3DLZA

Crystal structure of human haspin in complex with amp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
329
structure length
329
Chain Sequence
KGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase haspin
publication title Structure and functional characterization of the atypical human kinase haspin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 112
structure length 329
sequence length 329
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dlzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dlzA01
4IJPA 2Z02A 5J5SA 4MD9E 2X8IA 3F6XA 3HGKA 3NUPA 2IVTA 3UVQA 2Y9QA 4XV1A 3RJCA 2WTKB 4RIXB 2BAKA 1F3MC 2GNHA 3E88A 3L1SA 4EK4A 2W1GA 3BYSA 4DFNA 4NTSA 4QP3A 2BHHA 1WBTA 2J0JA 2JDVA 3G6HA 5I9XA 5IG1A 3ZM9A 4ZMEA 4JDKA 1YQJA 2JDOA 3R8VA 5K5NA 3QA0A 3TUBA 4RFYA 3WF6A 5A4LA 3QRKA 3FEGA 2O3PA 3BV3A 3EQRA 3F3TA 4ANMA 5CEPA 3HX4A 3W33A 5AA9A 4KINA 1ZAOA 2REIA 1JSVA 2W1CA 2YIRA 4RJ7A 4EOPA 3F3ZA 4MXYA 3VJNA 5L2IA 1IR3A 2H96A 3HP5A 3MY0A 4I21A 4PL4A 4QMYA 2R4BA 2PMLX 2F4JA 3ZS5A 1J7IA 4AN2A 4FTLA 3IW6A 4LYNA 4O7VA 2XIZA 4QMWA 4C58A 3QZHA 3LCDA 5HG9A 2OF2A 2UZLA 3FXWA 4IAKA 5HHWA 4CQEA 1J1BA 3SA0A 2YABA 5M07A 2VD5A 3R6XA 2PY3A 4CCBA 3I81A 3PXQA 2ZDUA 4GU9A 4JBQA 4QP7A 5L8KA 4KIPA 3I60A 4YHJA 3QD4A 5FEEA 2E2BA 3NW5A 4QQJA 3RM7A 5KNJA 4CG8A 3ZEWA 3BEAA 1AQ1A 3QAME 5IDPA 2R9SA 3IS5A 2JFMA 4G3DA 2VV9A 5F4NA 4NL0A 3MTFA 5L4QA 2F7EE 5TR6A 3T3VA 4EK8A 3BWJA 2BCJA 4R1VA 4S31A 4YJUA 2UZVA 3FUPA 4KIQA 3D0EA 4C35A 5CEMA 3EQFA 4G16A 4EUTA 5ICPA 2O5KA 1Z57A 2PTKA 2YFXA 4BVUA 3UTOA 1FVRA 1PMVA 1S9JA 3LQ8A 4J8MA 2WQNA 2VX1A 4J7BA 4ERWA 3DV3A 2LGCA 3WYYA 5J5TA 2HW7A 5ETAA 4A4OA 3I7BA 5HX6A 4K33A 4UMQA 2H34A 4CT1A 4HCUA 4MBJA 2BAQA 3WIGA 3PJ3A 4AZVA 5F94A 3VC4A 4YSMA 1JQHA 1YOMA 4AUAA 4XBRA 4IWDA 1PXKA 2W0JA 2YIWA 3M2WA 4G6LA 3W2CA 2Y4PA 1O9UA 2QVSE 4ZJVA 4S2ZA 5D1JA 2GNLA 3EMGA 3Q9WA 3BGQA 3OXZA 5AMNA 2WQEA 1A9UA 5EYCA 3FJQE 5E8TA 3E8CA 1WVYA 5JFSA 4BIBA 5A54A 2VWWA 3C5UA 4L3JA 2WMRA 2GSFA 4JDIA 4CFWA 4AW1A 1U4DA 4D2VA 3LQ3A 4QPSA 2X81A 3QWJA 1SYKA 5AIKA 3CE3A 4H1JA 2GDOA 4MXXA 4CYJA 3ANRA 3UBDA 4DTAA 5AP0A 3TKIA 3ZUVA 2DUVA 3W8QA 4IB3A 4ZTMA 2FSMX 4XOZA 3UMWA 3FY2A 5J87A 3UQGA 4M69B 3AT2A 5CVGA 2XMYA 1GIJA 4C57A 2JDSA 2W5AA 2WMSA 3E7OA 3COHA 3BZ3A 1ZYJA 5KMLA 3A61A 4IACA 5EHLA 4XP0A 2UZEA 5LWNA 4D4SA 3MJ2A 2W17A 3U6JA 3VUHA 5C27A 3PY1A 3DAEA 2JLDA 3HMOA 4DFUA 3Q5ZA 4AGDA 4QYHA 4RWKA 2UUEA 3FKOA 4JBVA 3UQFA 3VVHA 4PP9A 2E9VA 4C3RA 4X3FB 3KXHA 2VTRA 2BZHB 3G9LX 1JKSA 2C3KA 2J0KA 1PKGA 4FKOA 3HRBA 4FTQA 4FYOA 4W8DA 3GU7A 4YC8A 3U51A 3PXYA 1TQMA 4AAAA 3F3UA 2C6MA 2GTMA 3R7EA 3TDWA 3ZO4A 3MA6A 1RJBA 3MI9A 3PIYA 4UEUA 1PMNA 3UVRA 4FICA 1H0WA 1H00A 2H6DA 3EFJA 3ZH8A 4FL1A 4FEXA 4AWIA 3PY3A 1R1WA 4JI9A 2WMWA 5A4QA 2EB3A 3NX8A 4YJSA 3OF0A 4KD1A 3DBDA 4L3PA 4OUCA 4RMZA 3V01A 5HEZA 5HU9A 5K4IA 3SOAA 5EW8A 5HD4A 4WHZA 4CQGA 5FXQA 5FLFA 5HO8A 1BI8A 3BE2A 5IUGA 1K2PA 3FLWA 3EYHA 1XKKA 1T45A 3DU8A 5L6OA 1ZY4A 4G34A 1PXMA 3EH9A 4AZWA 2J5FA 3FYJX 2OH0E 5JRSA 4ZMFA 4IX4A 3ZZEA 5EW3A 3GU4A 5LVNA 3VW6A 4ZS4A 3A7FA 3ZLYA 4DT8A 1JLUE 4ANQA 4BCGA 5M57A 2I1MA 2JIIA 2VX0A 4BB4A 5EYMA 5CAVA 4RBLA 4Q5EA 4HYSA 3RZFA 3SRVB 2C6IA 3DKOA 2GFCA 2HWOA 3QX2A 2FB8A 3GCSA 4O22A 1GNGA 5ETIA 4EBVA 5TKDA 5CF4A 3LFCA 2YEXA 3LM5A 2PVNA 3DBQA 3H10A 3JVSA 4MTAA 4OT6A 4ZXTA 4C62A 3MPTA 3EFLA 4PTEA 5D9HA 3KULA 3F61A 2E9UA 4FSZA 2BMCA 3F66A 3TZ9A 4G5JA 3WF8A 1SZMA 4UZHA 5AP5A 3TNHA 4R77A 2GTNA 2BZKB 2VWBA 2YACA 4R8QA 5CALA 3PE1A 5DHJA 5HIBA 4YO6A 5HNIX 5BPYA 3HDMA 4QMTA 4ENYA 5CAQA 3SC1A 1H1QA 2A0CX 4HOKA 4JBOA 5EYKA 4C02A 3LOKA 4FIGA 2WOUA 4W9WA 4X21A 4LUEA 2UW7A 3MESA 4DCAA 2C4GA 4PRJA 2P33A 3E7VA 2FVDA 3LJ2A 4I6BA 4ZZMA 4AA4A 5AAGA 3UZTA 4K2RA 1B39A 5L2SA 4OTFA 3RAHA 2W9FB 4MNEB 5CSVA 2XNBA 4I4EA 4RWJA 5H8BA 4IIRA 5BX0A 5LMKA 4GYGA 4G5PA 1YOLA 4XP3A 4ZSEA 2Q83A 4QMUA 2X6EA 3OBJA 4XLVA 1UVRA 4LL0A 4F65A 3ZSGA 4CTCA 3G0EA 3KVWA 3UOHA 4JS8A 5FTOA 2ESMA 4BDIA 5BMMA 4F9WA 5IMEA 3DK3A 3CJFA 2O65A 3QD3A 4M3QA 4RX8A 3ZOSA 5CAUA 1FVVA 1FGKA 3UNJA 1PJKA 3R0TA 4BCMA 4BYIA 4D9TA 4HCTA 4LGGA 3GEQA 3DB6A 4OTIA 3NUSA 3DJ7A 4ARKA 4DH1A 3I79A 4O7YA 5D10A 3HV3A 3FAAA 2WD1A 4CFNA 4F7NA 2RFEA 2XNOA 4MF0A 4XOYA 1PXOA 3PZHA 3MJ1A 3M11A 3E62A 4A4LA 4KUJA 4CMTA 3DPKA 3QKMA 2OXYA 2V5QA 3EWHA 3VUKA 4PPAA 5KUPA 4FKUA 5AR3A 5E91A 4GK4A 3NYNA 5E9EA 4YGAA 3ALNA 2C6DA 3MY5A 3MH1A 3D5XA 4YJVA 4QPMA 2WTKC 5JQ5A 3TI1A 1URWA 4EZ7A 5CSWA 1GZNA 4H58A 1YXSA 1KE8A 2RGPA 3BHTA 2BFXA 5CEIA 1YRPA 4WNOA 1RDQE 4FMQA 5FTGA 3PYYA 3MS9A 1OITA 1LEWA 3O8UA 3FPQA 3PSBA 4P90A 2QO2A 4GFMA 5EG3A 4BCIA 5M4IA 1KE5A 4LGDA 1TVOA 3OP5A 4JQ8A 4ZJIA 1WMKA 4FI1A 2J2IB 3SRVA 4UYAA 5KCVA 4H3BA 4BWPA 3RAKA 3TG1A 1MUOA 4H1MA 3U6HA 3C13A 3PZEA 2QU6A 5AAEA 4I5PA 2W05A 2CPKE 4KBKA 4E4NA 1KE6A 2W7XA 3R9RA 4QMSA 2G2FA 2JBOA 4BC6A 1ZRZA 2ZDTA 2BRNA 4FC0A 5H3QA 2VTAA 4XV9A 4QMPA 4YU2A 2PVRA 2XM9A 3LZBA 1WFCA 4OW8A 1WBPA 4IVBA 4CKRA 1SNXA 3QZGA 5KZ0A 2R3IA 4ZLZA 2YAKA 4I23A 4GK2A 2VO0A 4FNYA 1SMHA 3Q96A 4GSBA 3QKLA 4F1OA 3ZONA 2PE0A 4KS8A 1YDSE 3G90X 1PF8A 