3DM2A

Crystal structure of hiv-1 k103n mutant reverse transcriptase in complex with gw564511.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
539
structure length
531
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 146
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dm2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dm2A05
1VSKA 1RT7B 3V6DB 4NYNA 5SZTA 4ZP7A 4CJ5A 5KGXA 2W8LA 3AVCA 3SQ4A 4W5QA 4DL4A 3P83D 1LW2B 3NBPA 3ZSRA 4OLBA 1NJXA 3KLEB 1VSEA 4G3IA 4ZP9A 1NHVA 2HB5A 4GVMA 1WAJA 4H4MB 4Q45A 3SUNA 2W9BA 1NK7A 1TL3A 2B43A 3AA3A 3LZIA 5EDWA 2KZMA 1ZBHA 4LH5A 1S97A 1ZBLA 5KRSA 3DRSA 2ILZA 1BHLA 3AVJA 5HRPA 3LPTA 5F8IA 3EY1A 2FLLA 4KI4A 4M3XA 3OL6A 4BDPA 4CGFA 2D0CA 3V9XA 1S1WA 1XWLA 2BQUA 3VA0A 4IR9A 3VQPA 4HCCA 3KHRA 4Q0BB 5FROA 3O4QA 2IS3A 1K6YA 3VQQA 2G8FA 2AX0A 1VSFA 2HVIA 4KHMA 3KMQA 1RDRA 3ZCMA 3T3FA 2BANA 2C2DA 1QE1B 4Z0UA 4F4XA 3M9OB 4Z4CA 3OYHA 4F4KA 2E9RX 4Q43A 1FKPA 2ZD1A 1LWFB 5F9LA 1JKHB 1DLOA 4OVLA 2QV6A 4NCAA 1B9DA 4PQUA 4DTSA 4JS4A 1IKVA 2IM2A 3KLIB 4QWAA 2QK9A 1SV5B 2ALZA 3THVA 5J1EB 4WXWA 4J2AA 1S9EA 2YKMA 1KTQA 4KI6A 4CJVA 3O3FA 3KJVB 2HNYB 3NF6A 3NFAA 4H4MA 3K5MA 1JLQB 1TK8A 1FKPB 4NLXA 4O55A 3AVBA 3ULDA 1N6QA 2R2UA 4L8RB 4ID1A 3BQ0A 3AVIA 4CHOA 1HJRA 1DTTA 1QSYA 4CK1A 2ASJA 1IKVB 5DG9A 3TABA 4CE9A 3AVMA 4DSEA 4OGCA 2R8KA 4Y1CA 2A1RA 5KT2A 3OYAA 5L1KA 2JEJA 3VQ4A 1RTDA 3C95A 5J2PB 5HLFB 4K4VA 4B3OB 4CJEA 3NAIA 4J2BA 3SI8A 2IDOA 5C24B 3MEGA 2IMWP 5KI6A 4FVMA 1BI4A 2VG5A 2OPPB 3GILA 2XWYA 4M3TA 2R2TA 1C2PA 2OH2A 1EKEA 4OGEA 4B8CA 4Y2AA 1U45A 3T1AA 3SQ2A 1U49A 3M8QA 4DFJA 3RAXA 1QSSA 1HMVA 4PQUB 3IN5A 4QCLA 2F8EX 4NLSA 2JLEA 1R0AA 3QO9A 3KD1E 3MEEB 4F50A 4BWJA 4R5PA 2FLNA 2I5JB 4YP3A 2D41A 4U6PA 3TAPA 1S1TB 3IAYA 3V81B 3PZPA 2HNZB 3OSNA 3M8PB 4LH4A 5I3UB 3CFOA 1N6QB 1KLMA 4PY5A 1WNEA 4ZVGA 4DF4A 3LWLA 1TVRB 4ID5A 3DMJB 4FJKA 1RT2B 4MFBA 2IM3A 4O0IA 4TYBA 4NRTA 3QETA 2D5RA 3OL7A 4EZ6A 3K58A 2WK4A 3QIOA 4BDZA 4Z4HA 1L3VA 2W9BB 2ILYA 4E7LA 3DLGA 5KFFA 2UVWA 1LWEB 5KFGA 3CYMA 3GQCA 1RTHA 3ALYA 3KHLA 2DFHA 3OYEA 1LW2A 4I2PB 1U47A 2HHSA 4Z4IA 2HHXA 1IKYB 1NK8A 2D7SA 3CFPA 2E9ZA 5DG7A 3V4IA 3O3HA 4N76A 2HNDA 4MKAA 3RB4A 4PWDA 4FJ7A 2G8UA 3LAKA 1OS5A 3VN5A 3DLGB 4EZ9A 2O4GA 2E4LA 3RRHA 4GC7A 4W5NA 4HHTA 2R2RA 1Q8IA 4H8KA 3KTQA 5C42B 1L3UA 1S49A 3H98A 1L3SA 1BIZA 3RB6A 2RF2B 4CK2A 1TKXA 4ED3A 4URGA 5KG7A 5CZ1A 5F8JA 1VSJA 3CJ4A 5KFZA 2BRLA 3GV8B 1SL1A 3N6NA 4AHTA 1JLAB 5EWGA 4RW7B 1SKRA 4PUOB 4ZTJA 4GC6A 4FJ8A 1UA0A 2VWJA 4DTXA 3VQ8A 4IRKA 2HMIA 4HUEA 4FLTA 4CJ4A 1HNVB 2GV9A 1SKWA 2P5GA 4DL6A 1X9MA 1S9GB 3CWJA 1C1CA 1TK5A 4CK3A 5F8NA 2OPSA 4CHNA 4KHWA 2PYLA 1ZBFA 3ZSYA 3UIQA 4ED0A 1RBTA 3L3VA 4O4RA 3VQ5A 1EX4A 1S1VB 4QPXA 5CZ2A 1HYVA 3PW7A 1KVBA 4OKKA 4CFBA 1NJYA 3F9KA 4NRUA 3OYBA 4AHCA 3QNOA 2RKIA 3L3UA 4E19A 1ZBUA 2GC8A 3MF5A 2KFZA 1SL2A 1JL1A 3LPUA 1BI4B 4ELUA 1ZBIA 4IKAA 3PX0A 3OYDA 3RMAA 4RW4B 4EYHB 4Q5VA 2VG7B 5FRMA 2IA6A 4M95A 2P1JA 1A5WA 1RDAA 1BIUA 3E51A 3TWHA 1W9HA 4WE1A 2ZE2B 4R5PB 4ECXA 3L2WA 1T03B 3QGIA 4ICLB 3G6XA 5HBMB 3QIDA 3SPZA 5KFAA 3HXMA 3E01B 3AVLA 3HK2A 4B8AB 3RR8A 4CGHA 2HAIA 4FJXA 4J9NA 3I8DA 3OHBA 3CDWA 4NLWA 5KFQA 4N56A 4YR3A 1LV5A 3NH2A 5DG8A 1BISA 1QUVA 4WZQA 2X6SA 4ZPDA 3KLIA 4NYFA 3FSIA 3ITHB 4IFVB 2CKWA 3TAMA 3T5LA 3PJWA 3RBEA 4IG0A 2JEIA 3MFHA 4ECVA 4J9QA 1SUQA 4IDKB 1NJWA 1C0TB 4DG1B 4RW8B 3QLHA 1LWEA 5KFPA 2WTFA 1NKCA 4IH6A 1RBRA 4ZHRB 2XCPA 4DTPA 3HVTB 5HP1B 2KZZA 1B9FA 3WNGA 3AO5A 4E7HA 2X78A 4TYAA 1I3AA 3TAMB 1JIHA 5HRSA 4M94A 4K4ZA 5D3GB 3OVNA 4C8MA 4DQSA 2BDPA 3EPGA 4IBNA 4WE1B 3K2PA 4FLYA 4M42A 3WNFA 4QAGA 3V9SA 4DG1A 1I6JA 4I2QA 1S0MA 1S6PA 1C1AA 3DI6A 3FRZA 4ED8A 4ZHRA 3I5BA 1RBUA 1N48A 2R7YA 3P1GA 1RA7A 1QAJA 3JYTA 1JXLA 4CFAA 1RTJB 4CF0A 5T14A 3HO1A 4RW6A 5D3GA 2DTUA 3SPYA 4NLRA 1K1QA 2QE5A 3KNAA 5FDLB 4IOBA 1IKXA 2ZQBA 3OS0A 4FK0A 1C0UB 4B9MA 3C94A 3Q8SB 4ED1A 3PO4A 1MMLA 4O3RA 1I39A 1SUQB 3KLVA 2F8SA 3TARA 4F3OA 4JLHA 4FBTA 1HYZA 3HVRA 1WNSA 3RRGA 3SUQA 3RMCA 3NGYA 2OA8A 4KTQA 5KFTA 3V6JA 4ECSA 5KT4A 2O5DA 1SL0A 3DOKB 4KB7A 3HVAA 2FLPA 2OPSB 4J9RA 3NGZA 3MEDA 2F96A 3KK1A 4K8ZA 1S6PB 1U09A 3BSCA 4U7CA 2WOMA 3KK3B 2IC3A 4PA1A 4H4OB 3MXMA 3QZ8A 4B9TA 3L2VA 1S9EB 2XI3A 4CJUA 1JXBA 4ZVEA 4IR1A 3GIKA 4FJHA 5L1JA 4URSA 3LP1B 3OS2A 1F21A 4PWDB 2AJQA 5DGBA 5J2MA 1TKDA 4MIBA 1A5XA 3PW5A 1Z25A 2W9CB 4HVJA 4I7FA 4DFMA 1CSJA 5K14B 4F4WA 4O4GB 3H2LA 4EP4A 3EZ5A 4NZ0A 5KFEA 2YNHA 3O3GA 2ETJA 1JX4A 3BQ1A 3QO9B 1D9DA 2FVPA 3HP9A 4N41A 4ZTFA 1RYSA 4IFYA 2YHAA 1YTAA 1JLGB 1KFSA 1KRPA 4DQPA 3CJ0A 3QZ7A 2PZSA 1RILA 3Q8PB 3GIIA 3I5AA 4B9SA 4KHYA 3BR9A 4CF2A 4CEOA 1R0AB 2VG5B 3C6UA 5KGWA 3OLBA 4F2SA 2FBTA 3K5OA 2YHBA 1T7PA 4CESA 1ASWA 4DTJA 3HVTA 4HKQA 4ZPBA 3LAMA 1S1TA 3LP2A 3PX6A 4JUZA 4Y3CA 2WHOA 3AO4A 3AA5X 1NKBA 3PO5A 3JSMA 4I2QB 3DOLA 2B6AB 3H5SA 4ZP8A 1BQMA 2IJFA 3DRSB 1SH3A 4I2PA 4N5SA 4NLVA 2RDJA 2JEGA 3QEPA 2AWZA 1RT5A 3QGGA 1HQUB 4CEEA 3IRXA 4B9LA 4Z4GA 3KHGA 1TL1B 4CJSA 1C6VA 4K4WA 3IGVA 4TXSA 4RZRA 2G8HA 3GYNA 1WSEA 3CJ5A 