3DM2A

Crystal structure of hiv-1 k103n mutant reverse transcriptase in complex with gw564511.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
539
structure length
531
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 146
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dm2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dm2A05
4ED1A 3OYKA 3DYAA 3NBPB 4O3RA 4CJVA 3ZSYA 4Y1CA 2ATQA 5F9NA 5KGWA 4Z4HA 3AVAA 3KNAA 3GILA 2HNYA 4ECUA 3AA3A 1L3SA 4NLRA 3AVJA 4B9VA 1HNVB 1ASUA 3DDKA 2XHBA 2YV0X 4Q0BA 3K2PA 5HLFA 5D3GB 4B3OA 1BISA 2BQ3A 2DPIA 1JLAB 4ZTJA 4Q8FA 2XY7A 1HYZA 5HBMB 5KFQA 2FLPA 4F4ZA 3EYZA 2A1SA 4DSKA 3DYAB 2IDOA 1JXLA 4CECA 3GIIA 4YNQA 3HPHA 1DLOB 3KLEB 3DRPA 1S6QA 3SUPA 2G8UA 3KIOA 1UAXA 4IG3A 4URGA 2XGPA 4GC6A 3NDKA 1Q8IA 2W42A 1Z25A 2KTQA 1ASWA 3VQBA 1SV5A 2RPIA 1LWEB 5HLFB 3T5JA 4J2AA 4FJ5A 4F2SA 1S1WB 4DL3A 4B3OB 1XWLA 4CJEA 3C6TA 3KMQA 3OHAA 3OHBA 3CJ2A 3IG1B 4OJRA 4CF8A 3KK3A 3PO4A 3CFRA 3SUOA 3PV8A 2IM3A 3V9SA 3BSNA 4PA1A 1C2PA 3PHEA 1QSYA 3DRPB 3H5XA 3G0ZA 1K1SA 1RAJA 4IG3B 4RW7A 2WCXA 4NLDA 4EBDA 3I0RB 4MIAA 1SKSA 2HHVA 4AHRA 1IH7A 1RBRA 3H4DA 4H4OB 4AHSA 2IS3A 3ISND 3WNHA 4YMEA 1YTUA 4EYIB 3QGIA 3M8PA 1GX6A 4FJNA 4ED2A 4DQQA 3HP6A 4IBNA 3WNEA 4R5PB 1LWCA 3HP9A 2V4QA 2FBVA 3HSTB 4TLRA 2UUWA 3HVAA 3MEEA 1F21A 2OYQA 4K4VA 4E1NA 3KMSA 4KSEB 4O55A 4ZP9A 2R2RA 1D0EA 3AO1A 4JS5A 4CJWA 1HPZB 1U47A 3NAIA 4CJFA 3M8PB 3HXMA 3HJFA 1TKXB 1WN7A 3PJWA 4KHNA 1HYVA 3QYYA 1RTJA 3IRXB 4K50A 1HARA 5KFIA 3NKYA 3ZSQA 3DRRA 4HUGA 5KFXA 4CJLA 4KAZA 1S1UB 1NKBA 4CJPA 2NUBA 2P5OA 5EDWA 3MEEB 4HKQA 4F4YA 2YNIA 4PQUA 2ILZA 1ZBIA 2DPJA 3QERA 3Q8QB 4FCYA 1N6QB 1VRTB 3BJYA 4O4GB 2BE2A 4LSNB 4FK0A 3DOLB 3PX0A 2QV6A 3V9ZA 1BL3A 5F8JA 1QQCA 4Z0UA 4DTOA 1T94A 4DWIA 3ZT2A 5T7BA 2W9BA 3NF7A 2QK9A 4DLGA 4M3ZA 4C8NA 3L2QA 3PW0A 