1ZOHA 2JC6A 4QMVA 2YAAA 2JKKA 2I0YA 3DKFA 5ETCA 3PVGA 5IZFA 4MNEA 3Q9ZA 2FUMA 3VS3A 3QQKA 2BDFA 4ZSAA 1PXIA 2GMXA 4RA5A 2X4FA 3CCNA 2UW3A 3ZMMA 1Y57A 1H8FA 5J79A 2YCFA 5A4CA 2P3GX 4EOLA 3AGLA 3L9PA 4I24A 1H26A 4M0YA 3DTWA 3EOCA 3LMIA 3VS1A 4F09A 4D4RA 2R3FA 2WTWA 3R1NA 5AV4A 1QPDA 2C69A 5GZ8A 4NCTC 4C59A 3R04A 5HIEA 3BKBA 2B9HA 3IG7A 3S0OA 5AFVA 3UDBA 3F5UA 2Z2WA 4AACA 3LXPA 1UNHA 4J97A 3GXLA 4LGHA 5ANJA 1KE7A 4ACDA 4CV9A 4DBXA 2VGOA 5C8MA 2G01A 3WOWA 2R3PA 3VBVA 3G5DA 4Z55A 5DIAA 3LFDA 4IVAA 2WQOA 3D5UA 3ORMA 4WT6A 3C1XA 2I0HA 1K9AA 1H08A 2XRUA 1Z9XA 4GG7A 1KV2A 2PVJA 2W1ZA 3NUUA 4HGSA 4FEQA 5FDPA 3KK8A 3NUNA 1IRKA 4PDYA 2J0IA 5EHYA 4RJ5A 4DLIA 2JKQA 2XK6A 4UMRA 4FK3A 3DJ6A 1XH5A 4G6NA 5A46A 4QMOA 3LCKA 2GCDA 3DXPA 1ND4A 4PUZA 5JKGA 5LXMA 3OCGA 4FEVA 4YPDA 4YJPA 5BYYA 4QP4A 2W96B 1OBGA 3SKCA 2GNGA 1M2PA 3PRIA 1SM2A 1DS5A 3LFFA 5ACKA 4EOIA 4HVIA 3TUCA 4IH8A 2EVAA 3BLRA 5DI1A 3NNUA 2WNTA 4RC4A 4ZLYA 4CVAA 3HP2A 2Y4IB 4S34A 4BICA 3U8WA 4D2TA 2CNUA 3CTJA 5CT0A 3DNDA 2WMUA 5D7AA 3NUXA 3QQUA 4G3CA 2R3MA 2R3GA 5LMKC 2QOLA 2W4JA 1GY3A 4JIAA 5ANEA 5HNGA 3D7TA 4QMZA 2R3JA 5DN3A 3OC1A 4X3FC 4MWIA 2JAVA 5HX8A 2J4ZA 3QCYA 4H3QA 4F1TA 3N51A 3ZU7A 1ZYCA 4FKRA 3UO5A 3RVGA 2HZ4A 3PXRA 3ZBXA 3MN3A 3NIZA 2F2CB 1WBVA 4HW7A 2C1AA 2HXLA 5AR2A 3SXRA 2C3IB 4KIKB 3MYGA 3QTSA 4ZK5A 5EYDA 5K0KA 2X2LA 4XG4A 2I40A 4BI1A 4YC3A 4FR4A 1Q41A 4RIWA 1CMKE 3D5VA 4U41A 2WTCA 3FSFA 3QUDA 4N0SA 5BUEA 3HNGA 2HWPA 4QO9A 3LMGA 4OBPA 5HU3A 2J50A 2NP8A 4QNAA 1Y8GA 2UZUE 3DFCB 4NM5A 2WTJA 4CZYB 4FZ7A 1BI7A 2IJMA 3Q9YA 3TJDA 3G15A 4ZZOA 3R1YA 3CR0A 3VUIA 4XRJA 1UNLA 1VYWA 3CLYA 4BY9E 2ITOA 1WZYA 3OOMA 5IA3A 4FKLA 1V0OA 3QRJA 3FQEA 1PYXA 2I0VA 2HCKA 3OY1A 3BEGA 4TL0A 1UNGA 2JDTA 3O51A 3HAMA 5HCXA 4RJ8A 3RGFA 1UWHA 3F3VA 4QTCA 4FV9A 4UXLA 5EM7A 4W4WA 2CGUA 3JXWA 1CKIA 4I6FA 2J0MB 5DNRA 3DXNA 2ZV8A 2GHGA 3F5GA 3HV4A 3KC3A 2CSNA 3Q4UA 4I0TA 5EM6A 2XYUA 5I9UA 4EQMA 5HE2A 3QTXA 4TYJA 5JMSA 5ANDA 4ZTRA 4IM0A 5HVJA 4M67A 3R7IA 1HCLA 4FTOA 1FINA 4YUQA 3KXMA 4RFMA 3SHEA 4S33A 2ZYBA 5KE0A 2WEVA 3T3UA 2XJ2A 3OY3A 3L9MA 3OTUA 4WG5A 4P7EA 3NEWA 2PMIA 4QMQA 1OL6A 1W98A 3WBLA 1RE8A 2XKEA 4MYGA 2QOIA 1BL7A 3FHRA 4NZWB 4BDAA 4E4MA 5C8NA 4F6SA 4UB7A 5CAPA 1WCCA 4FKPA 4C3PA 4EH9A 2OJJA 2V7OA 5DT4A 3OG7A 2H9VA 3TZMA 2WHBA 4CXAA 4J99A 3DS6A 3KXXA 4KSQA 2XP2A 2PULA 5FWKK 4M14A 3ETAA 1YDRE 3VNTA 5JQ8A 4FUYA 5BVOA 3VS4A 2YZLA 5H8GA 1JWHA 3AC8A 3Q6UA 4LL5A 4FZDB 1BUHA 2C3JA 2B4SB 4HGLA 1LP4A 3HEGA 4DH7A 2ZOQA 4E3CA 3NMUF 2XNNA 5DWRA 3V3VA 4Z16A 4KNBA 2QO7A 5HESA 3FI8A 2WMXA 1KE9A 3LXKA 5EHOA 1DI9A 4BN1A 5CSHA 1V0BA 2QG7A 2XJ0A 4ITIA 5IQGA 4M15A 2P4IA 4FKJA 4KIKA 3TNQB 3Q3BA 2CN5A 4L00A 5AR4A 4HVGA 5CWZA 2EUFB 2VUWA 5LVPA 3C4CA 1T46A 1JSTA 4J96A 3UP2A 2B9FA 5IEYA 1GAGA 4QP6A 4ZTSA 5HI2A 4BI0A 4C2VA 5EQPA 3WZKA 3QUPA 4MVFA 4EK3A 3C51A 3A7HA 3ZDUA 3LKMA 3DDQA 4I3ZA 1OPLA 4NW6A 5HBEA 3QTWA 4GUBA 4I1ZA 5H9BA 4QMXA 4ZY5A 3QQLA 2WOTA 1CDKA 3L8XA 4YLLA 4TWPA 4JG7A 3QHWA 2ETKA 3R02A 2WMVA 4WG4A 1H27A 3FXZA 3G6GA 3KRWA 4ACHA 4AFJA 5KMKA 4D55A 4MEDA 2ZV7A 2YDIA 4E6CA 5EW9A 3W1FA 4R3RA 3FLNC 3MVJA 1VZOA 2XB7A 3P23A 4L01A 4X6RA 3IW8A 4X7QA 4BRXA 2W1IA 5I3RA 1XJDA 2C5YA 2EXEA 1GOLA 3E63A 3N4TA 1Z5MA 3D9VA 3PWYA 5E90A 5DOSA 3V6RA 4RGJA 4JLCA 4FTTA 2O0UA 5IA2A 3UYTA 5T3QA 1ZARA 3F2AA 2XK9A 2R0UA 2YDKA 4TY1A 2R3OA 4L43A 3PVUA 2YLFA 1OKVA 2XCHA 2CMWA 3FZPA 3KVXA 4ANLA 3R8MA 3BX5A 3EFKA 1Q3WA 4TYIA 2BAJA 3LHJA 4M7IA 3DKCA 5DVRA 5EDRA 4C7TA 3CSVA 2B1PA 4I6HA 1JPAA 3EZVA 4JBPA 4MBLA 2PZIA 1MRUA 3MVLA 4IM3A 2CKQA 2XA4A 4W4YA 3BHYA 4EZ5A 3H9FA 2OG8A 4E5AX 3KRLA 4MAOA 4NM3A 4IZYA 2KTYA 4R3CA 3EN7A 4PMSA 2ZM4A 1KUTA 4DE4A 3D2KA 3ZLSA 3DBCA 5ANGA 5AP4A 3QQFA 3ZDIA 4F0FA 5AUVA 3SDJA 3FZTA 5HVYA 1HCKA 5HGIA 2P0CA 3BQRA 3T8OA 3BLQA 4AGUA 2WU7A 5IKWA 3ODZX 5IQDA 4FV1A 4JQEA 5I9WA 3DLZA 2GNFA 3MIYA 3S00A 4FV4A 4FTKA 3PLSA 3ZHPC 3O8TA 3VHEA 1H1PA 2C5NA 4WNMA 3LM0A 3W8LA 4APPA 4D4VA 4D2SA 5A3XA 4N4SA 4XNEA 4Z7HA 1ZOGA 3AD5A 3W10A 2IVUA 2A4LA 3IGOA 4C3FA 5FGKA 3HMMA 4A7CA 3AMAA 3FMEA 3R71A 3W32A 4X2GA 3EQHA 2G9XA 4WUAA 1NY3A 3ZO3A 5GZAA 4M66A 5IA1A 4DFBA 4BDJA 4PX6A 1JOWB 3KN6A 3RK7A 4PMMA 2QNJA 4DEIA 1UU8A 5B7VA 5J9ZA 4X0MA 4WIHA 3GU8A 4GK3A 4R3PA 3O7LD 2PUPA 1S9IA 3RK9A 1U5QA 1XH4A 5BVFA 1NT2A 4YTIA 3KMWA 4M68A 3UPXA 5CU2A 4YJRA 3QHRA 3BRBA 3R8UA 4GL9A 4BDGA 3LPBA 4PDSA 1FMOE 3MGYA 2RL5A 3P7BA 4G1WA 4IEBA 2GS2A 2X6DA 2JKMA 2X9EA 4I93A 2I7QA 3OWLA 3Q6WA 1NXKA 2Y7JA 4FODA 5FEDA 4OTQA 2HENA 5LCJA 2SRCA 2Y4IC 1V1KA 3EZRA 5DYJA 4RVLA 4NK9A 3C0HA 5TOZA 5BUJA 2ITNA 3OROA 3PA5A 2NRYA 2VTQA 4BZNA 3HVCA 4H36A 2VWYA 2HYYA 4ZS0A 4IX5A 2CLQA 1H24A 4DINA 5AEPA 4J98A 3NZ0A 3JVRA 1KWPA 3QFVA 1OM1A 4RC3A 2OJFE 1YHWA 3QLGA 4ANOA 5GNKA 4TYHA 2FSLX 3CGOA 3SXFA 2B54A 3QRIA 4JQ7A 1W0XC 3EQIA 4FVPA 3HMPA 4R5YA 1BKXA 2OO8X 4OGRA 5EI8A 3G51A 3NIEA 2XK3A 4RX5A 3R63A 2PVLA 5CT7A 4AT3A 4E5BA 2XBJA 5DH3A 3RCDA 2A1AB 1ZYSA 5IPJA 3FE3A 4EH8A 3DDPA 5T6KA 2PZRA 4LOPA 3VS0A 1GZ8A 4ERKA 4K77A 3KXZA 4JAIA 4A9RA 2BUJA 3JS2A 2YIXA 4UV0A 4DH3A 2XNGA 4OAUC 4CFVA 4NTTA 4I22A 2VTLA 