2PY5A 3MECA 4Y34A 1Z26A 4CGGA 1XC9A 1K1SA 3A2FA 4QWBA 2XC9A 2G8WA 1LWFA 3V1QA 3D5MA 3CDUA 1FK9A 3OLAA 3SJJA 2I1RA 2AX1A 1LW0B 2EX3A 5F8GA 4RG8A 4DS5A 2FBXA 4YR2A 1BL3A 3KMSA 4FZYA 3Q8QB 3GV5B 4K4UA 3NF7A 3VQ9A 4DLGA 2YNGA 3BGRB 5L1LA 1CZ9A 4AILC 4ZMMA 4CHQA 1KSPA 5E41A 1NK9A 1HYSA 2ASDA 3DOKA 1T94A 1S1UA 4KKOA 4KB0A 2HW3A 1GOAA 3HP6A 1T8EA 3BDPA 4DTOA 1N5YA 3DLEB 2J6SA 2ZKUA 4DTMA 2QKKA 3KD5E 1NKEA 4K4YA 4LD0A 4TY8A 3K5NA 2BQRA 3MECB 1JLBA 3M8SA 4Q0BA 2E6LA 4EBCA 2YV0X 5KG0A 4FJLA 3L2UA 4EYIB 1RT4B 4DEZA 2JC0A 4DFPA 4F3TA 1CLQA 1HMVB 3LP1A 1JLCB 2AGQA 4IG3B 1SH2A 4DU3A 3WNHA 1DLOB 4W5RA 5L1IA 2UUTA 4IH7A 4ZPCA 3VQCA 4RNMA 4DQRA 3NGIA 1SV5A 1QE1A 3M8PA 5FDLA 3DLKB 5F9NA 4RUCA 2FBVA 1JLEB 2XY5A 1BCOA 4F2RA 4R0EA 2FBYA 1XR7A 2HHQA 4C8OA 2RKIB 4DL3A 4ED6A 1LWCA 3C6UB 1S4FA 3V9ZA 1TP7A 3QERA 4E89A 4EP5A 3DLRA 2B5JB 4FBUA 4YQWA 3HJFA 1N56A 4DSJA 4KHSA 4KBIA 2Y1IA 4IH5A 5HROB 4M45A 1KVAA 3C6TB 4TQRA 4M41A 2KQ2A 4FM1A 2G8VA 1N4LA 4CEAA 2FVCA 4ECRA 1W0HA 4CF9A 1BQMB 5KFKA 4JRPA 2BGGA 3PJXA 2RN2A 1T3NA 1LWCB 3CIZA 2B6AA 3V1RA 1DTTB 1RT5B 4IFVA 3BSNA 4CFDA 3O4NA 3AVFA 1TGOA 4FZZA 3DOLB 4B9VA 4TQSA 1NK4A 2GIRA 1RAJA 1DTQB 3H59A 1X9WA 1REVB 5CYMB 3G86A 4CJRA 4AHUA 3ICLA 5HBMA 4MQ3A 5HP1A 3IS9A 2D0BA 4LY7A 2XGPA 3L2QA 3PW4A 1S6QB 4KAIA 1TKZB 5DQHA 1EP4B 4DTUA 4K4XA 2GUIA 4KTZA 3SYZA 3H4DA 1NNDA 4QOZB 4RW6B 4MH8A 3TI0A 4RW8A 5JXSA 3MXIA 4OKJA 1TAQA 3KLFB 4IRDA 1D8YA 4GW6A 2E6MA 3ITHA 4CERA 2AQ4A 1D5AA 1FK9B 1HNVA 2BANB 2WRMA 2OYQA 3VA3A 3JYTB 4O44B 1TK0A 4XPEA 2JGUA 2OZSA 4H54A 2X6NA 4QW8A 5KFUA 4KHRA 3CM5A 4AHSA 4ECQA 2W42A 1XHZA 2GIQA 2JEFA 3ZSVA 3S3NA 3NL0A 4C8KA 1RTJA 5JUMA 1S0NA 1L5UA 4M3RA 4NLPA 1JLBB 5C5JA 4FCYA 4CHPA 4FZXC 5CYMA 2FVRA 4NLGA 3DI6B 3D28A 4AHRA 3SUOA 1N5YB 2IOCA 3B6PA 4CEZA 2FJWA 4H4OA 4M3UA 2HHUA 2XHBA 1S1XA 4CECA 2ZD1B 4ZP6A 3LP0A 2ASLA 1TV6B 1L3TA 4CFCA 2HWHA 3LZJA 4MK7A 4YFUA 5KG5A 5KT5A 4OL8A 5KFHA 4X2BA 1UOCA 5J2NB 3VQDA 2V4RA 1ASVA 2R2SA 3UR0A 4FJ5A 4BACA 4KV8A 1QTMA 2F8TA 4LQ9A 5C42A 4EEYA 1GX5A 2HNYA 1RBVA 4ECTA 1W25A 3ZT1A 1Q9YA 1JLQA 3TAQA 3LP0B 3ZSXA 4O4GA 2YKNB 4E3SA 3G6YA 5DLFA 1ZTTA 1ZTWA 3MEEA 2C28A 2G8KA 1JLEA 2FVSA 4XIUA 1JLAA 3I0SA 4XPCA 4ECUA 4K50A 4FM2A 5KFBA 3AO3A 2HNZA 4FK4A 3D0PA 2Z1IA 4OPKA 1QHTA 4M3WA 3QLHB 5KFOA 1YVUA 4HYKA 3QYYA 3QEVA 1U04A 4YR0A 5HROA 2XCAA 3FFIB 5J1EA 4FJNA 4O0JA 4NCGA 4O3QA 3ZSQA 4I7FB 4O3PA 3NF9A 2V9WA 4YNQA 4HUGA 3LWMA 4NLQA 5EWFA 4DTRA 1TKTB 2YNHB 1A5VA 2XRIA 1HPZA 5J2NA 3OS1A 3HT3A 3HHKA 4KB1A 3P5JA 4UQGA 2OPRA 2D3UA 4WYLA 4EO6A 4RW4A 3T19A 2BE2A 4N47A 5KFNA 2ATQA 4CEQA 3SNNA 2KW4A 1SH0A 4J9LA 1CXUA 3BREA 3G0ZA 4DQQA 4Z4EA 1U48A 3CJ3A 3OYLA 3H5UA 1NOYA 5KTQA 1TL1A 4WZMA 5DMRA 1RT1B 4DL7A 3M8QB 3JSMB 2BE2B 1QSLA 4URQU 1RDBA 4KPYA 3OL8A 3SQ0A 1UA1A 3DRPA 3NGDA 4JS5A 2XY6A 3RB3A 5C25B 5KFCA 2BRKA 3SCXA 1XHXA 1VSLA 5KG6A 4Y2CA 4G1QB 3RTVA 5DGAA 1HARA 2OPQA 3ZSZA 1GX6A 4NLTA 3V6KA 3MEDB 4FLZA 4QW9A 1S1UB 3HSTB 1S5JA 3SZ2A 3GIJA 4DSFA 3AVGA 4KFBA 1IKWA 1XR5A 4KE5A 2IBKA 3MR6A 3UDLA 3MAQA 3S9HA 4FLXA 3V1OA 5CY4A 5KFMA 1JL2A 1J5OB 5KT6A 1TV6A 4CIEA 4E7JA 3LANA 3UPFA 2R8IA 4BE2A 1RDCA 1QS4A 4KV8B 3MXJA 4J9PA 2I5JA 5F8HA 1IKWB 3QESA 2IJNA 3SFUA 4LSLA 4CJWA 3V81A 3QGHA 3H5YA 4WFXA 4RU9A 3KIOA 2VG7A 4EO8A 2UVRA 1IO2A 2A1SA 2C2RA 1HYSB 1QAIA 3KKSA 3LP3A 3RB0A 5EU7A 5EUHA 3DYAB 4J9SA 5C25A 5F8MA 4ICLA 5KFDA 2AGOA 2DPJA 5HRNA 4NYZA 1D9FA 3OJUA 2RDIA 4FXDA 3ZT3A 4YMEA 2IAJA 2W7OA 4JV2A 4FJGA 2VG6A 1RT3B 4MIAA 4CGJA 2FJVA 1O1WA 4F4ZA 3AO1A 1NK0A 4BE1A 1EETB 2WONB 4KTWA 1D1UA 5J2QA 1HQEB 3QIPA 2GBZA 2J6TA 3KK1B 4E1MA 3SV3A 1IH7A 1IKYA 4M3YA 2Z1JA 4AHVA 4RNFA 3S3MA 1RT6A 5HLFA 4CIGA 5KFWA 2HMIB 3ASMA 1TKTA 5KFIA 3BQ2A 1S48A 4FW2A 2ZE2A 2B4JA 2WOMB 2X74A 1RNHA 1ASUA 3OYKA 2UVVA 4IQXA 4O3NA 2WB4A 4NCGB 3NKYA 3H5XA 4C8LA 3EPIA 4ECZA 3NH0A 3IG1B 3K59A 4KREA 1S1VA 1X9SA 2W7PA 3QEWA 3FQLA 4J9MA 5C24A 4ED7A 1UAXA 2YNIB 4FK2A 4RW7A 3NAHA 4F4YA 2ITGA 3VQEA 2KTQA 5CYQB 2DPIA 1LW0A 4TY9A 2W9CA 4KO0A 4FYDA 2C2EA 2UVUA 4QWDA 2RPIA 3VQBA 3RMBA 3DRPB 2J6UA 3I0RA 3AVKA 2Y1JA 2YKNA 2YNIA 1S10A 4CHYA 2W9AA 1JLGA 4CEBA 5DK5A 4RW9A 1RT2A 4MFBB 2Z1GA 4QWCA 3PHEA 4IRCA 1KVCA 4EBEA 5KT7A 2YKMB 2WCXA 1KLMB 4DU4A 1NOZA 4TLRA 2R8JA 3AVNA 1XR6A 3NAEA 4BDYA 3LP2B 4ZVHA 5F8LA 1X1PA 3DM2A 4NLOA 4R8UB 2ATLA 4KHQA 3T5HA 1ZETA 1BQNA 3KK2A 3SI6A 1TAUA 4WXOA 3U3YA 1NJZA 4TY8B 1LAWA 4OPJA 1VRUB 4KHUA 2DFEA 2XGQA 1LAVA 3AO2A 2OZMA 1KHWA 5J2PA 1J5OA 3CQ8A 2C22A 4R8UA 3KLGA 2FC0A 5FRNA 1HPZB 1RT4A 2UUWA 4OKEA 4CIFA 4J9OA 1TKXB 1RCHA 1YT3A 2HNDB 1KFDA 5HRRA 1MU2A 3VQ6A 4M3ZA 2BQ3A 3V9UA 2AGPA 4WFYA 3TANA 1Q9XA 3ZT4A 3TAFA 3K5LA 1NK5A 3VQ7A 4CF8A 4FJJA 1WLJA 4NCBA 4ED2A 4CGDA 4LSLB 5J2MB 4DQIA 3U6FA 4TSXA 3MR2A 3OYNA 1S9GA 3RWUA 3DRRA 4JV0A 1YVFA 1NK6A 1S0OA 2WONA 1T05B 4DSIA 3DM2B 1C0MA 1WSIA 1HQEA 4E7IA 1C1BB 1RT7A 3V6DA 1EETA 4CEDA 2FVQA 2HHWA 4O3OA 2XY8A 3BJYA 4KKOB 3C6TA 2IAJB 2FJXA 4GMJB 4EBDA 1VRUA 5DLGA 1KLNA 4CJLA 5I42A 3OHAA 3OYMA 5J2QB 2HHVA 2BR0A 3PX4A 4CCHA 3TAGA 2R8GA 2E9TA 