3DM2A

Crystal structure of hiv-1 k103n mutant reverse transcriptase in complex with gw564511.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
539
structure length
531
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 146
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dm2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dm2A05
3L2VA 3T5HA 3TARA 4DFKA 5FRMA 3KHHA 3JYTA 4KTWA 3KK3A 1LWEA 2E9TA 4DFJA 4ED7A 1BGXT 3PVXA 4CHYA 4FLVA 4DF4A 3DLEB 1Y97A 4CJSA 1HQUA 1N56A 5KG3A 4FJMA 3TAMB 1QS4A 4KKOA 2ZD1A 1MU2A 1X9SA 1T94A 3DRPB 4FJNA 3QGGA 4FLTA 1SV5A 2WHOA 4CFAA 3HT3A 3UQSA 3PHEA 4BDYA 2QK9A 4NLVA 3SV3A 3BR9A 1GX6A 5KRTA 3RR7A 4NYZA 3SCXA 2DPJA 2V0NA 4KB1A 3OS1A 4FS2A 1QAJA 2YNHB 3F9KA 5F9LA 4DQSA 4F3TA 5EUHA 1NJZA 3G0ZA 1XWLA 4C8NA 3DI6A 3HSTB 4J9LA 1A5VA 4Z0UA 4J2EA 4IR9A 1KLNA 2W42A 2ATQA 5KFDA 3PW0A 4ELTA 2CJQA 4TY8B 4J9MA 1UAXA 2RPIA 1RT6B 4ICLB 5JS1A 4IG0A 4EBDA 4FXDA 2UUTA 3TVKA 1VSLA 2UVVA 4WYLA 2IA6A 3LP2A 4CJPA 1BQNB 4CJKA 2YHAA 3TAGA 4NLTA 4BDZA 3KD1E 1RT2A 5EWEA 4KHWA 4NRTA 3OL6A 4WFYA 1S1TB 1ZTWA 3B6PA 2B43A 4F2RA 5CZ1A 4QAGA 2X74A 2OYQA 5SWMA 4WYWA 1VK0A 3DYAA 3CYMA 3DOKB 1TL3B 3ZT0A 5I42A 2OPSB 3CIZA 1U49A 1RTIB 4FJGA 4Z4IA 1RT4A 4LSNB 3CJ5A 2JC0A 3DLHA 4IFVB 3OHBA 4CHZA 4LQ3A 4CEZA 3K5OA 3EZ5A 1RBUA 1CZBA 3JYTB 4Y1DA 3KK3B 1LWEB 4I9QA 4IOBA 4CERA 3LAKA 4B8CA 4DTSA 3SNNA 2YNIA 4PQUA 3ZSOA 4CGIA 3BDPA 1HQUB 4AHVA 3AA4A 3OYLA 4KKOB 2ZD1B 4TQRA 1IKYA 1MU2B 2WOMA 4CJVA 4DLEA 4MKAA 5CYQA 1SV5B 4QWEA 1JLQA 4CEFA 2O5DA 3UPFA 4E7IA 3FDSA 4Q43A 3U6FA 3CM5A 4NCAA 3NF7A 2OZSA 4E7JA 5T14A 5KG4A 2IMWP 2AJQA 4WFZA 3V9SA 2F8TA 4MK8A 3AA2A 3V6HA 3MR3A 1BCMA 5KFWA 1HNVA 2D7SA 1LW2A 2ZE2A 4YFUA 5E41A 2HNDA 4DL7A 3QEIA 1TKZA 2AX0A 2QXFA 5KFTA 3EPIA 4Q8FA 4TN2A 3VQSA 3CJ2A 3QO9A 3DI6B 3N6NA 2IM0A 2HHXA 1ZTTA 1WNSA 1S9FA 3WNGA 3OSPA 3WNHA 4FJLA 4K4WA 3AVFA 1VRTA 1JX4A 4HCCA 3CFPA 3G86A 1JLAA 4IG0B 2JC1A 3MTKA 3ZSVA 2W7PA 3GIIA 1NKCA 3LP2B 4ID5A 5KFIA 3ZSRA 3IAYA 2GUIA 4NLGA 4DU1A 3M9NB 4GMJB 1RT2B 2G8UA 3IS9A 1FK9A 3V9XA 4IKFA 1GX5A 3QNOA 3CQ8A 2E9ZA 5DQGA 3OYMA 1DTTA 4WE1A 3NH2A 3OY9A 3HPHA 3DYAB 4C8LA 4W5OA 5I42B 3Q8QB 1ASUA 1RT4B 3FSIA 1TAQA 4WFXA 4AHRA 3KJVA 3RB4A 5KFPA 2PYJA 4IG3A 3MEEA 1RBVA 5KT5A 5DLFA 3HVRA 4E0DA 4FLWA 2YNIB 4PQUB 2VWKA 1U45A 1NKBA 4GC6A 4CGHA 4FK4A 1IKYB 2WOMB 3OYBA 4FLUA 2BQUA 5CYQB 4EEYA 1JLQB 1B9DA 1N5YA 3TAQA 2A1RA 1HYSA 1XR7A 3DLBA 4MKBA 4DTJA 1JLFA 3MFIA 3OL9A 4ZMMA 1HNVB 1LW2B 2ZE2B 3MR5A 4ZP6A 2HWHA 2HNDB 1IG9A 1QAIA 1TKZB 2AU0A 4J9NA 1HMVA 5DLGA 3VQ4A 2OZMA 2CKWA 3NGDA 3AVHA 3AVAA 3QO9B 4KHUA 2P5GA 4FJIA 5DQIA 4K8XA 4YR0A 1W0HA 3KLIA 4NCGA 3NL0A 1B9FA 4AH9A 1VRTB 3VQ7A 2D3UA 5KT2A 1JLAB 1RT5B 1IO2A 3SI6A 2NUBA 5L9XA 2XGPA 2C22A 4ID5B 4TY9A 3V4IA 3OYFA 4RW9A 3PUFA 3IG1A 4FM0A 4EZ9A 2R2SA 4N56A 1VSKA 2RDIA 5HRRA 3C6UA 3IS9B 1FK9B 4FCYA 4O3SA 3EYZA 1S97A 1K1SA 3AVLA 2IS3A 1DTTB 4LH5A 5J2MA 1RDRA 4WE1B 3TR8A 4DQRA 3GIMA 3PV8A 3ZSXA 5C5JA 1JLCA 3HPGA 2XCAA 4TXSA 4F4YA 4KHQA 1L3UA 4FZXC 1N48A 1KRPA 1WAFA 2R8JA 4TSXA 5KFSA 2GBZA 2GIRA 2HHSA 4NZ0A 3KJVB 3MXJA 4IG3B 2HAIA 3MEEB 1JLGA 3QGHA 1EETA 4URSA 1LV5A 4OL8A 3THVA 4RNNA 5C24A 3KK1A 2B6AA 4M3YA 1N4LA 2IGIA 4PUOA 2C28A 1GOAA 3K59A 1VSMA 4N41A 2HNYA 1GOBA 3BSOA 2JEJA 3RAXA 1N5YB 1NKEA 1HYSB 4CEDA 4J9RA 5K14A 2JEFA 4ZHRA 1B92A 5KFBA 3MFHA 1A5WA 3ISNC 1JLFB 4M3ZA 4L8RB 4DQPA 3NHGA 4DTOA 3ZCMA 2F8SA 1XR5A 3C6TA 1HMVB 5KT3A 3PZPA 3Q8PB 2ETJA 4N5SA 1T3NA 2YV0X 3TWHA 3KLIB 4KHNA 1W9HA 4O3QA 4NCGB 4DLGA 2F8EX 4DL5A 5DMRA 4HVJA 1YT3A 1S6PA 1RT1A 1U47A 1NK4A 1VSIA 1UWBA 1JIHA 4E19A 1XHZA 1S1XA 4OJRA 4BE2A 3V4IB 4RW9B 3SQ1A 3HJFA 3IG1B 2ATLA 3PX4A 1S9GA 4IQXA 3DRPA 3BSNA 4YQWA 3C94A 4CJ4A 3C6UB 4DQQA 3ITHA 1Z25A 5KG6A 4IBNA 1YTUA 1D5AA 5J2MB 3OL8A 4AHTA 4RUAA 4XIUA 1NJWA 1RTJA 1JLCB 3AA5X 4M3WA 3HP6A 2KQ2A 3LANA 4I2PA 3L2QA 2IJFA 3NMAA 4FK2A 4HYKA 2G8IA 1RYSA 4J2BA 4NLSA 5KT6A 1YVUA 4J2AA 1IH7A 3D0PA 1JLGB 3OL7A 3ZSWA 4FYDA 3OYAA 3RAQA 4I9LA 4O5BA 1EETB 3DRRA 4FBTA 4B08A 1BISA 4QWAA 5C24B 3KK1B 2B6AB 3O3HA 4ECWA 1SKWA 4OVLA 4PUOB 2R8KA 4KHMA 1IKWA 2G8VA 3H98A 4EBEA 2AQ4A 4LY7A 1HQEA 4DS4A 1EP4A 3MR6A 3EPGA 4XPEA 3SUQA 5K14B 1TKXA 3V1RA 1JXBA 4B8AB 3TAFA 3CG7A 4ZHRB 4MIBA 3DLGA 3SFGA 2XY8A 1XR6A 4F8RA 3KK2A 1YVFA 3TANA 3C6TB 1ZBHA 3G10A 4BE1A 1S0OA 3L8BA 1ASVA 2FBVA 3T1AA 2IAJA 4O4RA 4DL2A 3V9UA 4ED1A 2VWJA 5EDWA 4C8KA 4EZ6A 4DL3A 2D3ZA 4TQSA 4E3SA 3V6JA 1S6PB 1RT1B 3E01A 4QCLA 1Q9YA 4CF1A 4Y3CA 1UWBB 5KFJA 1VSDA 2RKIA 4CESA 2HHQA 1S1XB 2FLLA 3SQ2A 2D0AA 3AVJA 2WB4A 3CM6A 5CY4A 5L1KA 3KLVA 4DWIA 1ZBLA 1SH3A 1S9GB 4NLUA 3OYIA 4KV8A 3HXMA 1HYZA 3ITHB 3DLKA 4PA1A 4RNFA 3O3FA 2XY6A 3NKYA 3AVNA 1NK5A 3CDUA 2UVWA 4W5TA 4F4WA 3I5BA 4EYIB 1QUVA 1RTJB 1C1CA 4B9LA 5HRPA 5F9NA 2IOCA 4I2PB 2FLPA 4ZPCA 3TQ1A 2HNZA 4M45A 5CYMA 5C25A 2XWYA 2D5RA 1QE1A 4DFPA 4K4ZA 1JLEA 4JS5A 1SUQA 3LDSA 3DRRB 5F8MA 3L3VA 4J9PA 3KHLA 2XY7A 3D28A 2FVRA 1DTQA 3VQPA 4ZP8A 1IKWB 3CJ0A 4DTPA 1HQEB 3H08A 2BRKA 5KFMA 1EP4B 3NF6A 5F8JA 2B5JA 1RAJA 1NK9A 