4IDTA 3C5IA 2W1EA 4N6YA 5CSXA 4IFCA 2BHEA 4IX3A 3O17A 4RFZA 3VBQA 1YWVA 2ETRA 4KB8A 2IWIA 3F7ZA 3W2QA 3LW0A 4IDVA 4RPVA 4D28A 1XH6A 4AW0A 1ZY5A 2Y6OA 2YIQA 3FMLA 3MB6A 4NJDA 5ANIA 2C0OA 2DWBA 4UALA 5IEXA 4RZVA 3WZUA 3L9NA 4FBXA 4U44A 3QALE 3NUAA 2XZSA 3MIAA 3AGMA 1SVHA 5E7RA 2IZUA 5M4FA 4D5HA 2Y0AA 5KZIA 2ZV2A 1YDTE 2C1BA 3JY0A 4Q9SA 1WBNA 4XYFA 3V5TA 2PMNX 1OL2A 4J8NA 2QOKA 2YM5A 4FKTA 4JT3A 4EC8A 5JN2A 4UWBA 2R7IA 2UZWE 5IQFA 2JIUA 4BCOA 4EL9A 2W5BA 4DC2A 5KHWA 2XVDA 4FG7A 3BHUA 3Q9XA 2GU8A 2ZMDA 4RIYB 4RIXA 4PMPA 1OIQA 5IMXA 2CNQA 5ACBC 5JFWA 3IK3A 3RALA 3V5QA 2DS1A 4HNIA 4I5MA 5AP3A 4ACCA 4JRVA 3JY9A 4C4JA 5JGAA 2B53A 5GJFA 2BILB 2R3HA 4FZAB 3VHKA 4AXAA 5M53A 4WSYA 3PA3A 4EWHA 3R1SA 2QOBA 4XV3A 3WYXA 4DYMA 5K9IA 3MB7A 2QOFA 3MFRA 3GCPA 4AZTA 3ZRMA 3U6IA 3GP0A 4TWNA 4FSUA 3OW3A 2QQ7A 3GFEA 3FI4A 5A4TA 5G1XA 1WVWA 2JAMA 3IDBA 2JITA 2WIHA 4I6QA 3JYAA 4C4GA 4QP1A 4CSVA 4YPSA 3R9NA 3SGCA 4BCKA 4BKJA 4ENXA 3DBFA 3Q04A 4GFGA 3VUGA 4O7WA 4BWXA 1H28A 4OTDA 3BYUA 4U7ZA 2YA9A 4YZ9A 1OKYA 3RTPA 4A9UA 1QPEA 4EH4A 3VF9A 3WZEA 3VWAA 4CV8A 3PP1A 4X3JA 1H25A 4DG2E 1XHAA 1QPCA 5IQIA 3WARA 2C5OA 5AUZA 3QX4A 4E20A 1IA8A 3S1HA 3GUBA 1ERKA 5D11A 3PPJA 1W8CA 3R9HA 3QCQA 3REPA 3NRMA 3B8RA 1OI9A 1O6LA 3LLAA 4FX3A 3KGAA 2ONLC 4HYIA 3F82A 3LLTA 4RZWA 4QP2A 5LMBA 2B9JA 4EK6A 5EKOA 1B6CB 2BIYA 3K54A 3BV2A 4FIEA 4DFLA 2EXMA 1U54B 4IE9A 4NFNA 4BTMA 3V5PA 3BE9A 3E8NA 3TJCA 4F08A 2IPXA 2WO6A 2VTOA 4C4EA 4F64A 2C6EA 4WRGA 5DGZA 3WIKA 3ENHA 3MY1A 4BTFA 1NVSA 3O23A 4YURA 5ITAA 1WBWA 3F2RA 3FV8A 2XH5A 5DR6A 2ERZE 4IADA 4O0SA 4V04A 5DBXA 3WF7A 3DXQA 2OFUA 3QBNA 3RPRA 4NCTA 2OFVA 4QQTA 2YCSA 3NWWA 4XG2A 2HXQA 2QO9A 3IKAA 5JSMA 4WBBB 4O2ZA 3OMVA 3FYKX 4L6QA 4RLLA 4KRCA 4JRNA 3E3BX 4XLIA 3UODA 4FV7A 4BCQA 3JPVA 3TZ7A 2J0LA 3AC5A 4I4FA 5F20A 3DLSA 4RIYA 3MH2A 4EI4A 4OAVB 5FD2A 4EK5A 4EHVA 2QOOA 2JKOA 2QHMA 2XBAA 3FQSA 3VUTA 5I0BA 1R0PA 3D14A 3I4BA 4LRJA 4FF8A 4GIIA 1QCFA 3UMXA 3TIZA 3VN9A 3FL5A 5DMZA 5L3AA 4O0YA 3LCSA 2QONA 3O0GA 3UC3A 5HE0A 3ORIA 3PSCA 2BIKB 4PY1A 4M69A 3F3WA 3UOKA 1YWNA 4CTBA 2YM6A 4USFA 3GCQA 5FBOA 2QURA 3C4WA 4L7SA 2BZIB 4ZTQA 5E1SA 5K3YA 4OBQA 2A2AA 2GS6A 3EJ1A 2UW4A 4M97A 3MVMA 3OUNB 4KKGA 2ITZA 2IZRA 3QZIA 3VBXA 3EQPA 3F9NA 3SG8A 2XNMA 2ITTA 3HLLA 4E7WA 4UMPA 5CI7A 4YZBA 1SNUA 4BBFA 4AA0A 2WB8A 4OTWA 3O2MA 4AGCA 4EOJA 3VS2A 2B9IA 3EHAA 3LXLA 3E8EA 3E92A 4FTJA 3LJ1A 4ZTHA 3PXZA 2PWLA 4BDHA 4X3FA 5LARA 2PE2A 1OBDA 3R7UA 4DG3E 5BYLA 2YM4A 2C5VA 5CEKA 4O7LA 1M52A 4FKVA 3PIZA 4RWIA 5EOLA 3FLQA 2F49A 4BZOA 2CKPA 2X4ZA 2F57A 2C30A 4K18A 4MNFA 1Y8YA 5C4KA 5CY3A 1JKKA 2WEIA 2BVAA 2XK8A 4G3EA 4OT5A 4IVDA 2ERKA 4DT9A 4CCUA 1CM8A 4KAOA 4U9AA 2X9FA 4BIDA 1MQBA 4Q5HA 3NS9A 4V01A 2HZIA 4MWHA 2C0IA 4RVTA 3Q5IA 3ITZA 1NVRA 1U54A 3DA6A 4CFFA 3V5LA 3KL8A 5HVKA 3D7ZA 5IISA 4BHZA 3V8TA 4F9BA 5M56A 1NA7A 4E93A 3VS6A 5AX3A 2UZNA 2WELA 2Q0NA 1MRVA 2ITWA 5CNNA 4E73A 5M44A 2HIWA 5HCYA 4DFYA 4OBOA 4L45A 4FNXA 4JJRA 2UVZA 5CI6A 2IO6A 3NGAA 2B55A 4CMUA 1REJA 2C68A 2X0GA 4MD8E 4NWMA 3R8PA 1ATPE 4AOIA 4F7JA 4UY9A 4DEEA 1U5RA 2P2HA 4QYGA 2OGVA 4EQUA 1UV5A 3U9CA 3QTIA 2YZAA 4EH3A 2BDJA 3F5PA 5GZ9A 3RHKA 5K0XA 4O6LA 4IAYA 4JXFA 5HLNA 5AM6A 1KOBA 5HLPA 3C0IA 3VUMA 1URCA 3P4KA 2BPMA 3RZBA 2WIPA 3PG3A 4QRCA 3TL8A 3H0ZA 5I9YA 3UP7A 4EZ3A 1J91A 3MSSA 3KY2A 4GVAA 4IJ9A 4F9YA 4JX3A 5AM7A 4CMOA 1YXTA 3EKKA 3MH0A 4QYEA 4YR8A 3RHXA 5BQ0A 4DGGA 2YERA 3QTRA 3EL7A 4PTGA 4APCA 3GC0A 2VN9A 3EKNA 5E8VA 2OZAB 2B52A 3FQHA 5F1ZA 5AJQA 3PJCA 2W9ZB 2XKFA 4LI5A 4BYJA 4R78A 3UNZA 4ACGA 3I1AA 3LCOA 4FTCA 4K9YA 3TXOA 2WTDA 3UNKA 2XKDA 3CC6A 2PMOX 3I0OA 4JDHA 5A6NA 4HZSA 3F7WA 4EC9A 3IO7A 4BDCA 4AZSA 4HVHA 3HMIA 4PL3A 5AUXA 3CKWA 3TZ8A 3EQGA 4WSQA 1LUFA 1Y6BA 5JFXA 4FGBA 4BGQA 4BDEA 4AT4A 3O7LB 4NM7A 5LVLA 2J6MA 2ETMA 2YCQA 2ZB1A 5E92A 3O50A 2UW8A 4L44A 3UIXA 3TEIA 1VEBA 1VYZA 3P7CA 4CFUA 3S95A 3TDVA 3PWDA 1ZWSA 5IEVA 3LFSA 3F2NA 2YJRA 3IW7A 4XV2A 4IHPA 2Z7SA 2GQGA 2GPHA 3GCUA 3PFQA 2YM7A 5F9EA 2JIVA 3KA0A 4KKHA 4NM0A 4BDDA 4U97A 5HKMA 2C3LA 4O0XA 3CBLA 2UZTA 5IA0A 4TT7A 4MD7E 2QD9A 5DRDA 2I0EA 3OW4A 4AN3A 2YISA 5KMJA 1OVEA 2GHLA 3K2LA 3P78A 2IG7A 1G3NA 3R8LA 4J71A 4YMJA 5C4LA 3UQCA 5IH5A 4GV1A 4U3ZA 5BVWA 4D1SA 4BDBA 3NW6A 3U9NA 3BU5A 3E64A 5FDXA 3DAJA 2UZOA 3KMMA 5JGBA 4EYJA 5IA4A 4YC6A 4FV6A 3AOXA 3MA3A 5DT3A 1M2QA 2ZV9A 4OTHA 2PHKA 5B2MA 4IFGA 2UW9A 3H30A 4EOOA 1UKHA 2FGIA 4HVSA 1OGUA 2G1TA 4YTCA 4II5A 2QCSA 4PPCA 4TYGA 3R7GA 2RFNA 4L67A 4PQNA 3RNIA 4DEHA 2XEZA 4FT9A 3FZRA 3PA4A 4E26A 4O84A 3ZRLA 3T9TA 4DF3A 1MP8A 3WF5A 4UX9A 2O8YA 5K4JA 3COMA 2QOCA 1W83A 3DFAA 4I20A 4MX9A 1J7LA 3VQUA 5DG5A 1KSWA 4Y83A 4B99A 1R0EA 2J7TA 3R01A 4RA4A 1ZYDA 4D0XA 3GC9A 3G2FA 4BIEA 4ANSA 2BDWA 2W4OA 2UV2A 2WQBA 3A4OX 4AFEA 4FTAA 2R3RA 4IB1A 3SVVA 3P0MA 4BCJA 2OXXA 5CQWA 3GB2A 3GU6A 3M42A 2OJIA 5AWMA 4EJNA 4L52A 4LUDA 4DGLC 2BRGA 4EWQA 4LV8A 3LIJA 5FEQA 5GJDA 1UKIA 3FC1X 4JDJA 1R78A 1PY5A 2Z8CA 3OWJA 3ZUUA 4YJQA 3KMUA 3PJ2A 4XG9A 1A48A 2QKRA 5M4UA 3SX9A 3EN4A 1O6KA 3PVWA 5C03A 2VWIA 5TE0A 3IQ7A 4KIOA 1IG1A 2OI4X 4LOOA 4DA5A 