1Z4UA 3CO9A 2R8HA 3IGNA 4F8RA 3FFIA 5DQIA 1VK0A 3I0SB 4ECYA 4LQ3A 4I9QA 2G8IA 1DTQA 2HHTA 1XI1A 1VSIA 4JV1A 1S1WB 1HNIB 3KLHA 3V4IB 4NLUA 3OYFA 5I42B 2Z1HA 2HVHA 2IGIA 3F73A 4DTNA 1U4BA 1QQCA 2XY7A 3AVAA 3OYJA 3E01A 1RDDA 4J2DA 3N6LA 5EWEA 2VA2A 1VSMA 4ECWA 3KKRA 1TQLA 4CJKA 3Q8RB 3HL8A 5L9XA 5KFXA 1JKHA 4IG3A 4O5BA 4CHZA 2YNFA 3AV9A 3ISNC 1WSGA 1RYRA 1YTUA 4ELTA 4BWMA 3HVWA 3L8BA 3CFRA 3ZT0A 5KG4A 1SKSA 4K8XA 4O44A 4DL2A 2D3ZA 3G6VA 1WSHA 3DLKA 3HKWA 3QEIA 5KG2A 4K4TA 3ZSWA 2QXFA 5K14A 1ZYQA 4JRQA 2VG6B 2V4QA 3PV8A 3EYZA 1WN7A 4IKFA 4FJ9A 2JC1A 1GOCA 1BGXT 2W8KA 4KAZA 1BQNB 4IFYB 3HYFA 4ELVA 3PW2A 3LALA 4IDKA 1J54A 1TL3B 3M9NB 1C0TA 4XO0A 4TN2A 1HNIA 4B08A 3H40A 1RT6B 4FM0A 4KHNA 3GV7B 3OYIA 3FDSA 4Q8EA 3M9MB 2KFNA 4WYWA 4DU1A 1TVRA 3U3GA 3T5KA 3QINA 3T5JA 3KLGB 4Z4FA 1VSDA 3RR7A 3OL9A 4I9LA 3HPOA 4B9NA 1S9FA 1KCFA 4G1QA 4KSEB 3EZUA 4J9KA 3HM9A 4FLUA 1CXQA 1HRHA 3PW0A 5KRTA 2YNFB 4KRFA 1RTHB 2P51A 4DMNA 3QNNA 3DMJA 4Q8FA 1IG9A 4RNNA 3S3OA 2YNGB 3BGRA 4HUFA 4NLYA 1S6QA 1TKZA 2RF2A 2PYJA 3IS9B 3NF8A 3AA2A 5I3UA 3VQSA 1JLCA 1B92A 3BSOA 3LDSA 3PVXA 4FW1A 2HWIA 5KFYA 1VRTA 2VWKA 4B9UA 3CVKA 4K4SA 1RTIB 1RBSA 1C1BA 4W5OA 1NHUA 2XO7A 3MTKA 4DF8A 4DLEA 3K57A 4C8NA 1RA6A 4FLVA 1UWBA 3NBPB 3PR5B 4CJ3A 4FLWA 3HPGA 2EHGA 5KG1A 5KFVA 3ZT2A 3MR3A 3KK3A 4KFBB 4HCBA 3DYAA 1BCMA 3SV4A 3RAQA 3SFGA 1J9AA 1D0EA 4J2EA 3KLEA 4OJRA 5KFSA 3IRXB 4E7KA 4WFZA 1S1XB 5KFJA 3OY9A 3V6HA 5JS1A 1RT3A 1WSFA 3PUFA 3KLHB 3V9WA 1C1CB 3WNEA 1FKOB 3HPHA 3NCIA 3B6OA 4CJQA 3H08A 4PUOA 2OPRB 1FXXA 3G10A 4CF1A 1IM4A 4DWIA 2O4IA 4MKBA 2IM1A 4DSLA 4DSKA 3DLEA 4CJFA 2P5OA 3OSPA 4O3SA 4Q44A 3PR4A 3NDKA 5T7BA 4RNHA 1JLFB 4LSNA 4MK9A 4CGIA 3H4BA 3QIPB 2XI2A 1IKXB 3RMDA 3TR8A 4DL5A 3AVHA 5DQGA 4FJIA 2V0NA 4MK8A 3KJVA 3CDEA 4KO0B 2CJQA 3DRRB 3FQKA 1G15A 1T05A 1JLFA 4LSNB 1CZBA 3NMAA 5KFLA 4ZPAA 3GIMA 3PY8A 1Y97A 2OPQB 2IM0A 5CYQA 2DY4A 4AH9A 1KHVA 1RTDB 3SQ1A 2DFFA 4W5TA 1J53A 4RNOA 1FKOA 3AA4A 1ITGA 5JS2A 3QEXA 3CG7A 3KOAA 4QWEA 2IC3B 5KT3A 1EP4A 4HTUA 3OJSA 3M8RA 3IG1A 4BE0A 3N6MA 1GOBA 3TQ1A 1HQUA 4CJPA 4FJMA 5SWMA 4B3OA 1WAFA 3MFIA 2D0AA 3I0RB 3L2RA 3KLFA 3SUPA 4ZVFA 1T03A 3MR5A 3NH1A 4E0DA 3VQAA 3CM6A 3MEGB 3NE6A 2Q3SA 3I5CA 4RUAA 3D45A 3BSAA 3DLHA 2OPPA 4NLDA 3KK2B 3KHHA 2VA3A 2LSNA 5KFRA 2EC0A 4E1NA 4IG0B 2AU0A 4Y1DA 3CJ2A 3OYCA 1EXQA 5KG3A 4CEFA 3ZSOA 3UQSA 3OYGA 3NHGA 4DFKA 2B5JA 1VRTB 4FS2A 1REVA 3DDKA 2NUBA 3TAEA 4CJTA 4RW9B 1UWBB 1C0UA 3RBDA 4OLAA 1MU2B 1RT1A 4FS1A 4DS4A 2QKBA 1VSHA 1WSJA 3TVKA 3DLBA 3ISND 1RTIA 4ID5B 1JXEA
chains in the Genus database with same CATH superfamily
3E2EA 2W4CA 1VSKA 5SZTA 4ZP7A 4CJ5A 1H98A 1WC0A 2DCUB 3SQ4A 3TRGA 1RI7A 4DL4A 3DXMA 3D66A 3ZSRA 3B54A 4OZ0A 3O9TA 3T6JA 1VSEA 1NHVA 2VDIA 4OYAA 4Q45A 3RGIA 5EDWA 4CDIA 1RWWB 3TP2A 1H2UX 2VFTA 4LBHA 3BBBA 5LSRA 4BCAA 4IFEA 1RE1B 1RKIA 2ROEA 3ELHA 3AVJA 5HRPA 3LPTA 2B7BB 3EY1A 2XHCA 2WVFA 1S1WA 1XWLA 2BQUA 4HHJA 3VA0A 1RWUA 3VQPA 2WSFC 4Q0BB 3FCWA 5ETVA 1JJCB 1D09B 3AD7C 1HBOB 4JI3F 3T3FA 4Z0UA 1QE1B 2OJ3A 2HFVA 1NGAA 1J5EK 3SXLA 5I4MA 4OVLA 4JS4A 1IKVA 1SV5B 4HHHA 4X4OA 4WXWA 3VV2B 2Y9HA 2W2MP 4KI6A 3BN7A 1OQ3A 2R7SA 2HNYB 4H4MA 3K5MA 3CJ9A 1JLQB 4NZ6A 3OA9A 1CJVB 5M2UA 1FFSB 2KHDA 3C8YA 3W5XA 1IKVB 2ZOGA 3G82A 3T69A 5L1KA 3QRQA 2E1MC 3ENVA 1HR0K 2Q6BA 2KKZA 3W61A 4B3OB 4CTAA 2IDOA 4ALZA 1VK3A 3MEGA 2R7TA 5KI6A 4EIAA 2VG5A 2XWXA 2OPPB 3GILA 2YWWA 2IVMA 3P45B 4JI8F 1C2PA 2Z2YB 4C0BA 4OGEA 5JMVA 2AIRB 3VETA 3QGPA 3CCQN 2YJFA 2KT5A 5BN8A 3RAXA 4DXLA 4IWVA 3IN5A 1U2FA 1I5OB 4ILLA 3QO9A 3DJCA 2HFOA 3MMAB 4YP3A 1HWLA 2D41A 1S1TB 3PZPA 3WXIA 4WU2A 5AZIB 4WTYA 3D1OA 4ANEA 5AFUA 2NCKL 1YUWA 4ZCKA 4DF4A 3I9V9 4BC9A 5AQYA 1K9MO 3LWLA 4FJKA 2N7YA 4MFBA 1HQ2A 4C3MA 4EZ6A 4JI0J 3L4BC 3TYTA 3EEQA 1L3VA 3M7VA 3DLGA 5F1XA 4K5RA 3VZHA 4XEIA 4V19J 1M1HA 4EFAC 1HHSA 1NO8A 3M2UB 4WPAA 2HHXA 4DUYK 4BRIA 1OKJA 4P52A 4PWDA 4FJ7A 4B1UB 3NWRA 3G4SS 2E4LA 3P5BP 5IWAK 5B08A 2VKRA 4H8KA 1L3UA 1S49A 3H98A 5KQ8A 3J7ZT 2J9EA 1B64A 3HDSA 2MLXA 4PQAA 1TKXA 2KJVA 1WEZA 3HZGA 3BM7A 4JI5J 2NRWA 2XMMA 1F6TA 4LF8J 3CCJS 4IUFA 3N6NA 2VFUA 2PD1A 3HHLD 2PI4A 5D0EA 4GC6A 1XMOJ 5D0HA 1AZSB 4HDHA 2Z57B 3N01A 2P5GA 3TOQA 4DL6A 1S9GB 4DKWA 5HJXA 1QDUB 2MZ1A 2HRYA 3FMWA 4CHNA 4KHWA 4OX6A 3GWCA 4C3LA 5FPDA 3VQ5A 1S1VB 4QPXA 1KVBA 3PW7A 5KOWA 3MR7A 3A3PB 4BVOA 2Q66A 2RKIA 3AD8C 4E19A 1ZBUA 4J5OA 4DR7J 4USKA 3CJ8A 3CD6S 3MF5A 3OXFA 2KFZA 1VHFA 2A1BA 4M7XA 5G4DA 2E1YA 3L6QA 2HBRB 4QPTA 1JL1A 3K89A 1VQLN 4EYHB 2V63A 2VG7B 4M95A 1S7HA 2XZTB 1OO0B 5AQLA 2HF3A 1KNZA 3D2WA 4OX8A 1W9HA 2MEWA 1VYAA 3L2WA 2EFNA 4FDFA 3QGIA 3G6XA 4GV9A 4OZ3A 4N8NA 1Z6RA 2PC6A 2Z30B 3CDWA 4N56A 1OY8A 3MXHP 4NEYA 3NH2A 1QUVA 2J8AA 4DV1F 3KLIA 2AP6A 1FJGK 4IFVB 4O8UA 2HFUA 1CJKA 2O67A 3T5LA 3BEXA 3AOAA 1F3FA 3G2XA 2ZEJA 2EFGA 4ECVA 3WC0A 4J9QA 3RJMB 2FHKA 1GMWA 3R5JB 2WTFA 1NKCA 3W3DA 1VQLS 4C11B 1X3MA 4DTPA 2DVIA 3CC7N 3WNGA 5G0RB 4OHWA 3TAMB 1JIHA 4TLQA 2HIYA 3OVNA 1GMWD 4FLYA 3K2PA 2XLIA 4M42A 3WNFA 2V52B 3V9SA 1S0MA 3C19A 5GIPA 