1TKXB 4KHRA 1NK7A 3ZSQA 4DMNA 3DLGB 3AO1A 4NYFA 4NLWA 2RDJA 1JL2A 3WNFA 4EYHB 4CHQA 4IH7A 3I8DA 4K50A 3KK2B 1EXQA 1D9FA 3LP1A 3NAEA 1NOYA 4ID1A 4O0IA 4LQ9A 4ECQA 2Z1GA 3VA3A 3TAPA 3VQDA 2IAJB 2HHUA 4JS4A 2YKMA 3H5YA 3CFOA 5HROA 5DG8A 2P51A 3D45A 3GILA 1XC9A 2YNFA 3L3UA 5KFKA 1UA0A 3GIKA 3E01B 1VSJA 4RW4A 4M3TA 2AX1A 3ALYA 4K8ZA 2RKIB 4IFYA 4FBUA 4RW7A 4CFCA 4LH4A 4NLXA 5DK5A 1MMLA 4DG1A 3SFUA 5J1EA 2BRLA 3PW4A 4IH5A 4RW8A 4KV8B 1HPZA 3DLKB 2ITGA 4F3OA 2IBKA 5CZ2A 3SUNA 1SKRA 4FJ8A 3ZSZA 5F8NA 1BL3A 3ICLA 5KFXA 2KZMA 1C1CB 2EC0A 1LW0A 3KHRA 1BI4A 4HTUA 4FM2A 1I39A 2HNZB 2UUWA 5CYMB 2E6MA 3V6DA 4LSLA 4O44A 5C25B 3OJUA 1UOCA 1VSHA 1QE1B 2FJWA 4K4YA 3KMSA 1KVCA 4MK9A 3OYCA 4FJ5A 1JLEB 3RMDA 3JSMA 1SUQB 2EX3A 4OGEA 4RNOA 2G8HA 3BSAA 1FKPA 1SKSA 3FQLA 3NF9A 3RRGA 1IKXA 5L1IA 1QQCA 1S5JA 4ZPBA 1DTQB 3NCIA 2P5OA 2HHVA 1RT5A 1SH2A 2HVHA 4G3IA 2AGPA 3VQ6A 2VG7A 4FS1A 2GC8A 2XCPA 4ELVA 2FVQA 4IR1A 2B5JB 1S10A 2W9BA 4F4KA 3CVKA 4H4OA 2KTQA 3K58A 4KB0A 3N6MA 4NLPA 2A1SA 4KPYA 3OVNA 4TYBA 3LP1B 4G1QA 2XC9A 3NH1A 3P1GA 1CXUA 1K1QA 3SZ2A 4QWCA 4ZVHA 2YKMB 1JLBA 3QZ8A 1WSEA 5HROB 3K5LA 2YNFB 3H4BA 1C6VA 5KFHA 4PWDA 3QERA 4RW4B 4YR2A 4UQGA 3LP3A 4IFYB 5DGBA 3NH0A 4RNMA 4RW7B 4E1NA 4FJXA 1JL1A 4DSEA 3PJWA 4DG1B 1TVRA 4CJWA 5J1EB 4WZMA 4RU9A 3SQ4A 4RW8B 4OKEA 3K5MA 4CEOA 1HPZB 4OKKA 2O4IA 3H5XA 3OS0A 1S1UA 3GQCA 4QOZB 1HARA 2LSNA 3OYNA 1RDCA 4H8KA 2G8KA 4CFBA 4O55A 3I0SA 2RF2A 2R2UA 3IRXA 4B9UA 4FJKA 2HVIA 1O1WA 3DDKA 4KHSA 1LW0B 1BI4B 1XHXA 2W9AA 2BGGA 1TP7A 3SI8A 2FVPA 3EZUA 3QZ7A 2KZZA 3V6DB 4LSLB 5DG9A 4O44B 5KTQA 2XGQA 4F4ZA 5DG7A 1KVAA 4JV2A 4CIEA 3JSMB 5KFRA 5EWGA 1FKPB 4HUEA 2ZQBA 1QHTA 4H54A 2XY5A 1IKXB 2WTFA 1ZBIA 5KFAA 3VQEA 4DL6A 2X6NA 4XO0A 2FVSA 3KLEA 2IJNA 3BSCA 1QTMA 4CCHA 1WN7A 1T7PA 5DQHA 2VG7B 3ISND 2FJVA 4C8OA 4ELUA 4XPCA 1WNEA 2D0BA 3OYEA 3B6OA 2W9BB 2JEIA 4H4OB 1L5UA 3PX6A 2KFNA 1DLOA 1RA6A 1JXEA 4M95A 4CGJA 2QKKA 4DSLA 2JLEA 3LZJA 3T3FA 3CWJA 1KHVA 5T7BA 4J9OA 2BQRA 4E89A 3RBDA 2YNGA 4BDPA 1RNHA 4RG8A 4G1QB 4W5RA 4B9MA 3HK2A 1KLMA 4CJRA 4K4UA 3S3NA 3DMJA 2R2TA 1D1UA 2XI3A 2D41A 2E6LA 1JKHA 4CF8A 4CHPA 1JLBB 4E7KA 3RBEA 4IH6A 4ED8A 2Z1HA 1REVA 4DTXA 1CXQA 2HB5A 4PWDB 1XI1A 2ILYA 3AA3A 5L1JA 5KFFA 4MH8A 1LAVA 2Z1JA 2BQ3A 4AILC 2W9CA 2IDOA 1TVRB 2I1RA 4Y2AA 1W25A 1WSFA 1FXXA 5JS2A 4HUFA 4N76A 2ASLA 4YR3A 3G6VA 1S1UB 3PJXA 4MFBA 3PO4A 4TYAA 5J2QA 1NK8A 1LWFA 3I0SB 2RF2B 3IRXB 5I3UA 3QEWA 4Z4GA 1TV6A 1BIZA 3UR0A 2QKBA 4I2QA 3G6XA 4Z4EA 3DRSA 3V9WA 4NRUA 4KRFA 4CF2A 3QESA 1T05A 3UIQA 2OPRA 5D3GA 3SQ0A 3PW7A 3O4NA 3FFIA 5KFQA 3A2FA 4B3OA 5EU7A 3AO3A 3KLHA 2QE5A 2ASDA 2WONA 5KFEA 3UDLA 4R8UA 5EWFA 3KHGA 3ZT4A 4CJUA 4Y1CA 3KLEB 3SV4A 2X78A 4KFBA 3MR2A 3S3OA 4WXWA 4QWDA 3S9HA 1RTHA 4I7FA 1VSEA 4U6PA 5DGAA 4Q45A 1DLOB 3RMCA 3RWUA 1J5OA 1NK6A 2UVRA 1ZYQA 3IN5A 5HLFA 3CO9A 4H4MA 2AGOA 5F8IA 4O4GA 2YNGB 4BWMA 1NOZA 4MK7A 2FBTA 1KLMB 3U3YA 1LAWA 5KG5A 1C2PA 3DMJB 2YHBA 2IC3A 1JKHB 4AHSA 4IRCA 4FJ7A 4K4XA 1RA7A 4DQIA 1S1WA 1REVB 2YKNA 5SZTA 1VRUA 3NBPA 4IRKA 3KTQA 5KRSA 3HP9A 4ECSA 5JUMA 1J54A 1S0NA 3EY1A 2V9WA 1WAJA 3KKRA 4KREA 5FRNA 2W9CB 3BGRA 2OPQA 2X6SA 5KG7A 2I5JA 5KFNA 4ECZA 5KFVA 4FM1A 4K4TA 4IKAA 1S1VA 4MFBB 1BIUA 3V6KA 5J2QB 3QGIA 3MF5A 1LWFB 3TAEA 5I3UB 1S0MA 1TV6B 3MEDA 5FROA 4I2QB 4JV0A 4RZRA 4QW8A 4OPJA 1CSJA 3DRSB 4R5PA 1RBSA 1T05B 2OPRB 5D3GB 1NK0A 2HHTA 4FLZA 3H2LA 3HVAA 4O3OA 3FFIB 4NLQA 1KSPA 2HMIA 4B3OB 3KLHB 4NLOA 4CHNA 2WONB 4IDKA 3D5MA 1BHLA 4R8UB 3E51A 1BCOA 4JRQA 3CDEA 4DL4A 4KBIA 2OPPA 1CZ9A 4KFBB 4MIAA 3N6LA 4ZTJA 3LALA 3VQAA 4TLRA 5KI6A 4DU3A 5L1LA 2J6UA 3MXIA 2FBXA 3FQKA 1RTHB 4I7FB 1NHUA 4CGDA 1S48A 1J5OB 1ITGA 3QIPA 1T8EA 1S9EA 4FZYA 1TKTA 3DOLA 5HLFB 2XO7A 4NCBA 1KTQA 4H4MB 1X1PA 4O4GB 3K5NA 4KTQA 5KFYA 3V81A 4RW6A 1RBRA 4JV1A 3VQQA 1RILA 2G8WA 3SJJA 3ZSYA 2XI2A 3FRZA 2JGUA 3OYDA 1TL1A 2IC3B 3GIJA 4KHYA 4OPKA 1S49A 2WCXA 2J6TA 4DTUA 3RTVA 1D9DA 3VN5A 3NGIA 1S1WB 2YKNB 3HYFA 1ZETA 1VRUB 3NBPB 4C8MA 1GOCA 3QLHA 2BDPA 4M41A 4KTZA 4CJTA 1L3TA 4CEQA 3HO1A 3Q8RB 3H40A 4JRPA 3M9MB 3ASMA 3HKWA 4J2DA 3BGRB 4ZVFA 2OPQB 2FLNA 1T03A 3TABA 2I5JB 2UVUA 3HVWA 4DSIA 2VG5A 3PX0A 1QSLA 2RN2A 1S4FA 3VQBA 1S1VB 4BACA 5FDLA 1K6YA 1KFDA 3NAHA 2Z1IA 4Z4CA 3S3MA 4CE9A 5F8HA 4N47A 4KB7A 2XRIA 2W7OA 3MEDB 2GIQA 3BQ2A 3AVBA 3TI0A 3DM2A 3M8SA 3LWMA 4R5PB 3CFRA 3MEGA 2C2DA 3PW2A 3RR8A 4DEZA 2FC0A 1R0AA 3V1QA 4CGGA 2R2RA 2HMIB 5KFUA 2WRMA 1TK5A 1SL0A 4IDKB 4CF0A 3I0RA 3BQ1A 1CLQA 1RT3A 2VA3A 1RT7A 3WNEA 3NE6A 2AWZA 2OPPB 4YNQA 4CFDA 2OA8A 4ZP7A 2R8GA 4WZQA 1S6QA 3NF8A 4B9TA 3PO5A 3LAMA 3M8QA 2BANA 4FLYA 4M3XA 4CHOA 5KFZA 2Y1IA 5KG0A 3G6YA 2W8KA 4JUZA 3AO5A 1NJYA 5KT7A 3K2PA 4CJFA 4X2BA 4CEEA 4KO0A 3OLAA 4KAIA 1F21A 4CJ5A 3HVTA 3QIPB 1S9EB 4M42A 1TKTB 3DOLB 4DSFA 1Z4UA 1D8YA 3RB0A 3M8PA 4J9SA 2ALZA 4ECUA 3V81B 4RW6B 3KLGA 1HNIA 3QETA 1JXLA 2PZSA 1HRHA 4HHTA 3AVIA 4OKJA 2EHGA 4NLRA 2DTUA 1TL1B 1U4BA 4DTRA 3PW5A 4W5NA 4QPXA 3BQ0A 4W5QA 4OLAA 3H59A 1RBTA 3QLHB 1HYVA 1SL2A 1TKDA 2KFZA 2C2EA 3O4QA 3ZT3A 