4TZRA 4QTBA 3KK9A 1XBBA 4KBAA 4L46A 3BYMA 5IH4A 4YTFA 4FEUA 2EXCX 2VTIA 3NAYA 5DFPA 4ASEA 1BLXA 3GVUA 4CLIA 3W18A 3OUKA 4FGRA 4FG9A 4GJ3A 4NYEA 4FVQA 2R64A 5C01A 4LOQA 1YI4A 2JBPA 2X39A 4U5JA 4AE9A 3POZA 1OZ1A 3RNYA 1OMWA 3RWQA 5EDQA 4I5HA 3R7VA 3C4EA 1JKTA 3SD0A 2YWVA 1YWRA 1ZOEA 2VO7A 4O0VA 4I0RA 5AADA 4F9CA 4IQ6A 5J9LA 2R3KA 1SVEA 4IB5A 4DGOA 2WKMA 3DZQA 1EH4A 5AUYA 3BGPA 5EI6A 4HCVA 3FC2A 4HPTE 4XUFA 3UOLA 4JVGA 4A07A 3A7GA 3TNWA 4PP7A 2QI8A 2P55A 3BELA 2F2UA 4TTHB 3OT8A 4H3PA 3QTUA 3BU3A 2GQRA 2GQSA 1LR4A 3B8QA 3O71A 3NCZA 2AC5A 3A62A 5CLPA 2FO0A 4FOCA 4YLKA 5AV1A 4ZLOA 4U6RA 5M55A 4JX7A 5CU3A 4TN6A 2RG5A 3BU6A 3ET7A 3OWKA 4EJ7A 4EUUA 1LEZA 4O83A 4KS7A 2BR1A 5T68A 2PE1A 3W2OA 2O63A 4N57A 3VRZA 3W2SA 4BFMA 3K5UA 5L8JA 3AQVA 1YXXA 3LFNA 2VTSA 2PPQA 1R39A 2V0DA 2PK9A 2Z7LA 4FL3A 4U40A 3FLSA 4UXQA 5AV3A 5AAFA 3UIBA 4IWPA 2CJMA 4FEWA 4K8AA 3I7CA 3NVKI 4F0IA 3KXGA 4FTUA 3QZFA 3WE8A 4F7SA 1GIIA 4K6ZA 2OSCA 5E8WA 4EHEA 4IZ5A 3UZRA 3GOPA 1ZLTA 4QQ5A 3Q32A 5LMAA 4R7BA 4QPAA 4BR3A 3DBEA 5ETFA 2PVFA 2R3NA 3CIKA 5JZJA 3OHTA 5FQDC 4A06A 5DPVA 2X8DA 4FIFA 3MTLA 4GG5A 4GT4A 4K1BA 4PL5A 1OECA 2OF4A 4G6OA 1FMKA 4I0SA 4LMUA 4O91A 3R83A 2PL0A 3RWPA 2YM8A 4U79A 3WILA 1XR1A 4RLKA 3UVPA 4MHAA 4QNYA 2IN6A 2VTTA 4YZCA 2FA2A 2G15A 5AUTA 2HZ0A 3LVPA 1Q8TA 2GHMA 3D83A 4K0YA 4B6LA 5IQBA 4LQMA 5BNJA 3GQLA 3ROCA 4R5SA 1J1CA 2HW6A 3ZYAA 3SXSA 5KKRB 4EOKA 4FSQA 5CYIA 3RKBA 3ORNA 5ANOA 5I9VA 1UU3A 4YJTA 3RAIA 4C4HA 2XS0A 3OCTA 5EI2A 4O0WA 4GYIA 2BRHA 2VWVA 3ACJA 3EFWA 4C4FA 4DH5A 4MQ2A 4FT3A 4OR5A 1VR2A 2V55A 2J5EA 3KRXA 4O38A 4BDFA 4AU8A 1W84A 1CTPE 2Z60A 4P4CA 5CZHA 3PY0A 2CDZA 2VO6A 3QRTA 2ZB0A 4NKAA 4L42A 4PV0A 4YTHA 2WFYA 3KXNA 4RIOA 5HBJA 2H8HA 2NPQA 2O64A 3GU5A 1WAKA 3HMNA 1ZMWA 3KCKA 5CF8A 3OCSA 2QR7A 4WA9A 5HG5A 5EDPA 2W1FA 3SAYA 2IZSA 3II5A 4QTAA 4CNHA 3PJ1A 3DTCA 2WMAA 3A4PA 5E8XA 3P7AA 3VUDA 4DHFA 4DTKA 2W99B 2CNVA 2PU8A 5HG7A 2OBJA 3ORPA 3HV5A 5CXHA 1M14A 1K3AA 3EB0A 3MFSA 4O0RA 5KMNA 4ASZA 3R7YA 2XKCA 3BYOA 4EKLA 4KBCA 4FIJA 4DEAA 3WZDA 4AOJA 3ZSHA 4C2WA 2PYWA 3PIXA 1ZYLA 2JDRA 2QU5A 5H8EA 5CU6A 5FP6A 3TT0A 4Y85A 3ZC5A 1A06A 4AE6A 3AC1A 3ENMA 2HY81 3GCVA 3OCBA 2QOQA 1X8BA 2UZBA 3QTZA 5G6VA 2UZDA 5HO6A 4J1RA 1RQQA 5KMOA 5J1VA 3P1AA 3ZO1A 3QA8A 1APME 2BTRA 4D2PA 2PVKA 5J9YA 3CQWA 3QQHA 3GQIA 3RINA 3A60A 3LJ0A 3AMYA 4JL9A 4ZP5A 5I9ZA 1F0QA 3DY7A 4PDOA 4QYFA 4X6QC 4ZSLA 3MFTA 4O82A 3R9DA 3SG9A 1PW2A 2X7OA 3I5ZA 4YNEA 3VS5A 3BQCA 4D1ZA 4DITA 2GNIA 1JAMA 1PXLA 4YO4A 2PZYA 3MDYA 5FXRA 5J1WA 3L8PA 3MW1A 4WD5A 4BKYA 4NT4A 4RQVA 5CENA 4D9UA 4O7TA 5KMIA 4FZFB 4AG8A 4BGHA 3KREA 2OIDA 2QLQA 3IECA 4CRSA 3RBWA 3DT1A 2VWUA 4KABA 4NW5A 5GIPE 3CQUA 4O2PA 4YJNA 2PVYA 4C33A 4BTJA 3KU2A 3BIZA 5LOHA 3K5VA 5M51A 4LG4A 3C50A 3TTIA 3KRJA 3SLSA 2ACXA 3AMBA 4FT0A 5CF5A 2CN8A 3Q4TA 2QG5A 1P4FA 2C6TA 4GT3A 3RCJA 4AT5A 3Q53A 1AD5A 2ONLA 3GNIB 5DA3A 4C38A 1IASA 4F63A 2C6KA 1OL7A 5BVNA 1GJOA 4FKWA 1Q99A 5D7VA 4O81A 3AC3A 1AGWA 4AW5A 4HJOA 4PNKA 3OFMA 4IVCA 2Q0BA 3HV7A 1P4OA 3RAWA 2ZM1A 2G2IA 3ZFYA 4FVRA 2HZNA 4EOSA 3P08A 1KOAA 4G3FA 4EH5A 3HA8A 4M84A 3WF9A 3R2YA 4DH8A 3HDNA 4ORKA 3IGGA 4OTGA 1YOJA 3HYHA 4UWCA 1OPJA 3CGFA 4A9YA 3UJGA 1TQPA 4NEUA 3RMFA 3TIYA 5B0XA 4I94A 2GNJA 3BPRA 1HOWA 3KCFA 1W82A 4HNFA 4Y46A 3Q2JA 3PG1A 1DAYA 4YZMA 3QRUA 5BVKA 1L8TA 1GIHA 3ORZA 4WUNA 5HD7A 4XS2A 4YHFA 3VO3A 3ZBFA 4U3YA 3UOJA 5HTCA 2RKUA 5CNOA 2XIKA 3VW8A 3QL8A 4JAJA 4RSSA 4D2RA 3B2WA 3BI6A 4O21A 3W16A 4PWNA 4BCNA 3KQ7A 3UG1A 5C8KA 2O2UA 2R3LA 5E8YA 2JD5A 3D15A 2IVVA 4UMTA 3WI6A 4FV0A 2ITYA 3OWPA 3RPSA 1PXJA 3W2RA 4RX9A 2PVMA 3ZFMA 4ITJA 2C6LA 4BI2A 4YHTA 3AD6A 5JZNA 1IEPA 3PPZA 4FNWA 1OL1A 2AYPA 2I6LA 3AG9A 3H9OA 3MH3A 3PJ8A 3SQQA 4E8AA 4HVDA 4AX8A 4EKKA 3GENA 4FL2A 5HNBA 4F7LA 3QGYA 2OW3A 3RPYA 4RVMA 4XG6A 1OKWA 5D41A 3DQXA 3HL7A 2XYNA 3CP9A 3DZOA 3IDCA 4CLJA 3NVMB 4XX9A 2OK1A 1QMZA 2WGJA 3R73A 4YBJA 2VAGA 3C9WA 4EH2A 4JOAA 4MH7A 3U54A 3EQDA 1H4LA 2R0IA 5IQHA 4O86A 3TWJA 2XNPA 4AQCA 2B0QA 3HA6A 3PTGA 4J53A 3RPVA 3COIA 3W2PA 3H9RA 1J3HA 2BKZA 1XO2B 2VRXA 1W7HA 4G17A 3A2CA 3NR9A 4BCPA 3PLAE 2IVSA 4YZDA 1H1RA 2A19B 4TXCA 1YVJA 2JEDA 4B4LA 4C0TA 4EHGA 4O0TA 4ZSGA 2Y6MA 1ZMVA 2VGPA 3FMJA 4Q2AA 5DRBA 2QOHA 3TACA 2ITUA 1OB3A 1IA9A 4Z7GA 5CVFA 2VTPA 4KKEA 4O6EA 2OLCA 4W9XA 3FY0A 3VBWA 1RW8A 2EWAA 2E9OA 3PSDA 1CKJA 2XK4A 4QYYA 4NSTA 2YCRA 3BWFA 4E4XA 3NYVA 2ZAZA 4R7IA 3A7IA 1NW1A 3V04A 1QL6A 3FWQA 4EORA 2P2IA 3I5NA 3F69A 3ZRKA 5JGDA 4LRKA 1XBAA 3ZTXA 3D4QA 4ACMA 2C6OA 3DNEA 3FMKA 4CFMA 1ZZLA 3QCXA 4FV2A 3NNXA 3GT8A 3ZLWA 3L8SA 2ITPA 5AX9A 4JR7A 2HELA 1Q97A 4FSTA 3OS3A 4I92A 3UZPA 4BCHA 4QTEA 3EYGA 2OKRA 5E4HA 3ZLXA 3NPCA 1FPUA 2E9NA 3NW7A 3MPAA 4E6AA 4H39A 2RFSA 5IUIA 3ID6C 4L7FA 3CD3A 5E8SA 3TKUA 1OUKA 4IAAA 5HG8A 2JGZA 4NJ3A 5A6OA 1TQIA 5FUTA 4ZTLA 5K5XA 3KULB 1JVPP 5EH0A 4CZTA 4DGNA 2QR8A 2CGXA 2XIRA 3I0QA 4FV8A 4LMNA 4PNIA 3CKXA 4IC8A 4UYNA 5L2QA 4DN5A 4F70A 3LMHA 2OJGA 2XK7A 5HE3A 5HZNA 5AUUA 1NVQA 2YITA 4B7TA 1DAWA 4XP2A 3LAUA 4A9TA 1UA2A 3A99A 3CPCA 4C36A 2VTJA 4Q9ZA 5DR2A 2BRMA 4F9AA 1E9HA 2PSQA 2BFYA 