4JI1F 1RBUA 1YG0A 5AQUA 3LF0A 4R25A 2E7WA 4DCPB 3THXB 1YJVA 2MSTA 4PYAA 4WWSA 1JNZB 3JYTA 4B17A 4CF0A 4DV3J 2DTUA 3SPYA 2ZH1A 2QE5A 3H2UB 5FDLB 4IOBA 1FRHA 4FK0A 1C0UB 4CLSA 5KPZA 4PRFA 3Q8SB 5F41A 3D6FB 4B3MJ 3VVTA 3KLVA 1P9YA 2DY1A 2NXNA 2F5GA 1WNSA 2NUUG 2MZJA 3AB4B 4LF6F 3VEXA 2CPZA 4Z2XA 3R7SB 2DCLA 2MY7A 3SBMA 3WUHA 3HFZB 1VQNN 2RMLA 3HVAA 2OPSB 3CJBA 3NCPA 2Q0UA 4PXBA 3C16B 1Q86O 3MEDA 2F96A 3KK1A 4JI3K 1UZDA 4U7CA 2IC3A 2WVBA 1SAZA 3MXMA 1TUVA 2BM0A 2Y1RI 4RUBA 3UD3P 2RVJA 2ZH6A 1PYOB 3LTOA 3IA0A 5E3RA 5AQJA 2P9GA 4MDBA 1HFEL 1CJUA 4R0JA 2ACMA 3LP1B 3OS2A 2C1EB 1BQXA 2AJQA 1TUUA 3J80Y 5DGBA 4BRDA 5J2MA 1VQYA 1QVFR 4YB1P 3L95X 3BGFA 4A47A 4YDXA 4HVJA 1YKWA 4I7FA 1HLUA 3BF3A 4DFMA 3VGVA 4F4WA 4O4GB 2I38A 3W2VA 3EZ5A 3KHYA 2ETJA 3QO9B 4CH0S 3QNWB 4WQ5A 4ZTFA 1PYSB 1YTAA 4ZLNA 4ILJA 5CZXA 4DQPA 3PFOA 3CJ0A 3QZ7A 4K5SA 3CC4S 1OJ4A 3BR9A 1YX2A 5L8RC 3CCQS 1RDWX 5CH7B 4CEOA 1EWQA 1R0AB 2VG5B 3K8WA 2AZ1A 5LJ5Y 2YHBA 1HNXF 1T7PA 1WACA 2ZM6K 4PL8A 2JFKA 1AT1B 4HKQA 3LAMA 1S1TA 3A8EA 2F4VF 5ITHA 4X4SA 2WHOA 5J1PA 4USIA 3DOLA 4ZP8A 2HPUA 2DRAA 1BQMA 2A40A 3DRSB 2H9ZA 3QEPA 2CPXA 1RT5A 3QGGA 4CEEA 3I56S 4BC4A 3LDLA 4BHQA 4YHHJ 1TL1B 4DZDA 4CJSA 2GUPA 1C6VA 4M8LA 4PAAA 2FJDB 2PY5A 3MECA 1URRA 4Y34A 1CS4A 1Y10A 2BVZA 3VAGA 2FZCB 3CC4N 1K1SA 5KPRA 2OGUA 2ZOMA 4X62F 4ANCA 3RVCA 1ACMB 1FJGJ 3N79A 2COLA 2FBXA 4DR4K 2FY1A 1IV0A 3BGRB 1T02A 4A8FA 1CZ9A 3CO0P 5H9FK 3CXCM 1W97L 3R3LA 1KD1O 2PDAA 2HVZA 1NK9A 3SSSA 3P96A 1HYSA 5BR8F 4L73A 1HKAA 4JYAF 4KB0A 4B3RJ 4OO1J 3HP6A 3TEGA 2PMHA 3LGNA 4NEZA 5L9NA 1NPPA 4LFCJ 2UUAJ 3DLEB 2J6SA 4ZJOA 2HVDA 2NZCA 3EX7B 3BGOP 4JBCA 2IMOA 2BABA 2ZGYA 3IR6B 4Q0BA 4QIGA 3E1YA 3J7ZO 4EBCA 4DV3K 5AQZA 5KG0A 1K8AT 3L2UA 4EYIB 1TMMA 4IEEA 5A0YB 4DEZA 4F3TA 1HMVB 4M7YA 1JLCB 1NXIA 3IFEA 1FDDA 4DU3A 4AQYJ 2XYHB 4LVNP 3ZTSA 3GG1A 1PAUB 1VOMA 3VQCA 2EC2A 1SV5A 1QE1A 3M8PA 2VFRA 2NSBA 2FBVA 1MMDA 1BCOA 2HIQA 2XY5A 3O08A 2HHQA 4YOTA 2RRAA 2O8BA 2YY3A 4JI4J 5FPNA 3V9ZA 1NNEA 1TUGB 4IO9Q 2QM1A 4OJ3A 4KHSA 2JZ5A 4LR7A 1VQKS 5DDOC 4LF7F 3C6TB 4Y6IA 4JI3J 2KQ2A 2G8VA 1N4LA 1YSJA 3JAMU 1M1KO 1W0HA 1V3ZA 2VL1A 4JRPA 3PJXA 2RN2A 1LWCB 3CIZA 2KM8B 4DR6F 4U8YA 3MOJB 4E2FB 1VRQC 2XMJA 3BSNA 2DNZA 4DV7J 1X4AA 1EKRA 5GVQA 4FZZA 1R59O 3GSIA 4TQSA 1NK4A 3TZWA 1CVJA 3H59A 3DU6A 3H1QA 4BC2A 2VQFK 3U1NA 4GVLA 2D0BA 1SC4B 3L2QA 1S6QB 4DV3F 4E8UA 3KVGA 4K4XA 2GUIA 3U9DA 4KTZA 1A9NB 2BJ3A 2LXIA 3OR1A 1X5SA 4A8XA 2FZKB 1HUXA 4QOZB 4RW6B 4MH8A 2CG4A 3J8AA 3IWLA 3MXIA 1V6HA 4OKJA 3MZIA 2D3OR 4WP9A 2NRHA 1DY3A 4DV5J 4IRDA 1FDNA 3JSYA 2L9WA 2E6MA 5FPMA 2JWLA 4CERA 3QSIA 2AQ4A 3CULA 1DFDA 4QR1A 1VFJA 2AP1A 1HNVA 4KHPJ 2HBQB 2N4CA 2PE8A 2HFNA 1OPZA 1FWLA 3C14A 4QJVA 1O6XA 4KHRA 2Q6CA 3CM5A 4AHSA 1TU0B 1EKSA 3TR5A 2P9EA 3S3NA 1ZM3A 2CDQA 1RTJA 2XNRA 2RU9A 1P1LA 4LF5F 2VOOA 1FI4A 3ENOA 3FSYA 1JLBB 2R3VA 2CQHA 4FCYA 3AFGA 4PL7A 4DR7F 5CYMA 1WJ9A 2FZGB 4NLGA 3SUOA 4HR2A 4M3UA 2HHUA 1S1XA 3CF5L 2ZD1B 4ZP6A 1TV6B 1L3TA 1SKUB 4GVBB 2HWHA 3SQGB 5KG5A 5KT5A 4JKDA 4OL8A 4B9QA 1IBMK 4CP5A 5IQQA 3UR0A 1QTMA 1X4BA 4IOAQ 4LQ9A 5C42A 2KRBA 3M6XA 1SJRA 3Q7BA 4ECTA 1YJ9S 3W3SA 1JLQA 2ZBIA 1RHQB 1QQMA 1W7AA 3ADAC 3HSCA 4E3SA 3C14B 2HURA 3G6YA 3T1HF 3ZC4A 1K9MT 1ZTWA 3MEEA 4HDGA 1M0SA 2VPXB 5KFBA 2HNZA 3VPZA 2Z1IA 2ZM6J 1QHTA 2B4PA 4M3WA 3QLHB 5KFOA 1YVUA 2F9WA 3NRBA 3H3OB 1F1BB 2ADCA 3QEVA 1IBKK 3OW2M 2RH3A 1KAYA 4YR0A 3TUIC 3ZSQA 4I7FB 3M4XA 1DQAA 3VMFB 4NLQA 5EWFA 2CQGA 2XRIA 1NWKA 3HT3A 3HHKA 2QEXS 2VYPA 2O8DB 1R3NA 3QMQA 3P5JA 4MDAA 2YTCA 4JI8K 3CTRA 2YBVA 5AQPA 3OBYA 2POKA 2IDLA 1IM6A 2DR7A 2KW4A 3FSXA 3TTCA 3ZETB 4J9LA 1BWFO 4Z4EA 1IJJA 3HT0A 3UKRA 1OH6A 2BACA 3OYLA 4ATNA 3HHLA 1K44A 3D68A 1NOYA 4WZMA 2HQDA 2CQIA 3VESA 2KL8A 1VMBA 1S0VA 4M5DB 3JS9A 3SQ0A 3NGDA 3RB3A 5C25B 2RQKA 2BRKA 3OBIA 3BF4A 1FDBA 5KG6A 5AQTA 1DGKN 3ZSZA 4CO4A 1GX6A 4LFCK 3V6KA 1HR0F 3MEDB 4FLZA 1OY6A 1FESA 3O1BA 4JKHA 1FJ7A 4DSFA 2W25A 4JYAJ 4DV2K 1VC6A 4NZ7A 1PJ6A 1BA0A 2ZJRL 2GMJA 3DGPA 3DDIA 3D7EO 1YHQS 4DV5F 2DY9A 1JL2A 3HHLC 5KFMA 1URNA 1NCLA 3UPFA 1E6YB 1FRMA 1SJ3P 1RDCA 4BE2A 3A1YG 1HX1A 5B0BA 2OSQA 4K2XA 3R8EA 4LSLA 3SEOA 1TL7B 3OXLA 1DKGD 1WSVA 2A1SA 2QFIA 3O6QA 2RE2A 3RB0A 4K25A 1VJQA 3HHDA 5EUHA 1DAXA 4UT4A 2YX4A 5IXUA 1U1NA 5C25A 1M5KC 2ITMA 1H73A 3D1HA 5D0RA 5BYQA 2IJRA 2DPJA 5HRNA 1D9FA 3JAMY 4K0KJ 3CW2C 1G1XA 4FXDA 3DHXA 1FXRA 3ULEA 2YHWA 4FJGA 1WDTA 4LF6K 3UCGA 2FJVA 1XMQJ 3D9BA 1EETB 4B3MK 3UNYA 3K2YA 3KKFA 1HQEB 2E5GA 1WEYA 4ZCIA 2Z1JA 4FO0A 4MMOA 4DPYA 3S3MA 2FIUA 5HLFA 4DPXA 4H0XB 1WI8A 2V2KA 1Q81O 5D15A 1TKTA 2ZZNA 4X4UA 4I68A 2WOMB 2J0XA 4ISEA 2BYCA 1RUSA 2RE1A 2CVEA 3ZFVA 4WIIA 3EPIA 3CJQA 5ADZA 2C2MB 2JVRA 4KREA 1ZM2A 4HEA9 4DV7F 4J9MA 1X4FA 4ED7A 2AMCB 4PG5A 1ZXOA 2YNIB 4ITSA 5AXKA 1PAEX 2XHWA 1GTEA 4F3QA 3MUVP 4RW7A 2EPIA 2GQQA 2A0FB 2QT7A 2YQ0A 2DPIA 4TY9A 1FJCA 1JNRB 1U1RA 4QIEA 5E2QA 4DV4J 2C2EA 5JLFA 3THYB 1LOTB 3OR1B 1U25A 1Y4ZB 2IPOB 5LM7E 3RMBA 2J6UA 3AVKA 3O5TB 3J81U 2YNIA 4CWBA 3TJ9A 1XUPO 4MKVA 1JLGA 2MJUA 1V9OA 