOA 4CEAA 3VQQA 1HQEA 4CF8A 4CIEA 5C42A 4AHCA 5KRSA 4W5TA 4KAZA 2OPSA 2RPIA 4FLUA 3AVMA 2IAJA 4Z4IA 1C6VA 4I2PA 3TWHA 5CYMA 1KRPA 1BQMA 4IKFA 4CEZA 1VSFA 1R0AA 1C0MA 2I5JA 1U4BA 1S5JA 4FZZA 3SQ2A 2G8WA 4YFUA 1RTHA 3AVJA 3A2FA 1F21A 1TKZA 4Y1DA 4DTPA 1EX4A 1FKOA 1JLFA 1NK0A 1NJZA 4CJKA 3O3GA 2G8KA 1NKEA 4BE2A 1JL2A 4Q0BA 2WONA 4CF9A 4KB0A 4GVMA 3RMCA 4M45A 3KK2A 3NGIA 4FJIA 2P51A 2YKMA 3ZT0A 3VQ6A 2XO7A 3MAQA 4FM2A 3AO1A 4DTSA 3EY1A 4EP5A 2FC0A 3U3YA 3SV3A 4FYDA 3NE6A 3PX4A 2ETJA 4E3SA 3SQ1A 2ATQA 1SKSA 5C24A 3LP0A 1DTQA 1D5AA 1HRHA 3LWMA 3RMDA 4ZTJA 1YTAA 4KHYA 3OYLA 3LZJA 3SNNA 2GBZA 4J2EA 4ID5A 4DQSA 1T05A 3HVRA 5CYQA 3MEGA 3ZSZA 1EKEA 4ELTA 1RDBA 2DFEA 4IG0A 3S3NA 3IAYA 4KI4A 3V9WA 3O4NA 3KD1E 1BI4A 1A5WA 3ITHA 3QEWA 2F8TA 1ZBFA 1L5UA 2KTQA 3TANA 4CGFA 4OKKA 2A1SA 4DTMA 2OZSA 1S9EA 1J9AA 4CFCA 2RKIA 2Z1GA 3TAMA 4CK3A 4DS4A 1I3AA 4CF0A 4HCBA 4HVJA 2KZMA 1XC9A 4OGEA 1LV5A 3AVHA 1S9GA 4C8NA 4FCYA 2KQ2A 3QEIA 4C8KA 1WSEA 3DLGA 4CJVA 3L2QA 1BL3A 3LP1A 1J54A 1C0TA 4JS4A 4FW1A 1L3VA 4QOZB 1X9WA 3LANA 2PYJA 4FW2A 4DMNA 1KFSA 1VSLA 1KCFA 4QAGA 4E7JA 4B9MA 4BDZA 4RW6A 3TAEA 5CZ2A 1SKWA 4B8CA 1ZBHA 1RT4A 1RT7A 4CJWA 5D3GA 1NJXA 2YV0X 4CJRA 3C6TA 1TK0A 5I42A 3K59A 4KB1A 3HJFA 3WNGA 4FLYA 1IG9A 1QHTA 1GOBA 4ICLA 4N56A 4C8MA 2Y1IA 4LH4A 2F96A 3VA0A 1NK6A 2GV9A 3DLEA 5JS2A 1BCOA 4DU3A 5HRPA 4CJSA 4DFPA 3QIOA 3DYAA 3AVFA 1TKDA 1N5YA 4CERA 1W9HA 3M8RA 4CK2A 4FZXC 4JLHA 3NGZA 1S1XA 1VRUA 2OPRA 2X6NA 2JGUA 3DLKA 4CGDA 3OYCA 4DU4A 2IDOA 1IKXA 1GOCA 3TAFA 1X9MA 4FK0A 1JLEA 3ZT3A 1LAVA 4FM1A 4EZ6A 3TI0A 1YTUA 4QCLA 4N47A 4KHSA 4FJJA 2D5RA 3AO4A 3LALA 3U6FA 3VQ4A 1HJRA 2B6AA 4OVLA 3NFAA 2QKKA 2FBXA 3ZCMA 2LSNA 3VQ9A 4OPJA 1U48A 1DLOA 2HW3A 4HHTA 4AILC 2E6LA 3ZSOA 1BI4B 1SV5A 3OS2A 4DTJA 3PX0A 1RTIA 4DWIA 1IO2A 1HMVA 1S6QA 1W0HA 4DF4A 4CHQA 3OYNA 1Q9XA 2DFFA 5KGXA 1KVBA 3SPYA 1IH7A 1WAFA 3ZSQA 4YNQA 4M3TA 4CIGA 4M3XA 4L8RB 3CG7A 3KLEA 1RT5A 1U04A 5HBMA 3HT3A 4DFKA 1D8YA 4XIUA 1QTMA 4F4KA 2FBVA 2IGIA 1EETA 3HPGA 4DQRA 4DU1A 3DLBA 1XHZA 3FFIA 4W5NA 4PQUA 3V9UA 4LH5A 3NHGA 2RN2A 1I39A 2X6SA 4AHVA 4ZTFA 4FJ5A 1HYVA 1TAQA 2NUBA 3B6PA 4CEOA 4IFVA 1RBTA 1TKXA 5E41A 1B9FA 1RT2A 1CZBA 1K6YA 4FZYA 4HUEA 3QIPA 3T1AA 2G8FA 4PY5A 1NJYA 1NK8A 4KHNA 4AHRA 4OPKA 2B4JA 1ZYQA 2RF2A 4DQIA 2IS3A 4M3UA 4FLWA 4J2BA 4E19A 4H4OA 3AVNA 3PY8A 4DSLA 1LW0A 3MXIA 4FJ8A 3NF7A 2X78A 4CEFA 2D0CA 3VQCA 3OYEA 3HP6A 1NK4A 4B9LA 2Y1JA 1RDDA 2VG7A 1BISA 4KTZA 3VQBA 3ZSXA 3OYHA 4DSJA 2ZE2A 3VQ8A 1FK9A 1U45A 1RBUA 1S1UA 3AA4A 3DOLA 2G8VA 3SV4A 4CCHA 5J2NA 3SZ2A 1CZ9A 3VA3A 3HP9A 1JLGA 4Z4FA 4CHPA 4K8ZA 4O0IA 2OPQA 4FK4A 4CHYA 4KHQA 3ZSWA 3KKSA 5J2PA 1RNHA 3V9SA 4B9SA 1TV6A 3LAKA 3SUNA 1N6QA 2BGGA 3VQPA 2HB5A 2BANA 3LDSA 4E0DA 3DLRA 4IBNA 1Z26A 1VSIA 3M8QA 3M8SA 3CQ8A 3NH2A 3HPHA 1SL1A 1SKRA 4FK2A 1X1PA 3DMJA 1HNIA 3H08A 4KO0A 4CIFA 5T7BA 3V9XA 2XY5A 3CFOA 3QEVA 3L2WA 1U47A 4DG1A 4FJMA 1ITGA 2HNDA 3E01A 1RILA 3T19A 4AH9A 5FROA 4M3ZA 4BDYA 3KK3A 4DSIA 1NOZA 4FJKA 4FJGA 3AVAA 1EP4A 1T8EA 3LP3A 2WOMA 3AA3A 3ZT1A 4JRPA 1ASWA 1TGOA 2KW4A 4CFDA 4N5SA 3OS0A 2OYQA 3G10A 1CXUA 5KGWA 4E7KA 1J53A 1LW2A 4CJTA 4RW9A 1WLJA 1QSSA 3V1RA 4DS5A 5HRRA 4C8LA 4FLTA 3ZSRA 2BE2A 3DM2A 1IKVA 1DTTA 4RG8A 1YT3A 2ZQBA 3NF6A 5J2QA 1VSHA 2Z1IA 1WSIA 3LPTA 3LPUA 1XWLA 3MXJA 1WSFA 4CEQA 4FLVA 2XY6A 1REVA 3AV9A 3PO4A 4J2DA 2YKNA 1QSLA 1JXBA 1XI1A 1T03A 3I0SA 3NH0A 3CFPA 4ZHRA 4AHTA 3OYAA 3SQ4A 1RT3A 4CECA 1RBVA 2XY7A 3OYGA 1IKYA 4HUGA 4WE1A 2YNFA 3RMAA 4CGGA 1KTQA 4M42A 1NK7A 1LWCA 4W5OA 1LWFA 4K8XA 3LWLA 4RW4A 3PX6A 4FVMA 4AHUA 4CEBA 3OYDA 4O0JA 1Y97A 2VWKA 4O4GA 3D0PA 1ZBLA 1U49A 3F9KA 3OJUA 2P5GA 3K5MA 5I3UA 1TK8A 1C1CA 4N41A 4KTQA 1NK5A 3RR8A 1HPZA 3AA2A 3EZ5A 4E1MA 3D45A 3TARA 4GW6A 4NYFA 4CFAA 4PWDA 3SCXA 4NYNA 3OYIA 4DFJA 1QSYA 3VQEA 2F8SA 3WNEA 5HRNA 1CLQA 2HHTA 2DY4A 4BACA 3KLIA 4OLAA 4FM0A 3F73A 1ZBIA 1JLAA 4H4MA 5J2MA 4HCCA 3AO5A 5KTQA 4F3TA 3PV8A 5HLFA 1VSKA 4E7HA 4I9LA 4EZ9A 1Z25A 4FJXA 5DK5A 1O1WA 3K5OA 5FRNA 1B9DA 3THVA 4CGJA 4B9UA 4UQGA 4E89A 3P83D 4Z4CA 3RWUA 4BDPA 2HHUA 3NF9A 3IG1A 2D0BA 3HXMA 4O44A 4CE9A 3OYMA 3L2UA 3S3MA 3RR7A 3K57A 4DTRA 1SL0A 3M8PA 4M41A 1RBRA 4HTUA 3SUPA 2QXFA 3OS1A 4ID1A 1KLMA 2IC3A 4IG3A 3VQAA 3K5NA 3KLFA 3CFRA 2X74A 1JLQA 4PUOA 4HUFA 3ZSYA 2YHAA 4CJFA 1UA0A 3IRXA 3CM5A 5HROA 4M3RA 1EXQA 2FBYA 3DRRA 2ZD1A 4BWJA 4CHNA 1Q9YA 4F2SA 2QKBA 3HYFA 1VK0A 1HYSA 2O4GA 4LSNA 2JLEA 2VG6A 3OYKA 2O4IA 4CGHA 4FJHA 3BGRA 3DI6A 4TSXA 3QLHA 4CEDA 3LAMA 1KSPA 2XHBA 2P5OA 4CJUA 3B6OA 1UOCA 3K5LA 3L2RA 4F8RA 4NCAA 2XRIA 3HL8A 4DLEA 3OY9A 3SQ0A 1UA1A 2Z1JA 4OKEA 5DMRA 3DRPA 3O4QA 2B5JA 3VQ5A 1HQUA 3JSMA 3AVIA 2KFNA 2OA8A 4W5QA 3SI6A 4CJQA 4GMJB 3QINA 1VSDA 1WAJA 4CJ5A 2OPPA 3SUQA 4DTOA 3OJSA 1UWBA 4KREA 3ZT4A 3AVGA 3HPOA 3KK1A 1UAXA 4CF2A 2FBTA 4LSLA 5KRTA 4DTUA 3KD5E 1RT6A 2BDPA 3VQDA 2Q3SA 2D0AA 4W5RA 3S3OA 4B9NA 5HRSA 4KPYA 1A5XA 1BQNA 3MXMA 4JRQA 1KVAA 5JS1A 1YVUA 1IKWA 2DTUA 3V1QA 4NCGA 2E6MA 3CYMA 3VQ7A 4CHZA 3NCIA 2HHWA 4FLXA 4DSFA 3QNOA 3QERA 1QQCA 3IS9A 4F2RA 3T3FA 3AO2A 1VSMA 4FJNA 1RT1A 3HVTA 1TK5A 1FKPA 3RMBA 4B08A 4CJPA 1SL2A 1BGXT 3ZSVA 2PYLA 4B9TA 4RW7A 1HNVA 1D9FA 1RDAA 5SZTA 4BE1A 2G8IA 1TKTA 1QE1A 1S1WA 3KJVA 4DLGA 2VG5A 2YNGA 5C25A 1VSJA 3NAEA 2OZMA 3BDPA 3RRGA 1GOAA 4FJ7A 2HVHA 4H8KA 4Y1CA 2HHVA 3ULDA 3VN5A 4PA1A 2DFHA 3G0ZA 4LD0A 4CJEA 3TAPA 3TAQA 1NKBA 2HMIA 1G15A 3AVKA 3L3UA 3RTVA 3QETA 2HHSA 1WSGA 4CJ4A 2VWJA 5CY4A 3AVCA 4M3WA 4MQ3A 3OYBA 3NGYA 3I8DA 1L3UA 3MEDA 3WNHA 3L8BA 2R7YA 3TABA 3SJJA 3MEEA 1TL3A 1LAWA 3V9ZA 2PZSA 4JS5A 4Z4EA 1TAUA 4EP4A 3KKRA 3KIOA 3AVBA 4B9VA 3LP2A 4CJLA 4Z4HA 1L3SA 1A5VA 4CESA 5FDLA 3P5JA 4KHWA 2P1JA 2YHBA 1SUQA 1WSHA 4FJ9A 1WSJA 3ASMA 4FXDA 5SWMA 3RRHA 4DQQA 4J2AA 1BIUA 2GUIA 4ELUA 3DOKA 1BIZA 4E1NA 4CF1A 4Z0UA 2QK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHL A;  3DLH A;  4DQP A;  3ISN C;  3OVN A;  1LWE A;  2YNI A;  2E4L A;  2YNH A;  5EU7 A;  2G8H A;  4M3Y A;  2IOC A;  3V6D A;  3AA5 X;  1JKH A;  1TVR A;  