3U87A 3ULZA 3C0GA 3KB7A 2JFLA 4GVJA 2CLXA 4MF1A 5HTIA 3BBTB 3FMHA 4I41A 5I3OA 5GHVA 3ZM4A 3TV6A 3R1QA 4V05A 3EQCA 4O7SA 5M06A 5KKRC 4BZDA 4QMMA 4FKIA 4B0GA 5EQYA 5EKNA 3BHHA 4TYEA 5JFVA 2CCHA 1ZZ2A 3CD8A 4Y5QA 5HLWA 2XIXA 3ACKA 2RIOA 1OUYA 3NUYA 2PVHA 3G9NA 3QC4A 3R28A 1UU9A 2OU7A 3RM6A 1Q8YA 4OLIA 3P9JA 4ZY4A 3FPMA 4MQ1A 4WRSA 4E6DA 4FKGA 3HAVA 3BBWA 3P5KA 1YW2A 2W4KA 3G0FA 5L6PA 5CASA 5AIRA 2R2PA 3R30A 4GT5A 2X1NA 1OPKA 5AR8A 5AUWA 1BYGA 4D4YA 4ZZNA 4UWYA 5E8UA 4KA3A 2VTNA 4P5ZA 4CT2A 1REKA 1VJYA 3KN5A 3RPOA 4IZ7A 3ATSA 3Q4CA 5AV2A 3ZUTA 2QLUA 3QCSA 3DJ5A 4XHKB 3PE2A 5CEOA 3FZSA 3UGCA 3QD0A 3BGZA 3RK5A 4DEBA 4RRVA 3FLZA 1GZOA 3BYVA 4RQKA 4D0WA 3CS9A 4YSJA 5J7BA 1TKIA 2YIYA 4BL1A 2HAKA 3FZOA 4IXPA 1XH7A 2GS7A 3CY3A 3E87A 4YJOA 2YWPA 4JG8A 4B8MA 4BBMA 4UMUA 4BGGA 4MCVA 4FKQA 4O1PA 1V0PA 3R7OA 4EHZA 4Y73A 2XNEA 1Q8UA 3FXXA 3R22A 3Q4ZA 4FTRA 1YKRA 2BKKA 4GKHA 3K3IA 4LRMA 3LFQA 2OH4A 2C5XA 3UYSA 2OWBA 4C61A 2VTMA 3PUPA 4AP7A 4XJ0A 2YLEA 3ELJA 4S30A 3TKHA 1G8SA 2WPAA 5DR9A 4X2FA 4U0IA 4C34A 1H0VA 1FQ1B 4YP8A 2XJ1A 3FSKA 2IW8A 4X2JA 3FKLA 4X2NA 4XCUA 4EH7A 1H01A 5JK3A 3ATTA 3UO4A 4BCFA 3R2BA 1PMEA 1KV1A 3UG2A 2ZJWA 1M17A 4FTNA 2YHVA 3COKA 3M1SA 2PUNA 1FVTA 4IAFA 3A8XA 3NYOA 2QC6A 4MBIA 2X7GA 4ONAA 4YBKA 4G9CA 2YM3A 4TRLA 3WE4A 1IAJA 4XMOA 3VS7A 1PYEA 3OEFX 2AUHA 3O96A 2NNWB 4EH6A 3N4UA 4EOQA 3UC4A 3P86A 4F99A 2WMTA 4ZJJA 3VIDA 4U45A 3D2IA 4HYUA 3ZO2A 5LJJA 4R7HA 4DFXE 1WBOA 3HUBA 4AN9A 3R00A 4GJ2A 4KWPA 5KBQA 4DGMA 4BKZA 3QLFA 4PF4A 1G8AA 1Y6AA 4QP8A 3CJGA 4M12A 3MWUA 4CRLA 4NFMA 1OIYA 2X2MA 5KMMA 5DLSA 4W4XA 4RC2A 4BWKA 3U55A 4FIIA 4I5CA 4NUSA 1PHKA 3RI1A 2Z7QA 4MXOA 4ZEGA 4M8TA 3F88A 1FOTA 4L53A 2AC3A 3OOGA 2UW6A 4NKSA 4EONA 4LV5A 1ZXEA 3G33A 1P14A 3CY2A 4IZAA 4J95A 5EK7A 4UBAA 3I6WA 3D94A 4DAWA 4IW0A 2WMBA 4CEGA 1XH8A 2XCKA 4HZRA 5DE2A 2UW5A 4O7NA 3ANQA 3QQJA 3DOGA 2J51A 3SV0A 4U81A 4IAIA 3QGWA 4UN0C 5CX9A 3EN6A 3LFEA 1OIRA 5EM5A 3H3CA 4FUXA 3L8VA 3AC4A 3EIDA 4A4XA 3TV7A 4AW2A 4B8LA 4NU1A 3NYXA 4FV5A 5H2UA 3LFBA 3V8SA 3VF8A 4AGWA 1Q61A 3JR1A 5FM3A 2EU9A 5IDNA 3Q60A 2QODA 5ANKA 2OICA 4ZIMA 5HBHA 4CFXA 3IDPA 4QP9A 4D5KA 4HGEA 3CXWA 3EL8A 4CKJA 5FRIA 3QKKA 4BDKA 4PPBA 3Q2MA 5I5ZA 3ZFXA 2CKOA 2R5TA 3MV5A 3BLHA 2WTIA 1U59A 4E1ZA 4GEOA 5A4EA 4XBUA 3POOA 1YXVA 3D7TB 3IOKA 5IU2A 5KO1A 3GOKA 3EQBA 4W4VA 5F95A 3ZCLA 5IQCA 3OXTA 3SW4A 2RG6A 4J52A 2BTSA 3H4JA 5E1EA 2R3QA 2RSVA 5HOAA 3TCPA 4L68A 3GC8A 5HO7A 2XRWA 3DAKA 4Z9LA 3DQWA 2NRUA 2F7ZE 5KX8A 3DK7A 2FSTX 4FE2A 2HK5A 2UVYA 1WVXA 1LPUA 5LVOA 2BALA 4G2FA 4G9RA 4U80A 5C26A 4JIKA 4IB0A 3PXFA 2WU6A 4BF2A 4RIWB 5AR7A 1R3CA 4F6UA 3ZEPA 5HQ0A 3KEXA 3V5WA 3VULA 3AT4A 1YI3A 3SW7A 3I6UA 4TKSA 4ZOGA 1Q8WA 1STCE 3TN8A 2VX3A 2C47A 2VZ6A 3QC9A 3AD4A 3QTQA 5BMSA 4PMTA 3O8PA 3UIUA 4AZFA 1P5EA 5BVEA 4R1YA 2OJ9A 5CF6A 5L8LA 5CANA 3QWKA 4FKSA 4L9IA 3U4UA 1XQZA 3VJOA 4CG9A 1DM2A 4AS0A 3ZZWA 3CTHA 1J7UA 5EOBA 3CTQA 3FHIA 2KULA 4H05A 1YXUA 5EQEA 1XBCA 3KF7A 3LXNA 3C7QA 2PUIA 5LVMA 5CAOA 3WZJA 2W1DA 4FSYA 3ZC6A 3PXKA 3W55A 4E5WA 4B9DA 4C37A 4O27B 4HYHA 3FMNA 4QT1A 3AT3A 5FBNC 3QQGA 2ZVAA 4C4IA 4ANNA 2DQ7X 5J7HA 3SOCA 2XM8A 4PTCA 2NO3A 3L9LA 2HY0A 4OTPA 4ALWA 3QD2B 5HICA 3THBA 3KRRA 3PVBA 1Q3DA 4DG0E 4M13A 4RG0A 4U8ZA 3VBTA 2OZOA 2WTVA 1H1WA 2VWXA 1M7NA 3IW5A 4XH6A 1P2AA 5BVDA 5LWMA 4A9SA 1F5QA 4ID7A 3ZXTA 2PZPA 3U4WA 3HRFA 4WBOA 5CXZA 3A7JA 2Y8OA 4FT7A 5A14A 3UO6A 3KFAA 3GC7A 3E8DA 2OZAA 3ORKA 3OVVA 4GMYA 5JH6A 2A27A 3E3PA 4KSPA 3E5AA 3TNPC 2X8EA 5IUHA 3LE6A 4QQCA 5HORA 3MBLA 3FKNA 5LCKA 3VQHA 4ZSJA 2WQMA 3PDTA 3HV6A 1BL6A 3KF4A 4TWOA 4DBNA 5FXSA 5KBRA 2FYSA 4XG8A 1DI8A 5L2TA 4CKIA 1MQ4A 4FSNA 3ORXA 3FL4A 1YHSA 3QF9A 4IANA 4N70A 4U42A 5AP7A 2Z7RA 5HE1A 3V6SA 5CEQA 2CHLA 2VTHA 3IPHA 4QMLA 3S4QA 3NLBA 4DCEA 5TO8A 1L3RE 3R21A 4EOMA 2X2KA 4Y8DA 4CYIA 3OXIA 3UIMA 3V51A 1GZKA 3HECA 3TUDA 3TM0A 1B38A 5FG8A 4D2WA 3A8WA 5TT7A 3EN9A 3AC2A 3QXPA 4X2KA 4O0UA 4RJ3A 2E9PA 3S2PA 4FA2A 4MK0A 5C9CA 3ZXZA 3VAPA 4DEGA 1PRYA 3MPMA 4QMNA 4RVKA 5C1QB 4PDPA 3DB8A 3JUHA 3T9IA 3BHVA 1PXPA 1O6YA 1G5SA 4MXCA 4RJ6A 4Y5HA 4MXZA 1OKZA 3UPZA 4G31A 1H1SA 1UU7A 4FK6A 3QYZA 1CSNA 5CZIA 1E1VA 1XH9A 2PZ5A 2V22A 4P2KA 3GBZA 4R6VA 3DGKA 4F1MA 5EFQA 4CD0A 1UWJA 3HRCA 4FG8A 4DLJA 4GKIA 4GCJA 5IQAA 2WAJA 1MRYA 3UE4A 2IZTA 2J9MA 1FBNA 3LCTA 4CGAA 1I44A 4FSMA 4FSRA 5LQFA 5M4CA 4DFZE 3OZ6A 3TV4A 5AR5A 5CU0A 4MKCA 3V8WA 4BBEA 5JRQA 3DCVA 4HPUE 1M7QA 2VO3A 2FH9A 5KHXA 4IMYA 2BZJA 3GGFA 4WO5A 1OL5A 4F4PA 5CSPA 3FI2A 5JT2A 3C4FA 5IA5A 3ZSIA 2J90A 3QYWA 4TNDA 2V7AA 2QKWB 3NNWA 3QUEA 2ITQA 4IBMA 3HUCA 3FZ1A 3FBVA 1Q5KA 4WKQA 1BX6A 5FM2A 2BRBA 5BYZA 1CKPA 4XRLA 4K11A 5HTBA 4GW8A 4BHNA 4F0GA 3DKGA 4ZAUA 5L2WA 2YDJA 2PUUA 3P79A 5BUIA 1E1XA 4GS6A 4IAZA 4DTBA 4USEA 3QXOA 4IX6A 3H0YA 5AP6A 2RFDA 4GU6A 4GH2A 4MXAA 3NCGA 4EYMA 3N4VA 4XG7A 5AP1A 1PXNA 4NIFB 3ORTA 3FLYA 2UW0A 2X7FA 3C4XA 4Y72A 2HOGA 4V0GB 3MFUA 4AOTA 3HZTA 2YN8A 3EN5A 2CCIA 1Q8ZA 4TPTA 3CQEA 4ANBA 4EQCA 3ORLA 3RP9A 5AA8A 5B2LA 4YZNA 4RWLA 3K3JA 3PRFA 4EEVA 4JG6A 3NSZA 3NNVA 4HGTA 5TF9A 4FIHA 4UZDA 5IF1A 3OTVA 