2Z1GA 4QWCA 4IRCA 2J0SD 2OTLN 1NGHA 3J7AP 4EBEA 1WOOA 3CQYA 5KT7A 2YKMB 2WCXA 4A5AA 2HBMA 2YWEA 1NOZA 4TLRA 1XR6A 4ZVHA 3AA8A 4F36A 3CMAS 1UFLA 3G25A 2OEKA 3VGTA 2LU2A 3CCES 3N9UC 2PN6A 5JVGL 1Q0NA 4M5NA 1NJZA 1HWJA 2VJUA 1M5PC 1IJEB 1Y5NB 2PAVA 1NBWA 4RTFD 1LAVA 1EQ0A 2CNOB 2GMHA 3J7A1 4PG4A 4KHPF 4JK8A 4DR4F 4YOYA 1HPZB 2LQBA 2W1BA 2LU1A 3L7PA 2UUWA 5A0YA 3Q2TC 3KNGA 1S77D 5LMNJ 4CIFA 1N5QA 4UUWA 6AT1B 3VQ6A 3VGLA 2AGPA 3TANA 3UN3A 3K5LA 5AJ3J 1WLJA 3CI5A 3QMLA 1LWXA 4USMA 5LT5A 2OTLS 3GJSB 2LCWA 4DX7A 4OYBA 3NS5A 3QT5A 3NNCA 3OYNA 3LDPA 2B51A 4BR0A 1M1GA 1F9EB 1S0OA 4FF3A 5AQWA 4DOZA 1C0MA 2EG1A 1RT7A 2B56A 2ZGZA 1XEZA 2FVQA 2HHWA 4M5DA 3C6TA 2DH9A 2XMAA 2FJXA 4DR4J 5HMZA 2E44A 5AT1B 3UI3A 2EK1A 4CJLA 3OHAA 3MPUB 2V94A 3OYMA 1YJ9N 1WOQA 2KHOA 3TAGA 2R8GA 3CO9A 3M2RB 4V19S 2YKPA 4PKIA 1YJTA 4KYZA 5DQIA 4GNIA 2FHOB 2G8IA 1QAYA 3DN9A 3N4QA 3KLHA 3V4IB 3J80O 4LFBJ 2QWNA 5I42B 2GGPA 3BEGB 4X84A 3F73A 4H0VB 4YORA 1AUSL 2UXCJ 3CJTA 1RDDA 4FN5A 3N6LA 5EWEA 1VSMA 4ISGA 4CZKA 1NM1A 3Q8RB 3HL8A 2JL9A 5C7PA 4O5BA 3SQOP 4QOTA 2YNFA 3AV9A 2ZVIA 3VAFA 4MJKA 1HBNB 4NYOA 2EXUA 4CD1A 1WOPA 3CFRA 3ZT0A 3NCRA 1FF2A 2VBWA 1SKSA 1UFWA 1GLAG 3G6VA 4ZVRB 3LOUA 3QEIA 3ZSWA 5K14A 5IV3A 4OJGA 1ZYQA 1MN7A 1X3NA 3BY5A 1CBKA 2Y0SD 3K0JA 5DO2A 1N36F 3C6AA 3QAUA 3PV8A 4DN9A 3WX4A 2JC1A 1BGXT 4CLZA 4CT9A 1BQNB 1UW9A 3US5A 3JTNA 2UUBJ 4L75A 3I55N 4XO0A 1HNIA 2HWTA 1PJ5A 2P9IB 4Q8EA 2KFNA 1ATRA 2HBKA 4DU1A 2E88A 2QLBB 4JI1J 3KLGB 4OX7A 1VSDA 4B1YB 3RR7A 2W6KA 4NMLA 1KCFA 1S9FA 3HM9A 4KSEB 4FLUA 2E8AA 3BYPA 3PW0A 2J0WA 1WHYA 2O1PA 2YNFB 4X4NA 1OPIA 3KWMA 3WEEA 2P51A 2H5EA 5AQFA 3IKMA 2D1KA 4K42A 3ZYYX 4NLYA 2I7PA 1S6QA 3SCIE 4CO0A 3G87A 3AA2A 4DR6J 1NAQA 4JI4F 1OVQA 1QY7A 3LDSA 3PVXA 2ATCB 2Y8WA 7AT1B 1GQEA 1Y11A 4LF6J 4K4SA 5EOYA 3THWB 4W5OA 2BUPA 1NHUA 5ELZA 4EFHA 2YJEA 4R79A 2RNEA 1WC4A 2OCEA 1UWBA 2VPWB 2VKZG 2LECA 3PSIA 3KWIA 1YTYA 4WCEL 2UXDJ 3DYAA 3GCXP 3SFGA 3R6LB 1J9AA 1NGEA 5HQMA 1OQ6A 3KUGA 3J81j 4CLWA 1HNZF 3SMPA 1RT3A 2FYXA 1WF2A 4CJQA 3VF6A 1FXXA 3G10A 1IM4A 3QPIA 4NXNF 4F25A 2VODA 3DLEA 1U8SA 3CMEN 4BR9A 4CZLA 2WB1D 3CD6N 3PG9A 3PR4A 3FCVA 4F02A 3NDKA 5T7BA 3W2VB 4MK9A 3ET6B 1I1GA 5DDQC 4J9VA 1RBAA 3ISZA 3CJ7A 2XI2A 3M1FA 2B9XA 4DL5A 2Q3PA 5FPEA 1F5AA 3KJVA 1R8AA 3PRDA 5HANA 3QBXA 3FJ2A 2DNQA 5GAHI 1HNZJ 3GIMA 2OPQB 2V2ZA 3H20A 4O0NA 1RP5A 3GYXB 4YDUA 1KHVA 3H90A 1IR1A 3ZNJ1 4RNOA 4YB7A 1E6VB 2BOPA 3HSGA 1VBYA 1HJOA 5A8KA 5KT3A 3IG1A 3EZOA 3JXOA 3TQ1A 1H2TZ 4FJMA 1ZAXA 3AODA 1VQ9S 3HCXA 3MFIA 3EE3A 3KLFA 4FYYB 2XS5A 4PG6A 3G8TA 3VQAA 2LFVA 5LMUF 3I5CA 4RUAA 4BRLA 2OPPA 1FEEA 2CJAA 2VA3A 4XDCA 1SI9A 3IUCA 5EX3A 4CEFA 4WJBA 2O8CB 2IVYA 3UQSA 2XLJA 2HHHF 3OYGA 1Z2LA 2QTDA 4DFKA 2B5JA 3JS6A 1FE0A 3F5TA 1CULB 1RLCL 4RW9B 1E4GT 1HNXK 4BR2A 1UWBB 3RBDA 4RWWA 4WFBQ 1K8AO 1MU2B 2ASYA 2FSKA 5GAEI 3UCUP 4AXIA 5B0DA 4I67A 1MA9B 1JXEA 1P90A 2W8LA 1XN9A 4KH4A 3AY0A 4ZIWA 2DITA 3P83D 1LW2B 3NBPA 3KLEB 2VHGA 4G3IA 5E3CA 3MM8A 3R5CA 3N5BA 2W9BA 4JHDA 3SUNA 2OEMA 2B43A 3AA3A 1D9AA 1S97A 1XNQF 1ZBLA 1P8GA 1NLVA 2ZC3A 3OV7A 4LF4F 5KRSA 2PO4A 3DRSA 3VEVA 2ILZA 1BHLA 1Q82T 2J8SA 4KI4A 2A2DA 4OYPA 4H5WA 4CGFA 2D0CA 3NCQA 5JVHQ 4FKYA 3QFPA 1IQTA 3KHRA 1BO5O 2F8MA 2WVEA 3C16A 3SJHA 3VQQA 2G8FA 1VSFA 1FNXH 2R7VA 1FW6A 2HVIA 1T11A 3FRYA 5CE3A 1N0VC 1BUXA 2F1FA 4CVNE 3M9OB 4Z4CA 2AYGA 4F4KA 4Q43A 2AEJA 2VOPA 3UVJA 3FBEA 1S59A 2QV6A 1EZZB 4PQUA 2Z58B 1OYEA 4WYBA 3KLIB 4UZBA 3FZLA 1KDNA 2ALZA 3G6EN 4NI2B 5J1EB 1SIZA 3QWUA 3KJVB 4G1PA 5M2RA 2YCHA 1TK8A 3SAGA 1TMJA 3AVBA 1N6QA 4L8RB 4BRNA 1HJRA 5K8NA 3AVMA 2W2OP 4DSEA 1WTBA 4HH0A 2A1RA 2QMUB 1RAEB 2BJ8A 3BBFA 2JEJA 3ZZYA 3JAMO 4DUZJ 3E9OA 3O5BA 3A8YA 4CQ1A 3DXBA 4CJEA 3NAIA 2VASA 5C24B 3EUNA 2IMWP 3VGKA 2E1ZA 4FVMA 2W01A 1T9UA 1NMNA 2J7WA 2A6MA 1X5TA 3KG1A 4Y2AA 2UU9F 3T1AA 3SQ2A 4DFJA 1N36K 2X1GA 4PQUB 5EX5A 5D78A 2PA8D 2CJBA 2I0XA 2JLEA 4H5RA 3T1HK 1NG9A 2HZAA 4F50A 4BWJA 4CO1A 3VERA 3GONA 2IVFB 1U1KA 2XZDB 3IAYA 3V81B 2K7JA 3M8PB 4WK1A 5I3UB 2CQ1A 1N6QB 1MNEA 2BX6A 1KLMA 4ISFA 1KONA 4JI2J 2MZQA 3DC2A 4ZK7M 1TVRB 5L39A 1QUPA 1RT2B 2IM3A 3AXKA 4M5LA 3RU0A 4JAXA 1Y9OA 1ZA1B 3K58A 3X3UA 1HBMB 1EQYA 1N54B 3GJTB 2LXUA 2HQGA 2ILYA 4DCJB 4E7LA 2BEFA 4RO0A 3CCLN 4V1Ak 3CYMA 3DRYA 2IDEA 2B4UA 3I9ZA 1U47A 3G96A 3VZIA 2F4FA 4O5FA 1IKYB 3GFYA 3PIOQ 5DG7A 2QG9B 1V4TA 3O3HA 4N76A 2HNDA 1HR0J 2OELA 4MKAA 1FWPA 4BG9A 5HMXA 3RB4A 3R7NB 4ES2A 5DDRC 4LF4K 1RBLA 3LAKA 1OS5A 1JB0C 1WSRA 2O01C 4EZ9A 2O4GA 2RT3A 2G0IA 4GC7A 3AGRA 4HHTA 2MKJA 4JV5K 3TPQA 3KTQA 5C42B 2DXEA 4OYMA 5A8WB 3RB6A 4A46A 3OVSA 1EHWA 4URGA 3GCWP 2VICA 4EAHD 2NSCA 5CZ1A 2DGVA 1QAXA 4ED4A 5FLXU 5KFZA 3K8VA 2LLZA 4AD6A 5JVHL 1U1PA 4NX9A 4QYZK 4F67A 1UA0A 3GE1A 4IRKA 2HMIA 4FLTA 3CCSN 5M1OA 5CR4A 1R0CB 4AE5A 4YY3F 1Z05A 1C1CA 3DU5A 5BPMA 4B02A 3OFHA 1IBKF 3ZSYA 3ET6A 3S7RA 2NZTA 3D0HE 2ZOFA 4DN0A 5BPLA 5CZ2A 4CFBA 4I6MA 2CQCA 1NJYA 2EFQA 2C3MA 4AHCA 3VTIA 1P6TA 2LP4A 3SCKE 1SL2A 4MAKA 3UO0A 2CWKA 1RWPB 3ILOA 3OYDA 3ETOA 3RMAA 2EFPA 4DR3K 