3C6U A;  4I9Q A;  1ASV A;  3MEC A;  3V4I A;  4Q5V A;  3OYF A;  3P1G A;  1QS4 A;  2EX3 A;  3K2P A;  1NK9 A;  1C0U A;  3QEP A;  3TR8 A;  4IDK A;  1T7P A;  3HO1 A;  4CGI A;  1ZBU A;  3HST B;  1J5O A;  4R5P A;  4DSK A;  2HHX A;  4ELV A;  1KVC A;  4IFY A;  1C1A A;  4CEE A;  3SPZ A;  3S9H A;  4LY7 A;  3KLH A;  1TL1 A;  1HYZ A;  3I0R A;  3NF8 A;  3UIQ A;  4FJL A;  4Z4G A;  4AHS A;  1KLN A;  1JXE A;  1WN7 A;  2G8U A;  1ASU A;  3AO3 A;  3ZT2 A;  5HP1 A;  4C8O A;  1XHX A;  3QO9 A;  1JL1 A;  3L3V A;  3OYJ A;  3NBP A;  3V81 A;  4KV8 A;  2PY5 A;  4F3O A;  1JLB A;  4DTX A;  4OLB A;  1VSE A;  2HNY A;  5K14 A;  1JLC A;  1D9D A;  3NDK A;  2EHG A;  4KI6 A;  3PO5 A;  3WNF A;  3QES A;  2A1R A;  4B3O A;  3LZI A;  1NJW A;  2AJQ A;  3L2V A;  3HM9 A;  4KRF A;  4CK1 A;  1RBS A;  2Z1H A;  4BWM A;  1RTD A;  4N76 A;  2HHQ A;  4OKJ A;  4NCB A;  1S1V A;  4B8A B;  4E7L A;  4DSE A;  1NKC A;  1B92 A;  1MU2 A;  2KFZ A;  3O3H A;  2XY8 A;  1S1T A;  3CM6 A;  3DRS A;  4KKO A;  3U3G A;  1S6P A;  3C95 A;  1C1B A;  3SUO A;  4O5B A;  3C94 A;  3ALY A;  1BCM A;  2HNZ A;  2KZZ A;  4KHU A;  2W42 A;  4MFB A;  1FXX A;  1RCH A;  4RW8 A;  5CZ1 A;  4E7I A;  4DTN A;  4DF8 A;  1RDC A;  1VRT A;  4OGC A;  3K58 A;  3QEX A;  3KTQ A;  1WNS A;  5FRM A;  5KI6 A;  1X9S A;  3V1O A;  4KTW A;  1Q8I A;  4CFB A;  3NH1 A;  3AVL A;  3O3F A;  3QNN A;  3SYZ A;  4FLZ A;  3TAG A;  4I7F A;  4I2Q A;  3HK2 A;  3PUF A;  2HVI A;  4OJR A;  4O55 A;  4CJ3 A;  3KLG A;  1L3T A;  2ITG A;  4KFB A;  1NOY A;  4DFM A;  5J1E A;  1KFD A;  4BE0 A;  3EYZ A;  1RTJ A;  3JYT A;  4G1Q A;  1CXQ A;  4CHO A;  4CEA A;  3VQQ A;  1HQE A;  4CF8 A;  4CIE A;  5C42 A;  4AHC A;  5KRS A;  4W5T A;  4KAZ A;  2OPS A;  2RPI A;  4FLU A;  3AVM A;  2IAJ A;  4Z4I A;  1C6V A;  4I2P A;  3TWH A;  5CYM A;  1KRP A;  1BQM A;  4IKF A;  4CEZ A;  1VSF A;  1R0A A;  1C0M A;  2I5J A;  1U4B A;  1S5J A;  4FZZ A;  3SQ2 A;  2G8W A;  4YFU A;  1RTH A;  3AVJ A;  3A2F A;  1F21 A;  1TKZ A;  4Y1D A;  4DTP A;  1EX4 A;  1FKO A;  1JLF A;  1NK0 A;  1NJZ A;  4CJK A;  3O3G A;  2G8K A;  1NKE A;  4BE2 A;  1JL2 A;  4Q0B A;  2WON A;  4CF9 A;  4KB0 A;  4GVM A;  3RMC A;  4M45 A;  3KK2 A;  3NGI A;  4FJI A;  2P51 A;  2YKM A;  3ZT0 A;  3VQ6 A;  2XO7 A;  3MAQ A;  4FM2 A;  3AO1 A;  4DTS A;  3EY1 A;  4EP5 A;  2FC0 A;  3U3Y A;  3SV3 A;  4FYD A;  3NE6 A;  3PX4 A;  2ETJ A;  4E3S A;  3SQ1 A;  2ATQ A;  1SKS A;  5C24 A;  3LP0 A;  1DTQ A;  1D5A A;  1HRH A;  3LWM A;  3RMD A;  4ZTJ A;  1YTA A;  4KHY A;  3OYL A;  3LZJ A;  3SNN A;  2GBZ A;  4J2E A;  4ID5 A;  4DQS A;  1T05 A;  3HVR A;  5CYQ A;  3MEG A;  3ZSZ A;  1EKE A;  4ELT A;  1RDB A;  2DFE A;  4IG0 A;  3S3N A;  3IAY A;  4KI4 A;  3V9W A;  3O4N A;  3KD1 E;  1BI4 A;  1A5W A;  3ITH A;  3QEW A;  2F8T A;  1ZBF A;  1L5U A;  2KTQ A;  3TAN A;  4CGF A;  4OKK A;  2A1S A;  4DTM A;  2OZS A;  1S9E A;  1J9A A;  4CFC A;  2RKI A;  2Z1G A;  3TAM A;  4CK3 A;  4DS4 A;  1I3A A;  4CF0 A;  4HCB A;  4HVJ A;  2KZM A;  1XC9 A;  4OGE A;  1LV5 A;  3AVH A;  1S9G A;  4C8N A;  4FCY A;  2KQ2 A;  3QEI A;  4C8K A;  1WSE A;  3DLG A;  4CJV A;  3L2Q A;  1BL3 A;  3LP1 A;  1J54 A;  1C0T A;  4JS4 A;  4FW1 A;  1L3V A;  4QOZ B;  1X9W A;  3LAN A;  2PYJ A;  4FW2 A;  4DMN A;  1KFS A;  1VSL A;  1KCF A;  4QAG A;  4E7J A;  4B9M A;  4BDZ A;  4RW6 A;  3TAE A;  5CZ2 A;  1SKW A;  4B8C A;  1ZBH A;  1RT4 A;  1RT7 A;  4CJW A;  5D3G A;  1NJX A;  2YV0 X;  4CJR A;  3C6T A;  1TK0 A;  5I42 A;  3K59 A;  4KB1 A;  3HJF A;  3WNG A;  4FLY A;  1IG9 A;  1QHT A;  1GOB A;  4ICL A;  4N56 A;  4C8M A;  2Y1I A;  4LH4 A;  2F96 A;  3VA0 A;  1NK6 A;  2GV9 A;  3DLE A;  5JS2 A;  1BCO A;  4DU3 A;  5HRP A;  4CJS A;  4DFP A;  3QIO A;  3DYA A;  3AVF A;  1TKD A;  1N5Y A;  4CER A;  1W9H A;  3M8R A;  4CK2 A;  4FZX C;  4JLH A;  3NGZ A;  1S1X A;  1VRU A;  2OPR A;  2X6N A;  2JGU A;  3DLK A;  4CGD A;  3OYC A;  4DU4 A;  2IDO A;  1IKX A;  1GOC A;  3TAF A;  1X9M A;  4FK0 A;  1JLE A;  3ZT3 A;  1LAV A;  4FM1 A;  4EZ6 A;  3TI0 A;  1YTU A;  4QCL A;  4N47 A;  4KHS A;  4FJJ A;  2D5R A;  3AO4 A;  3LAL A;  3U6F A;  3VQ4 A;  1HJR A;  2B6A A;  4OVL A;  3NFA A;  2QKK A;  2FBX A;  3ZCM A;  2LSN A;  3VQ9 A;  4OPJ A;  1U48 A;  1DLO A;  2HW3 A;  4HHT A;  4AIL C;  2E6L A;  3ZSO A;  1BI4 B;  1SV5 A;  3OS2 A;  4DTJ A;  3PX0 A;  1RTI A;  4DWI A;  1IO2 A;  1HMV A;  1S6Q A;  1W0H A;  4DF4 A;  4CHQ A;  3OYN A;  1Q9X A;  2DFF A;  5KGX A;  1KVB A;  3SPY A;  1IH7 A;  1WAF A;  3ZSQ A;  4YNQ A;  4M3T A;  4CIG A;  4M3X A;  4L8R B;  3CG7 A;  3KLE A;  1RT5 A;  1U04 A;  5HBM A;  3HT3 A;  4DFK A;  1D8Y A;  4XIU A;  1QTM A;  4F4K A;  2FBV A;  2IGI A;  1EET A;  3HPG A;  4DQR A;  4DU1 A;  3DLB A;  1XHZ A;  3FFI A;  4W5N A;  4PQU A;  3V9U A;  4LH5 A;  3NHG A;  2RN2 A;  1I39 A;  2X6S A;  4AHV A;  4ZTF A;  4FJ5 A;  1HYV A;  1TAQ A;  2NUB A;  3B6P A;  4CEO A;  4IFV A;  1RBT A;  1TKX A;  5E41 A;  1B9F A;  1RT2 A;  1CZB A;  1K6Y A;  4FZY A;  4HUE A;  3QIP A;  3T1A A;  2G8F A;  4PY5 A;  1NJY A;  1NK8 A;  4KHN A;  4AHR A;  4OPK A;  2B4J A;  1ZYQ A;  2RF2 A;  4DQI A;  2IS3 A;  4M3U A;  4FLW A;  4J2B A;  4E19 A;  4H4O A;  3AVN A;  3PY8 A;  4DSL A;  1LW0 A;  3MXI A;  4FJ8 A;  3NF7 A;  2X78 A;  4CEF A;  2D0C A;  3VQC A;  3OYE A;  3HP6 A;  1NK4 A;  4B9L A;  2Y1J A;  1RDD A;  2VG7 A;  1BIS A;  4KTZ A;  3VQB A;  3ZSX A;  3OYH A;  4DSJ A;  2ZE2 A;  3VQ8 A;  1FK9 A;  1U45 A;  1RBU A;  1S1U A;  3AA4 A;  3DOL A;  2G8V A;  3SV4 A;  4CCH A;  5J2N A;  3SZ2 A;  1CZ9 A;  3VA3 A;  3HP9 A;  1JLG A;  4Z4F A;  4CHP A;  4K8Z A;  4O0I A;  2OPQ A;  4FK4 A;  4CHY A;  4KHQ A;  3ZSW A;  3KKS A;  5J2P A;  1RNH A;  3V9S A;  4B9S A;  1TV6 A;  3LAK A;  3SUN A;  1N6Q A;  2BGG A;  3VQP A;  2HB5 A;  2BAN A;  3LDS A;  4E0D A;  3DLR A;  4IBN A;  1Z26 A;  1VSI A;  3M8Q A;  3M8S A;  3CQ8 A;  3NH2 A;  3HPH A;  1SL1 A;  1SKR A;  4FK2 A;  1X1P A;  3DMJ A;  1HNI A;  3H08 A;  4KO0 A;  4CIF A;  5T7B A;  3V9X A;  2XY5 A;  3CFO A;  3QEV A;  3L2W A;  1U47 A;  4DG1 A;  4FJM A;  