5HCZA 3NAXA 3ULIA 2RF9A 1U46A 4ZY6A 1Q62A 5I4NA 4YLJA 4XG3A 4O7RA 2W06A 2WMQA 5M09A 2VNYA 4XEYA 5CVHA 4IWQA 5A9UA 3HKOA 1XWSA 4WNPA 3KKVA 3VBYA 3LQ5A 5FP5A 4F6WA 4JNWA 4CZUA 4E6QA 1Q24A 2VU3A 4NH1A 4WG3A 3FI3A 3IOPA 2XF0A 3OD6X 1Y91A 3F5XA 4BTKA 5L6WL 4ALVA 4OTRA 4ZTNA 4ALUA 4IC7A 2ITVA 4W8EA 2CGWA 2G2HA 5DT0A 2VNWA 5JEBA 3PP0A 4L8MA 2C0TA 4G3GA 5B2KA 1SVGA 4GIHA 1I09A 5EM8A 2DYLA 4FT5A 4KRDA 1JSUA 4TWCA 4LM5A 3PPKA 2CKEA 3R8ZA 4ASDA 3TNIA 2WZJA 2W1HA 3IW4A 5AV0A 5J8IA 5GIOE 2ITXA 3GFWA 4S32A 4RX7A 3B2TA 5D12A 5DEWA 4FTMA 5J95A 3NDMA 1OIUA 2R7BA 4D58A 3OT3A 4QOXA 1ZMUA 4O96A 5HIDA 4E4LA 3VRYA 4RT7A 5DEYA 3AXWA 4FV3A 1Q4LA 1JBPE 5GJGA 2ZMCA 5AP2A 2ZM3A 4C8BA 1JKLA 2IW9A 3FMMA 4FSWA 4O1OA 4GFOA 4DEDA 5CTPA 3TTJA 3ODYX 3MVHA 4EBWA 4ASXA 4TYHB 3CPBA 4USDA 2VWZA 5CQUA 3FMDA 4GRBA 4TNBA 2LAVA 3ALOA 5FTQA 2BROA 2XIYA 3OEZA 4YNOA 2XEYA 4JR3A 4AA5A 1QPJA 4TW9A 5IQEA 4N6ZA 4IWOA 4U43A 4D1XA 2V62A 1M2RA 4FNZA 1PMUA 2WXVA 5GINE 5IH6A 3LFAA 2CGVA 4WOVA 1H07A 2B7AA 4AF3A 1FGIA 3GI3A 4NIFA 3DK6A 4V0GA 4FTIA 4ITHA 4Y95A 3BCEA 4Z3VA 4LFIA 3FDNA 1JNKA 2UVXA 2IW6A 3E93A 3IONA 2OXDA 3C4ZA 1IAHA 4P5QA 3OBGA 4GUEA 3S3IA 1YHVA 2GFSA 3ERKA 4QD6A 2OIBA 3N9XA 2FSOX 4WNKA 2F9GA 5CU4A 4O7ZA 2EB2A 3V5JA 4QTDA 3QU0A 4IM2A 4RJ4A 3R9OA 5M08A 1BMKA 2YJSA 3Q52A 4FOBA 5E8ZA 3ROYA 2XUUA 2QHNA 4AZEA 2F7XE 2W5HA 4M0ZA 4FYNA 3D5WA 2OIQA 1WBSA 3CEKA 1YI6A 5CS6A 1PKDA 4L3LA 4FZ6A
chains in the Genus database with same CATH superfamily
4IJPA 2Z02A 5J5SA 4MD9E 2X8IA 3F6XA 3HGKA 4AXEA 3NUPA 2IVTA 3UVQA 2Y9QA 4XV1A 3RJCA 2WTKB 4RIXB 2BAKA 1F3MC 2GNHA 3E88A 3L1SA 4EK4A 2W1GA 3BYSA 4DFNA 4NTSA 4QP3A 2BHHA 1WBTA 2J0JA 2JDVA 3G6HA 5I9XA 5IG1A 3ZM9A 4ZMEA 4JDKA 1YQJA 2JDOA 3R8VA 5K5NA 3QA0A 3TUBA 1W2DA 4RFYA 3WF6A 5A4LA 3QRKA 3FEGA 2O3PA 3BV3A 3EQRA 3F3TA 4ANMA 5CEPA 3HX4A 3W33A 5AA9A 4KINA 1ZAOA 2REIA 1JSVA 2W1CA 2YIRA 4RJ7A 4EOPA 4QDVA 3W0PA 3F3ZA 4MXYA 3VJNA 5L2IA 1IR3A 2H96A 3HP5A 3MY0A 4I21A 4PL4A 4QMYA 2R4BA 2PMLX 2F4JA 3ZS5A 1J7IA 4AN2A 4FTLA 3BLAA 3IW6A 4LYNA 4O7VA 2XIZA 4QMWA 4C58A 3QZHA 3LCDA 5HG9A 2OF2A 2UZLA 3FXWA 4IAKA 5HHWA 4CQEA 1J1BA 3SA0A 2YABA 5M07A 2VD5A 3R6XA 2PY3A 4CCBA 3I81A 3PXQA 2ZDUA 4GU9A 4JBQA 4QP7A 5L8KA 4KIPA 3I60A 4YHJA 3QD4A 5FEEA 2E2BA 3NW5A 4QQJA 3RM7A 5KNJA 4CG8A 3ZEWA 3BEAA 1AQ1A 3QAME 5IDPA 2R9SA 3IS5A 2JFMA 4G3DA 2VV9A 5F4NA 4NL0A 3MTFA 5L4QA 2F7EE 5TR6A 3T3VA 4EK8A 3BWJA 2BCJA 4R1VA 4S31A 4YJUA 2UZVA 3FUPA 4KIQA 3D0EA 4C35A 5CEMA 3EQFA 4G16A 4EUTA 3UDTA 5ICPA 2O5KA 1Z57A 2PTKA 2YFXA 4BVUA 3UTOA 1FVRA 1PMVA 1S9JA 3LQ8A 4J8MA 2WQNA 2VX1A 4J7BA 4ERWA 3DV3A 2LGCA 3WYYA 5J5TA 2HW7A 5ETAA 4A4OA 3I7BA 5HX6A 4K33A 4UMQA 2H34A 4CT1A 4HCUA 4MBJA 2BAQA 3WIGA 3AKLA 3PJ3A 4AZVA 5F94A 3VC4A 4YSMA 1JQHA 1YOMA 4AUAA 4XBRA 4IWDA 1PXKA 2W0JA 2YIWA 3M2WA 4G6LA 3W2CA 2Y4PA 1O9UA 2QVSE 4ZJVA 4S2ZA 5D1JA 2GNLA 3EMGA 3Q9WA 3BGQA 3OXZA 5AMNA 2WQEA 1A9UA 5EYCA 3FJQE 5E8TA 3E8CA 4AAYA 1WVYA 5JFSA 4BIBA 5A54A 2VWWA 3C5UA 4L3JA 2WMRA 1VLRA 2GSFA 4JDIA 4CFWA 4AW1A 1U4DA 4D2VA 3LQ3A 4QPSA 2X81A 3QWJA 1SYKA 5AIKA 3CE3A 4H1JA 2GDOA 4MXXA 4CYJA 3ANRA 3UBDA 4DTAA 5AP0A 3TKIA 3ZUVA 2DUVA 3W8QA 4IB3A 4ZTMA 2FSMX 4XOZA 3UMWA 4LV7A 3FY2A 5J87A 3UQGA 4M69B 3AT2A 5CVGA 2XMYA 1GIJA 4C57A 2JDSA 2W5AA 2WMSA 3E7OA 3COHA 3BZ3A 1ZYJA 5KMLA 3A61A 4IACA 5EHLA 4XP0A 2A98A 2UZEA 5LWNA 4D4SA 3MJ2A 2W17A 3U6JA 3VUHA 5C27A 3PY1A 3DAEA 2JLDA 3HMOA 4DFUA 3Q5ZA 4AGDA 4QYHA 4RWKA 2UUEA 3FKOA 4JBVA 3UQFA 3VVHA 4PP9A 2E9VA 4C3RA 4X3FB 3KXHA 2VTRA 2BZHB 3G9LX 1JKSA 2C3KA 2J0KA 1PKGA 4FKOA 3HRBA 4FTQA 4FYOA 4W8DA 3GU7A 4YC8A 3U51A 3PXYA 1TQMA 4AAAA 3F3UA 2C6MA 2GTMA 4FRFA 3R7EA 3TDWA 3ZO4A 3MA6A 1RJBA 3MI9A 3PIYA 4UEUA 1PMNA 3UVRA 4FICA 1H0WA 1H00A 2H6DA 3EFJA 3ZH8A 4FL1A 4FEXA 4AWIA 3PY3A 1R1WA 4JI9A 2WMWA 5A4QA 2EB3A 3NX8A 4YJSA 3OF0A 4KD1A 3DBDA 4L3PA 4OUCA 4RMZA 3V01A 5HEZA 5HU9A 5K4IA 3SOAA 5EW8A 5HD4A 4WHZA 4CQGA 5FXQA 5FLFA 5HO8A 1BI8A 1W2CA 3BE2A 1K2PA 3FLWA 3EYHA 1XKKA 1T45A 3DU8A 5IUGA 5L6OA 1ZY4A 4G34A 1PXMA 3EH9A 4AZWA 2J5FA 3FYJX 2OH0E 5JRSA 3AKJA 4IX4A 3ZZEA 4DHJA 4ZMFA 5EW3A 3GU4A 5LVNA 3VW6A 4ZS4A 3A7FA 3ZLYA 4DT8A 1JLUE 4ANQA 4BCGA 5M57A 2I1MA 2JIIA 2VX0A 4BB4A 5EYMA 5CAVA 4RBLA 4Q5EA 4HYSA 3RZFA 3SRVB 2C6IA 3DKOA 2GFCA 2HWOA 3QX2A 2FB8A 3GCSA 4O22A 1GNGA 5ETIA 4EBVA 5TKDA 5CF4A 3LFCA 2YEXA 3LM5A 4QDEA 2PVNA 3DBQA 3H10A 3JVSA 4MTAA 4OT6A 4ZXTA 4C62A 3MPTA 3EFLA 4PTEA 5D9HA 3KULA 3F61A 2E9UA 4FSZA 2BMCA 3F66A 3TZ9A 4G5JA 1W2FA 3WF8A 1SZMA 4UZHA 5AP5A 3TNHA 4R77A 2GTNA 2BZKB 2VWBA 2YACA 4R8QA 5CALA 3PE1A 5DHJA 5HIBA 4YO6A 5HNIX 5BPYA 3HDMA 4QMTA 4ENYA 5CAQA 3SC1A 1H1QA 2A0CX 4HOKA 2XALA 4JBOA 5EYKA 4C02A 3LOKA 4FIGA 2WOUA 4W9WA 4X21A 4LUEA 2UW7A 3MESA 4DCAA 2C4GA 4PRJA 2P33A 3E7VA 2FVDA 3LJ2A 4I6BA 4ZZMA 4AA4A 5AAGA 3UZTA 4K2RA 1B39A 5L2SA 4OTFA 3RAHA 2W9FB 4MNEB 5CSVA 2XNBA 4I4EA 4RWJA 5H8BA 4IIRA 5BX0A 5LMKA 4GYGA 4G5PA 1YOLA 4XP3A 4ZSEA 2Q83A 4QMUA 4BJJB 1TFFA 2X6EA 3OBJA 4XLVA 1UVRA 4LL0A 4F65A 3ZSGA 4CTCA 3G0EA 3KVWA 3UOHA 4JS8A 5FTOA 2ESMA 4BDIA 5BMMA 4F9WA 5IMEA 3DK3A 3CJFA 2O65A 3QD3A 4M3QA 