3OJSA 4Z4FA 1RYRA 3LP0A 4J9QA 2R7YA 4EP5A 4B9VA 4CIGA 1T03B 4HKQA 1HJRA 1N6QA 4CEBA 4M3UA 3QEXA 1WSGA 2VG5B 3VQ8A 3RMAA 4ECVA 4CJLA 5FDLB 2DFEA 3VA0A 3KLFA 1Q9XA 5KFLA 3LPTA 2PYLA 1TQLA 4K4SA 3QEPA 2GV9A 2FJXA 4QWBA 3BREA 1KCFA 3DM2B 3MEGB 1NJXA 1RDBA 2HW3A 3SUOA 3H4DA 5C42A 1UA1A 1R0AB 4CEAA 3BJYA 4DS5A 3T5KA 4Z4HA 4DF8A 4HUGA 3QIOA 3I0RB 2JEGA 4NLDA 1QSYA 1BQMA 5F8GA 3SUPA 1RT3B 2E9RX 1RT7B 3MAQA 2BE2A 2FBYA 2G8FA 1G15A 5KGWA 4EO6A 3CJ3A 4EBCA 1X9MA 5KG1A 1S6QB 4GW6A 3NGZA 3M8QB 2BANB 4ZVGA 1U09A 4BE0A 3KKSA 2Y1JA 4KO0B 5HP1A 3HVTB 4GC7A 1C1BA 4OGCA 3M8PB 1U48A 1ZBUA 1L3VA 2DPIA 4FJHA 3KLGB 1HNIB 3LPUA 2QV6A 3QEVA 3GV5B 2DFHA 2J6SA 3I5AA 2PY5A 3OYHA 2OH2A 3NFAA 5J2NA 5KFGA 3ULDA 1YTAA 4FZZA 4F2SA 4JLHA 2KW4A 4Q5VA 3M8RA 1QSSA 2IM3A 4CJEA 4DSJA 1RDDA 4FVMA 3MECA 1C0UA 5KGXA 2VG6A 1SH0A 5F8LA 3PR4A 4Q0BA 5KT4A 4QW9A 1OS5A 3HL8A 3LP0B 4FK0A 2HHWA 1WSIA 3LZIA 3OLBA 1N6QB 1Q8IA 4ECXA 3CJ4A 5KG2A 3IGVA 2XHBA 4O3PA 1X9WA 2R8HA 4IRDA 3O3GA 4PY5A 3KLFB 3V1OA 3KIOA 1LWCA 3RMBA 1RCHA 3P5JA 2Q3SA 4OLBA 5JXSA 4B9NA 4O3RA 5J2PA 1NNDA 4Q44A 3QINA 3C95A 2F96A 2ASJA 2B4JA 1IM4A 4ED6A 5C42B 1KHWA 4M94A 2V4QA 3GV8B 2BR0A 3I5CA 4FW2A 3T5JA 4M3RA 4ECYA 3CDWA 4ED0A 3OYGA 1BQMB 4YP3A 3OYKA 2BE2B 2AGQA 1IKVA 4ZPDA 4E7LA 5HRSA 4WXOA 1C0MA 4ZTFA 3RRHA 2R8IA 5HP1B 3NGYA 3OHAA 1C1AA 4EP4A 3MXMA 3LWLA 1C1BB 3H5SA 1L3SA 4CIFA 1RTDA 4K4VA 3GV7B 4YMEA 4FW1A 4R0EA 3VQ5A 1RDAA 4ZP9A 4FLXA 4HCBA 4Q8EA 1TK8A 2HWIA 3L2UA 2D0CA 3AO4A 4FJJA 5J2NB 4ZPAA 4E7HA 2ZKUA 4CK1A 4ECTA 3K57A 4DTNA 1TAUA 4NYNA 5HBMA 3MECB 3DLRA 3ZT1A 1C0UB 2VG6B 2O4GA 1C0TA 4CJQA 4Q0BB 3AV9A 3RB3A 4NLYA 1TGOA 4J9KA 3HHKA 1WSJA 1TK0A 3QYYA 2WK4A 1FKOA 3P83D 4O3NA 3IGNA 2IM2A 3Q8SB 4GVMA 3T5LA 3U3GA 4CK2A 5HRNA 4ECRA 3KOAA 1EKEA 4RNHA 4EO8A 1LWCB 2W8LA 4B9SA 2IM1A 1U04A 1I6JA 3F73A 3SPZA 3DLEA 5J2PB 2P1JA 4ED3A 3TAMA 4Y34A 3L2RA 4RUCA 2C2RA 4KE5A 3AVCA 3ZT2A 3RB6A 5KFOA 4CGFA 4MQ3A 3M9OB 3H5UA 1ASWA 4Y2CA 4CF9A 4F4XA 3OYJA 3AVKA 1IKVB 1D0EA 4F50A 1A5XA 2YNHA 1WSHA 1Z26A 3T19A 4URGA 4CECA 1KVBA 4KAZA 3OS2A 3HPOA 4ED2A 3KD5E 3AVGA 2E4LA 2DFFA 4DU4A 1EX4A 4ZVEA 3SYZA 3KNAA 1J53A 4TY8A 3VQCA 3L2WA 5KFCA 1RTDB 4FJ9A 1RT6A 4ICLA 3KMQA 3OSNA 2HNYB 3GYNA 2VA2A 4O0JA 3AO2A 4LD0A 1ZBFA 3VQ9A 4DFMA 1BQNA 3NDKA 4DSKA 1VSFA 1WLJA 4AHUA 4DTMA 2V4RA 4URQU 4U7CA 4CK3A 4E1MA 3SPYA 3HM9A 1J9AA 3QIDA 3V9ZA 1S1TA 5HBMB 3NAIA 4KI6A 4BWJA 2DY4A 1I3AA 4AHCA 1C0TB 2FVCA 1SL1A 3DOKA 3QNNA 1TL3A 2OPSA 1RTIA 2ILZA 3AVMA 4KSEB 4LSNA 1NHVA 1KFSA 4KI4A 1FKOB 4CJ3A 4IFVA 3PR5B 3PY8A
chains in the Genus database with same CATH superfamily
3TARA 2EG2A 2ZDOA 4QR0A 2QL9B 4KTWA 3KK3A 5CZXA 3KJFB 3W7BA 4DV6K 1NGDA 4DBQA 3EE8A 4AT1B 2V51B 4ANCA 4IO9Q 1Y97A 3MCNA 4WYBA 2G9OA 1MU2A 4FJNA 5IV3A 3QGGA 2QA4G 3AD7C 1RGVA 2DR6A 4CWBA 4OYPA 2V2VA 3PHEA 1RABB 2QK9A 3Q8UA 3DOMA 2KXFA 1HLWA 2DR5A 2OCEA 4UOHA 1HR0K 2PFFB 2DPJA 2V0NA 4NXNJ 1DBDA 2ZH9A 1W2IA 5EUHA 1U2VB 1XWLA 3IUCA 1HNZK 3TEGA 1BUPA 4J2EA 1Y7PA 2J9CA 1RK8A 4ELTA 2RUSA 4BLGA 4TY8B 2HK3A 2UUCF 2RPIA 1FA0A 1G99A 1D8ZA 2J7WA 5G4DA 1DFDA 1KC8T 2IA6A 4CJPA 1YI2S 4V1Ak 5DO2A 3TAGA 1BA1A 2UUBJ 4X4RA 3DDNA 4KHWA 1HW8A 3TUZC 3H3OB 2RS2A 1ZTWA 2MQLA 2Q36A 2B43A 5CZ1A 3JXUA 2E5LF 1VK0A 4FJGA 2MZQA 1IWAA 4LSNB 2QT7A 3L4QA 1VQON 4IFVB 2BYCA 5L46A 4CEZA 3JYTB 2YY3A 4B3RF 2HAFA 2V2KA 3MD1A 4LRFA 3CULA 3OTOK 1OH6A 2RRNA 1BMQB 1R43A 3ZSOA 1HQUB 2CQ3A 3OYLA 1U6BA 2G13A 2GNKA 1X4HA 4CJVA 4CLFA 4MKAA 2N4CA 4QWEA 1JLQA 3UNGC 1UW4A 3FDSA 4UY85 4KH6A 1FJGJ 4AL6A 4E7JA 3BPSP 3MPYA 3OVSA 3AA2A 5KFWA 1HNVA 2PC6A 2ZE2A 2E1AA 4CLSA 4O23A 4YOXA 2HNDA 4H5NA 2OEJA 2CYYA 2HFZA 3C0BA 3N6NA 3I31A 3R2CJ 1RU2A 1ZTTA 2CPJA 1WNSA 3THPA 2LU2A 2B4VA 3UDVA 3A0IX 4FJLA 3QWPA 5F41A 3A8KA 4JI2J 4P75A 1BG3A 2NXCA 3PHTA 3MTKA 3ZX2A 2UUBK 1R6VA 2B4UA 5LM7E 4NLGA 1BOTO 3TX0A 7FD1A 1OYEA 4UW2A 1PJ6A 5IZHA 3VAHA 2G8UA 4BR2A 4HHHA 2EK6A 3CQ8A 2BABA 5DQGA 4WE1A 3OY9A 4DHYA 4C8LA 1M1HA 5I42B 5ETPA 3K0JA 1RT4B 3QMLA 4JHDB 3ZNJ1 1GTHA 3EZWA 2VKRA 1VRQC 1IBLF 2R9LA 1YIJS 2Z2LA 3V2UC 1U1QA 1GLLO 4JV5F 4GY2B 5KT5A 2BOPA 3HVRA 4E0DA 1WG5A 2P5VA 4DR3J 2VWKA 4JKHA 1BLUA 1GLFO 2M4MA 3T1YJ 1QVGM 3ENWA 4CGHA 4FK4A 1IKYB 1FJGK 4FLUA 2W6KA 3VWSA 1RAEB 1HYSA 1KWMA 2Z30B 3L4IA 3PRBA 4YB6A 4DV2J 4DTJA 1JLFA 3Q7BA 3MFIA 4ZMMA 3CJSA 3FC9A 3IAM9 1CEZA 1FNXH 2BJDA 2OTJS 5MLCV 1IG9A 2P9SB 3ZYYX 4J9NA 2OZMA 5DLGA 3G9CA 5GAEP 4XH4A 4K8XA 1SC3B 2E20A 4JI2K 3KLIA 4NLCA 5GIOA 5D0RA 1SCJB 1ZH5A 5M1QA 4ALZA 1VRTB 3HFZB 2D3UA 4PWWA 4U8VA 3P5BP 5L9XA 2C22A 2V8HA 1T95A 3PUFA 4ILRA 3QGPA 4N56A 4WFBQ 1VSKA 1GMWA 4A57A 4FCYA 1FK9B 1N8RT 1DTTB 5BYRA 1BU6O 3U1LA 5C5JA 4KHQA 4TXSA 2AJFE 1L3UA 1KRPA 2YQ3A 2A0FB 2GIRA 5AE1A 2O8BA 1RTZA 4CO1A 2RQKA 1JLGA 4HHUA 5C7PA 5BPLA 4DR3K 3P6YC 2FGCA 4DN9A 3NWGA 4PL7A 3T1YK 4OL8A 5D4LA 3THVA 4RNNA 3KK1A 2B6AA 1KQSM 3K59A 2V7ZA 4CYUA 3AXKA 4M5MA 4M7XA 2ZBRA 2JEJA 1N5YB 2KYZA 4OJ3A 5KFBA 3CO0P 3H90A 2NLWA 1N5QA 2CADA 4M3ZA 1VQPS 2DRDA 2ZJRL 1HNWF 4CZJA 1Y4ZB 2AP6A 2GQ2A 3ZCMA 3I9V9 1HMVB 1V4TA 