1ITG A;  2HND A;  3E01 A;  1RIL A;  3T19 A;  4AH9 A;  5FRO A;  4M3Z A;  4BDY A;  3KK3 A;  4DSI A;  1NOZ A;  4FJK A;  4FJG A;  3AVA A;  1EP4 A;  1T8E A;  3LP3 A;  2WOM A;  3AA3 A;  3ZT1 A;  4JRP A;  1ASW A;  1TGO A;  2KW4 A;  4CFD A;  4N5S A;  3OS0 A;  2OYQ A;  3G10 A;  1CXU A;  5KGW A;  4E7K A;  1J53 A;  1LW2 A;  4CJT A;  4RW9 A;  1WLJ A;  1QSS A;  3V1R A;  4DS5 A;  5HRR A;  4C8L A;  4FLT A;  3ZSR A;  2BE2 A;  3DM2 A;  1IKV A;  1DTT A;  4RG8 A;  1YT3 A;  2ZQB A;  3NF6 A;  5J2Q A;  1VSH A;  2Z1I A;  1WSI A;  3LPT A;  3LPU A;  1XWL A;  3MXJ A;  1WSF A;  4CEQ A;  4FLV A;  2XY6 A;  1REV A;  3AV9 A;  3PO4 A;  4J2D A;  2YKN A;  1QSL A;  1JXB A;  1XI1 A;  1T03 A;  3I0S A;  3NH0 A;  3CFP A;  4ZHR A;  4AHT A;  3OYA A;  3SQ4 A;  1RT3 A;  4CEC A;  1RBV A;  2XY7 A;  3OYG A;  1IKY A;  4HUG A;  4WE1 A;  2YNF A;  3RMA A;  4CGG A;  1KTQ A;  4M42 A;  1NK7 A;  1LWC A;  4W5O A;  1LWF A;  4K8X A;  3LWL A;  4RW4 A;  3PX6 A;  4FVM A;  4AHU A;  4CEB A;  3OYD A;  4O0J A;  1Y97 A;  2VWK A;  4O4G A;  3D0P A;  1ZBL A;  1U49 A;  3F9K A;  3OJU A;  2P5G A;  3K5M A;  5I3U A;  1TK8 A;  1C1C A;  4N41 A;  4KTQ A;  1NK5 A;  3RR8 A;  1HPZ A;  3AA2 A;  3EZ5 A;  4E1M A;  3D45 A;  3TAR A;  4GW6 A;  4NYF A;  4CFA A;  4PWD A;  3SCX A;  4NYN A;  3OYI A;  4DFJ A;  1QSY A;  3VQE A;  2F8S A;  3WNE A;  5HRN A;  1CLQ A;  2HHT A;  2DY4 A;  4BAC A;  3KLI A;  4OLA A;  4FM0 A;  3F73 A;  1ZBI A;  1JLA A;  4H4M A;  5J2M A;  4HCC A;  3AO5 A;  5KTQ A;  4F3T A;  3PV8 A;  5HLF A;  1VSK A;  4E7H A;  4I9L A;  4EZ9 A;  1Z25 A;  4FJX A;  5DK5 A;  1O1W A;  3K5O A;  5FRN A;  1B9D A;  3THV A;  4CGJ A;  4B9U A;  4UQG A;  4E89 A;  3P83 D;  4Z4C A;  3RWU A;  4BDP A;  2HHU A;  3NF9 A;  3IG1 A;  2D0B A;  3HXM A;  4O44 A;  4CE9 A;  3OYM A;  3L2U A;  3S3M A;  3RR7 A;  3K57 A;  4DTR A;  1SL0 A;  3M8P A;  4M41 A;  1RBR A;  4HTU A;  3SUP A;  2QXF A;  3OS1 A;  4ID1 A;  1KLM A;  2IC3 A;  4IG3 A;  3VQA A;  3K5N A;  3KLF A;  3CFR A;  2X74 A;  1JLQ A;  4PUO A;  4HUF A;  3ZSY A;  2YHA A;  4CJF A;  1UA0 A;  3IRX A;  3CM5 A;  5HRO A;  4M3R A;  1EXQ A;  2FBY A;  3DRR A;  2ZD1 A;  4BWJ A;  4CHN A;  1Q9Y A;  4F2S A;  2QKB A;  3HYF A;  1VK0 A;  1HYS A;  2O4G A;  4LSN A;  2JLE A;  2VG6 A;  3OYK A;  2O4I A;  4CGH A;  4FJH A;  3BGR A;  3DI6 A;  4TSX A;  3QLH A;  4CED A;  3LAM A;  1KSP A;  2XHB A;  2P5O A;  4CJU A;  3B6O A;  1UOC A;  3K5L A;  3L2R A;  4F8R A;  4NCA A;  2XRI A;  3HL8 A;  4DLE A;  3OY9 A;  3SQ0 A;  1UA1 A;  2Z1J A;  4OKE A;  5DMR A;  3DRP A;  3O4Q A;  2B5J A;  3VQ5 A;  1HQU A;  3JSM A;  3AVI A;  2KFN A;  2OA8 A;  4W5Q A;  3SI6 A;  4CJQ A;  4GMJ B;  3QIN A;  1VSD A;  1WAJ A;  4CJ5 A;  2OPP A;  3SUQ A;  4DTO A;  3OJS A;  1UWB A;  4KRE A;  3ZT4 A;  3AVG A;  3HPO A;  3KK1 A;  1UAX A;  4CF2 A;  2FBT A;  4LSL A;  5KRT A;  4DTU A;  3KD5 E;  1RT6 A;  2BDP A;  3VQD A;  2Q3S A;  2D0A A;  4W5R A;  3S3O A;  4B9N A;  5HRS A;  4KPY A;  1A5X A;  1BQN A;  3MXM A;  4JRQ A;  1KVA A;  5JS1 A;  1YVU A;  1IKW A;  2DTU A;  3V1Q A;  4NCG A;  2E6M A;  3CYM A;  3VQ7 A;  4CHZ A;  3NCI A;  2HHW A;  4FLX A;  4DSF A;  3QNO A;  3QER A;  1QQC A;  3IS9 A;  4F2R A;  3T3F A;  3AO2 A;  1VSM A;  4FJN A;  1RT1 A;  3HVT A;  1TK5 A;  1FKP A;  3RMB A;  4B08 A;  4CJP A;  1SL2 A;  1BGX T;  3ZSV A;  2PYL A;  4B9T A;  4RW7 A;  1HNV A;  1D9F A;  1RDA A;  5SZT A;  4BE1 A;  2G8I A;  1TKT A;  1QE1 A;  1S1W A;  3KJV A;  4DLG A;  2VG5 A;  2YNG A;  5C25 A;  1VSJ A;  3NAE A;  2OZM A;  3BDP A;  3RRG A;  1GOA A;  4FJ7 A;  2HVH A;  4H8K A;  4Y1C A;  2HHV A;  3ULD A;  3VN5 A;  4PA1 A;  2DFH A;  3G0Z A;  4LD0 A;  4CJE A;  3TAP A;  3TAQ A;  1NKB A;  2HMI A;  1G15 A;  3AVK A;  3L3U A;  3RTV A;  3QET A;  2HHS A;  1WSG A;  4CJ4 A;  2VWJ A;  5CY4 A;  3AVC A;  4M3W A;  4MQ3 A;  3OYB A;  3NGY A;  3I8D A;  1L3U A;  3MED A;  3WNH A;  3L8B A;  2R7Y A;  3TAB A;  3SJJ A;  3MEE A;  1TL3 A;  1LAW A;  3V9Z A;  2PZS A;  4JS5 A;  4Z4E A;  1TAU A;  4EP4 A;  3KKR A;  3KIO A;  3AVB A;  4B9V A;  3LP2 A;  4CJL A;  4Z4H A;  1L3S A;  1A5V A;  4CES A;  5FDL A;  3P5J A;  4KHW A;  2P1J A;  2YHB A;  1SUQ A;  1WSH A;  4FJ9 A;  1WSJ A;  3ASM A;  4FXD A;  5SWM A;  3RRH A;  4DQQ A;  4J2A A;  1BIU A;  2GUI A;  4ELU A;  3DOK A;  1BIZ A;  4E1N A;  4CF1 A;  4Z0U A;  2QK9 A; 
#chains in the Genus database with same CATH topology
 3DLH A;  2E4L A;  2YNH A;  2YHX A;  3CCE N;  3C6U A;  3MEC A;  3V4I A;  3EE8 A;  4BQZ A;  3P1G A;  1J6Z A;  3TR8 A;  1T7P A;  3HO1 A;  3VEO A;  4E1J A;  5AQZ A;  4R5P A;  3GDQ A;  1C1A A;  4LY7 A;  1TL1 A;  1T6C A;  2ITM A;  3UIQ A;  1KLN A;  3AO3 A;  3ZT2 A;  4H0X B;  3QO9 A;  4KH4 A;  5JIC A;  4KV8 A;  2PY5 A;  4JI1 K;  4F3O A;  1GLC G;  5LL6 Z;  4OLB A;  2EHG A;  4B3O A;  2E20 A;  2AJQ A;  4BRG A;  2F9W A;  3MK6 A;  2HHQ A;  1S1V A;  4DSE A;  1NKC A;  2FSK A;  2I7N A;  2XY8 A;  5JVH L;  4HWI A;  3FGU A;  3CC2 N;  5C2D A;  4FWL A;  4KHU A;  2W42 A;  4MFB A;  1RDC A;  5AQK A;  5KI6 A;  1Q8I A;  3AVL A;  3M6G A;  3L0Q A;  4I7F A;  2HVI A;  4OJR A;  4KFB A;  2P9U B;  4DUY K;  4JI4 K;  1RTJ A;  3IUC A;  1CXQ A;  4W5T A;  4PKI A;  1NJI O;  2OPS A;  2RPI A;  2QA4 N;  2A40 A;  1QHA A;  2QWL A;  1BQM A;  2E2Q A;  1R0A A;  4FZZ A;  2P9K A;  2G8W A;  4DR4 K;  3QB0 A;  1EX4 A;  3ZLJ A;  3NVM A;  3DAW A;  4RTF D;  3O3G A;  1HLU A;  2G8K A;  1W2B M;  1NKE A;  3QFU A;  2WON A;  4IO8 A;  4KB0 A;  2UU9 K;  4FVU A;  5IWA K;  5AQJ A;  2XO7 A;  3MAQ A;  4EP5 A;  1R59 O;  4FYD A;  1HKG A;  4E3S A;  2ATQ A;  1SKS A;  3H45 C;  4YDU A;  1NM1 A;  4IXC A;  1DTQ A;  1D5A A;  3RMD A;  3E9O A;  3H1V X;  4BVP A;  5FPE A;  3LZJ A;  5BN8 A;  1T05 A;  4X66 K;  5C2F A;  4BR4 A;  4IG0 A;  1KD1 O;  3WUH A;  1NGD A;  1P8Z A;  3AY9 A;  4KI4 A;  3O4N A;  3KD1 E;  1A5W A;  3SK3 A;  3A5M C;  5JLH A;  4LF9 K;  3R6M A;  1V4S A;  1EWQ A;  2A1S A;  2OZS A;  3EZW A;  3KK7 A;  3TAM A;  4CF0 A;  3I33 A;  3AVH A;  4DV1 K;  4FCY A;  1LCU A;  2JWL A;  4C8K A;  1WSE A;  3L2Q A;  3HTV