3MTKA 4YR0A 3AO3A 3RAXA 4B9TA 2YNIB 2WHOA 3WNGA 3B6PA 4PQUB 4LQ9A 4CFCA 3G10A 2KZZA 4NLOA 2IM0A 5KFCA 2HNZA 4IRKA 3CM5A 2VG5A 3V1OA 4WXOA 4NYFA 3HVRA 3NFAA 5KFDA 1S9FA 2BE2B 2RKIA 1RT5B 3BR9A 3I0SA 3O4NA 4MK9A 1NHUA 1KVBA 3RRGA 1FK9A 3HO1A 3OLAA 3MR3A 3OSNA 3N6NA 1W25A 1JLFA 2OPSA 3V4IA 1S1VB 4FS1A 3SV3A 4NCGA 4J2DA 4EO8A 2CJQA 5KFZA 4N47A 1QS4A 4E89A 3I0SB 4DTPA 2HHXA 2FJXA 3VA3A 2HHTA 4W5TA 3PW2A 4ECRA 3ZT4A 4AHUA 1B92A 4OLBA 1VSEA 3MAQA 2XCPA 3RMCA 2AWZA 3MR5A 1VSMA 5L9XA 1KCFA 2OZMA 1CLQA 2OPSB 1TAQA 4FW1A 3V4IB 2AX0A 3L2WA 3NHGA 2FBYA 4CESA 1ZETA 4FJXA 1S10A 1IO2A 4NYNA 3TI0A 2HVIA 1S97A 3M8SA 1KRPA 4AHVA 4FJ8A 2DTUA 3UDLA 2E9RX 4M45A 3IGVA 4ED3A 1A5WA 3RTVA 1U49A 1JLCA 4KAIA 2ZQBA 2C2RA 4NZ0A 1RTIA 1X9SA 1VSIA 1S9GA 1D1UA 4HYKA 1JLBA 5KGXA 3TAQA 1ZBFA 1JLGA 2YKMB 1C1CA 4XIUA 1WAFA 1C6VA 1RCHA 3CDUA 1NK6A 1JLEA 1WSJA 3LP2A 3ICLA 4CJ5A 3QNOA 3OL6A 2VA2A 4B8AB 1C0TA 4ID5A 3AA2A 1QE1A 5KFKA 2HNDA 1L3TA 1JLCB 3IGNA 3OYMA 2FJWA 4QOZB 5DQIA 2RDIA 4GC7A 1S5JA 3O4QA 1RTIB 5KT3A 2FVRA 1GX5A 1TL1B 1JLBB 4DFMA 4BDZA 3NH2A 1S4FA 4K4ZA 3OYLA 5KFAA 1KLMB 1RBVA 3SCXA 4YFUA 5KG5A 4CGJA 4DTSA 1O1WA 4DG1A 4DU3A 1YVUA 4EBCA 2XCAA 4KV8B 3DMJB 1QE1B 3OL9A 3BSCA 1HMVA 5KG2A 4IRDA 2G8HA 4PWDA 2FC0A 1REVB 5F8MA 4FJGA 5DG9A 1BI4A 3BQ0A 4ZMMA 5KG7A 1IKVA 5KFMA 4IR9A 4RW8B 2EX3A 3KLGA 5KFWA 3IS9A 4CFDA 4KE5A 4MK7A 4IG0B 3NF9A 3MEGA 1IM4A 1L3UA 3KD1E 4CEEA 4PUOB 1QHTA 4FLVA 3FQLA 3L2VA 2KQ2A 5SZTA 2IAJA 2VG7B 4DG1B 4DTNA 4J9SA 2JEJA 2BDPA 3OYFA 1C0MA 1NKCA 4N41A 5J2QA 3ZT1A 1HMVB 5KFJA 4WFXA 4RUCA 4M95A 2WK4A 2W9CA 2J6TA 1IKVB 3C6UB 5KT6A 3WNFA 1QAJA 3LZIA 3CYMA 5F8GA 2JC1A 1WSFA 2ASJA 4XPEA 3AVFA 3MFHA 1FKPA 1EETA 3AV9A 1TGOA 2OPRA 2XWYA 1N5YA 1RDRA 4FM1A 4AILC 2EC0A 4FZYA 4DF8A 4IDKA 3QINA 3E01B 1VSFA 5KFOA 2W9AA 1Q9YA 4XO0A 2W9CB 2I1RA 1T03B 5EWFA 