3DHWC 1OY9A 2NLXA 1CJTA 3OTOK 5ETKA 4CBXA 1O8BA 3E51A 4FF1A 4NO7A 5AQGA 2PIIA 1NDKA 3CCSS 2RAQA 2ZE2B 4FVCA 4R5PB 2ZH5A 4AXJA 2PSZA 3QT8A 5M1PA 5C0YA 4ICLB 2D9PA 3MM6A 3FBBA 5KFAA 3E01B 5L38A 1N33F 2KXNB 4B8AB 5BRDA 5GMKa 3J7YI 2BUNA 4J9NA 3OHBA 3LH2S 4NLWA 5KFQA 1GLDG 1LV5A 1Q78A 5T41A 2DNRA 4ER8A 3OTBA 3EVOA 4ZPDA 3I6PA 3FSIA 2L9NA 4LF2A 3SIPB 3VVUA 3WXKA 3E66A 4UUXA 5F3TA 4IDKB 5K8OA 2XTJP 4DG1B 4RW8B 3D1QA 3GTYX 5KFPA 1YBTA 3AQOA 4ZVSB 2RQMA 2UU9J 3HVTB 5HP1B 3OFFA 2KZZA 2WTUA 3AO5A 4E7HA 2AF6A 4TYAA 1MMNA 2EBEA 5CD4A 3HLUA 4M94A 3RZAA 4IBNA 2UUBK 4LF7K 2MLYA 2VONA 3W2WB 2E5JA 5AE1A 1I6JA 1RWXB 4CTAB 2VIHA 4ED8A 4ZHRA 5EX0A 1N48A 6FDRA 5MAOA 1H6KX 3PM9A 1JXLA 1G2EA 5HMYA 5T14A 2DR8A 2E5HA 3I55S 1NDCA 2KKHA 1K1QA 1DBDA 2ZKTA 2DH7A 5A8RB 1IKXA 3OTCA 2ZQBA 4QS7A 5LSOA 4KC5A 3C94A 1FT8A 3PO4A 5LXRA 1MMLA 3WZ0A 1N8RT 1EWRA 3QICA 1Y7PA 3UDVA 4JLHA 2KI2A 2NLWA 1EB0A 1HYZA 3FE1A 4DR2F 3RRGA 1QVGR 3UDEA 3RMCA 4A5BA 2OA8A 3M2VB 3RUBL 2MQLA 3V6JA 4ECSA 3V2UC 2Z2MA 3NG8A 2GHVC 2O5DA 3K9KA 4DV7K 1FNOA 2CWXA 3D4JA 1S6PB 1U09A 2D3O1 3BSCA 3WXMB 5E26A 2ZM6F 5AZJB 1PO6A 4B9TA 3L2VA 2DGWA 3M6UA 2Y8YA 2BZ2A 4FXWA 2ZUAA 1NMDA 4ZVEA 5L1JA 3UE5A 3NMRA 3G6ES 4NMXA 1F60B 3I4HX 2H51B 3F56A 2F3JA 2X1AA 1X4GA 4HACA 4MIBA 1TKDA 3CD7A 5DM6L 4A8KA 5ETNA 3CEDA 2W9CB 4A62A 4FPRA 2E1RA 1OYDA 1CSJA 3ZNUA 5K14B 5K8PA 1TL7A 4RL1A 2HBYB 3KWGA 4I1TA 3TUPA 3H46O 5KFEA 2YNHA 4PXEA 1RADB 4DUZF 3BQ1A 1JJ4A 1D9DA 1T3VA 3PACA 4GMKA 5H9EK 1KFSA 3UE2A 1KRPA 1WC3A 3HI0A 1RILA 4QZVB 3Q8PB 3GIIA 4B9SA 2CPHA 4DV0F 4KHYA 4QIWD 2GELA 1N34J 3M32B 3C6UA 3BO4A 5KGWA 4F2SA 3VF2A 1ASWA 4DTJA 1Z2ZA 5IT0A 3C15B 1H72C 3U02A 4Y3CA 3MCSA 3AO4A 3ONQA 5MLCQ 4L74A 1UJ4A 2C42A 1BMQB 2D0PA 1RAGB 2WW8A 2IIRA 1A7GE 2IJFA 3CUNA 1SH3A 4N5SA 4NLVA 2RDJA 1EO1A 2UP1A 2AWZA 1XTZA 1HQUB 3IRXA 3MX2A 3IRWP 4Z4GA 3KHGA 3IAM9 4K4WA 4OQJA 3UN2A 2B9WA 2UZAA 4RZRA 4FOIA 3GYNA 2WSCC 2WBRA 3D2FB 4PWWA 1KQGB 1XQIA 4DR2K 4YOXA 1Z26A 4CGGA 1XC9A 3EMTA 1VQ4N 4B3TJ 1T3OA 3OLAA 3SJJA 2I1RA 1Q7LB 3QJPA 5B09A 2VQEF 4OHYA 4CI6A 5F8GA 3B78A 3TUZC 4X65J 4RG8A 3NVMA 3BZCA 4DS5A 1SQKA 4I64A 3OPKA 4FZYA 3Q8QB 1X5OA 2KHCA 2GO8A 4AILC 3LGHA 2Q0RA 4CHQA 5E41A 1Y3KA 2ASDA 2UUBF 2VGMA 2YWFA 1T94A 3MAAA 3JXUA 2B0GA 4KKOA 2HW3A 1GOAA 2QX0A 1IN0A 4JI0K 3T9NA 1KQSR 2ZH9A 4DTOA 4BC5A 2QKKA 1UKUA 1VQ6N 4LD0A 2QEXN 1VQ7S 2H4WB 4RKUC 1SQEA 3D2FA 1JLBA 4WFNQ 2YV0X 5I3QA 2VBZA 5B0EA 3AARA 3NLCA 2H65B 2G0CA 4FJLA 4H4KA 1RT4B 2CYYA 1AB8A 1QVGM 4B3SF 4IG3B 1SH2A 2G2ZA 2C3UA 2QWRA 5F0XA 1Q79A 1DLOB 2PFUA 5L1IA 2ZH4A 3I82A 4IH7A 1SJ1A 3ID8A 4RNMA 1WG5A 4DQRA 2CQ4A 4RUCA 3OR2B 1JLEB 3MGJA 2FBYA 1XR7A 3LDQA 4XH4A 1H38A 3MCAB 4ED6A 4FWRA 1ITPA 2MDAA 4BVPA 3C6UB 1S4FA 2WC9A 1TP7A 4E89A 2KN4A 1RAIB 5U47A 4EP5A 2B5JB 4DI6A 5IV4A 4YQWA 4BR5A 2JJ4D 3R7BB 3IR7B 1N56A 4DSJA 4CLUA 4KBIA 2I7NA 2Y1IA 4IH5A 5HROB 1KVAA 2ZHBA 5D4NA 2XB2D 4U96A 3OVAA 2DGUA 2FVCA 2OANA 4CF9A 1BQMB 2BGGA 3AAPA 1PG5B 2RS2A 1TUWA 4V19X 1RT5B 1S4EA 4DV0J 5AQHA 2V8HA 2CPIA 2EW9A 3G82B 1Q8LA 2LA4A 1RK8A 4LF5K 2MKHA 2D69A 3DOLB 4B9VA 1RAJA 1F5BA 4A4JA 1V3SA 5CYMB 4CJRA 4P74A 4C1NI 3ICLA 5GAGI 1ZAVA 5EN1A 4MQ3A 3L9ZA 4LY7A 3PW4A 1NSKL 1R8CA 5DQHA 3D2EA 3T6BA 4NXNK 1J5EJ 2P9LB 2Q79A 5IOLA 1DQ9A 3DWLA 4RW8A 5JXSA 5SUHA 4EWTA 1TAQA 2X51A 3KLFB 2H54B 4GRSA 3UKUB 3ITHA 1FK9B 4PXCA 4CO2A 2WRMA 2W41A 3CC7S 2DNLA 4O44B 3BBCA 3QB0A 3P49B 3A8IA 2R7WA 4XPEA 2OZSA 5M1FA 1C4AA 2H5JB 1ZZNA 1MG7A 3CE8A 4LF9J 3OFEA 3GFZA 4KH5A 1WBDA 4LFAK 4LT6A 4C8KA 1XMOK 3CCVS 4RCHA 4B3SK 1ESVA 1DZ5A 5C5JA 4AL7A 2VQEJ 4HTLA 4CHPA 3H7HB 4JI7K 3DI6B 3D28A 1MROB 3B6PA 4CEZA 3RW6A 3OT9A 4WP8A 1U1OA 1S6UA 5A76A 8RUCA 3NGTA 2J0QD 2OIHA 1Q81T 4JKGA 2XSJA 4CFCA 4ZLPA 1RKJA 3G9CA 4B3TK 2QA2A 4HT5A 2HGMA 5BXIA 4CO5A 1E6YA 4BACA 4YOWA 4KV8A 2F8TA 2DTJA 2ZITA 4EEYA 1GX5A 1PC5A 1RBVA 1W25A 1Q9YA 2MGZB 5H9EJ 3TAQA 3ZSXA 1UVNA 1U1LA 1GFWB 2YKNB 3Q8YA 3FKBA 3BH6B 3NMUA 1OH7A 2V34A 4CBWA 4HT7A 4S0MA 2DO4A 4Y0FA 2C28A 1UPPA 1OWXA 4HACB 1WG4A 1JLAA 3I0SA 4XPCA 1TTHB 1KEKA 1KOHA 1R8HA 4KHPK 4FK4A 2K3IA 3MX5A 3D0PA 3GFHA 1Q95G 4CLFA 1UJ5A 5FLXY 4CZMA 3CPEA 4HYKA 2I9SA 1NGIA 1U0SA 3TJAA 4HTIA 1Y64A 1YLXA 2QLFB 3IMQJ 2GX8A 1LK5A 5HROA 4B1ZA 3FFIB 2BJEA 4O0JA 4OYOA 1RGIA 4OLPA 1WB9A 4O3QA 1JCGA 1FJEB 3GG4A 4O3PA 3NF9A 4HUGA 1MLAA 2VUGA 2VB6A 1TKTB 2YNHB 3PTWA 4DR5F 1UP1A 2CJ9A 3DOMA 4I6WA 2UXCK 3MPYA 4IOCL 3TEHB 4MT1A 4ZVOB 2OPRA 3CJCA 2CGJA 3M6WA 5IT9Y 2HGLA 2DH8A 5KFNA 5ETTA 4CEQA 5JJBA 2IIHA 1SH0A 3OTOJ 2Q31A 2JLGA 4G9ZA 2GVDA 3CJ3A 2ZH7A 2RS8A 2P9CA 3THTA 2RU3A 1HL6A 3H5UA 5KTQA 1TL1A 1RT1B 2RB7A 4FPIA 4KH0B 3M8QB 2BE2B 1QSLA 2GHPA 4URQU 3A0IX 3MCNA 4KPYA 3J7AN 1RDBA 2UUCK 3DRPA 4JS5A 4C0OC 4D3GA 3SCXA 1VSLA 3O9QA 4G1QB 5HMWA 3VF0B 3GBTA 4NLTA 1PSDA 1RABB 2NYIA 4DBQA 2GJFA 3SZ2A 4LF5J 4KFBA 1IKWA 2ZHOA 1XR5A 1ZS6A 1VQMN 1XNQK 3D6TB 3T9ZA 4KE5A 2IBKA 5ADXH 3MR6A 4FLXA 3DKDA 4DV5K 1J5OB 5KT6A 1TV6A 4CIEA 4E7JA 4CBUA 3QRPA 2UXBF 2R8IA 5AQQA 4J9PA 3ZTRA 2IJNA 3SFUA 4CJWA 1PBUA 2ZNYA 1YWXA 2A2CA 3UDCA 