A;  3WXM B;  4E7J A;  4B9M A;  4BDZ A;  4RW6 A;  3TAE A;  4ISE A;  5JMV A;  1WBD A;  4B8C A;  2QWR A;  4CBX A;  4B3M K;  5LJW A;  2ZF5 O;  1XUP O;  1JJ2 M;  3J7Y P;  2HBJ A;  1QHT A;  4N56 A;  2Y1I A;  1IV0 A;  4LH4 A;  1NK6 A;  3VEV A;  2QM1 A;  4CJS A;  4DFP A;  3DYA A;  2NRV A;  1N32 K;  3IKM A;  3NGZ A;  5AQX A;  1S1X A;  4CGD A;  1YI2 N;  3DLK A;  3ENB A;  1LAV A;  5AZJ B;  4QCL A;  2A41 A;  4KHS A;  3AO4 A;  3U6F A;  3VQ4 A;  1HJR A;  5C12 A;  4CI6 A;  1W97 L;  3A5O C;  5LJV A;  5AFU A;  2HW3 A;  4AIL C;  3C6A A;  1BDG A;  4CHQ A;  2AA4 A;  3SPY A;  3T7Z A;  1IH7 A;  5FPD A;  3VEX A;  4M3X A;  4NLB A;  4YOU A;  3FZM A;  3A0I X;  4DFK A;  4Z94 A;  4EAH D;  4JHD A;  4BR0 A;  3HPG A;  4B1U B;  1XHZ A;  4GV3 A;  4PQU A;  3I56 N;  3V9U A;  4AHV A;  4CEO A;  4IFV A;  5E41 A;  3SLC A;  4BR5 A;  3AGR A;  1NLV A;  1TUU A;  3UKR A;  4GVE A;  4J2B A;  2OAN A;  4H4O A;  3AVN A;  3PY8 A;  3MXI A;  4FJ8 A;  3NF7 A;  4IO9 L;  3LM9 A;  3VQC A;  4BRD A;  4B9L A;  1NK4 A;  5GAH P;  3JAM O;  2VG7 A;  1BIS A;  4KTZ A;  3OYH A;  3VQ8 A;  2G8V A;  1FK9 A;  1RBU A;  1DT9 A;  3GOI A;  3DOL A;  2ZM6 K;  3SV4 A;  4AM7 A;  3SZ2 A;  5J2N A;  1CZ9 A;  3QBW A;  3ULE A;  3HP9 A;  4CHP A;  4F9O A;  5AQW A;  5AFU H;  2D4W A;  3IFR A;  1RNH A;  3V9S A;  2BGG A;  2HB5 A;  3LDS A;  3CQX A;  4IBN A;  4FPB A;  3CQ8 A;  4BRA A;  4WFN L;  1RFQ A;  3CFO A;  1U47 A;  4DG1 A;  1SAZ A;  1ITG A;  3E01 A;  4X65 K;  5LMU K;  3RVC A;  3KK3 A;  3HRG A;  3CCJ N;  2OYQ A;  4WCE L;  3J80 O;  3G10 A;  1CXU A;  1HNZ K;  1KC8 O;  3CJB A;  2BE2 A;  3MCA B;  1DTT A;  2ZQB A;  4UY8 O;  3CET A;  2GUP A;  2XY6 A;  2YKN A;  1XI1 A;  2VQE K;  4H0T B;  1ZBS A;  4ZHR A;  4AHT A;  3SQ4 A;  4CEC A;  2KHO A;  1IKY A;  1SQK A;  4MO5 A;  1LWC A;  5EXW A;  4AHU A;  2YHY A;  4CEB A;  4DB3 A;  3OYD A;  1Y97 A;  1U49 A;  4B1V A;  3TTF A;  3CER A;  2GWK A;  3ULE B;  1TK8 A;  4N41 A;  4KTQ A;  4GKK K;  4WQ5 A;  5E84 A;  4GW6 A;  4PWD A;  3OYI A;  3O8M A;  1QSY A;  3KVG A;  5HRN A;  1CLQ A;  2DY4 A;  2QWQ A;  1NGB A;  3VEY A;  1JLA A;  4H4M A;  4HCC A;  3AO5 A;  3PV8 A;  4FJX A;  5FRN A;  1YVN A;  4ILJ A;  4CZJ A;  4FO0 A;  2BUP A;  3NF9 A;  3IG1 A;  3HXM A;  4O44 A;  4CE9 A;  3OYM A;  3RR7 A;  3K57 A;  4DTR A;  3M8P A;  3VF2 A;  5F2R A;  1RBR A;  4M41 A;  4HTU A;  5BRD A;  4IG3 A;  3KLF A;  3CFR A;  1JLQ A;  4HUF A;  3ZSY A;  4CJF A;  1UA0 A;  3N4P A;  3IRX A;  1N8R O;  4BY9 C;  4M3R A;  1EXQ A;  2FBY A;  4BWJ A;  4FWP A;  4LSN A;  2FLO A;  2HBL A;  4CGH A;  3BGR A;  4TSX A;  4CED A;  1QZ6 A;  2XHB A;  2P5O A;  4A5A A;  3HM8 A;  4F8R A;  1MDU B;  4DLE A;  3SQ0 A;  4BG8 A;  4LC9 B;  3DRP A;  2FSJ A;  1HQU A;  5EX5 A;  2KFN A;  1XMQ K;  4BGA A;  3QIN A;  1VSD A;  1WAJ A;  2OPP A;  1MA9 B;  4CD1 A;  4IJA A;  4KRE A;  3ZT4 A;  4BRO A;  5AQM A;  3SBT A;  3SMP A;  3EL2 A;  4LSL A;  3TPQ A;  3CCM N;  2Q3S A;  4B9N A;  5HRS A;  4KPY A;  1A5X A;  1ATN A;  2D1K A;  1KVA A;  5JS1 A;  4WFA L;  4H0O A;  4NCG A;  2CGK A;  1HX1 A;  2YX6 A;  4DCH A;  2HHW A;  3T3F A;  3AO2 A;  4G9Z A;  3HVT A;  4RCH A;  5BRF A;  2PYL A;  4FWK A;  2UXC K;  3TU5 A;  1QE1 A;  5LY3 A;  3KJV A;  2CH5 A;  5C25 A;  4CZE A;  4OO1 J;  1IJJ A;  4Y1C A;  2HHV A;  1NMD A;  3VN5 A;  1NKB A;  3AVK A;  4O5F A;  3QET A;  1OVY A;  1WSG A;  3AVC A;  4M3W A;  4JI8 K;  3OYB A;  3TTC A;  3HZ6 A;  2PBD A;  2R7Y A;  1TL3 A;  4Z4E A;  3KKR A;  3LP2 A;  5FDL A;  3O1B A;  3LDQ A;  3P5J A;  4IJN A;  4BVO A;  4KHW A;  3ASM A;  3MWP A;  3K9J A;  3H3O B;  1BIZ A;  4PL7 A;  4Z0U A;  2AP1 A;  4DQP A;  3BUZ B;  2G8H A;  4M3Y A;  4DUZ K;  1TVR A;  3D6R A;  3FZH A;  2KLA A;  3K2P A;  1NK9 A;  1HNX K;  1C0U A;  1K8K A;  3T69 A;  2NRR A;  4NXM K;  1ZBU A;  4KH5 A;  4ELV A;  3P31 A;  4B9Q A;  3KLH A;  1Q7Y O;  1HYZ A;  1NGI A;  2G8U A;  1ASU A;  5HP1 A;  2Q0U A;  1XHX A;  3SJH A;  3O9T A;  4JKG A;  3NBP A;  3V81 A;  2ASP A;  4JK9 A;  1NNE A;  2ZJQ L;  1VSE A;  2HNY A;  1JLC A;  4KI6 A;  3O4W A;  4JK7 A;  3ZET A;  4N76 A;  4NCB A;  4B8A B;  4E7L A;  1B92 A;  2KFZ A;  5BPM A;  1S1T A;  3CM6 A;  3DRS A;  3K0S A;  1C1B A;  3C94 A;  2HNZ A;  2KZZ A;  3H3N O;  4DF8 A;  1VRT A;  3FE1 A;  3QDK A;  4OGC A;  1U2V A;  4IEE A;  3J7A P;  1JCF A;  4KTW A;  1QZ5 A;  4CJ3 A;  4JK8 A;  1L3T A;  4BRP A;  1NOY A;  5J1E A;  4CF8 A;  4W5N A;  4CIE A;  5C42 A;  3U9Z A;  1HNW K;  1C0F A;  2Q36 A;  4IZ9 A;  3ENH A;  2IAJ A;  4IKF A;  2HF3 A;  1KAY A;  2I5J A;  3F9M A;  1RTH A;  3AVJ A;  1NWK A;  1QVF M;  3EE9 A;  1NJZ A;  2IIR A;  4BE2 A;  1JL2 A;  4Q0B A;  4LFB K;  3NGI A;  4FWM A;  3VEW A;  2IVN A;  4FM2 A;  1KAZ A;  2NLX A;  3O80 A;  1YUW A;  5C24 A;  3HBT A;  3ZET B;  5AQU A;  1HRH A;  3PSF A;  1RDU A;  3R8E A;  1XQS C;  3MEG A;  2A5X A;  3SMS A;  2GEM A;  4M63 C;  3QEW A;  4PKG A;  1J5E K;  1U2V B;  2QWN A;  4DTM A;  1S9E A;  1J9A A;  1YHQ N;  3VES A;  3KZB A;  1I3A A;  4HCB A;  5AR0 A;  4HVJ A;  1WB9 A;  1XC9 A;  4OGE A;  1LV5 A;  2EWS A;  4WFB L;  3DLG A;  4B1W B;  1BL3 A;  2WBN A;  3BZC A;  3JS6 A;  4FW2 A;  1KFS A;  2O8F B;  1KCF A;  4GV9 A;  5CZ2 A;  1SKW A;  1ZBH A;  1RT4 A;  1RT7 A;  5D3G A;  4CJR A;  4CBW A;  5AQS A;  2KKZ A;  5KPZ A;  1CZA N;  1BO5 O;  3R9P A;  2GEL A;  2F96 A;  3VA0 A;  3M1F A;  3QIO A;  1TKD A;  3M8R A;  4CK2 A;  1NGF A;  1VRU A;  5J2Q A;  2OCE A;  1NU0 A;  1EQY A;  1JLE A;  2W40 A;  1XNQ K;  4EZ6 A;  3E1Y A;  5GIN A;  4N47 A;  2CH6 A;  4O8K A;  4OVL A;  4H03 B;  1XC3 A;  2FBX A;  2P9I A;  3ZCM A;  2HF4 A;  4WF9 L;  1TYQ B;  1DLO A;  3ZSO A;  3OS2 A;  2VYP A;  1Q9X A;  1W0H A;  5KGX A;  1KVB A;  3ZSQ A;  4M3T A;  3CJ9 A;  4GKJ K;  5KPT A;  1U04 A;  2FBV A;  3GG4 A;  4FOE A;  3DLB A;  3OA9 A;  4FWO A;  4LH5 A;  5M1O A;  1BA0 A;  1I39 A;  2NUB A;  4JI2 K;  3WXK A;  4JI6 K;  1TKX A;  4DR3 K;  1QQM A;  4AHR A;  1ZYQ A;  2IS3 A;  4FLW A;  3G4S N;  1X3M A;  1VQM N;  1HJO A;  3PLA A;  3G6E N;  1GLL O;  1KXP A;  2X78 A;  2D0C