4IFEA 3PZPA 1H6KX 4YB7A 1NSQA 3DXBA 3R1XA 1R8AA 4DLGA 2D69A 2F8EX 1S4EA 4NX9A 1YT3A 1R6YA 2GMLA 3VEVA 1VSIA 2ZH7A 4WQ5A 1YDLA 3ZNUA 1XHZA 3G71S 4CLTA 4OJRA 3UD5A 1R89A 4BRDA 2E7WA 4RW9B 2CQHA 3C6UB 4DQQA 5F0XA 2V4JB 2E5GA 3AJ2A 4IBNA 1VQ9S 4HHJA 3OL8A 4AHTA 2BM0A 1VYAA 1RTJA 3AA5X 1AT1B 4NLBA 2IJFA 4CM0A 2G8IA 4NLSA 2RRBA 1NEEA 4FWQA 2ZM6J 3OL7A 2PEHA 3BY5A 1KKHA 4I9LA 5E3RA 4O5BA 3FLCO 3HFVA 3W3DA 3O3HA 1IKWA 2DNGA 1YHQN 3UFCX 2R7OA 1N0UA 1HQEA 2A5XA 2HK2A 5K14B 4DPYA 4KYZA 3CG7A 3FKBA 4K0KJ 2QWNA 1XR6A 3HZ6A 5E26A 2KKZA 1YJNS 3HM8A 1WTBA 1S0OA 1GLCG 5LJWA 3L8BA 2A2DA 1KVIA 3HD1A 3T1AA 3CB4A 4DL2A 4EZ6A 2D3ZA 4DOZA 2ZOGA 5F3TA 3D6RA 1MROA 2ERRA 3U7JA 3KJQB 1QM9A 2DRBA 1SAZA 3ZX3A 2OGUA 5K8PA 1TUVA 4A61A 2HHQA 1T3OA 2XS5A 1P6TA 3SQ2A 1RDWX 2V2QA 2UU9F 2D0AA 5CY4A 5KPTA 5L1KA 4DWIA 3CETA 4MKYA 1AXQA 3R5JB 1J6ZA 1P9QC 3CUNA 3MM7A 1HYZA 3NVMA 3DLKA 3QMQA 5B0DA 3DN9A 1HBUA 3O3FA 3GR1A 2XY6A 4JI7J 2DH8A 2R7SA 4BC7A 1X4CA 1CVJA 2QEXS 1NB2A 3W2VA 5F9NA 2FLPA 3IFRA 4ZPCA 5HL7L 2ZM6K 1E6VA 3T7ZA 3KZBA 3OFFA 4ISEA 1QE1A 4DFPA 4CLKA 3LDSA 4KHPF 5DM6L 2DGVA 2VBZA 2L9NA 3BEGB 3D28A 1T9XA 5AT1B 2F65A 2BJ8A 4JD2A 1RBLA 1MWZA 4AYBD 4ZP8A 2D74B 4ILJA 4DPXA 3UO0A 3NF6A 5F8JA 2F4VF 1NK9A 1FF2A 3LOUA 3F9MA 5D0GA 2VU5A 4WCEQ 4K50A 1EXQA 1D9FA 3S6EA 3UVJB 3WXJA 3VVTA 1NOYA 4CZEA 4MYUA 1W7WA 4LQ9A 4FKXA 4JS4A 1XQSC 2CPHA 3H5YA 3QAEA 5IXUA 4JKAA 3JS6A 5JVHQ 4M5DB 4PCQA 3GIKA 1IG8A 5D78A 4K8ZA 2K7JA 1C4AA 4FN5A 4DUZJ 1FX2A 3EEQA 5DM7L 2R7VA 4U8YA 1MMLA 4DG1A 3FSYA 3M4XA 5HJXA 4B9QA 3PW4A 4RW8A 2P9IA 1AA1B 4JI7K 3OXLA 3QFPA 1WI8A 1SKRA 1WHVA 4YY3J 3M8WA 5F8NA 2ZEJA 3ADAC 2KZMA 3D1OA 1IBMK 2VZ9A 1OYDA 4C11A 2CJBA 1LW0A 3KHRA 4HTUA 5K5MA 5GVQA 4FM2A 3E2EA 5AZIB 3V6DA 2ROPA 2FSNA 4MK9A 3RMDA 3JSMA 1SUQB 3SAHA 3QFHA 4DV5J 2NRRA 2MQQA 1FKPA 1KQFB 3NF9A 5L1IA 4Y65A 1S5JA 4C23A 4ZPBA 3NCIA 4OPHA 1VQ7S 2HVHA 3SMZA 3IWNC 1BA0A 2B0GA 4IR1A 1YJRA 2B5JB 1FVSA 3CJKB 2CH6A 5DS7A 2W9BA 1L3KA 4PEOA 4E98A 3N6MA 2A1SA 3QT6A 4H03B 1U1NA 6AT1B 3OXGA 2CDRB 4K7QA 3OBWA 4G1QA 2XC9A 3NH1A 2HSTA 3P1GA 4Q2LA 3ISZA 4CRJA 4IOCL 2GA7A 3QZ8A 1WSEA 3BGLA 3VV2B 3R9PA 1FCAA 5KAKA 1P9YA 2VDIA 4XDDA 4DUZK 1UW9A 5KFHA 3HFKA 3I8BA 3MCSA 1FJ7A 4RW4B 5LMNF 3MDQA 5DGBA 1Q8LA 2HQFA 4FJXA 3JAMO 3Q2TC 3SMSA 1VK3A 1WF0A 1XMOJ 4G1IA 3K5MA 4KJIA 4CEOA 1DQAA 2O4IA 3OS0A 3W9HA 1S1UA 1W2BM 1RDCA 1KD1O 2XWXA 2WVBA 2RF2A 4B9UA 2XSFA 2HVIA 1O1WA 2VFVA 1BI4B 1E4FT 2K7KA 2W9AA 2FVPA 2PO4A 3VGKA 3QZ7A 1KQGB 3TX8A 1N5TA 2O3DA 2XGQA 3Q23A 2ZITA 3QQCD 5DG7A 4DV5K 3X1LB 4ATNA 2EVZA 2D9OA 4WP3A 4LF6J 1DARA 2F1FA 1N36F 1QHTA 1IKXB 3NY0A 2VICA 5KFAA 3KLEA 4DJBA 4CCHA 5LJVA 4DR2F 3NNAA 2E8AA 3SBTA 2OLWA 1Q0NA 4XPCA 4ZVUB 2ITMA 5LL6d 3AH6A 2J0SD 3B6OA 2PMZD 1NB7A 2DHXA 2J8AA 3ZEUA 3HCXA 3SSRA 4DSLA 3N28A 1ATSA 3CWJA 1WUAA 4EIAA 2NZCA 4BDPA 3GYXB 3OV7A 4RG8A 3GL1A 5ETOA 3QICA 3VZHA 5L9NA 1GK8A 4N77A 2QL5B 4CP5A 1F9FA 4CJRA 4K4UA 3TJAA 3DMJA 2R2TA 2JWLA 3A5LC 2DHAA 2OFGX 4LF8J 4LBPA 3U9DA 1JLBB 3D67A 2Z1HA 2BOAA 1YXQA 4DTXA 2QFIA 3PFEA 2AYBA 2HB5A 4PWDB 1NSKL 2ILYA 3TSUA 1XMOK 3R6LB 2GQQA 2QN6B 3QDKA 1TVRB 4Y2AA 3J7ZT 3TJ8A 1WSFA 3J7YI 4LR7A 2G1DA 3OFEA 1WF2A 4OO1J 5M1KA 2ASLA 3G6VA 1G3OA 1WOSA 1HWIA 3CJBA 3QFWA 3GFXA 1NU0A 5C2GA 4DR4J 3D6HB 2DIUA 2QKBA 4I2QA 3G6XA 1FJCA 1T6CA 3KNGA 5A6WA 4DV1J 4NRUA 4DX6A 2UXDJ 4FPAA 5D3GA 3SQ0A 4B3OA 2BACA 5CXTA 5EU7A 3EDRB 5HMWA 2MY8A 3MOJB 2DPNA 3UDLA 1SQGA 4R8UA 2XYPB 5LXRA 2CQBA 4CJUA 4X84A 1IR0A 2X78A 2HFSA 4I0WA 3A8JA 4ISGA 4J7CA 2ZNZA 3S3OA 3THXA 1SQKA 4CO5A 2B3TB 2E66A 3W64A 4TU8A 1PO6A 1DLOB 2MKCA 2OMOA 2MHNA 2OSRA 3BN4A 3QRRA 3IN5A 4USIA 2AGOA 3OVAA 3MHYA 4O4GA 2YNGB 4BWMA 2QW9A 2FBTA 1X5TA 1S3XA 4LF8K 2RQMA 4JN4A 2CQ1A 3VAIA 5M2UA 1JKHB 1Q82T 2BH1A 1S1WA 3A3NB 3TUJC 3NBPA 3KTQA 2HFNA 5F2RA 4OV1A 1Y9OA 3C15B 4F0HA 3G8QA 1S0NA 2I6WA 3VEXA 2V9WA 4KREA 3BGRA 5A6PA 2UUCJ 3K9JA 4P52A 3R8YA 2X6SA 4ECZA 4K4TA 1X0FA 1RGIA 1S1VA 4MFBB 5LMUF 3V6KA 4DR4K 1FNMA 4OZNA 3MF5A 2RS8A 2X1AA 1S0MA 3MEDA 2UXDK 4DPOA 5AXKA 5AXNA 3AGKA 1RBSA 1H2VZ 2HHTA 2V52B 5AR0A 4FLZA 3H2LA 2E5LJ 3WEEB 1D09B 4WJBA 1KSPA 3MURP 2HMIA 3M6GA 3A3PB 3OFGA 4I6MB 3F0NA 3D5MA 4ES3A 3SCLE 1UJ5A 2Y8YA 3R9LA 3VQAA 1P8GA 4CD1A 4HACB 4LBHA 5L1LA 3CCEN 4OHWA 3CD7A 1S99A 1VBZA 1S48A 3EXYA 2O8EA 3MPVA 3CIPA 1TKTA 4ZLPA 4NCBA 4XH1A 5K8MA 3K5NA 4DL0C 5KFYA 1RWXB 4RW6A 1TUGB 1FDDA 3MXHP 3I87A 2XI2A 4N8NA 5IT9U 1TL1A 2IC3B 3C6HA 4OPKA 1WC4A 2WCXA 3M30B 1J2VA 2CJKA 3CCJS 4DTUA 1WG1A 5AXMA 3VN5A 2MGZB 5T7LB 1YRXA 1VRUB 2XG8A 3EJMA 2W2NP 4OI0A 1KN6A 2U1AA 2UUCK 5J1NA 4BREA 4JRPA 2EFOA 3C2PA 1CPZA 4ZVFA 2FHKA 1AW0A 1JJ2R 3CF5L 1O13A 4EHUA 2FLNA 3CXCR 4WF9L 3VALA 2I5JB 4DSIA 1R8BA 3VQBA 1K6YA 3NAHA 2O8DA 3ULEB 4N47A 1U7LA 1Y5IB 2V2ZA 4Y00A 2IBOA 1RHJB 1UVIA 2I7PA 4AUKA 2MY7A 3TI0A 2BE7D 2E5LK 3LWMA 2AIRB 3PW2A 1ZAWA 3R27A 1U1MA 3RSEB 3BZCA 3D3CJ 1TK5A 2A6OA 4UT4A 4IDKB 4A8OA 2VA3A 1RT7A 4USVA 1IBLJ 3WNEA 1SB6A 4DQ8A 2OA8A 2E7VA 3NF8A 2DNRA 5HATA 4PL8A 4B9TA 4GKKF 2MLXA 4OV6A 4DI6A 2BANA 4K5RA 