1S99A 3MN5A 1LEOA 2ERRA 2E20A 4Y2MA 1NMEB 5DM7L 2NXCA 3KKSA 9RUBA 3LQVA 3LP3A 5EU7A 1BWVA 1WF0A 2LEAA 4PPDA 2LKZA 4J9SA 4KQZA 1C0FA 4ICLA 5KFDA 3OJUA 2RDIA 2RUGA 2VBXA 3WBZA 1KQKA 3ZT3A 2IAJA 4C2MA 2W7OA 2I6WA 4JV2A 2E5LK 3PIPQ 4MIAA 3BZKA 3VAJA 2WFBA 1PILA 2QI2A 2B9EA 3PEHA 4BY9C 3EN9A 2J6TA 2CPFA 3KK1B 4E1MA 3SV3A 4M3YA 2G2YA 3H45C 2W4DA 1RT6A 2X7IA 1IBMJ 3ASMA 2WW4A 2UXBJ 1APSA 3BQ2A 3HZEA 1S48A 3CCRS 3O9RA 2BE9B 3W1YC 2WUSA 2K8GA 2B4JA 1U2VB 1ASUA 4IQXA 3H5XA 3HULA 1PBAA 3TUJC 1CEZA 3NH0A 2QFJA 1X9SA 2W7PA 3F9MA 5CZVA 5GIOA 5BRHA 5KPTA 4P2MA 1RHMB 1FFGB 5D4OA 4TNOA 1F0XA 3AAQA 1NDPA 4NLCA 4OHVA 3MWPA 3HFKA 4OX9K 2A6OA 4KGXB 2KTQA 3BGLA 2VF3A 2WVCA 4FYDA 3MN6A 3VF4A 4JKAA 1UZHA 4C48A 2YPZA 3VQBA 3U7JA 1KD1T 1NZ8A 2VFVA 4IDHA 2HVEA 1S10A 4CEBA 2A3JA 1X7VA 3MEKA 3MUTP 1KVCA 1D4XA 5KAKA 3SMSA 1HWKA 1SJQA 3Q89A 2Q2RA 3AVNA 3W8GA 3HOTA 3MAHA 5F8LA 5IQ6A 3DM2A 3CJKB 4R8UB 2ATLA 2HQCA 1GLBG 2DNYA 3BKUA 2IVNA 3M32A 4K0KF 1U2RA 3IMXA 4EU0A 4U95A 2NREA 3ID6A 1DRZA 4KHUA 4H0YB 3AO2A 4WFNL 4OV6A 3ZX2A 1KS2A 5AQKA 2GJ2A 4R8UA 3CETA 5FRNA 3HZ6A 4DJBA 4PG8A 1HIYA 4LF9F 3C0BA 1RCHA 1YT3A 2GQCA 4K8RA 3P39A 1I51B 3P5TL 2BQ3A 3V9UA 1N33K 3TAFA 5LL6d 3SSQA 3W9JA 2CG8A 3FGUA 3VQ7A 2LYVA 1PYTA 2RHQB 7FD1A 2IRYA 3U6FA 3MR2A 1SJFA 2KYZA 3DRRA 3Q23A 1YVFA 3E9PA 1NK6A 1U8WA 3DM2B 3LDNA 2E7VA 1HBNA 3VAIA 4Q2LA 3QBCA 4OHXA 2YX7A 3GR1A 1VQOS 1IBLJ 2F7TA 2MXYA 2NRRA 4GMJB 2A18A 4EBDA 1TL4A 3ZTPA 3BH7B 1SS6A 2L08A 3X1LB 1IQZA 1W2BR 1YJWS 3MDFA 5BR8J 5GADU 3CT9A 3I32A 3FBCA 4CCHA 4GKKK 2E9TA 2JRSA 2R9LA 4RU2A 3FFIA 2QYGA 4LQ3A 4JI2K 1G7CB 3S01A 1DTQA 1XI1A 4NLUA 2FSNA 2HVHA 2IGIA 4CM0A 4CYUB 4F7VA 4DV1J 1M5OC 2CGLA 4DTNA 4C97A 1QQCA 2VC1A 3E01A 9ATCB 5LJ3Y 4J2DA 1CJTB 1F9HA 1TQLA 1VHIA 4LF1A 3QT7A 1HI1A 3EVWA 3FZMA 3WHIA 1GEHA 2DBBA 4OZ2A 3CDAA 1RYRA 4ELTA 1X4DA 1JCFA 3HVWA 3L8BA 2ALYB 2EFVA 3W60A 5E5NA 1S6OA 1UTAA 4DL2A 1WSHA 3DLKA 3L7OA 5KG2A 1RB0A 2QXFA 3BS9A 4C8YA 1T9YA 1MWZA 3J81O 1O51A 2E1PA 4DPOA 3VR1A 5M1NA 4IFYB 3HYFA 3Q7CA 1NPKA 4IDKA 1P9QC 1J54A 1HBMA 1I3OB 4NPOA 4LSZB 4TN2A 4KHNA 3GV7B 1SZ2A 4WYWA 1TVRA 3TO8A 1JK9B 5IM0A 1X0FA 2W2NP 3HPOA 4B9NA 4FWLA 1S72N 4G1QA 1V5IB 1B0VA 3TX0A 3M6GA 1PKUA 2RQ4A 2JHEA 1IUJA 1CXQA 4HHUA 4KRFA 2PT0A 4OYIA 1RTHB 4JB8B 4DMNA 3DMJA 1FD2A 4Q8FA 1X31C 4MYUA 2HQFA 3BGRA 4RUHA 1CULA 1TKZA 3ENAA 4QYRA 3R9PA 3CCMS 3IS9B 2FD2A 3VQSA 4I69A 1H1VA 1B92A 3R1XA 3FR0A 4XH5A 1BE4A 4K7QA 4FW1A 2HWIA 1S76D 1RHKB 1BY9A 3ENHA 1H2VZ 1XJWB 1RBSA 1YJNS 2HHPA 4NLBA 4OYXA 2W7AA 2DIUA 2NXJA 2AYEA 3MTKA 2XO7A 3K57A 1RA6A 2LVWA 4FYVB 4JKEA 3NBPB 3PR5B 1HBUA 1ZBTA 3B8AX 4FLWA 3QFHA 1KOOA 2EHGA 1GLEG 4LBPA 3ILLA 3U8XA 2QMWA 4HVZA 3J81Y 4J2EA 2JWNA 2VFSA 5AQIA 4OJRA 2ZVSA 4P7VA 4E7KA 2KH9A 5AJ3K 4M5IA 4WFZA 1S1XB 1VQKN 2A10A 5ADXA 3J7YU 3V6HA 4GVBA 5HL7L 1C1CB 4YN3B 3NCIA 3H08A 1ZPVA 2OPRB 4BR7A 4CF1A 4UZCA 4JKBA 4ZCLA 3OSPA 4X4QA 4CJ7A 3QAEA 1FXDA 4H0OA 4IQMA 4P72A 4LSNA 2XYPB 1HI8A 4CGIA 2GAHC 3QIPB 2P9NA 3CB4A 4JNEA 2CJXB 2OMLA 2OO4A 3CPWR 3KK7A 1E4FT 1UVMA 1G15A 4B1WB 1RQ0A 4LSNB 1CZBA 1JMTA 4PG7A 1W2IA 4X64K 3QATA 3PY8A 4F26A 4AQYK 4CZFA 1N32J 1LK7A 3VWSA 4GKKJ 3ZO7A 2DY4A 1BHNA 1JQGA 5HN0A 1ULRA 3SDEB 4W5TA 3VQTA 3A3NB 4DPTA 3CG7A 5HATA 2ZF5O 3KOAA 5BRFA 4JV5J 2IC3B 1EP4A 2G13A 2MKCA 1B7FA 2DR6A 2AJ4A 3FNNA 4LRFA 3MR5A 5AQXA 4E0DA 2J9CA 3D45A 3DLHA 3A8KA 2D0OA 3AA9A 3M05A 4E1NA 1MW7A 4IG0B 2FJEB 3OYCA 3KUHA 4JKGB 4BBYA 3CJ1A 3ZSOA 2F65A 3MWTA 2B4OA 3DDKA 1LCUA 1RWKB 1RAOA 4CJTA 3FZKA 2ZBCA 1C0UA 1VC0A 4Q2MA 4LFBF 4OLAA 2HK3A 4QR0A 4BC3A 2YKOA 2MGZA 4DS4A 2U1AA 4F0KA 1N36J 4UOHA 2IFXA 1VSHA 2ZHAA 3ISND 1RTIA 2BE7D 4MTPA 3D0IE 1RT7B 4FXVA 4NYNA 4CZGA 2CQBA 5KGXA 3AVCA 4DDFA 4W5QA 5BR8K 4QS8A 4OLBA 2KRRA 1NJXA 5M1KA 1WG1A 2HB5A 4GVMA 1WAJA 3DXKB 4X62K 2AJ1A 2IBOA 3L0QA 1OMSA 1NK7A 1H3DA 2P8IA 1Q8BA 1X8DA 2HRUA 2HAFA 4TU9A 3S41A 1EARA 3N4PA 2BV3A 1SC1B 1OIAA 4LH5A 4BREA 1UVKA 6FD1A 3G71N 3BP8A 3D3BJ 3T1YK 2FLLA 1Q4RA 4I0WA 4M3XA 1IR2A 4CW7B 5JICA 2ZBPA 4HCCA 4IR9A 2N3OA 3HSDA 4AM7A 2OAUA 3VALA 1K6YA 2IS3A 2GVZB 5DM7Q 8AT1B 4YOEA 2DYAA 4KHMA 2BANA 1MWYA 5HK4A 1Q1KA 4F4XA 3OYHA 1WHXA 2E9RX 2ZD1A 2V8DA 3AH6A 3TWZA 3KG0A 1QTNB 2OI2A 1I94J 4UQTA 1OSDA 4ES3A 4A2BA 4AF1A 5LMUJ 2KB2A 2GVDB 3THVA 3D6RA 1HD0A 3HRGA 2YKMA 1KTQA 2MY8A 1MWMA 3UW1A 2M4MA 5AJ3F 4O55A 3GB0A 2RILA 2CQ2A 2YQ3A 5B7WA 4DZ6A 5HAOA 4WKYA 2DNGA 1P27B 4CHOA 1BXNA 3IM9A 4CK1A 2ASJA 5DG9A 4OZ1A 4ILRA 4CE9A 4LRDA 2DHAA 3TZZA 2R8KA 2NPIA 3EGVA 2YH1A 1RTDA 3C95A 2W24A 5HLFB 3CCZA 4J2BA 3SI8A 4M5JA 1ZOTA 4G6VB 5ETMA 3GSDA 2XWYA 1SJ4P 4WTOB 1VBKA 5K5MA 2OH2A 1FA0A 2GZOA 2GV1A 1WC5A 1U45A 3Q2SC 2DHHA 2CIMA 3M8QA 1QSSA 1EAYC 4QCLA 4NLSA 1R0AA 3UWTA 5CXTA 4X66F 2KO1A 4U6PA 1RCOB 4LF8K 3OSNA 2ZWOA 4CLKA 2F9JA 4LH4A 3U1LA 4PY5A 1WNEA 1ZPWX 5C2DA 3DMJB 4NRTA 4JI6F 1WORA 1R8BA 3ILIA 4M63A 3OL7A 2FDNA 2RHSB 4OHZA 1NGCA 3FCHA 2DGXA 2CJKA 4UY85 5KFFA 1XNRF 5KFGA 1QLNA 3GQCA 1RTHA 3ALYA 3EKUA 5F2RA 3S1TA 4I2PB 4IZ9A 2OMOA 4H0TB 1NEEA 2CFXA 1IWAA 2D7SA 3R5BA 