A;  3VGM A;  1YJ9 N;  1RDD A;  3ZSX A;  5FPM A;  1U45 A;  3O08 A;  3AA4 A;  4KBO A;  3VF6 A;  3THW B;  4CCH A;  4MLE A;  4CZM A;  2HST A;  3C65 A;  4FWQ A;  4DV5 K;  4KHQ A;  5J2P A;  3LAK A;  1N6Q A;  4J8F A;  5AZJ A;  3DLR A;  1Z26 A;  1VSI A;  3M8Q A;  2P9I B;  1SL1 A;  1VQN N;  1X1P A;  2YJE A;  3DMJ A;  4V19 S;  3H08 A;  4KO0 A;  3I55 N;  3QEV A;  1M1K O;  3VET A;  2FSN A;  2NNW A;  3L2W A;  4A2B A;  4XH5 A;  4FJM A;  3L4I A;  2HND A;  1Q18 A;  3DXK A;  3T19 A;  5FRO A;  4FJK A;  4FJG A;  1EP4 A;  3RSE A;  3AA3 A;  1ASW A;  4CFD A;  3MX2 A;  4QS7 A;  1K8A O;  4RW9 A;  4C8L A;  2FF3 B;  4DS5 A;  4DKW A;  4FLT A;  3DM2 A;  4LFC K;  3ATU A;  4WQ5 C;  3DJC A;  3NF6 A;  1VQP N;  1VSH A;  3LPT A;  1WSI A;  5AQO A;  1WSF A;  4O8U A;  4FLV A;  4J2D A;  2PAV A;  1WUA A;  3TSP A;  5H1S Q;  1QSL A;  4DV6 K;  1HKB A;  3I0S A;  3NH0 A;  3OYA A;  3O9R A;  3P38 A;  2XY7 A;  3VF4 A;  3VPZ A;  4MO4 A;  4WE1 A;  3RMA A;  4CGG A;  1KTQ A;  4BRL A;  4W5O A;  2GX9 A;  2RHK A;  4RW4 A;  3LWL A;  4FVM A;  3PX6 A;  1ZBL A;  3O9Q A;  3OJU A;  5I3U A;  2YCH A;  5HOO A;  3S41 A;  3EZ5 A;  2O8D A;  4CFA A;  4NYN A;  3VQE A;  2F8S A;  1ATR A;  3WNE A;  3LM2 A;  4WQ4 A;  1ZBI A;  4OPH A;  5KTQ A;  4E7H A;  4I9L A;  4FOI A;  4DV0 K;  3BY5 A;  4BGB A;  1KAX A;  1O1W A;  3K5O A;  4JKE A;  4B9U A;  3DXK B;  4UQG A;  3RWU A;  3ZEU B;  4Z4C A;  3CJC A;  5TKY A;  4LFA K;  4BC4 A;  1SL0 A;  1NGH A;  3RSE B;  3GL1 A;  3O5B A;  3QBX A;  3SUP A;  5EVZ A;  3OS1 A;  1KLM A;  2IC3 A;  5C10 A;  1U6Z A;  4PUO A;  2YHA A;  5HRO A;  4F2S A;  1Q9Y A;  4JEP A;  2ZD1 A;  4X64 K;  2QKB A;  3HYF A;  1HYS A;  2O4G A;  3VGL A;  3DI6 A;  2V52 B;  3M5R A;  3LAM A;  3B6O A;  5AQY A;  2F4V K;  3K5L A;  4NCA A;  4KHP K;  3HL8 A;  3VGK A;  4A61 A;  2Z1J A;  1GLE G;  1SZ2 A;  4OKE A;  5DMR A;  3CJ1 A;  1QQO A;  3VQ5 A;  3JSM A;  4HTL A;  3SI6 A;  4CJQ A;  4GMJ B;  4BR7 A;  4YY3 K;  4K43 A;  3AVG A;  3OBY A;  1UAX A;  3C0B A;  2FBT A;  5KRT A;  3H6E A;  1EWR A;  2O8D B;  2D0A A;  5M1Q A;  3MXM A;  3VMF B;  1IKW A;  1Z6R A;  3V1Q A;  3NCI A;  3OHR A;  4NO7 A;  3JXU A;  1VSM A;  4CZH A;  1Z05 A;  1N36 K;  4B08 A;  1BGX T;  3ZSV A;  3DLL L;  4B9T A;  4CZG A;  4RW7 A;  1RDA A;  4BE1 A;  1S1W A;  4DLG A;  3TTD A;  3KHY A;  5GIO A;  1VSJ A;  3RRG A;  1GOA A;  4FJ7 A;  2HVH A;  3ULD A;  5AQG A;  4LD0 A;  4CJE A;  3TAQ A;  1G15 A;  3RTV A;  4AM6 A;  2HOE A;  4CJ4 A;  4AF1 A;  5CY4 A;  3NGY A;  3L6Q A;  3WQT A;  2P9S B;  4LF8 K;  1V4T A;  1TAU A;  1ATS A;  3KIO A;  4CJL A;  1L3S A;  4CES A;  4H0Y B;  2QXL A;  3MCP A;  3MMV A;  4FWS A;  2YHB A;  4JNE A;  5EY4 A;  4A57 A;  3RRH A;  5MLC Q;  1BIU A;  4KH6 A;  4DR6 K;  1HKC A;  1BHL A;  3OVN A;  5BR8 K;  2IOC A;  4I9Q A;  1JKH A;  5C0Y A;  3BF3 A;  2BTF A;  3W3D A;  1QS4 A;  2EX3 A;  4ISF A;  2OTL N;  1Y64 A;  4CGI A;  3EN9 A;  3CME N;  4IWV A;  4BRE A;  4DSK A;  2HHX A;  4CEE A;  3SPZ A;  5F1X A;  4C1N I;  3D7E O;  4Z4G A;  4XH1 A;  4C8O A;  5AQF A;  3OYJ A;  1JL1 A;  3L3V A;  4XEI A;  3THY A;  3U4L A;  4DTX A;  3ID8 A;  1D9D A;  4L3Q A;  5AZI A;  3FFK B;  4BRI A;  2HMP A;  1TUY A;  3QES A;  2A1R A;  4GNI A;  3J81 O;  4H5N A;  3LZI A;  4BC5 A;  3L2V A;  1T3V A;  4KRF A;  3UB5 A;  4CK1 A;  2Z1H A;  1RTD A;  4YOY A;  4OKJ A;  2D0O A;  1MU2 A;  2P9P A;  3O3H A;  1JCE A;  3U3G A;  3SUO A;  4O5B A;  5BPN A;  1VHX A;  4DR2 K;  4DV3 K;  1YIT N;  4DTN A;  4PL8 A;  3QFP A;  3QEX A;  2UUA K;  1X9S A;  3V1O A;  3QNN A;  4FLZ A;  3HK2 A;  4I2Q A;  2Q1N A;  4DFM A;  3ATV A;  1KFD A;  1ZXO A;  3VQQ A;  4KAZ A;  5KRS A;  5AQP A;  4AHC A;  1Q86 O;  3MN9 A;  3AVM A;  3UKU A;  4Z4I A;  1C6V A;  1IBK K;  3G71 N;  4CEZ A;  1WBB A;  1C0M A;  1U4B A;  3ZX3 A;  1K9M O;  3MN7 A;  3A2F A;  1TKZ A;  5TKW A;  1JLF A;  1E4G T;  4A2A A;  4MLH A;  1NK0 A;  1NGC A;  5AJ3 K;  4CJK A;  1BOT O;  4CF9 A;  3A8Y A;  4CVN E;  4GVM A;  4FJI A;  3THY B;  1VQ7 N;  3VQ6 A;  2WC9 A;  5AZI B;  2UYT A;  4DTS A;  3WXJ A;  3U3Y A;  3NE6 A;  3SQ1 A;  5KQ8 A;  4GY2 B;  2YI1 A;  5IT9 O;  5B8H A;  4ZTJ A;  4U67 L;  2P9P B;  4JKH A;  3SNN A;  4ID5 A;  3HVR A;  3QIC A;  5CYQ A;  1C0G A;  3P4I A;  1EKE A;  4NB4 A;  1RDB A;  2DFE A;  3S3N A;  3IAY A;  4M7X A;  1ZBF A;  1L5U A;  3FZF A;  4CGF A;  1VQ9 N;  4A5B A;  2Z1G A;  3CJ7 A;  2KZM A;  4H5T A;  1S9G A;  2KQ2 A;  3QEI A;  5E26 A;  4CJV A;  5GAD P;  4B1Y B;  3LP1 A;  3A5L C;  1J54 A;  1C0T A;  4JS4 A;  4FW1 A;  3OW2 M;  3BEX A;  3HI0 A;  2PYJ A;  3UKU B;  4DMN A;  1VSL A;  3PIP L;  3H46 O;  4IFE A;  4CJW A;  1NJX A;  2YV0 X;  1TK0 A;  5I42 A;  3CHW A;  3I8B A;  2Q0R A;  5AQL A;  4CBU A;  1GOB A;  3NMU A;  2GV9 A;  5M1P A;  1GLJ O;  1BCO A;  4DU3 A;  5HRP A;  3CIP A;  4CER A;  1W9H A;  1IBL K;  3M3Z A;  5M1K A;  4FZX C;  4JLH A;  2O8C B;  2JGU A;  4FK0 A;  2IDO A;  3TAF A;  1GOC A;  1YTU A;  3BP8 A;  5ADX A;  2Q31 A;  4DR1 K;  4FJJ A;  5LMN K;  3NFA A;  5AQQ A;  3VQ9 A;  4OPJ A;  1U48 A;  2CGL A;  4HHT A;  3DXM A;  1SV5 A;  4GV6 A;  1RTI A;  1HMV A;  1S6Q A;  2W6K A;  3OYN A;  2FXU A;  1WAF A;  1BA1 A;  2ZWH A;  4YNQ A;  4CZI A;  4JKA A;  3CG7 A;  3KLE A;  1RT5 A;  2W6L A;  4F4K A;  1QTM A;  3NHG A;  2RN2 A;  1VQ4 N;  3E9L A;  3B6P A;  1NBW A;  4YDU C;  3EEQ A;  1RBT A;  2O8F A;  1RT2 A;  1CZB A;  2YHW A;  1K6Y A;  4FZY A;  1YAG A;  4HUE A;  3QIP A;  2NRH A;  2G8F A;  1NJY A;  1NK8 A;  3BZK A;  4KHN A;  4OPK A;  4DQI A;  3R3L A;  2RF2 A;  4M3U A;  4H5V A;  2IVP A;  1GLD G;  3WXL A;  1YXQ A;  3IDH A;  2E5L K;  4BRH A;  1LW0 A;  2DPN A;  3VER A;  4CEF A;  3OYE A;  5AQT A;  5ADX H;  2Y1J A;  1IG8 A;  4DSJ A;  2A3Z A;  4JV5 K;  2ZE2 A;  1S1U A;  4BQL A;  3VA3 A;  3T1H K;  1YJN N;  1JLG A;  4K8Z A;  4O0I A;  4FK4 A;  4CHY A;  3ZSW A;  3VQP A;  3QML A;  2F7T A;  5CHI A;  5GAE P;  1N34 K;  3J7Z O;  4NXN K;  3HPH A;  2A6A A;  3E9P A;  5GAG P;  4FK2 A;  4CIF A;  1HNI A;  3V9X A;  2XY5 A;  4QS9 A;  4BC3 A;  1TYQ A;  3U9D A;  