3LF0A 3R5CA 3R5GA 4MKVA 4X2BA 4CEEA 3POTB 2LQ8A 4KAIA 3QIPB 3DOLB 4DSFA 1Z4UA 4IYQA 2VUGA 2ALZA 4LF5F 4RUBA 2PD1A 4A8FA 4HHTA 4OKJA 3KWGA 2EHGA 4NLRA 1UEKA 3BBBA 2DTUA 4QYRA 2XS7A 4K2XA 2BMBA 2NRTA 2XEXA 3BQ0A 4USHA 4H5WA 4W5QA 1FESA 5EX0A 1V9OA 3H59A 1RBTA 3QLHB 3M6WA 1DKGD 1HYVA 3TU5A 4XTTA 3BF3A 4QQBA 3O4QA 3ZT3A 3B82A 1UTAA 2X51A 3CPWM 2KT5A 3OJSA 1R0CB 4J9QA 3MD3A 3TUIC 4CIGA 1T03B 2DGSA 4CTAB 1WSGA 2VG5B 3VQ8A 3L7UA 3P3DA 4ZVTB 2DFEA 4MLEA 3UB5A 4F0MA 4HDHA 3LPTA 2F7TA 3G2XA 2FJXA 5AQVA 2DH9A 1ZAXA 3DM2B 2I0XA 2HW3A 1HIYA 5IS2A 4H5VA 1UA1A 1R0AB 1KQKA 1UEVA 1IBLK 4DF8A 4HUGA 1VCTA 3BGFA 5F8GA 3GCWP 5HI7A 3WX8A 2LECA 1G15A 5HAOA 5IV4A 4EBCA 4BVOA 3ENQA 5EX3A 4ZVGA 3CMQA 4BE0A 1BXNA 1YI2N 3HHLD 5CE3A 2Y1JA 4KO0B 3BYPA 4TVAB 3HVTB 1GLAG 2C3UA 4GC7A 3LA0A 3M8PB 5IOLA 1L3VA 3FBCA 3O2IA 3THYB 4ITSA 3W3SA 4FJHA 2DNKA 3KLGB 1HNIB 2QI2A 2O01C 3FGUA 4RR5A 1XNQF 5THWA 4CO4A 4BR9A 3CCLN 2OH2A 2NUUG 4P2SA 3ULDA 1WF1A 2YH0A 2GGPA 3OTDA 2GVZB 2IM3A 1RDDA 4X4UA 1GNKA 3BEXA 4NI2A 3PR4A 5KT4A 3CE8A 1OS5A 3I56S 4RX6A 1K8KA 3LP0B 3HL8A 4OHYA 1HBNB 4NOHA 2VB6A 3D2WA 3P31A 4K42A 2EFQA 3IGVA 1RBOB 4IRDA 3V5RA 4DV3F 4JI4F 2KU7A 3SSSA 1NM2A 3RMBA 3HZGA 2VIHA 1RCHA 2Q3SA 2OHDA 4DPWA 5A0YB 1SKUB 1LKZA 3N79A 3C95A 2QO3A 5A8WA 2F96A 3MWPA 2GELA 3IC1A 5K20B 1KHWA 2WBNA 3I5CA 4CNZA 5I3QA 3DLJA 3T5JA 1YJ7A 2H5IB 4ECYA 2Y9HA 2PFDA 2I9SA 4DR1F 4P2FA 4ZPDA 3U27A 4E7LA 4WXOA 4CQ1A 3R2DJ 3ZETA 4ZTFA 4C0HA 3B78A 2ZH5A 2H65B 4BRQA 3VEWA 3NGYA 1C1AA 2MHEA 4CBXA 4ZCLA 1TUYA 4BC3A 3H5SA 1Q78A 1LCUA 1SI9A 4YHHF 1RTDA 4CIFA 4K4VA 5JVGL 2XM3A 5HN0A 3VQ5A 4I67A 2DISA 1HNWK 3NG8A 2JHEA 3CJAA 1Y00A 1M5VC 2VQFF 5ETQA 4ZPAA 4DV0J 2XO6A 1TELA 3BR8A 1YIJN 1S7HA 4ECTA 3TZWA 3K57A 4DTNA 1YAGA 4AQYF 3AGRA 3VTIA 5HBMA 2WUSA 4K2JA 2JFDA 1C0UB 1DAXA 4Q0BB 3KXDA 5FPEA 3AV9A 3RB3A 1TGOA 5MAOA 2GHVC 3HHKA 1FKOA 4ETXA 3Q7CA 3M2RA 2VH7A 2IM2A 1VIXA 2X1BA 3E1YA 2MKJA 2UU9J 3OTEA 1GAOA 2WBRA 1NLVA 4LUBA 2E29A 4RNHA 2I8EA 1LWCB 5AZJB 4PYDA 2IM1A 2BW7A 1NZ8A 3CCVN 3BKFA 2C3YA 3SPZA 2XMMA 4X4QA 5J2PB 5A76A 2FZCB 4Y0WA 3Q89A 3QATA 2XNRA 2OTJN 3MMBB 4Y34A 1VJWA 4PG7A 4MMOA 1F2HA 3QJJA 2Z2ZA 2C2RA 1JQGA 3NMRA 5HMXA 3VOVA 3RB6A 2UUAF 3EKUA 1HX1A 3V4MA 3PIPL 1FVQA 1AFIA 4EFHA 4CT8A 4C97A 1SJFA 3MTJA 3EZOA 4YEAA 4CLLA 3C14A 1P1TA 4F50A 1A5XA 4KAZA 1TU0B 3HPOA 4ERDA 4ED2A 5BJRA 3OS2A 5HO4A 2GAHC 4CLWA 2AYGA 3AVGA 1G4CA 2C2KB 1EX4A 4ZVEA 4LFAF 3M32B 3KNAA 4PXEA 1RT6A 3G82A 5FLXO 3OSNA 1JJHA 3VQ9A 4DV0K 2VFTA 1BQNA 4M1KA 3M8YA 4DXLA 4DTMA 4URQU 3A13A 3J81U 1Y11A 3SPYA 2LU1A 3FFKB 4B1VA 5BYSA 4DV7F 1I3AA 4AHCA 2LXUA 3B8HA 1RTIA 2W2OP 3G6ES 3SDEB 2ILZA 2UU9K 1RAOA 4KI4A 5FPMA 3PY8A 3L2VA 3T5HA 3LDOA 5HL7Q 5FRMA 4DFJA 1KS2A 4ZVPB 3PVXA 4FLVA 1VQPN 2ZKTA 3CCZA 4USJC 4FJMA 1QS4A 4KKOA 2ZD1A 1I94F 1T94A 1FWLA 4FLTA 3M1VB 5B0CA 4M5GA 5BR8F 2WHOA 4DU7A 4CFAA 4BDYA 4YB5A 1X4GA 4FNIA 2D0OA 4A8WA 2IJRA 1ZA1B 4KHPK 1GX6A 5KRTA 3RR7A 1Q5VA 8ATCB 4FS2A 3IFEA 4KQZA 3G71N 1FDNA 4FNHA 4UOFA 1NJZA 2LLZA 3G0ZA 4C8NA 3DI6A 4J9LA 1FERA 4Z0UA 2ZHBA 3EVMA 4IR9A 1YF5L 2F4VK 4IO9L 3JAMY 3PW0A 3P8BB 3D6TB 4J9MA 1UAXA 3I55S 2W4DA 2MTLA 1X4AA 2ZC4A 1FFWB 1VQ9N 4ICLB 1G6BA 1ROFA 2C3PA 3TVKA 1VSLA 2M9KA 3WQUA 2OEMA 2QX0A 3MM6B 4CJKA 4JKGA 1RT2A 2MZSA 1UWAA 1WSVA 4PQAA 1CJTA 3D0HE 2OSQA 3DXKA 2DNQA 4QAGA 4H5RA 4NYPA 4W92B 5SWMA 4WYWA 3CYMA 3DXSX 2Z4PA 2OPSB 2HIQA 1E3MA 4Z4IA 3MCMA 2F40A 2JC0A 3FZBA 4CHZA 3OHBA 3I4PA 4ZKAA 1VQKS 5AQKA 4ZDNA 3GG1A 1LWEB 4I9QA 1JB0C 4IOBA 4CERA 2EFNA 4DTSA 4O5FA 1HI8A 2YNIA 2MKHA 3SNNA 3NMUA 4PQUA 4ZCMA 2Q3PA 5KPZA 1D9AA 4AHVA 1YJNN 3AA4A 4TQRA 3TTCA 2CPXA 1BUXA 3OQ2A 2MZTA 4DLEA 1SV5B 3UPFA 3SIPB 4Q43A 3M3ZA 3CM5A 4NCAA 3NF7A 2OZSA 4HT5A 2AJQA 4WFZA 4UOGA 3V6HA 4ZJQA 3W60A 2ZC3A 3SEOA 2D7SA 5GAEI 1LW2A 4IXCA 2M70A 9ATCB 1TKZA 2QXFA 4Q8FA 2FC8A 4RU2A 2GAGC 3VQSA 3CJ2A 1YLXA 3QO9A 4UF4A 3KG4A 1MLAA 2HHXA 4KBOA 5AFUH 1OSDA 4NXNF 3WNGA 1SIWB 2AW0A 3D54A 3OR2A 4K4WA 4ES1A 3AVFA 1UFWA 3G86A 1JLAA 4IG0B 2JC1A 1H38A 1QUPA 3ZSVA 2QEXN 5AFUA 1Q7YO 3LP2B 3UDEA 1CULA 1O51A 4L3KA 4KH4A 4ZVOB 3PYEA 3CC2N 4OHVA 4DUYJ 3IS9A 3IM9A 2R7QA 4FF1A 3AB2B 4NMXA 1NGFA 3DXMA 3NH2A 3DYAB 1F3FA 1Z2ZA 3EICA 1UAWA 3CJ9A 2BJ7A 3SBGA 3QSIA 1WEXA 4DZ6A 1KP6A 2HBKA 3KJVA 2PYJA 4IG3A 2ATCB 2POKA 1LWXA 2GWKA 2NXNA 1RBVA 3CCQS 4FLWA 1NO8A 2QWQA 1VQ8S 1VC0A 2YWWA 2QWPA 4L6V3 1NKBA 4GC6A 5KQDA 4J9VA 2UXBJ 1QTNB 2WOMB 2RILA 2D4WA 2R7RA 4FYVB 5CYQB 1CJKB 2E2OA 1B9DA 3CMEN 4BR5A 1O0PA 3R7BB 3HI0A 3MDFA 3C19A 2HHHF 1PKUA 2QWLA 5DJBA 3MR5A 1N36K 1KD1T 4ZP6A 2HWHA 1QAIA 2AU0A 1FNOA 3VQ4A 2CKWA 3NGDA 3AVHA 4DR2K 4FJIA 3C8YA 1A9NB 5DQIA 4YR0A 3CPEA 3H3NO 4OYZA 5CABA 1W0HA 4NCGA 1ZM9A 1B9FA 4AH9A 2ZOFA 3VQ7A 2XMUA 1B0VA 2IVMA 4ZPTR 3WZ0A 3WXLA 2YJEA 2BE9B 4ID5B 3JTPA 4TY9A 3JS9A 1UVJA 3J7AP 1XQIA 2ZOMA 1VOMA 1FRHA 5IC6B 5HRRA 4D3GA 2VV5A 4MAKA 4LH5A 1RDRA 2F7VA 3PV8A 3FGVA 3ENVA 3HPGA 2XCAA 3PRDA 2HBYB 3RG6A 1UJ6A 3O9QA 1U1RA 2OANA 2C1EB 3J81j 3ETMA 2KI2A 1B99A 4ED4A 2HHSA 5AQSA 2HAIA 1GMUA 3MEEB 4MDBA 