4RX8A 3ZOSA 5CAUA 1FVVA 1FGKA 3UNJA 1PJKA 3R0TA 4BCMA 4BYIA 4D9TA 4HCTA 4LGGA 3GEQA 3DB6A 4OTIA 3NUSA 3DJ7A 4ARKA 4DH1A 3I79A 4O7YA 5D10A 3HV3A 3FAAA 2WD1A 4CFNA 4F7NA 2RFEA 2XNOA 4MF0A 4XOYA 1PXOA 3PZHA 3MJ1A 3M11A 3E62A 4A4LA 4KUJA 4CMTA 3DPKA 3QKMA 2OXYA 2V5QA 3EWHA 3VUKA 4PPAA 5KUPA 4FKUA 5AR3A 5E91A 4GK4A 3NYNA 5E9EA 4YGAA 3ALNA 2C6DA 3MY5A 3MH1A 3D5XA 4YJVA 4QPMA 2WTKC 5JQ5A 3TI1A 1URWA 4EZ7A 5CSWA 1GZNA 4H58A 1YXSA 1KE8A 2RGPA 3BHTA 2BFXA 5CEIA 1YRPA 4WNOA 1RDQE 4FMQA 5FTGA 3PYYA 3MS9A 1OITA 1LEWA 3O8UA 3FPQA 3PSBA 4P90A 2QO2A 4GFMA 5EG3A 4BCIA 5M4IA 1KE5A 4LGDA 1TVOA 3OP5A 4JQ8A 4ZJIA 1WMKA 4FI1A 2J2IB 3SRVA 4UYAA 5KCVA 4H3BA 4BWPA 3RAKA 3TG1A 1MUOA 4H1MA 3U6HA 3C13A 3PZEA 2QU6A 5AAEA 4I5PA 2W05A 2CPKE 4KBKA 4E4NA 1KE6A 2W7XA 3R9RA 2IF8A 4QMSA 2G2FA 2JBOA 4BC6A 1ZRZA 2ZDTA 2BRNA 4FC0A 5H3QA 2VTAA 4XV9A 4QMPA 4YU2A 2PVRA 2XM9A 3LZBA 1WFCA 4OW8A 1WBPA 4IVBA 4CKRA 1SNXA 3QZGA 5KZ0A 2R3IA 4ZLZA 2YAKA 4I23A 4GK2A 2VO0A 4FNYA 1SMHA 3Q96A 4GSBA 3QKLA 4F1OA 3ZONA 2PE0A 4KS8A 1YDSE 3G90X 1PF8A 1ZOHA 2JC6A 4QMVA 2YAAA 2JKKA 2I0YA 3DKFA 5ETCA 3PVGA 5IZFA 4MNEA 3Q9ZA 2FUMA 3VS3A 3QQKA 2BDFA 4ZSAA 1PXIA 2GMXA 4RA5A 2X4FA 3CCNA 2UW3A 3ZMMA 1Y57A 1H8FA 5J79A 2YCFA 5A4CA 2P3GX 4EOLA 3AGLA 3L9PA 4I24A 1H26A 4AXDA 4M0YA 3DTWA 3EOCA 3LMIA 3VS1A 4F09A 4D4RA 2R3FA 2WTWA 3R1NA 5AV4A 1QPDA 2C69A 5GZ8A 4NCTC 4C59A 3R04A 5HIEA 3BKBA 2B9HA 3IG7A 3S0OA 5AFVA 3UDBA 3F5UA 2Z2WA 4AACA 3LXPA 1UNHA 4J97A 3GXLA 4LGHA 5ANJA 1KE7A 4ACDA 4CV9A 4DBXA 2VGOA 5C8MA 2G01A 3WOWA 2R3PA 3VBVA 3G5DA 4Z55A 5DIAA 3LFDA 4IVAA 2WQOA 3D5UA 3ORMA 4WT6A 3C1XA 2I0HA 1K9AA 1H08A 2XRUA 1Z9XA 4GG7A 1KV2A 2PVJA 2W1ZA 3NUUA 4HGSA 4FEQA 5FDPA 3KK8A 3NUNA 1IRKA 4PDYA 2X0QA 2J0IA 5EHYA 4RJ5A 4DLIA 2JKQA 2XK6A 4UMRA 4FK3A 3DJ6A 1XH5A 4G6NA 5A46A 4QMOA 3LCKA 2GCDA 3DXPA 1ND4A 4PUZA 5JKGA 5LXMA 3OCGA 4FEVA 4YPDA 4YJPA 5BYYA 4QP4A 2W96B 1OBGA 3SKCA 2GNGA 1M2PA 3PRIA 1SM2A 1DS5A 3LFFA 5ACKA 4EOIA 4HVIA 3TUCA 4IH8A 2EVAA 3BLRA 5DI1A 3NNUA 2WNTA 4RC4A 4ZLYA 4CVAA 3HP2A 2Y4IB 4S34A 4BICA 3U8WA 4D2TA 2CNUA 3CTJA 5CT0A 3DNDA 2WMUA 1G8JA 5D7AA 3NUXA 3QQUA 4G3CA 2R3MA 4O4CA 2R3GA 5LMKC 2QOLA 2W4JA 1GY3A 4JIAA 5ANEA 5HNGA 3D7TA 4QMZA 2R3JA 5DN3A 3OC1A 4X3FC 4MWIA 2JAVA 5HX8A 2J4ZA 3QCYA 4H3QA 4F1TA 3N51A 3ZU7A 1ZYCA 4FKRA 3UO5A 3RVGA 2HZ4A 3PXRA 3ZBXA 3MN3A 3NIZA 2F2CB 1WBVA 4HW7A 2C1AA 2HXLA 5AR2A 3SXRA 2C3IB 4KIKB 3MYGA 3QTSA 4ZK5A 5EYDA 5K0KA 2X2LA 4XG4A 2I40A 4BI1A 4YC3A 4FR4A 1Q41A 4RIWA 1CMKE 3D5VA 4U41A 2WTCA 3FSFA 3QUDA 4N0SA 5BUEA 3HNGA 2HWPA 4QO9A 3LMGA 4OBPA 5HU3A 2J50A 2NP8A 4QNAA 1Y8GA 2UZUE 3DFCB 4NM5A 2WTJA 4CZYB 4FZ7A 1BI7A 2IJMA 3Q9YA 3TJDA 3G15A 4ZZOA 3R1YA 3CR0A 3VUIA 4XRJA 1UNLA 1VYWA 3CLYA 4BY9E 2ITOA 1WZYA 3OOMA 5IA3A 4FKLA 1V0OA 3QRJA 3FQEA 1PYXA 2I0VA 2HCKA 3OY1A 3BEGA 4TL0A 3W0SA 1UNGA 2JDTA 3O51A 3HAMA 5HCXA 4RJ8A 3RGFA 1UWHA 3F3VA 4QTCA 4FV9A 4UXLA 5EM7A 4W4WA 2CGUA 3JXWA 1CKIA 4I6FA 2J0MB 5DNRA 3DXNA 2ZV8A 2GHGA 3F5GA 3HV4A 3KC3A 2CSNA 3Q4UA 4I0TA 5EM6A 2XYUA 5I9UA 4EQMA 5HE2A 3QTXA 4TYJA 5JMSA 5ANDA 4ZTRA 4IM0A 5HVJA 4M67A 3R7IA 1HCLA 4FTOA 1FINA 4YUQA 5BV3A 3KXMA 4RFMA 3SHEA 4S33A 2ZYBA 5KE0A 2WEVA 3T3UA 2XJ2A 3OY3A 3L9MA 3OTUA 4WG5A 4P7EA 3NEWA 2PMIA 4QMQA 1OL6A 1W98A 3WBLA 1RE8A 2XKEA 4MYGA 2QOIA 1BL7A 3FHRA 4NZWB 4BDAA 4E4MA 5C8NA 4F6SA 4UB7A 5CAPA 1WCCA 4FKPA 4C3PA 4EH9A 2OJJA 2V7OA 5DT4A 3OG7A 2H9VA 3TZMA 2WHBA 4CXAA 4J99A 3DS6A 3KXXA 4KSQA 2XP2A 2PULA 5FWKK 4M14A 3ETAA 1YDRE 3VNTA 5JQ8A 4FUYA 5BVOA 3VS4A 2YZLA 5H8GA 1JWHA 3AC8A 3Q6UA 4LL5A 4FZDB 1BUHA 2C3JA 2B4SB 4HGLA 1LP4A 3HEGA 4DH7A 2ZOQA 4E3CA 3NMUF 2XNNA 5DWRA 3V3VA 4Z16A 4KNBA 2QO7A 5HESA 3FI8A 2WMXA 1KE9A 3LXKA 5EHOA 1DI9A 4BN1A 5CSHA 1V0BA 2QG7A 2XJ0A 2XAMA 4ITIA 5IQGA 4M15A 2P4IA 4FKJA 4KIKA 3TNQB 3Q3BA 2CN5A 4L00A 5AR4A 4HVGA 5CWZA 2EUFB 2VUWA 5LVPA 3C4CA 1T46A 1JSTA 4J96A 3UP2A 2B9FA 5IEYA 1GAGA 2IEWA 4QP6A 4ZTSA 5HI2A 4BI0A 4C2VA 5EQPA 3WZKA 3QUPA 4MVFA 4EK3A 3C51A 3A7HA 3ZDUA 3LKMA 3DDQA 4I3ZA 1OPLA 4NW6A 5HBEA 3QTWA 4GUBA 4I1ZA 5H9BA 4QMXA 4ZY5A 3QQLA 2WOTA 1CDKA 3L8XA 4YLLA 4TWPA 4JG7A 3QHWA 2ETKA 3R02A 2WMVA 4WG4A 1H27A 3FXZA 3G6GA 3KRWA 4ACHA 4AFJA 5KMKA 4D55A 4MEDA 2ZV7A 2YDIA 4E6CA 5EW9A 3W1FA 4R3RA 3FLNC 3MVJA 1VZOA 2XB7A 3P23A 4L01A 4X6RA 3IW8A 4X7QA 4BRXA 2W1IA 5I3RA 1XJDA 2C5YA 2EXEA 1GOLA 3E63A 3N4TA 1Z5MA 3D9VA 3PWYA 5E90A 5DOSA 3V6RA 4RGJA 4JLCA 4FTTA 2O0UA 5IA2A 3UYTA 5T3QA 1ZARA 3F2AA 2XK9A 2R0UA 2YDKA 4TY1A 2R3OA 4L43A 3PVUA 2YLFA 1OKVA 2XCHA 2CMWA 3FZPA 3KVXA 4ANLA 3R8MA 3BX5A 3EFKA 1Q3WA 4TYIA 2BAJA 3LHJA 4M7IA 3DKCA 5DVRA 5EDRA 4C7TA 3CSVA 2B1PA 4I6HA 1JPAA 3EZVA 4JBPA 4MBLA 2PZIA 1MRUA 3MVLA 4IM3A 2CKQA 2XA4A 4W4YA 3BHYA 4EZ5A 3H9FA 2OG8A 4E5AX 3KRLA 4MAOA 4NM3A 4IZYA 2KTYA 4R3CA 3EN7A 4PMSA 2ZM4A 1KUTA 4DE4A 3D2KA 3ZLSA 3DBCA 5ANGA 5AP4A 3QQFA 3ZDIA 4F0FA 5AUVA 3SDJA 3FZTA 5HVYA 1HCKA 5HGIA 2P0CA 3BQRA 3T8OA 3BLQA 4AGUA 2WU7A 5IKWA 3ODZX 5IQDA 4FV1A 4JQEA 5I9WA 3DLZA 2GNFA 3MIYA 3S00A 4FV4A 4FTKA 3PLSA 3ZHPC 3O8TA 3VHEA 1H1PA 2C5NA 4WNMA 3LM0A 3W8LA 4APPA 4D4VA 4D2SA 5A3XA 4N4SA 