1X9J A;  3DXM B;  4CW7 B;  4M7Y A;  3NVK A;  4AH9 A;  4B3S K;  4M3Z A;  4U7B A;  4BR2 A;  1NGJ A;  3LP3 A;  2WOM A;  4JRP A;  1T44 A;  3ZX0 A;  4CJT A;  1WLJ A;  3V1R A;  3F2K A;  2WUS A;  1YT3 A;  5AQR A;  4BC2 A;  1Q82 O;  1XWL A;  3PO4 A;  3N4Q A;  3VOV A;  1H1V A;  3CFP A;  3FZK A;  4A62 A;  3H1Q A;  4HUG A;  5DM6 L;  2YNF A;  4H5R A;  1LWF A;  2UXB K;  4O0J A;  2VWK A;  3MN6 A;  4H5W A;  5CR4 A;  5KQD A;  3F9K A;  2P5G A;  4BRK A;  3K5M A;  3THW A;  1NK5 A;  3RR8 A;  1OVQ A;  1HPZ A;  3AA2 A;  4E1M A;  3D45 A;  2NRX A;  3TAR A;  1XNR K;  5FPN A;  3WQU A;  3CJA A;  2HHH K;  4DV2 K;  2HHT A;  4BAC A;  3KLI A;  4OLA A;  4FM0 A;  3F73 A;  1E3M A;  4F3T A;  1VSK A;  2NRT A;  5DK5 A;  5C15 A;  3CCL N;  4DQ8 A;  1B9D A;  2BH1 A;  2J4R A;  4CGJ A;  4ILG B;  4AQY K;  3P83 D;  3R1X A;  4EHU A;  3D2F A;  1E4F T;  2D0B A;  3A5N C;  3S3M A;  3L2U A;  4R79 A;  3MWT A;  2VQF K;  1T8E A;  4ID1 A;  3VQA A;  2VCP A;  3DRR A;  4FWN A;  5CE3 A;  1IBM K;  1VK0 A;  4BRM A;  1BG3 A;  4K41 A;  2JLE A;  4MDA A;  4JI3 K;  2O4I A;  4FJH A;  4BRN A;  4CJU A;  3LDO A;  3MX5 A;  1UOC A;  2E88 A;  3KWI A;  2V7Y A;  4JAX A;  2OTJ N;  3B8A X;  4DV7 K;  3W0L A;  3E66 A;  3VEZ A;  3OBW A;  4WYB A;  4W5Q A;  2P9N A;  4CJ5 A;  3SUQ A;  4DTO A;  3OJS A;  3MDQ A;  1UWB A;  4QS8 A;  3KK1 A;  4CF2 A;  3KD5 E;  1RT6 A;  2BDP A;  3VQD A;  4W5R A;  3S3O A;  2PFU A;  3EKS A;  2RE2 A;  4JRQ A;  3HOT A;  1S22 A;  2DTU A;  2E6M A;  3CPE A;  3CYM A;  3VQ7 A;  4CHZ A;  4FLX A;  3QNO A;  4F2R A;  1QQC A;  4YOW A;  4FJN A;  3RMB A;  4CJP A;  1ZC6 A;  3OTO K;  1YJW N;  3D2E A;  5SZT A;  1MWM A;  2G8I A;  3D2F B;  3ZEU A;  2VG5 A;  2YNG A;  3NAE A;  2OZM A;  3CCR N;  3LDL A;  4H8K A;  4PA1 A;  2DFH A;  2HHS A;  5GIP A;  1GLF O;  5A2Q O;  2ZJR L;  1L3U A;  3MED A;  3WNH A;  3IMX A;  1GLA G;  3C6H A;  3TAB A;  1MWK A;  3MEE A;  3V9Z A;  3UE5 A;  2PZS A;  5BRH A;  2WFB A;  4YOR A;  4EP4 A;  3TSQ A;  3VTH A;  3WEE A;  3EO3 A;  3WT0 A;  2HBM A;  1A5V A;  4YOV A;  1WSH A;  4IOA L;  2VWB A;  4FXD A;  1OH8 A;  4J2A A;  2UUB K;  2GUI A;  4ELU A;  4E1N A;  4CF1 A;  2E1Z A;  2QK9 A;  2P9N B;  3CC7 N;  3ISN C;  1LWE A;  2YNI A;  5EU7 A;  3V6D A;  3AA5 X;  2D0P A;  1ASV A;  3FZL A;  4Q5V A;  4A59 A;  1OH6 A;  3OYF A;  3QEP A;  4IDK A;  3DWL A;  2P9K B;  3HST B;  1GLB G;  1J5O A;  1Q81 O;  2UUC K;  1KVC A;  4IFY A;  1HR0 K;  3S9H A;  3CCV N;  3I0R A;  3NF8 A;  4FJL A;  4AHS A;  1JXE A;  1WN7 A;  1P90 A;  3CCS N;  1O13 A;  1S72 N;  3D2E B;  1S3X A;  4K42 A;  1JLB A;  4FWR A;  5K14 A;  3NDK A;  3Q7B A;  3PO5 A;  3WNF A;  1NJW A;  2QI2 A;  5AQI A;  3HM9 A;  1FW6 A;  3CF5 L;  1RBS A;  2E1Y A;  3SAH A;  4BWM A;  2Q2R A;  3K9K A;  4YOT A;  2CGJ A;  4KKO A;  1S6P A;  3C95 A;  2P9S A;  3ALY A;  1BCM A;  4FSV A;  3WEE B;  3LDP A;  4MDB A;  5CZ1 A;  1FXX A;  1HUX A;  1RCH A;  4RW8 A;  4E7I A;  2H3G X;  3K58 A;  3KTQ A;  1WNS A;  4K25 A;  5FRM A;  2E2P A;  3TAG A;  1NGA A;  3P39 A;  4CFB A;  3NH1 A;  3O3F A;  3SYZ A;  2ZJP L;  1BWF O;  3PUF A;  3CXC M;  4O55 A;  3KLG A;  3AAQ A;  2ITG A;  3MN5 A;  4BE0 A;  3JYT A;  4G1Q A;  4CHO A;  4CEA A;  3EYZ A;  1HQE A;  3CI5 A;  1RGI A;  4FLU A;  2VGM A;  5AQH A;  4I2P A;  2E2N A;  3TWH A;  5CYM A;  4JKC A;  3Q7C A;  1KRP A;  4OX9 K;  1VSF A;  3CCU N;  4JYA K;  1S5J A;  3SQ2 A;  4YFU A;  4DTP A;  1F21 A;  4Y1D A;  1ESV A;  2QWO A;  1FKO A;  3CQY A;  3VEN A;  1K73 O;  3RMC A;  4EIA A;  4M45 A;  3KK2 A;  2P51 A;  2YKM A;  3ZT0 A;  3AO1 A;  3GE1 A;  4XH4 A;  3EY1 A;  1VQ5 N;  2FC0 A;  3SV3 A;  3PX4 A;  2ETJ A;  3AAR A;  1OH5 A;  3LP0 A;  3LWM A;  4RWT A;  4IEI A;  3O9S A;  1YTA A;  4KHY A;  3OYL A;  2GBZ A;  4J2E A;  4DQS A;  3ZSZ A;  4ELT A;  3FR0 A;  1OH7 A;  3V9W A;  5F0X A;  1BI4 A;  3ITH A;  2V7Z A;  2F8T A;  5BRE A;  2KTQ A;  3TAN A;  3ID6 A;  4OKK A;  3ZX2 A;  3EKU A;  5AQV A;  4H0P A;  4CFC A;  2RKI A;  4CK3 A;  4DS4 A;  4JHD B;  1X3N A;  4C8N A;  3ZYY X;  4JD2 A;  1L3V A;  4QOZ B;  1X9W A;  3LAN A;  4DV4 K;  1D4X A;  4QAG A;  2P9L A;  4CJ7 A;  1FJG K;  3UKR B;  3C6T A;  4ISG A;  3U8X A;  3K59 A;  4KB1 A;  3HJF A;  3WNG A;  4FLY A;  1IG9 A;  3SBG A;  4ICL A;  2O8B A;  4B1X B;  4C8M A;  3AGK A;  3DLE A;  5JS2 A;  1N5Y A;  3AVF A;  1M90 O;  4IOX A;  2OPR A;  3OYC A;  2X6N A;  4DU4 A;  1VQ8 N;  1IKX A;  1X9M A;  3ZT3 A;  4FM1 A;  3TI0 A;  4YOX A;  1VQ6 N;  2D5R A;  3LAL A;  3FLC O;  2B6A A;  2QKK A;  2LSN A;  3ENO A;  2E6L A;  1BI4 B;  4DTJ A;  3PX0 A;  2QEX N;  4DWI A;  2NRZ A;  1IO2 A;  4DF4 A;  2DFF A;  5KPR A;  1G99 A;  4B3R K;  4CIG A;  5BN9 A;  4L8R B;  3HT3 A;  5HBM A;  1D8Y A;  4XIU A;  2A42 A;  5JVG L;  4H0V B;  2IGI A;  1EET A;  4DQR A;  3O1W A;  4DU1 A;  2E2O A;  3FFI A;  4ZTF A;  2X6S A;  4JD2 B;  3CC4 N;  4FJ5 A;  1HYV A;  1TAQ A;  1NMN A;  2Q97 A;  1YIJ N;  1B9F A;  4C1N K;  2P9L B;  3SAF A;  3T1A A;  4PY5 A;  2ZGY A;  4JKB A;  2V51 B;  2B4J A;  4IDH A;  1BU6 O;  3BF1 A;  4E19 A;  5BR9 A;  3KWG A;  4DSL A;  4OPA A;  2O8B B;  4ILH A;  5DM7 L;  3HP6 A;  3VQB A;  4Z4F A;  2QTD A;  2NRW A;  4PKH A;  4IOC L;  2OPQ A;  4JKF A;  2O8C A;  1DGK N;  3KKS A;  4B9S A;  1TV6 A;  3SUN A;  2BAN A;  4E0D A;  1VQL N;  4BR9 A;  3M8S A;  2IVO A;  3NH2 A;  3CMA N;  1NG9 A;  3WXI A;  1SKR A;  2F9T A;  1VQO N;  5T7B A;  2I7P A;  4K0K K;  1NGG A;  2VGN A;  4FPA A;  1RIL A;  4PHT X;  4BDY A;  4B1Z A;  1YF5 L;  4DSI A;  1NOZ A;  3AVA A;  4CZF A;  3ZT1 A;  4N5S A;  1TGO A;  2KW4 A;  3OS0 A;  4E7K A;  5KGW A;  1J53 A;  1LW2 A;  1QSS A;  5HRR A;  4CD3 A;  3ZSR A;  1ILY A;  1IKV A;  3THX A;  4RG8 A;  4JI0 K;  2Z1I A;  3LPU A;  1DEJ A;  4I6M A;  3MXJ A;  4CEQ A;  1REV A;  3AV9 A;  4X62 K;  1JXB A;  1T03 A;  4B3T K;  2E8A A;  1RT3 A;  1RBV A;  3OYG A;  2ASM A;  4JN4 A;  5JLF A;  4BRQ A;  4M42 A;  3HSC A;  1NK7 A;  4K8X A;  3D0P A;  4O4G A;  1NGE A;  1T6D A;  1C1C A;  1SS6 A;  3T1Y K;  2QWP A;  2JWK A;  2NZT A;  5BPL A;  4NYF A;  5HL7 L;  