4LC9B 5H1SV 4OMFG 2ZZTA 5C24A 2CUYA 4WFBL 4M3YA 1N4LA 5LMUJ 5AQOA 4N41A 1VSMA 2ZUAA 1NKEA 4CW7B 4CZKA 2YI1A 2JEFA 4ZHRA 1B92A 3MFHA 1A5WA 2VWBA 3C7NA 3O8WA 2NRVA 1ZXOA 1CC8A 2VD3A 3JQJA 3GWCA 1KNZA 1XR5A 3GJRB 3MAHA 4DV2F 4DX5A 5KT3A 2CNLB 1XNRJ 3UN2A 5ELZA 5E33A 3FRYA 2P9UB 1FFSB 1XK8A 3Q8PB 2ETJA 1QDUB 3MEKA 4N5SA 2W2QP 5E3QA 5LY3A 4NASA 4G6VB 3D4JA 5J1PA 5D15A 2FY8A 4HVJA 4DCPB 1RT1A 3ZX0A 1NK4A 4E19A 1S1XA 5B0EA 3CCUS 3V4IB 1MWYA 1VAZA 3SQ1A 3IG1B 2ATLA 2MLZA 1S9GA 4UTGA 1P90A 5GADU 3C94A 1ILYA 1HBOA 1WB9A 2WTUA 1Z25A 2MLYA 3K2YA 3A8YA 2B9YA 2OUGA 1YTUA 1HWUA 1T44A 3MAAA 5J2MB 1R8CA 1NJWA 4UY8O 1C0FA 5K9FA 1SJ1A 1JLCB 2KQ2A 2CQ2A 2OMLA 4I2PA 3C65A 2M0GB 2JFKA 1RLDA 3FBEA 1Q16B 3FSXA 1NMEB 4HYKA 5KT6A 2W25A 3TTFA 3ZC4A 2DO0A 3D0PA 3ZSWA 4BQZA 3TZZA 1EETB 4ZA1A 3BO3A 2CIMA 1FX4A 2IIHA 4B08A 2ZJQQ 5LMUK 4QWAA 4EI2A 2KB2A 3N5BA 4R79A 2F9DA 4S0MA 4OVLA 4PUOB 2R8KA 4KHMA 4ID8A 4RCHA 1EJ7L 2AQ4A 2FHJA 2XB2D 1EP4A 3MM6A 3MMAB 2DGXA 1NMDA 3EPGA 1CJUB 3SUQA 5BPNA 3V1RA 1JXBA 2PN6A 4BQLA 1WOOA 1P1LA 1TL7A 3DLGA 5F0UA 2V5HG 3R1HA 3RW7A 1V6HA 3NCPA 5BXIA 1XERA 2ZZNA 3KK2A 1YVFA 3TANA 3TZYA 1XNRK 3DKDA 2HLTA 2Q2RA 5T41A 3IDHA 1LOUA 3C6TB 4RWXA 3AAWB 3G10A 2FBVA 1T9TA 2PT0A 3FNNA 5EDWA 1IJEB 2KKHA 4IEEA 1B64A 2JH3A 1BQXA 3ZZ0A 4WK1A 2MZ1A 2RU9A 4B3TF 3FZMA 1S6PB 3ET6B 5GMDA 3W0LA 1F5AA 4X4OA 3E01A 4A4JA 1UWBB 2RKIA 1RKJA 3MM9A 2FLLA 3H25A 2DNMA 3VGVA 1QJHA 3CC7S 1DY3A 4NLUA 4LF5J 5IT4A 3OYIA 3B4DA 1R27B 3TZXA 4KV8A 3THWB 5GAHU 3ITHB 2QRRA 3UKRB 2FDNA 3NKYA 2K1RB 3UD3P 2UVWA 5CHIA 3N4WA 1C1CA 1GMVA 5CZVA 3MM8A 3IWLA 4OIXA 3TQ1A 2HNZA 2PFUA 2HURA 3LDPA 2P9NB 4PWUA 2XWYA 2JZ5A 2Y0SD 4K4ZA 1JLEA 1SC6A 3A3OB 3DRRB 4FPBA 4USWA 3L3VA 1HL6A 1LK7A 2FVRA 1DTQA 3J7A1 3VQPA 2FZGB 1GFWB 3DU5A 3CJ0A 1EO1A 2CRLA 4PZVA 2BRKA 1EQYA 1RAJA 3SXLA 1BWFO 1TKXB 2IY5B 3ZSQA 1VHXA 5EOYA 1VQ4S 2CJ9A 1T6DA 4IH7A 3I8DA 4QR2A 3RRKA 2P6SA 5A2QO 4PAAA 3QRQA 3LP1A 3NAEA 4K0KF 5LT5A 1IBKJ 2GUPA 3BS9A 3VA3A 4GKKK 2IAJB 3UCZP 4BC5A 2R7TA 2YKMA 1WBDA 5DG8A 3D45A 1XC9A 1Q18A 3L3UA 3K8WA 5D4NA 3TRGA 1UA0A 3BYRA 1N54B 3S7RA 5G0RB 3EGNA 4IFYA 3FK4A 4RW7A 4LF5K 2H51B 1YJ9S 1SQEA 5DK5A 3SFUA 2BRLA 4A46A 2LCWA 2BA9A 3DHWC 4WCEL 3DJCA 3CQYA 1FDAA 4DB3A 4F36A 2MSSA 3GFHA 1OH5A 1XNQJ 1PAEX 2VL1A 1DT9A 2AD9A 1VC6A 2HBQB 3SUNA 3VVUA 2KHCA 3ZSZA 4NE9C 3TQEA 1BL3A 3ICLA 2ZDPA 2BJEA 2V67A 3CIMA 2UUWA 5CYMB 4O44A 5C25B 3FCWA 1UOCA 2FJWA 2MZRA 3OYCA 4ED5A 5AQHA 1YGYA 1X3MA 2HMPA 4ZVQB 4HLBA 4IEIA 2ASYA 4DV3J 1SH2A 2FGOA 4JI4J 1YG0A 4G3IA 2AGPA 3VQ6A 2VG7A 1A6LA 3MMCA 2PIIA 4FS1A 4Y6IA 1N0VC 1CS4A 3CMAS 2A42A 1S10A 1NBWA 4CNYA 4FWMA 3CVKA 4H4OA 1B0TA 2KTQA 3CCJN 2PA8D 1RFQA 3K58A 4ZIVA 4NLPA 1AUDA 3UWTA 4GVLA 2J4RA 3EO3A 1EWQA 4JKCA 3LL3A 4WP9A 1K1QA 4AXJA 2YWKA 4QWCA 2NNWA 2MYFA 4ZVHA 2V8VA 5HROB 3K5LA 2DHSA 2JVRA 2YNFB 3CJCA 1REGX 2P9LA 2N4DA 1C6VA 3OR1B 3ATUA 2FJAB 3C16B 1NDPA 2IMOA 4YR2A 3H2VE 3LP3A 4RNMA 2AF6A 2MQPA 2LXFA 2ZH4A 4DSEA 4CJWA 1XC3A 5J1EB 1XNQK 4OKEA 5H9FK 3W2WB 1HPZB 4DUZF 2B56A 1UVMA 2QLJB 4FF2A 2CNOB 2VQFJ 2G8KA 3PYGA 3I0SA 4C3KA 3IRXA 1SQFA 4FJKA 1UZHA 4ZVSB 2GVDB 2RUGA 1XHXA 4A59A 4AQYJ 3HDSA 1OJ4A 3D9BA 4QYZJ 4LSLB 5DG9A 5KTQA 4YY3F 1HBMB 2HQIA 3KWMA 1HD1A 1VQ5S 3A1YG 1RWNB 3DAWA 5HVGA 2FZKB 5EWGA 2ZQBA 4DV3K 4H54A 5KQ8A 4JI4K 3LPYA 3W5YA 2E2QA 4ENOA 4DL6A 1Q5YA 4H4KA 1QTMA 1N5VA 3ISND 2JL9A 2AEFA 5CCMA 2JEIA 4I6WA 4BRGA 2KFNA 5FLXY 2ASMA 1JXEA 3THTA 4BHQA 2W24A 3ZZRA 3O3LA 3SLCA 4JI3F 4CI0B 3M2VB 3KUGA 2X1GA 3RBDA 4DR1K 2ZNYA 2UUAJ 4B9MA 1FFGB 1KLMA 5E2QA 1IM6A 3VCDA 3S3NA 4IWVA 1QD1A 2E6LA 2BKOA 3IAS9 1RHUB 3RBEA 4A48A 4IH6A 3P49B 1REVA 2YHYA 3C6AA 2VBXA 3A5OC 2ZWOA 4B1XB 2DNNA 2J0WA 4B3SJ 4C4WA 2ZJPQ 3J7ZO 1LAVA 2FJBB 1X9JA 2W9CA 2IDOA 3FEXB 5GIPA 2V8PA 1FXXA 4OZ3A 2WC9A 1CLFA 5D4PA 4A8YA 3BP8A 2VQFK 1SZ2A 1CJUA 4YR3A 1CJVA 1T9WA 5CCLA 3CXCM 3D2EA 1NK8A 4AQYK 1BC6A 3QEWA 1TV6A 1BIZA 2B7CB 4QYZK 4RBTA 3JSBA 1PBAA 3UIQA 2OPRA 5B0AA 4DV7J 3PW7A 2FHOB 2Q1NA 3FFIA 5KFQA 4GV6A 2A18A 2RQCA 2P9PB 5AQWA 3VEYA 2ASDA 5FD1A 2JLFA 3ZT4A 4Y1CA 5CYJA 3SV4A 4KFBA 4LF6F 2OTLS 1Q8BA 2NZ4A 5KOXA 3EX7B 2QSFA 2HS3A 4C0OC 4D3HA 1RTHA 1IUJA 4A62A 2CXEA 4U6PA 5DGAA 4Q45A 3TNVA 3RWUA 1J5OA 1I94J 2BKNA 2UVRA 5HLFA 1OY9A 2UUAK 4YDDB 4H4MA 1PC5A 1TTHB 4PKGA 4HT7A 1KOHA 1ESVA 2DCUB 3P96A 4ETZA 4RO0A 1BWEA 4I69A 5SZTA 1DURA 1Q79A 4IRKA 1RWUA 3S1TA 4ECSA 3KJNB 5JUMA 3EY1A 3BDEA 4HEA9 2A40A 5FRNA 2X7IA 3EGZA 2HBMA 3D68A 1MN9A 4JI6J 3M05A 5E5NA 3ZTQA 4ILLA 3L0QA 4P74A 1MWQA 4O8KA 4Y2MA 4N8OA 5J2QB 2G0IA 2KXHA 4OJ1A 1LWFB 3TAEA 5I3UB 1OPZA 3UW1A 1F3VA 3W8GA 1X5SA 4RZRA 3ENAA 2JOQA 4DV7K 3BF4A 4NXMF 3DRSB 4CO2A 4F7VA 3UCGA 1ZPWX 3PG9A 1T05B 1I51B 1NK0A 1N33F 2XHWA 4O3OA 4DR4F 2CQ0A 1GMWD 4NLQA 3KLHB 4BC9A 4DV1F 1PBUA 3NS5A 2KG0A 2WONB 3EL2A 1BHLA 2VBYA 4YDXA 3OUYA 5EX5A 4JRQA 3CDEA 2OPPA 2C2NA 1SIZA 1R31A 2RNEA 4ILGB 2D3O1 3LALA 5BRHA 3R5DA 1QY7A 5GAGU 2HVZA 5ETKA 3OW2R 1I94K 4I7FB 1NHUA 5FPNA 2NXUA 1NPKA 5BR8K 5GADP 2VQEF 4U96A 3LH2S 1OWXA 2P9KA 3MX2A 2LP4A 2XO7A 