4XNEA 4Z7HA 1ZOGA 3AD5A 3W10A 2IVUA 2A4LA 3IGOA 4C3FA 5FGKA 3HMMA 4A7CA 3AMAA 3FMEA 3R71A 3W32A 4X2GA 3EQHA 2G9XA 4WUAA 1NY3A 3ZO3A 5GZAA 4M66A 5IA1A 4DFBA 4BDJA 4PX6A 2X0PA 1JOWB 3KN6A 3RK7A 4PMMA 2QNJA 4DEIA 1UU8A 5B7VA 5J9ZA 4X0MA 4WIHA 3GU8A 4GK3A 4R3PA 3O7LD 2PUPA 1S9IA 3RK9A 1U5QA 1XH4A 5BVFA 1NT2A 4YTIA 3KMWA 4M68A 3UPXA 5CU2A 4YJRA 3QHRA 3BRBA 3R8UA 4GL9A 4BDGA 3LPBA 4PDSA 1FMOE 3MGYA 2RL5A 3P7BA 4G1WA 4IEBA 2GS2A 2X6DA 2JKMA 2X9EA 4I93A 2I7QA 3OWLA 3Q6WA 1NXKA 2Y7JA 4FODA 5FEDA 4OTQA 2HENA 5LCJA 2SRCA 2Y4IC 1V1KA 3EZRA 5DYJA 4RVLA 4NK9A 3C0HA 5TOZA 5BUJA 2ITNA 3OROA 3PA5A 2NRYA 2VTQA 4BZNA 3HVCA 4H36A 2VWYA 2HYYA 4ZS0A 3NFFB 4IX5A 2CLQA 1H24A 4DINA 5AEPA 4J98A 3NZ0A 3JVRA 1KWPA 3QFVA 1OM1A 4RC3A 2OJFE 1YHWA 3QLGA 4ANOA 5GNKA 4TYHA 2FSLX 3CGOA 3SXFA 2B54A 3QRIA 4JQ7A 1W0XC 3EQIA 4FVPA 3HMPA 4R5YA 1BKXA 2OO8X 4OGRA 5EI8A 3G51A 3NIEA 2XK3A 4RX5A 3R63A 2PVLA 5CT7A 4AT3A 4E5BA 2XBJA 5DH3A 3RCDA 2A1AB 1ZYSA 5IPJA 3FE3A 4EH8A 3DDPA 5T6KA 2PZRA 4LOPA 3VS0A 1GZ8A 4ERKA 4K77A 3KXZA 4JAIA 4A9RA 2BUJA 3JS2A 2YIXA 4UV0A 4DH3A 2XNGA 4OAUC 4CFVA 4NTTA 4I22A 2VTLA 4IDTA 3C5IA 2W1EA 4N6YA 5CSXA 4IFCA 2BHEA 4IX3A 3O17A 4RFZA 3VBQA 1YWVA 2ETRA 4KB8A 2IWIA 3F7ZA 3W2QA 3LW0A 4IDVA 4RPVA 4D28A 1XH6A 4AW0A 1ZY5A 2Y6OA 2YIQA 3FMLA 3MB6A 4NJDA 5ANIA 2C0OA 2DWBA 4UALA 5IEXA 4RZVA 3WZUA 3L9NA 4FBXA 4U44A 3QALE 3NUAA 2XZSA 3MIAA 3AGMA 1SVHA 5E7RA 2IZUA 5M4FA 4D5HA 2Y0AA 5KZIA 2ZV2A 1YDTE 2C1BA 3JY0A 4Q9SA 1WBNA 4XYFA 3V5TA 2PMNX 1OL2A 4J8NA 2QOKA 2YM5A 4FKTA 4JT3A 4EC8A 5JN2A 4UWBA 2R7IA 2UZWE 5IQFA 2JIUA 4BCOA 4EL9A 2W5BA 4DC2A 5KHWA 2XVDA 4FG7A 3BHUA 3Q9XA 2GU8A 2ZMDA 4RIYB 4RIXA 4PMPA 1OIQA 5IMXA 2CNQA 5ACBC 5JFWA 3IK3A 3RALA 3V5QA 2DS1A 4HNIA 4I5MA 5AP3A 4ACCA 4JRVA 3JY9A 4C4JA 5JGAA 2B53A 5GJFA 2BILB 2R3HA 4FZAB 3VHKA 4AXAA 5M53A 4WSYA 3PA3A 4EWHA 3R1SA 2QOBA 4XV3A 3WYXA 4DYMA 5K9IA 3MB7A 2QOFA 3MFRA 3GCPA 4AZTA 3ZRMA 3U6IA 3GP0A 4TWNA 4FSUA 3OW3A 2QQ7A 3GFEA 3FI4A 5A4TA 5G1XA 1WVWA 2JAMA 3IDBA 2JITA 2WIHA 4I6QA 3JYAA 4C4GA 4QP1A 4CSVA 4YPSA 3R9NA 3SGCA 4BCKA 4BKJA 4ENXA 3DBFA 3Q04A 4GFGA 3VUGA 4O7WA 4BWXA 1H28A 4OTDA 3BYUA 4U7ZA 2YA9A 4YZ9A 1OKYA 3RTPA 4A9UA 1QPEA 4EH4A 3VF9A 3WZEA 3VWAA 4CV8A 3PP1A 4X3JA 1H25A 4DG2E 1XHAA 1QPCA 5IQIA 3WARA 2C5OA 5AUZA 3QX4A 4E20A 1IA8A 3S1HA 3GUBA 1ERKA 5D11A 3PPJA 1W8CA 3R9HA 3QCQA 3REPA 3NRMA 3B8RA 1OI9A 1O6LA 3LLAA 4FX3A 3KGAA 2ONLC 4HYIA 3F82A 3LLTA 4RZWA 4QP2A 5LMBA 2B9JA 4EK6A 5EKOA 1B6CB 2BIYA 3K54A 3BV2A 4FIEA 4DFLA 2EXMA 1U54B 4IE9A 4NFNA 4BTMA 3V5PA 3BE9A 3E8NA 3TJCA 4F08A 2IPXA 2WO6A 2VTOA 4C4EA 4F64A 2C6EA 4WRGA 5DGZA 3WIKA 3ENHA 3MY1A 4BTFA 1NVSA 3O23A 4YURA 5ITAA 1WBWA 3F2RA 3FV8A 2XH5A 5DR6A 2ERZE 4IADA 4O0SA 4V04A 5DBXA 3WF7A 3DXQA 2OFUA 3QBNA 3RPRA 4NCTA 2OFVA 4QQTA 2YCSA 3NWWA 4XG2A 2HXQA 2QO9A 3IKAA 5JSMA 4WBBB 4O2ZA 3OMVA 3FYKX 4L6QA 4RLLA 4KRCA 4JRNA 3E3BX 4XLIA 3UODA 4FV7A 4BCQA 3JPVA 3TZ7A 2J0LA 3AC5A 4I4FA 4F78A 5F20A 3DLSA 4RIYA 3MH2A 4EI4A 4OAVB 5FD2A 4EK5A 4EHVA 2QOOA 2JKOA 2QHMA 2XBAA 3FQSA 3VUTA 5I0BA 1R0PA 3D14A 3I4BA 4LRJA 4FF8A 4GIIA 1QCFA 3UMXA 3TIZA 3VN9A 3FL5A 5DMZA 5L3AA 4O0YA 3LCSA 2QONA 3O0GA 3UC3A 5HE0A 3ORIA 3PSCA 2BIKB 4PY1A 4M69A 3F3WA 3UOKA 1YWNA 4CTBA 2YM6A 4USFA 3GCQA 5FBOA 2QURA 3C4WA 4L7SA 2BZIB 1ST4A 4ZTQA 5E1SA 5K3YA 4O4DA 4OBQA 2A2AA 2GS6A 3EJ1A 2UW4A 4M97A 3MVMA 3OUNB 4KKGA 2ITZA 2IZRA 3QZIA 3VBXA 3EQPA 3F9NA 3SG8A 2XNMA 2ITTA 3HLLA 4E7WA 4UMPA 5CI7A 4YZBA 1SNUA 4BBFA 4AA0A 2WB8A 4OTWA 3O2MA 4AGCA 4EOJA 3VS2A 2B9IA 3EHAA 3LXLA 3E8EA 3E92A 4FTJA 3LJ1A 4ZTHA 3PXZA 2PWLA 4BDHA 4X3FA 5LARA 2PE2A 1OBDA 3R7UA 4DG3E 5BYLA 2YM4A 2C5VA 5CEKA 4O7LA 1M52A 4FKVA 3PIZA 4RWIA 5EOLA 3FLQA 2F49A 4BZOA 2CKPA 2XANA 2X4ZA 2F57A 2C30A 4K18A 4MNFA 1Y8YA 5C4KA 5CY3A 1JKKA 2WEIA 2BVAA 2XK8A 4G3EA 4OT5A 4IVDA 2ERKA 4DT9A 4CCUA 1CM8A 4KAOA 4U9AA 2X9FA 4BIDA 1MQBA 4Q5HA 3NS9A 4V01A 2HZIA 4MWHA 2C0IA 4RVTA 3Q5IA 3ITZA 1NVRA 1U54A 3DA6A 4CFFA 3V5LA 3KL8A 5HVKA 3D7ZA 5IISA 4BHZA 3V8TA 4F9BA 5M56A 1NA7A 4E93A 3VS6A 5AX3A 2UZNA 2WELA 2Q0NA 1MRVA 2ITWA 5CNNA 4E73A 5M44A 2HIWA 5HCYA 4DFYA 4OBOA 4L45A 4FNXA 4JJRA 2UVZA 5CI6A 2IO6A 3NGAA 2B55A 4CMUA 1REJA 2C68A 2X0GA 4MD8E 4NWMA 3R8PA 1ATPE 4AOIA 4F7JA 4UY9A 4DEEA 1U5RA 2P2HA 4QYGA 2OGVA 4EQUA 1UV5A 3U9CA 3QTIA 2YZAA 4EH3A 2BDJA 3F5PA 5GZ9A 3RHKA 5K0XA 4O6LA 4IAYA 4JXFA 5HLNA 5AM6A 1KOBA 5HLPA 3C0IA 3VUMA 1URCA 3P4KA 2BPMA 3RZBA 2WIPA 3PG3A 4QRCA 3NFGB 3TL8A 3H0ZA 5I9YA 3UP7A 4EZ3A 1J91A 3MSSA 3KY2A 4GVAA 4IJ9A 4F9YA 4JX3A 5AM7A 4CMOA 1YXTA 3EKKA 3MH0A 4QYEA 4YR8A 3RHXA 5BQ0A 4DGGA 2YERA 3QTRA 3EL7A 4PTGA 4APCA 3GC0A 2VN9A 3EKNA 5E8VA 2OZAB 2B52A 3FQHA 5F1ZA 5AJQA 3PJCA 2W9ZB 2XKFA 4LI5A 4BYJA 4R78A 3UNZA 4QEBA 4ACGA 3I1AA 3LCOA 4FTCA 4K9YA 3TXOA 2WTDA 3UNKA 2XKDA 4BJJA 3CC6A 2PMOX 3I0OA 4JDHA 5A6NA 4HZSA 3F7WA 4EC9A 3IO7A 4BDCA 4AZSA 4HVHA 3HMIA 4PL3A 5AUXA 3CKWA 3TZ8A 3EQGA 1G8KA 4WSQA 1LUFA 1Y6BA 5JFXA 4FGBA 4BGQA 4BDEA 4AT4A 3O7LB 4NM7A 5LVLA 2J6MA 2ETMA 2YCQA 2ZB1A 5E92A 3O50A 2UW8A 4L44A 3UIXA 3TEIA 1VEBA 1VYZA 3P7CA 4CFUA 3S95A 3TDVA 3PWDA 1ZWSA