2HBK A;  3SCX A;  4DFJ A;  4EHT A;  3PIO L;  3LDN A;  2O8E A;  4C23 A;  4Y0W A;  5J2M A;  5HLF A;  4EZ9 A;  3SAG A;  1Z25 A;  4BRC A;  1WOQ A;  2ZGZ A;  3THV A;  3CPW M;  4E89 A;  4BDP A;  2HHU A;  5FLX O;  4DR5 K;  3VTI A;  2GWJ A;  4EFH A;  3L4Q A;  1DKG D;  2QXF A;  3K5N A;  1VQK N;  2X74 A;  4NLC A;  3CM5 A;  4LF7 K;  4CHN A;  1KQS M;  3THX B;  3AAP A;  3OYK A;  2VG6 A;  4I6M B;  4LF6 K;  4FL9 A;  3QLH A;  2UXD K;  1KSP A;  3C7N A;  3O6W A;  1EO1 A;  2ASO A;  1N33 K;  2QWM A;  3L2R A;  2XRI A;  3OY9 A;  4BRF A;  1UA1 A;  2GTD A;  3O4Q A;  2B5J A;  4JKD A;  3AVI A;  2OA8 A;  3HOS A;  5M1F A;  1LOT B;  3F5T A;  3J8A A;  3O9U A;  5AQN A;  2FF6 A;  1HPM A;  4CZL A;  3PSI A;  3HPO A;  4YHH K;  4DTU A;  1QVG M;  1JCG A;  1K8K B;  4DHY A;  1BQN A;  1I94 K;  1YVU A;  2O8E B;  4DSF A;  3QER A;  3IS9 A;  1RT1 A;  1TK5 A;  1FKP A;  1SL2 A;  1XMO K;  4JKG B;  4LF4 K;  1HNV A;  1D9F A;  1TKT A;  4DR7 K;  4LF5 K;  3GBT A;  3CD6 N;  3BDP A;  3LL3 A;  4CZK A;  3G0Z A;  3TAP A;  2HMI A;  1W7A A;  3L3U A;  4BG9 A;  2W41 A;  5ELZ A;  2VWJ A;  3CCQ N;  4MQ3 A;  1OKJ A;  5EOY A;  3I8D A;  4JI5 K;  3L8B A;  1VAZ A;  3SJJ A;  1BUP A;  1LAW A;  4JS5 A;  5I9E B;  1RDW X;  5M1N A;  2YJF A;  3AVB A;  4B9V A;  4JI7 K;  3C7N B;  4Z4H A;  2QW9 A;  3TSU A;  4WQ4 C;  2P1J A;  1SUQ A;  4FJ9 A;  1WSJ A;  5SWM A;  4DQQ A;  2WTU A;  3DOK A;  3G25 A;  1QQN A;  2P9U A; 
#chains in the Genus database with same CATH homology
 1BHL A;  3DLH A;  4DQP A;  3ISN C;  3OVN A;  1LWE A;  2YNI A;  2E4L A;  2YNH A;  5EU7 A;  2G8H A;  4M3Y A;  2IOC A;  3V6D A;  3AA5 X;  1JKH A;  1TVR A;  3C6U A;  4I9Q A;  1ASV A;  3MEC A;  3V4I A;  4Q5V A;  3OYF A;  3P1G A;  1QS4 A;  2EX3 A;  3K2P A;  1NK9 A;  1C0U A;  3QEP A;  3TR8 A;  4IDK A;  1T7P A;  3HO1 A;  4CGI A;  1ZBU A;  3HST B;  1J5O A;  4R5P A;  4DSK A;  2HHX A;  4ELV A;  1KVC A;  4IFY A;  1C1A A;  4CEE A;  3SPZ A;  3S9H A;  4LY7 A;  3KLH A;  1TL1 A;  1HYZ A;  3I0R A;  3NF8 A;  3UIQ A;  4FJL A;  4Z4G A;  4AHS A;  1KLN A;  1JXE A;  1WN7 A;  2G8U A;  1ASU A;  3AO3 A;  3ZT2 A;  5HP1 A;  4C8O A;  1XHX A;  3QO9 A;  1JL1 A;  3L3V A;  3OYJ A;  3NBP A;  3V81 A;  4KV8 A;  2PY5 A;  4F3O A;  1JLB A;  4DTX A;  4OLB A;  1VSE A;  2HNY A;  5K14 A;  1JLC A;  1D9D A;  3NDK A;  2EHG A;  4KI6 A;  3PO5 A;  3WNF A;  3QES A;  2A1R A;  4B3O A;  3LZI A;  1NJW A;  2AJQ A;  3L2V A;  3HM9 A;  4KRF A;  4CK1 A;  1RBS A;  2Z1H A;  4BWM A;  1RTD A;  4N76 A;  2HHQ A;  4OKJ A;  4NCB A;  1S1V A;  4B8A B;  4E7L A;  4DSE A;  1NKC A;  1B92 A;  1MU2 A;  2KFZ A;  3O3H A;  2XY8 A;  1S1T A;  3CM6 A;  3DRS A;  4KKO A;  3U3G A;  1S6P A;  3C95 A;  1C1B A;  3SUO A;  4O5B A;  3C94 A;  3ALY A;  1BCM A;  2HNZ A;  2KZZ A;  4KHU A;  2W42 A;  4MFB A;  1FXX A;  1RCH A;  4RW8 A;  5CZ1 A;  4E7I A;  4DTN A;  4DF8 A;  1RDC A;  1VRT A;  4OGC A;  3K58 A;  3QEX A;  3KTQ A;  1WNS A;  5FRM A;  5KI6 A;  1X9S A;  3V1O A;  4KTW A;  1Q8I A;  4CFB A;  3NH1 A;  3AVL A;  3O3F A;  3QNN A;  3SYZ A;  4FLZ A;  3TAG A;  4I7F A;  4I2Q A;  3HK2 A;  3PUF A;  2HVI A;  4OJR A;  4O55 A;  4CJ3 A;  3KLG A;  1L3T A;  2ITG A;  4KFB A;  1NOY A;  4DFM A;  5J1E A;  1KFD A;  4BE0 A;  3EYZ A;  1RTJ A;  3JYT A;  4G1Q A;  1CXQ A;  4CHO A;  4CEA A;  3VQQ A;  1HQE A;  4CF8 A;  4CIE A;  5C42 A;  4AHC A;  5KRS A;  4W5T A;  4KAZ A;  2OPS A;  2RPI A;  4FLU A;  3AVM A;  2IAJ A;  4Z4I A;  1C6V A;  4I2P A;  3TWH A;  5CYM A;  1KRP A;  1BQM A;  4IKF A;  4CEZ A;  1VSF A;  1R0A A;  1C0M A;  2I5J A;  1U4B A;  1S5J A;  4FZZ A;  3SQ2 A;  2G8W A;  4YFU A;  1RTH A;  3AVJ A;  3A2F A;  1F21 A;  1TKZ A;  4Y1D A;  4DTP A;  1EX4 A;  1FKO A;  1JLF A;  1NK0 A;  1NJZ A;  4CJK A;  3O3G A;  2G8K A;  1NKE A;  4BE2 A;  1JL2 A;  4Q0B A;  2WON A;  4CF9 A;  4KB0 A;  4GVM A;  3RMC A;  4M45 A;  3KK2 A;  3NGI A;  4FJI A;  2P51 A;  2YKM A;  3ZT0 A;  3VQ6 A;  2XO7 A;  3MAQ A;  4FM2 A;  3AO1 A;  4DTS A;  3EY1 A;  4EP5 A;  2FC0 A;  3U3Y A;  3SV3 A;  4FYD A;  3NE6 A;  3PX4 A;  2ETJ A;  4E3S A;  3SQ1 A;  2ATQ A;  1SKS A;  5C24 A;  3LP0 A;  1DTQ A;  1D5A A;  1HRH A;  3LWM A;  3RMD A;  4ZTJ A;  1YTA A;  4KHY A;  3OYL A;  3LZJ A;  3SNN A;  2GBZ A;  4J2E A;  4ID5 A;  4DQS A;  1T05 A;  3HVR A;  5CYQ A;  3MEG A;  3ZSZ A;  1EKE A;  4ELT A;  1RDB A;  2DFE A;  4IG0 A;  3S3N A;  3IAY A;  4KI4 A;  3V9W A;  3O4N A;  3KD1 E;  1BI4 A;  1A5W A;  3ITH A;  3QEW A;  2F8T A;  1ZBF A;  1L5U A;  2KTQ A;  3TAN A;  4CGF A;  4OKK A;  2A1S A;  4DTM A;  2OZS A;  1S9E A;  1J9A A;  4CFC A;  2RKI A;  2Z1G A;  3TAM A;  4CK3 A;  4DS4 A;  1I3A A;  4CF0 A;  4HCB A;  4HVJ A;  2KZM A;  1XC9 A;  4OGE A;  1LV5 A;  3AVH A;  1S9G A;  4C8N A;  4FCY A;  2KQ2 A;  3QEI A;  4C8K A;  1WSE A;  3DLG A;  4CJV A;  3L2Q A;  1BL3 A;  3LP1 A;  1J54 A;  1C0T A;  4JS4 A;  4FW1 A;  1L3V A;  4QOZ B;  1X9W A;  3LAN A;  2PYJ A;  4FW2 A;  4DMN A;  1KFS A;  1VSL A;  1KCF A;  4QAG A;  4E7J A;  4B9M A;  4BDZ A;  4RW6 A;  3TAE A;  5CZ2 A;  1SKW A;  4B8C A;  1ZBH A;  1RT4 A;  1RT7 A;  4CJW A;  5D3G A;  1NJX A;  2YV0 X;  4CJR A;  3C6T A;  1TK0 A;  5I42 A;  3K59 A;  4KB1 A;  3HJF A;  3WNG A;  4FLY A;  1IG9 A;  1QHT A;  1GOB A;  4ICL A;  4N56 A;  4C8M A;  2Y1I A;  4LH4 A;  2F96 A;  3VA0 A;  1NK6 A;  2GV9 A;  3DLE A;  5JS2 A;  1BCO A;  4DU3 A;  5HRP A;  4CJS A;  4DFP A;  3QIO A;  3DYA A;  3AVF A;  1TKD A;  1N5Y A;  4CER A;  1W9H A;  3M8R A;  4CK2 A;  4FZX C;  4JLH A;  3NGZ A;  1S1X A;  1VRU A;  2OPR A;  2X6N A;  2JGU A;  3DLK A;  4CGD A;  3OYC A;  4DU4 A;  2IDO A;  1IKX A;  1GOC A;  3TAF A;  1X9M A;  4FK0 A;  1JLE A;  3ZT3 A;  1LAV A;  4FM1 A;  4EZ6 A;  3TI0 A;  1YTU A;  4QCL A;  4N47 A;  4KHS A;  4FJJ A;  2D5R A;  3AO4 A;  3LAL A;  3U6F A;  3VQ4 A;  1HJR A;  2B6A A;  4OVL A;  3NFA A;  2QKK A;  2FBX A;  3ZCM A;  2LSN A;  3VQ9 A;  4OPJ A;  1U48 A;  1DLO A;  2HW3 A;  4HHT A;  4AIL C;  2E6L A;  3ZSO A;  1BI4 B;  1SV5 A;  3OS2 A;  4DTJ A;  3PX0 A;  1RTI A;  4DWI A;  1IO2 A;  1HMV A;  1S6Q A;  1W0H