1RAIB 4BVPA 3P45B 4JV1A 3VQQA 4GVBB 2DR7A 4JAXA 4ILHA 4FWLA 2XULA 3GIJA 3MGJA 4BRMA 2M3DA 2J6TA 3RTVA 1RAFB 4LR8A 4RPFA 1BDGA 3HHLA 2BKPA 2YKNB 1ZETA 3AQPA 4C8MA 4EUVA 1OH8A 4DR7F 2HGNA 1KQSR 5M1NA 1E6YA 5AQXA 1Z05A 4LRAA 2MSTA 2CVIA 4CJ7A 2OPQB 1WKJA 4AM7A 3HVWA 2CQPA 3SQGB 1KOOA 1UETA 5FDLA 1NH8A 5HMZA 3S3MA 2X1FA 3EGWB 2KRBA 2XRIA 4HTLA 2XMWA 4PG5A 2GIQA 1NGCA 5ADXH 2EC2A 4R5PB 4Z37A 4PXCA 2XLIA 3BGOP 5JLFA 4DEZA 1F5BA 5DDPC 1KDNA 5ADXA 4CF0A 1RT3A 4DHVA 3HULA 2H5EA 1FXDA 2FSKA 1YJWS 1S6QA 4H0VB 3PO5A 4WFAQ 4FLYA 4M3XA 4H0PA 5KFZA 2Y1IA 3G6YA 4JUZA 1NJYA 2BUPA 5KT7A 3OPKA 1GLBG 1S9EB 4M42A 3HF5A 1D8YA 4TLQA 3LO3A 3M2UA 1NPRA 3V81B 4OZ0A 5U47A 2HHHJ 3AVIA 1U4BA 1U0HB 2FQQB 1APSA 3CJRA 4QPXA 4CIOA 4DDFA 5DETA 3RBZA 3AT1B 4NXNK 4C98A 1TKDA 1T9YA 2C2EA 1VISA 4HI1A 4OYIA 2LQJA 3QEXA 1XMQF 2A6AA 5K8NA 3RMAA 3RYLA 4NZ7A 2E88A 1P27B 4K4SA 3R3TA 2P6TA 2RAQA 3TA1A 4C3MA 2GV9A 2FYXA 3BREA 3MUVP 4JI1J 1UP1A 2DXEA 2J7UA 2ADCA 1I5OB 2O8CA 3MEGB 1RDBA 2MB0B 4GRSA 2K2PA 4M5JA 3TVYA 3GLJA 3BKUA 3H4DA 4ZPVR 1Q7YT 3B54A 1GLDG 2B8PA 3BJYA 4DS5A 3T5KA 1BY9A 3NCRA 2LEPA 4B1WB 2CQGA 3TVZA 1WHYA 2JEGA 3I0RB 2CJYB 3SUPA 2KLAA 1RKIA 2E9RX 3I55N 3MAQA 3W5XA 2LVWA 2BE2A 4JKBA 2C2OB 4F3QA 1GLEG 4C2MA 5KG1A 3M8QB 3BUZB 2L9WA 3GBTA 5LSOA 1VS3A 1M5SA 2DHGA 4CH7A 3Q24A 1C1BA 5IM0A 3Q8VA 4PABA 2MQNA 2HHHK 5E3PA 3LPUA 2QV6A 3F41A 3NLCA 2OP5A 5HSPA 3W65A 1GH8A 3S8SA 4FWRA 3I5AA 3HD2A 4UQTA 4X66J 2ZH6A 4JK8A 5J2NA 5KFGA 5A8KA 1WSRA 1YTAA 2ZBPA 1VQKN 4FZZA 4AXIA 4P72A 4YOUA 2DRAA 3TOQA 1QSSA 3CD5A 4CJEA 4FVMA 1FD2A 4KT0C 3BGUA 1SH0A 1UFKA 1TZ0A 2AZ3A 2CPYA 4OHXA 1WSIA 1N6QB 2DNZA 4ECXA 5IT9O 3OVBA 2HVEA 1PG5B 1X9WA 2MKKA 3KLFB 4KH0B 4JI1K 3OBIA 3P5JA 3KK7A 4OLBA 4LIWA 5JXSA 3GFYA 4OZJA 3TR5A 1WJ9A 3MR7A 1NNDA 4Q44A 2F5GA 3W8PA 4OYAA 3HRGA 4ZJOA 5C42B 3GG4A 2BR0A 5JICA 4KR0B 1AB8A 3DGPB 1ACMB 1FWPA 1BQMB 4YP3A 3R7NB 3OYKA 2AGQA 2QLFB 3ZFVA 3R1LA 1VQNN 1IQZA 1ZA2B 1JCEA 2EEYA 1KAXA 1JNRB 2R8IA 5JLHA 3HKZD 2O8FA 5HP1B 1NDCA 3OHAA 3KG0A 5D4OA 3JSYA 2D1CA 5EY4A 2VCPA 3MUTP 2BUNA 5L8RC 4LF1A 4YMEA 4OX7A 3ZTPA 4FW1A 4ZP9A 4FLXA 4HCBA 4X66K 4CD3A 4CZMA 1M1KO 3JTNA 2HWIA 2HZCA 3Q86A 1SJ3P 2HPUA 2D0CA 2LDIA 4DV2K 1FRLA 2EXUA 1U24A 1WDTA 5A8RB 1TYQA 4CK1A 2HFOA 7AT1B 4WTYA 2P2CB 1TAUA 1AZSA 4NYNA 4GKJF 1RDUA 3CCQN 1EWRA 3HOTA 5M1PA 3MECB 5AQYA 1VQ8N 2YKAA 2WVFA 3J8AA 2VG6B 4B3TJ 2EWHA 1NXIA 3DRXA 4J9KA 1WSJA 1S72N 4F67A 2WK4A 1FDBA 3Q8SB 2J7KA 4FL9A 4H0XB 3T5LA 2MMYA 4J90A 4CK2A 3KOAA 1EKEA 3B8AX 4PXDA 2Z56B 4HWIA 4JEPA 3WXIA 4PHTX 4LFCF 1S6OA 2P1JA 4GVBA 3WDOA 3L2RA 1V5VA 2J8SA 4AL5A 1U2RA 2ZHOA 2ABYA 5A2QY 2M8DB 3ZT2A 1URRA 2HSEB 4U7UK 1RWMB 3BPDA 4CGFA 4MQ3A 1JJCB 2QC3A 3G87A 1IR1A 4CF9A 3NEKA 5E84A 4F4XA 3AVKA 1IKVB 1UMJA 4UY8T 1WSHA 1QVFR 3LPEA 4CECA 1S22A 1KVBA 1GT8A 1F6TA 1YRTA 1W2BR 1U2VA 1AUSL 2MQ8A 2M52A 1NAQA 2WB1D 3QNWB 2DFFA 4DU4A 4EHTA 1J27A 4KIAA 3IM8A 4TY8A 3VQCA 3IA0A 4FJ9A 2PMWA 3IXQA 4QBUA 3MM5B 3LDNA 1Y3JA 2HNYB 3GYNA 2QXLA 3BO4A 1ZBFA 4DCHA 4DR5J 2F8MA 4QS8A 1WKLA 3PYDA 1SXLA 3VETA 4F02A 2ROGA 2YWGA 2V4RA 2KN4A 4P7VA 4Y28C 1ZM3A 3N0VA 3IMQJ 3FMWA 4B3TK 2DY4A 1FXLA 1JWWA 4DV0F 1C0TB 2FVCA 1SL1A 3QNNA 1YITS 1U1OA 3D6FB 1NWKA 2BTFA 4KSEB 4LSNA 5F3ZA 4IFVA 3TYTA 4R25A 4LFBF 4PR6A 4DFKA 4ILMA 2G1HA 3KHHA 3JYTA 2HFUA 1F9EB 4OLPA 1BGXT 3O8MA 3QFUA 3WT0A 2VF3A 1Q81T 2RQ4A 3L9ZA 5LSLA 3DLEB 4DF4A 1HQUA 2GIFA 1N56A 3R3LA 5BN9A 3TAMB 1HHQA 5ITHA 5IFMA 3VMFB 4YDUC 3DRPB 1RHQB 3WUHA 1FE4A 3EWGA 1HPMA 4QZVB 3PRVA 3A5NC 2DHHA 4F4AA 3E66A 5LSRA 5CD4H 4WQ4C 3OBYA 3SV3A 3BR9A 4FPIA 4NYZA 3SCXA 2PEBA 5ADZA 3AD8C 3EVOA 2YNHB 1H73A 2C2MB 3F9KA 4IQMA 2GO9A 4DQSA 1OKJA 3CCUN 5DZ6A 4BR0A 3HSTB 1A5VA 1KLNA 3HLUA 1GQEA 3CCRS 1XIQA 2PI5A 3EE9A 2CJQA 1GLJO 3HI9A 1VMBA 1I1GA 4NO7A 4LREA 5JS1A 2JVOA 3D2FB 4EBDA 4FXDA 2UUTA 2JLGA 4WYLA 4FVUA 4K0KK 2CPEA 2GQCA 4O8UA 2YHAA 4NLTA 2WW4A 5EWEA 5ETRA 5AQNA 4MIWA 3OL6A 2NRHA 3VAJA 1S1TB 5DDRC 5JJBA 2BJ9A 2X74A 2OYQA 3DOKB 1TL3B 3ZT0A 5I42A 3CIZA 4R0JA 2BBEA 1NGEA 1U49A 1RT4A 4JHDA 3PCOB 2V7YA 2HF3A 5GAGP 1N5SA 4LQ3A 3EZ5A 1RBUA 2VONA 3KK3B 1HKAA 1RWWB 1JXVA 1FEHA 1K0TA 2Q31A 3BDPA 4CGIA 2E5JA 2VJVA 4LF7F 3T6JA 3M7VA 3HX9A 2HF4A 1UFLA 1IKYA 1MU2B 1BE4A 4E7IA 2O5DA 1BO5O 3U6FA 4ER8A 1LFPA 5T14A 5KG4A 2IMWP 2F8TA 3DOMB 3MR3A 3CCSS 3E9LA 1DGKN 2YBVA 3CW2C 3EM1A 4YFUA 1OSCA 2O1PA 1X4EA 4DL7A 3QEIA 3BH6B 2P9SA 3PTWA 3L7OA 4TN2A 2G2OA 4OZ5A 4E1JA 3CC7N 2AV5A 4BBYA 4MYTA 1S9FA 3OSPA 1MMNA 1VRTA 3CFPA 3E3XA 2NSCA 3VAMA 3GIIA 1NKCA 3J80U 4JI3J 3ZSRA 4DX7A 4DU1A 2HS0A 3M9NB 2W1BA 1ZOTA 4CO0A 4GMJB 5DDQC 4OZ1A 3L09A 1Q53A 2W40A 1FK9A 1K9MO 3M1FA 3V9XA 2ASPA 1LK5A 3QNOA 2VFUA 4OLOA 2CJAA 4QIGA 1DTTA 3GJQB 1PAUB 3H42A 1S6UA 2I7NA 3FSIA 2QL7B 4JI5F 1X31C 4WFXA 4AHRA 4V19J 4QIWD 5KFPA 2N7YA 4C8ZA 4YOWA 2IA0A 4A8MP 1WI6A 1WG4A 2MEWA 3J81O 4BC4A 1VQ4N 4CLUA 4LVOP 3AB4B 2DXFA 2KFYA 3OYBA 4DCJB 2BQUA 1NSAA 1JLQB 1U1LA 3WIUA 1N5YA 3TAQA 1XR7A 3W62A 2N7CA 4YY3K 3DLBA 4WBFA 1K8AT 3IBFB 1Z1ZA 3VEOA 1ULRA 2NQPA 3OL9A 4MJKA 