3CFPA 2MQNA 3V4IA 3Q0AA 2Z4PA 2G8UA 3VN5A 4GV3A 3DLGB 4IJNA 4X66J 3RRHA 1WKLA 1Q8IA 1HNZK 1X0PA 3MK6A 5BREA 5IT9O 2RF2B 4CK2A 1VQ8N 1NZAA 4ED3A 5KG7A 1NUEA 5F8JA 1VSJA 3ZXWA 4DHVA 1Y5IB 2BRLA 3R97A 3GV8B 5GADP 4RLEA 1HNWK 2VZ9A 1SL1A 1UMJA 4DHYA 4RW7B 1SKRA 4PUOB 2HBZB 4ZTJA 2MB0B 1EX8A 2VWJA 3VQ8A 4HUEA 4CJ4A 4ZVTB 1VQMS 1RHUB 2MKYA 1X9MA 5AQNA 1UEUA 3A12A 3LM2A 4CZCA 4NE9C 3FLCO 1R89A 2OPSA 3MWBA 1BDGA 2PYLA 1ZBFA 1B7YB 3UIQA 1FVSA 2ABYA 1RBTA 3L3VA 2R7XA 2OFGX 1O5JA 1EX4A 2Y3YA 3DNCA 4DR6K 1KAXA 3M3ZA 3F9KA 3QNOA 4KH6A 3L3UA 1QM9A 2NRVA 5LMNK 3BGUA 3PEJA 1QJHA 1YJRA 5GMDA 1BI4B 4WQ4A 3PX0A 1LQ9A 1VJWA 1JXVA 2QXLA 4Q5VA 4C8ZA 4WQ5C 1UVIA 4OI4A 1A5WA 1RDAA 1BIUA 4A8OA 3TWHA 3N28A 3SDEA 4HL9A 1B4SA 2C2KB 3F0NA 3GJRB 2ZDPA 2ZJQL 1UL3A 5D0GA 5HBMB 3SPZA 4O23A 2ZDOA 3HXMA 3JQMA 3AVLA 1I94K 1U26A 3HK2A 3RR8A 3I8DA 2DNKA 3WX8A 2O8EA 2QIFA 4YR3A 3R1HA 1HW8A 4USTA 4Z94A 4DR7K 4WZQA 4NYFA 4JKFA 1YIJS 3ITHB 2QN6B 2PMWA 3TAMA 3P4IA 5D6GA 1IXKA 3MM5B 2B8PA 4BLGA 2YXLA 2NQPA 2JEIA 1XMBA 4L6V3 2H3GX 1NB2A 4ZCMA 1RJJA 2FUG9 1SUQA 4CNYA 3WXLA 3KYLA 3QLHA 1LWEA 2CZVC 4IH6A 1T6CA 2XCPA 2XMKA 3NY0A 1B9FA 2AA4A 2X78A 1I3AA 1UPMB 2YPYA 2EG2A 3GL1A 4OMFG 5HRSA 2QSFA 1NGGA 5D3GB 4DQSA 4NASA 3EPGA 3SCJE 4QAGA 2MTLA 4DG1A 1S6PA 1IG8A 3DI6A 3FRZA 4BR4A 3MMBB 2G1DA 3M2RA 4CO3A 3CCVN 2R7YA 4DR3J 1RA7A 1VQSA 4CFAA 1G6BA 1RHRB 3HOSA 4RW6A 2KU7A 2O8EB 2QWOA 4NLRA 3ZZRA 4P75A 2EVZA 3KNAA 4BRPA 4U9RA 1FRLA 3OS0A 2ZC4A 4B9MA 3K0SA 3QRRA 4JI6K 2HGNA 2MYFA 4U7UK 1VQON 4ED1A 3FEXB 2HZVA 1I39A 1VQ4S 1JCEA 5DZ7A 4FBTA 3HVRA 3SUQA 3W5YA 3PIPL 3NGYA 4ZLJA 4KTQA 3MMVA 5KFTA 4ZVPB 2V50A 1SL0A 2GA7A 3GU0A 4KB7A 2P9KB 3ETMA 3HHNB 4J9RA 4W90B 4B1VA 2FY8A 5T7LB 2UU9K 1VGYA 1AUDA 4H4OB 3QZ8A 5H1SV 1S9EB 2G4BA 2XI3A 2QA4N 4CJUA 1JXBA 5HVHA 2AJ2A 2AJ0A 2F8HA 5CD4H 5LXYA 4FJHA 3BO3A 4URSA 4LF7J 5GAEU 1H0HB 3FZ2A 3L4QA 1F21A 2VWBA 4PWDB 3MM6B 3LL3A 1IJFB 2N7CA 2HSTA 2CPEA 1Z25A 4JI8J 4K2JA 4ZIVA 2HLTA 1HKCA 2KG0A 4F9OA 3CC2N 3HSJA 3H2LA 3O8WA 4EP4A 3V4MA 3MPDA 3AXMA 1M90O 1JX4A 2FVPA 4N41A 1RYSA 1JLGB 1RZMA 2H48B 4FWNA 4MLEA 4NOHA 3MUMP 3MN7A 4CF2A 3TSUA 2E5IA 2J76E 1GTHA 3K5OA 4Y65A 4CESA 3ZTQA 4IYQA 1PGZA 5BYSA 5DDPC 2F63A 3HVTA 2CJYB 4CZJA 5HQLA 4NXMJ 3PX6A 2M2BA 1U1QA 3CHWA 3AA5X 3EDRB 1NKBA 3PO5A 3JSMA 3WIUA 5LL6Z 3H5SA 2XMWA 2CH5A 3NXZA 3DLJA 2XNQA 2FXUA 3PCOB 3A5LC 3IFRA 2P9PB 4I2PA 5CA5A 3MOZA 4TU7A 3L4IA 4PKDB 3HHLB 2J5AA 3NGUA 3ENWA 2DNPA 4GV6A 4OI6A 4Y28C 4TXSA 2G8HA 2XBPA 3CJ5A 2DR5A 3I8BA 4QWBA 2XC9A 2G8WA 1LWFA 2MZRA 3V1QA 2BJ9A 3DCAA 1C4CA 3CDUA 1AW0A 1FK9A 4J91A 3DGPB 2AX1A 3FK4A 1TFYA 1LW0B 1T6DA 2E1AA 4YY3J 3O44A 4JKCA 1FO1A 3Q86A 1PJ7A 4CNZA 3KMSA 4XK8C 3VENA 3VQ9A 4DLGA 4L3KA 1B99A 4XTTA 2M8HA 2O8FB 2YNGA 5LY3A 3O4WA 4ZMMA 1QVFM 3TJ8A 4DR1J 3ATVA 5IWAF 2M5YA 3DOKA 3DXKA 1S1UA 1H74A 1BLUA 1KVIA 2CUYA 2LEBA 3W64A 1L3KA 3R3TA 1T8EA 4ERDA 4DTMA 5K9FA 3KD5E 1BG3A 2IHR1 4DX6A 1NKEA 3DXSX 4TY8A 5D77A 5EHHA 3K5NA 4C23A 4XAKA 2DB1A 3MECB 2MKIA 3M8SA 3VEYA 2ACYA 3Q8VA 4M5MA 3SSRA 2CNKB 2B9YA 3MMJA 2JC0A 4EGLA 3HJVA 3LP1A 2E2OA 1KTVA 3ZETA 2N4DA 2AGQA 2A5XA 1MWKA 2PFDA 1DQ8A 4CLPA 4W5RA 4I4BA 2JH3A 4F0HA 2M7SA 3NGIA 3DLKB 1LOUA 5LJVA 5CQGA 2AHOB 3NOCA 1HBUB 4F2RA 4B3RF 4R0EA 4A8MP 1B70B 2E5LJ 3MD1A 2PEBA 1BD6A 4DL3A 1LWCA 3QERA 2YH0A 3CXCR 3O9SA 1NGBA 2Q97A 3HJFA 2W2QP 4DPWA 8ATCB 3JQKA 2F9TA 3PLAA 4M45A 4PCQA 4TQRA 2G9OA 2J4RA 3HD2A 4M41A 4ENOA 1UJ6A 2H1YA 3O2IA 2ASOA 3EM1A 2E2QA 1MWQA 2UXBK 4IJAA 4ECRA 1ZM4A 5KFKA 2UUAK 1T3NA 1RWOB 2GIFA 1V3RA 4FVUA 2B6AA 1NBEB 3SCLE 1DTTB 1I94F 4J37A 1HD1A 1UCNA 2O8DA 1FX2A 3T41A 1R6VA 2MLZA 4CFDA 2G1HA 3O4NA 1TGOA 3WXJA 4ETXA 1TUYA 4BRMA 1DTQB 2OKQA 1X9WA 4DR5K 1REVB 2F4VJ 3JSRA 3G86A 2IVPA 4ED5A 3GLJA 4EI2A 4RBVA 2V7YA 2HS0A 3GPAA 1KQSM 1EP4B 2YWKA 3H4DA 3R2DJ 4USWA 3MCMA 2AJFE 4ANDA 1UVLA 4PPZA 5THWA 3EKSA 2L9DA 3A3OB 3JYTB 3WQPA 2JGUA 5E3QA 4X4RA 2P6TA 2XEXA 5CCMA 3RAMA 4QW8A 5KFUA 5LJWA 4OI2A 4BG8A 2NS1B 2FC9A 4ECQA 2W42A 3W66A 3PYFA 3VHQA 5D8HB 4DMZA 2GIQA 3ZSVA 1QD1A 3S6EA 1VQ7N 4QYZJ 5HO4A 1S0NA 1L5UA 1KXPA 4NLPA 4M3RA 4IEIA 1F5CA 4FZXC 2ZH8A 2FVRA 3GFXA 5LOQA 4BRGA 3CQXA 3M2VA 4WFAL 4CECA 2ZJRQ 4L76A 2QWPA 1QHAA 2YHYA 3CGIA 4GVEA 3CMAN 4YFUA 3GZ7A 3M8YA 1XK8A 1M5HA 3M8WA 4CZIA 4X2BA 5J2NB 2IYIA 3VQDA 2V4RA 2R2SA 4FJ5A 2K2PA 1FEHA 1LFWA 3O3LA 2HNYA 1J6ZA 4ZA1A 2P5VA 3C6HA 4U7UD 3MCPA 4O4GA 4YHHK 3KUEA 5B0GA 2X1FA 2RDDA 1FTCA 2RHKA 3CERA 5K20B 2J9DA 3MM5A 3ENQA 2G8KA 3EE8A 1JLEA 1Y3JA 1HNWJ 4XIUA 4ECUA 2JDJA 4FM2A 3AO3A 2D9OA 1UEKA 1FNMA 5D4LA 4OPKA 2IYGA 1CJUB 4YDDB 4JI5K 2MQOA 2VV5A 4WBFA 2YX6A 3QYYA 4C98A 4L3QA 1WF1A 1RCXB 2V8VA 5J1EA 4FJNA 1CLFA 4CM2A 4NCGA 4MKYA 4YNQA 3LWMA 3A5NC 2DHSA 3CCMN 4DTRA 1VIXA 1A5VA 1T44A 1E6VA 2YKQA 4EUVA 4H5VA 2QSWA 1YITN 1HWUA 3M30A 1Q7YT 3FEYB 4M1KA 4JI7J 1ATNA 2GW8A 1H7WA 3EZWA 2D3UA 4CH7A 2JLFA 4DX5A 4EO6A 1EIYB 3T19A 4N47A 2ATQA 4RWXA 4BC7A 2DNOA 2NRZA 1R8PA 3TX8A 2GJIA 3AQPA 3BREA 2JVOA 4J90A 3CC2S 1MDUB 1ILYA 5DMRA 2R7UA 2DNHA 2FQQB 1NLKL 3IC1A