A;  4DF4 A;  4CHQ A;  3OYN A;  1Q9X A;  2DFF A;  5KGX A;  1KVB A;  3SPY A;  1IH7 A;  1WAF A;  3ZSQ A;  4YNQ A;  4M3T A;  4CIG A;  4M3X A;  4L8R B;  3CG7 A;  3KLE A;  1RT5 A;  1U04 A;  5HBM A;  3HT3 A;  4DFK A;  1D8Y A;  4XIU A;  1QTM A;  4F4K A;  2FBV A;  2IGI A;  1EET A;  3HPG A;  4DQR A;  4DU1 A;  3DLB A;  1XHZ A;  3FFI A;  4W5N A;  4PQU A;  3V9U A;  4LH5 A;  3NHG A;  2RN2 A;  1I39 A;  2X6S A;  4AHV A;  4ZTF A;  4FJ5 A;  1HYV A;  1TAQ A;  2NUB A;  3B6P A;  4CEO A;  4IFV A;  1RBT A;  1TKX A;  5E41 A;  1B9F A;  1RT2 A;  1CZB A;  1K6Y A;  4FZY A;  4HUE A;  3QIP A;  3T1A A;  2G8F A;  4PY5 A;  1NJY A;  1NK8 A;  4KHN A;  4AHR A;  4OPK A;  2B4J A;  1ZYQ A;  2RF2 A;  4DQI A;  2IS3 A;  4M3U A;  4FLW A;  4J2B A;  4E19 A;  4H4O A;  3AVN A;  3PY8 A;  4DSL A;  1LW0 A;  3MXI A;  4FJ8 A;  3NF7 A;  2X78 A;  4CEF A;  2D0C A;  3VQC A;  3OYE A;  3HP6 A;  1NK4 A;  4B9L A;  2Y1J A;  1RDD A;  2VG7 A;  1BIS A;  4KTZ A;  3VQB A;  3ZSX A;  3OYH A;  4DSJ A;  2ZE2 A;  3VQ8 A;  1FK9 A;  1U45 A;  1RBU A;  1S1U A;  3AA4 A;  3DOL A;  2G8V A;  3SV4 A;  4CCH A;  5J2N A;  3SZ2 A;  1CZ9 A;  3VA3 A;  3HP9 A;  1JLG A;  4Z4F A;  4CHP A;  4K8Z A;  4O0I A;  2OPQ A;  4FK4 A;  4CHY A;  4KHQ A;  3ZSW A;  3KKS A;  5J2P A;  1RNH A;  3V9S A;  4B9S A;  1TV6 A;  3LAK A;  3SUN A;  1N6Q A;  2BGG A;  3VQP A;  2HB5 A;  2BAN A;  3LDS A;  4E0D A;  3DLR A;  4IBN A;  1Z26 A;  1VSI A;  3M8Q A;  3M8S A;  3CQ8 A;  3NH2 A;  3HPH A;  1SL1 A;  1SKR A;  4FK2 A;  1X1P A;  3DMJ A;  1HNI A;  3H08 A;  4KO0 A;  4CIF A;  5T7B A;  3V9X A;  2XY5 A;  3CFO A;  3QEV A;  3L2W A;  1U47 A;  4DG1 A;  4FJM A;  1ITG A;  2HND A;  3E01 A;  1RIL A;  3T19 A;  4AH9 A;  5FRO A;  4M3Z A;  4BDY A;  3KK3 A;  4DSI A;  1NOZ A;  4FJK A;  4FJG A;  3AVA A;  1EP4 A;  1T8E A;  3LP3 A;  2WOM A;  3AA3 A;  3ZT1 A;  4JRP A;  1ASW A;  1TGO A;  2KW4 A;  4CFD A;  4N5S A;  3OS0 A;  2OYQ A;  3G10 A;  1CXU A;  5KGW A;  4E7K A;  1J53 A;  1LW2 A;  4CJT A;  4RW9 A;  1WLJ A;  1QSS A;  3V1R A;  4DS5 A;  5HRR A;  4C8L A;  4FLT A;  3ZSR A;  2BE2 A;  3DM2 A;  1IKV A;  1DTT A;  4RG8 A;  1YT3 A;  2ZQB A;  3NF6 A;  5J2Q A;  1VSH A;  2Z1I A;  1WSI A;  3LPT A;  3LPU A;  1XWL A;  3MXJ A;  1WSF A;  4CEQ A;  4FLV A;  2XY6 A;  1REV A;  3AV9 A;  3PO4 A;  4J2D A;  2YKN A;  1QSL A;  1JXB A;  1XI1 A;  1T03 A;  3I0S A;  3NH0 A;  3CFP A;  4ZHR A;  4AHT A;  3OYA A;  3SQ4 A;  1RT3 A;  4CEC A;  1RBV A;  2XY7 A;  3OYG A;  1IKY A;  4HUG A;  4WE1 A;  2YNF A;  3RMA A;  4CGG A;  1KTQ A;  4M42 A;  1NK7 A;  1LWC A;  4W5O A;  1LWF A;  4K8X A;  3LWL A;  4RW4 A;  3PX6 A;  4FVM A;  4AHU A;  4CEB A;  3OYD A;  4O0J A;  1Y97 A;  2VWK A;  4O4G A;  3D0P A;  1ZBL A;  1U49 A;  3F9K A;  3OJU A;  2P5G A;  3K5M A;  5I3U A;  1TK8 A;  1C1C A;  4N41 A;  4KTQ A;  1NK5 A;  3RR8 A;  1HPZ A;  3AA2 A;  3EZ5 A;  4E1M A;  3D45 A;  3TAR A;  4GW6 A;  4NYF A;  4CFA A;  4PWD A;  3SCX A;  4NYN A;  3OYI A;  4DFJ A;  1QSY A;  3VQE A;  2F8S A;  3WNE A;  5HRN A;  1CLQ A;  2HHT A;  2DY4 A;  4BAC A;  3KLI A;  4OLA A;  4FM0 A;  3F73 A;  1ZBI A;  1JLA A;  4H4M A;  5J2M A;  4HCC A;  3AO5 A;  5KTQ A;  4F3T A;  3PV8 A;  5HLF A;  1VSK A;  4E7H A;  4I9L A;  4EZ9 A;  1Z25 A;  4FJX A;  5DK5 A;  1O1W A;  3K5O A;  5FRN A;  1B9D A;  3THV A;  4CGJ A;  4B9U A;  4UQG A;  4E89 A;  3P83 D;  4Z4C A;  3RWU A;  4BDP A;  2HHU A;  3NF9 A;  3IG1 A;  2D0B A;  3HXM A;  4O44 A;  4CE9 A;  3OYM A;  3L2U A;  3S3M A;  3RR7 A;  3K57 A;  4DTR A;  1SL0 A;  3M8P A;  4M41 A;  1RBR A;  4HTU A;  3SUP A;  2QXF A;  3OS1 A;  4ID1 A;  1KLM A;  2IC3 A;  4IG3 A;  3VQA A;  3K5N A;  3KLF A;  3CFR A;  2X74 A;  1JLQ A;  4PUO A;  4HUF A;  3ZSY A;  2YHA A;  4CJF A;  1UA0 A;  3IRX A;  3CM5 A;  5HRO A;  4M3R A;  1EXQ A;  2FBY A;  3DRR A;  2ZD1 A;  4BWJ A;  4CHN A;  1Q9Y A;  4F2S A;  2QKB A;  3HYF A;  1VK0 A;  1HYS A;  2O4G A;  4LSN A;  2JLE A;  2VG6 A;  3OYK A;  2O4I A;  4CGH A;  4FJH A;  3BGR A;  3DI6 A;  4TSX A;  3QLH A;  4CED A;  3LAM A;  1KSP A;  2XHB A;  2P5O A;  4CJU A;  3B6O A;  1UOC A;  3K5L A;  3L2R A;  4F8R A;  4NCA A;  2XRI A;  3HL8 A;  4DLE A;  3OY9 A;  3SQ0 A;  1UA1 A;  2Z1J A;  4OKE A;  5DMR A;  3DRP A;  3O4Q A;  2B5J A;  3VQ5 A;  1HQU A;  3JSM A;  3AVI A;  2KFN A;  2OA8 A;  4W5Q A;  3SI6 A;  4CJQ A;  4GMJ B;  3QIN A;  1VSD A;  1WAJ A;  4CJ5 A;  2OPP A;  3SUQ A;  4DTO A;  3OJS A;  1UWB A;  4KRE A;  3ZT4 A;  3AVG A;  3HPO A;  3KK1 A;  1UAX A;  4CF2 A;  2FBT A;  4LSL A;  5KRT A;  4DTU A;  3KD5 E;  1RT6 A;  2BDP A;  3VQD A;  2Q3S A;  2D0A A;  4W5R A;  3S3O A;  4B9N A;  5HRS A;  4KPY A;  1A5X A;  1BQN A;  3MXM A;  4JRQ A;  1KVA A;  5JS1 A;  1YVU A;  1IKW A;  2DTU A;  3V1Q A;  4NCG A;  2E6M A;  3CYM A;  3VQ7 A;  4CHZ A;  3NCI A;  2HHW A;  4FLX A;  4DSF A;  3QNO A;  3QER A;  1QQC A;  3IS9 A;  4F2R A;  3T3F A;  3AO2 A;  1VSM A;  4FJN A;  1RT1 A;  3HVT A;  1TK5 A;  1FKP A;  3RMB A;  4B08 A;  4CJP A;  1SL2 A;  1BGX T;  3ZSV A;  2PYL A;  4B9T A;  4RW7 A;  1HNV A;  1D9F A;  1RDA A;  5SZT A;  4BE1 A;  2G8I A;  1TKT A;  1QE1 A;  1S1W A;  3KJV A;  4DLG A;  2VG5 A;  2YNG A;  5C25 A;  1VSJ A;  3NAE A;  2OZM A;  3BDP A;  3RRG A;  1GOA A;  4FJ7 A;  2HVH A;  4H8K A;  4Y1C A;  2HHV A;  3ULD A;  3VN5 A;  4PA1 A;  2DFH A;  3G0Z A;  4LD0 A;  4CJE A;  3TAP A;  3TAQ A;  1NKB A;  2HMI A;  1G15 A;  3AVK A;  3L3U A;  3RTV A;  3QET A;  2HHS A;  1WSG A;  4CJ4 A;  2VWJ A;  5CY4 A;  3AVC A;  4M3W A;  4MQ3 A;  3OYB A;  3NGY A;  3I8D A;  1L3U A;  3MED A;  3WNH A;  3L8B A;  2R7Y A;  3TAB A;  3SJJ A;  3MEE A;  1TL3 A;  1LAW A;  3V9Z A;  2PZS A;  4JS5 A;  4Z4E A;  1TAU A;  4EP4 A;  3KKR A;  3KIO A;  3AVB A;  4B9V A;  3LP2 A;  4CJL A;  4Z4H A;  1L3S A;  1A5V A;  4CES A;  5FDL A;  3P5J A;  4KHW A;  2P1J A;  2YHB A;  1SUQ A;  1WSH A;  4FJ9 A;  1WSJ A;  3ASM A;  4FXD A;  5SWM A;  3RRH A;  4DQQ A;  4J2A A;  1BIU A;  2GUI A;  4ELU A;  3DOK A;  1BIZ A;  4E1N A;  4CF1 A;  4Z0U A;  2QK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...