1HNVB 3TSPA 2ZE2B 5AQMA 3NWRA 4IOAQ 2HNDB 3F5TA 1HMVA 1FXRA 1YJ9N 2GW8A 3BKTA 4OI4A 3AVAA 2ZBIA 1GXTA 4Q2MA 3CJ1A 2ZBQA 4MLHA 3NL0A 3BZKA 1C0GA 3Q8YA 5KT2A 4JI3K 1IO2A 5M2RA 4FKYA 4BGBA 3E8OA 5EN1A 2P8IA 3PNIA 1FRJA 2W4CA 4RW9A 2WW8A 4OZLA 1S59A 1H3DA 3FMBA 2EBGA 1JK9B 2RDIA 3C6UA 2V4JA 4O3SA 1RZMA 3EYZA 1S0VA 3GE1A 2PGCA 3S01A 1S97A 1K1SA 2IS3A 4C6AA 4K25A 3O9UA 4WE1B 2I2YA 2KM8C 4DQRA 3GIMA 3ZSXA 4DUYF 1YBUA 2CAJA 1WAFA 1NSPA 4TSXA 3PEHA 5KFSA 2GBZA 4NZ0A 3NGTA 3CMAN 3FZHA 2EFPA 4URSA 1IXKA 1MNEA 2XMAA 4KRWA 2IGIA 2C28A 1GOAA 2PE8A 2HNYA 2UV8G 3CJ8A 2QLXA 3CCES 1GOBA 1V5IB 2MJUA 4Z7YA 2XLKA 4OX6A 1HYSB 4CDIA 2DNOA 4J9RA 4L72B 5K14A 1IJFB 4NXMJ 3OXFA 4MTPA 2LEBA 2HBJA 2UXBF 2HQ3A 1N33J 1JLFB 1IBCB 1TMMA 1PJ5A 3ID8A 4O0NA 1MDUB 4L8RB 1U02A 2RMLA 3FZKA 4DQPA 2F8SA 4BRLA 3EDQB 4LF6K 3SCIE 2XTJP 2IVNA 1T3NA 2YV0X 1TFYA 3KLIB 4P73A 1W9HA 4O3QA 3OD2A 4M5NA 4CZCA 3JQKA 4DL5A 5DMRA 1U47A 3JTOA 4DR6F 1H98A 1F2GA 3QRPA 2Y3YA 1JIHA 2VQEJ 1OQ3A 4I6AA 4DV6J 4BE2A 4CVNE 4OYOA 1ZBSA 3HJFA 4CH1A 3DRPA 4IQXA 4LF9F 2AHOB 3DWLA 3BSNA 4YQWA 4CJ4A 4DU8A 4QIFA 1RU1A 3A5MC 1FT8A 4I4BA 3W5ZA 3DNCA 3BB5A 3VESA 2I38A 4C9DA 3VHQA 4RUAA 4XIUA 1Q95G 1W7AA 4M3WA 4QU6A 3LANA 4TU9A 3NMAA 4DR7J 5HK4A 4FK2A 2JSXA 5ETLA 4QS9A 1RYSA 2O8BB 1YVUA 4J2AA 1K0VA 1EKRA 1IH7A 3QT7A 1JLGB 4FYDA 2CZ9A 1UJ4A 3OYAA 3RAQA 5L39A 4Y0FA 2FF6A 2E7XA 1Q86O 2AA4A 3KK1B 2B6AB 4KPCA 4RBVA 4F04B 1GXUA 2RIJA 1SKWA 3ZLJA 4I64A 4JK7A 4CYUB 3L95X 3H98A 3HZEA 1HJOA 4NXMK 4LY7A 4DS4A 3FE1A 2W7AA 1N33K 4B8AB 4X64F 3AA8A 4MIBA 1N52B 4XDCA 3UI3A 2XY8A 1PYSB 1HA1A 4DV1K 4F8RA 4RTFD 2XMKA 1V4SA 4BRPA 3UVJA 3US5A 1ZBHA 5ETMA 1HNXF 1ELOA 2R7WA 2ZJQL 4O4RA 4ED1A 3VGLA 2VWJA 4C8KA 2XMVA 1RE1B 4U67Q 2NYIA 4BS2A 4E3SA 4AF1A 1XNRF 4M5DA 1M90O 3AODA 2VQEK 3VTHA 4QCLA 3ENHA 1VSDA 4CESA 2QZ8A 4LF4F 2GTDA 2GMHA 3OTOJ 2WB4A 2CWKA 1KBRA 3IMXA 3HXMA 2HRTA 4BY9C 5B7WA 2QWOA 4PA1A 2N3LA 4RNFA 4M63C 5E3CA 4A8QA 1S76D 3I96A 1NK5A 2NREA 3QBXA 3PDNA 3I5BA 4EYIB 4DR7K 1QUVA 1JJ4A 1RTJB 4PKIA 4B9LA 5HRPA 2IOCA 3GJTB 3BM7A 2J0XA 5B09A 2YX1A 5AZIA 2OTLN 1VBKA 4FXWA 1UVLA 4H4KC 2D5RA 3OHRA 1XUPO 3A8EA 4JS5A 1SUQA 1NU4A 2W41A 2A10A 1RADB 1WC6A 1XMQJ 4E8UA 3O44A 2Q97A 4NB4A 2RU3A 1IKWB 4BCAA 2BJ3A 3JB9k 3AAPA 3AA9A 3GP9A 1HQEB 3H08A 5KFMA 1FHTA 2B5JA 3CJKA 1N88A 3GFZA 1HD0A 2ZWPA 1NK7A 4PPDA 2HFVA 4DMNA 3R6GB 5AQTA 3OA9A 3EXCX 2YVSA 3IR6B 3K89A 4NYFA 2BW2A 2QA4S 2YQ0A 3RGIA 4CHQA 4YOTA 3D1QA 5CR4A 1S5ZA 4N7TA 4ECQA 3H7HB 3QPIA 3VQDA 2HHUA 3VGUA 2HBZB 4M5HA 3CCLS 1HKGA 2GS8A 3UN3A 3CFOA 5DZ7A 1MROB 4C8YA 3GILA 4WK3A 5B08A 5KFKA 3IR7B 1X4FA 4CM2A 1VSJA 4RW4A 4M3TA 5IT9Y 2XNQA 5IQQA 4CFCA 4LH4A 4NLXA 5CA5A 1NJIO 4IH5A 3ENOA 3LGMA 2CZVC 3MM7B 4KGZB 1V3ZA 3DLKB 5HQ8A 1S79A 1HBUB 2C42A 4F3OA 2IBKA 5CZ2A 4GNIA 5C10A 3B6BA 5KFXA 2ZZMA 2B8QA 5TKYA 1X0PA 3ZZUA 1BI4A 3W2VB 2WVCA 1VLYA 3KHYA 5JMVA 3KDNA 3L7PA 3DDIA 1I39A 1WDDA 1E6VB 4CLYA 1WHXA 2E6MA 1VSHA 1QE1B 1SS6A 3AJDA 1D3WA 4U9RA 2O66A 4RWWA 1XMQK 2EX3A 5AE3A 2G8HA 3BSAA 1FTRA 1SKSA 3RRGA 1IKXA 1RI7A 1QQCA 2VPXB 2K8GA 2P5OA 4JD2B 3CDAA 3W9IA 2HHVA 4JK9A 4WKRA 3HTVA 4DMZA 2QTWA 5E3AA 5K8OA 2XCPA 2J0QD 4ELVA 2FVQA 4EAHD 1H74A 3UD4P 4F4KA 3MWBA 2IVPA 4PG8A 5HMYA 5I4MA 2WSEC 2FPHX 4UOCA 2P9CA 3CQXA 3AARA 1ZZFA 1DJ0A 2IFXA 2HBRB 1ZC6A 1DQ9A 2GJ2A 1CXUA 2KO1A 1VFJA 1YUWA 4ZLJA 5FJ4A 1TL5A 1JLBA 3VF0B 1IBKF 2JWNA 4CZGA 3TW0A 1MG7A 4PWDA 2RHKA 3QERA 1HFEL 5BRDA 1XJWB 3NH0A 4WP8A 1BD6A 4DG1B 1TVRA 4OI2A 2DYAA 4WZMA 5AXLA 4RW8B 2LDYA 2P9IB 4I6YA 3H5XA 3ZXWA 4ZIWA 1FI4A 3OYNA 4H8KA 4CFBA 4O55A 2R2UA 3CCVS 4C11B 4KHSA 1LW0B 2BGGA 1TP7A 3SI8A 2CNNB 3EZUA 1YJWN 4GKJJ 4AD6A 2KZZA 3V6DB 1VJQA 4F4ZA 3KUEA 4UUWA 3L6QA 3JSMB 3EGVA 3T41A 2AYMA 2NYHA 2G2YA 1FKPB 5AQRA 3NNCA 4WWSA 3KVGA 4ES2A 8AT1B 3RAMA 2WTFA 1ZBIA 3AJ1A 4NL5A 4KGKA 3MN7A 4XO0A 4J37A 2FVSA 2IJNA 3BSCA 4FWPA 5DQHA 2AZ1A 2IVOA 2FJVA 4C8OA 1WNEA 3TJ9A 4AM6A 2W9BB 3PIOQ 4LFCJ 2VFSA 3RJMB 2PAVA 3PX6A 1DLOA 1RA6A 4M95A 3AOCA 2QKKA 3OW2M 3T3FA 4NMLA 1VBXA 2ZGZA 1TUUA 1KHVA 4BR4A 3HHLC 4HH1A 2YNGA 4OX8A 1RNHA 1RAGB 4G1QB 5AQUA 1NHKL 4W5RA 3BF1A 4ZVRB 1V3SA 3Q2SC 2D41A 4FWNA 1JKHA 1VQMS 4CF8A 4CHPA 2FUG9 3Q22A 4WIQA 2EK1A 1CXQA 2P9EA 5A2QU 1VR6A 3C15A 3AA3A 1WHWA 4C1NK 5L1JA 5KFFA 4MH8A 4LBIA 2I1RA 2V68A 2Z2YB 1W25A 5JS2A 4DV4F 2EFVA 4N76A 2CNKB 3VENA 1S1UB 4LR9A 3PJXA 4MFBA 1GEHA 3FZ2A 2QJ3A 1RWPB 2Z58B 2RF2B 1YX2A 4GKJK 3UR0A 4Z4EA 1TUWA 2NR0A 3V9WA 3GIRA 1NGHA 1M1KT 4JI0F 3WEEA 2ZJPL 1KEKA 1VQSA 4J5OA 6FDRA 3PKYA 3AO3A 4I6MA 4U7BA 3DLLQ 2HVDA 2DJWA 5EWFA 4MDAA 3W61A 2KT3A 4FYYB 1ZAVA 4LFBJ 1A7GE 2DNYA 4JI8F 3KLEB 1KXPA 4LFCK 5AQLA 1CBKA 4HACA 3MR2A 5GADI 3NS7B 1OY8A 5CAAA 1VSEA 1K44A 2Q0RA 3RMCA 3ZEUB 2V8DA 5TKWA 2APOA 1ZYQA 1MA9B 2WAQD 2K3IA 4WU3A 1LAWA 1C2PA 3DMJB 2IC3A 3M30A 4AHSA 4IRCA 3QSYB 3EVWA 4JOUA 4FJ7A 3E9OA 2MGZA 5T7LA 2DEJA 1VRUA 3QJLA 3H8YA 4UZCA 3T9NA 1RSCA 1WAJA 3NXZA 3VAGA 4B3SF 5KG7A 3O1LA 4X4NA 2I5JA 2LQBA 5KFVA 4IKAA 5LL6Z 2KJVA 5GMEA 3QGIA 3ULEA 3OTCA 5FROA 2DGWA 4I2QB 3D0IE