3PR4A 4LH4A 2YNFA 1JLQB 3OYEA 4K8XA 4OGEA 1OS5A 2JC0A 1RILA 2R8GA 5F8NA 5KT2A 1FKPB 1UOCA 4FLWA 1TV6A 2DY4A 5I3UA 3QGHA 4ELTA 4G1QA 3L8BA 1N5YB 4CHPA 2RN2A 4OGCA 4FK2A 3LP3A 4ED8A 3B6OA 3LP0B 1KHVA 3QGGA 5KG1A 2ZKUA 4RW9A 4IH6A 4KKOA 3QLHA 4QWBA 4HCCA 2YNFB 5J2NB 3OYAA 2JLEA 3KLIA 4DU4A 4DSEA 1T05B 3SQ1A 3GIJA 2AX1A 3S3MA 1BCOA 3KLVA 3CDWA 4TYAA 1TP7A 4FJ7A 4FLYA 3S9HA 5EU7A 2YNHA 3H5SA 4Q43A 1TKDA 5C5JA 3K58A 1ZBHA 3KLIB 2W8KA 2Z1IA 3LPUA 4GMJB 4OPKA 1RT4A 3KHRA 2KZMA 3H5UA 4DTMA 2D41A 4Y2AA 1I39A 3CWJA 1RTDA 2Z1GA 3RBDA 3I5CA 3QEWA 2FVQA 3PW7A 3TR8A 5C24B 3GV5B 4CERA 1SL0A 5KFBA 4DTJA 1TKZA 4QPXA 5KG3A 4I9LA 2YNHB 3ULDA 3PR5B 5KG4A 4KHYA 4K4UA 5KFPA 2XRIA 4M3WA 4K8ZA 3UR0A 3DLEB 1RT4B 2KFZA 3HK2A 1BIUA 3OYCA 1QSLA 5C25A 4WE1A 3AO5A 1XI1A 1RT7B 3VQPA 4CEBA 3VQ6A 5K14A 4Y34A 3OLBA 2HHSA 1I6JA 3IAYA 2UVVA 3RR8A 4CF1A 1HNIB 1CSJA 4ICLB 5J2PA 3D0PA 4CJ4A 4Q8EA 4LD0A 1HQUA 4ELVA 3ITHB 2F8TA 2V0NA 4YR2A 1ZBLA 4FM0A 3VQQA 3O3FA 2XI3A 4OKEA 4Z4CA 3SQ2A 2HHUA 4QAGA 4J2EA 2D0AA 4RNHA 1BQMA 2AGQA 4ECSA 2HNYB 1YVFA 3HHKA 3TAFA 2I5JA 1EP4A 3KTQA 5DLFA 4Q0BB 1Q9XA 3KHLA 1NK7A 3OL7A 1HQUB 4ZVHA 1RBSA 1KFDA 5CY4A 3SJJA 4QWAA 4F8RA 3ZSXA 1UA0A 2O4GA 3PO5A 3G6YA 4KHUA 2Q3SA 3TARA 3SUNA 2OPPA 4CF0A 3D28A 1KHWA 5JUMA 5EWGA 4FJ9A 2BANA 4JUZA 3KLFA 1S6QB 4ECTA 1XR7A 4BDPA 3NCIA 1BHLA 4KTQA 2WONA 1UWBA 1W0HA 2WRMA 4CEDA 1MMLA 1SV5B 1S1TA 3T5LA 1LV5A 5DGBA 4HHTA 2GBZA 3MEDA 1HJRA 4C8KA 3C6TB 3NF6A 4EZ6A 4DTUA 3KK3B 4DMNA 4FXDA 3QIPA 3H98A 4FZXC 1SKRA 2OPPB 4KB7A 3TVKA 4KREA 4DQRA 4EEYA 3KLFB 1L3VA 5KFGA 1U45A 4RW7B 1ZYQA 3LALA 1U48A 2WTFA 3THVA 3VA0A 2R8HA 4EBEA 2B6AA 1DTQA 1NK5A 5CYQA 4FJMA 1KLNA 3BQ2A 2CKWA 4K4TA 2DFEA 3QO9A 2J6UA 3TWHA 1RYSA 2G8WA 2ZE2A 4M3TA 3O3HA 4CF2A 5KT5A 2DFHA 1LWCB 3OSPA 4MH8A 4DL5A 4CFAA 4KB0A 1S1XA 3BQ1A 3KKRA 4ECQA 1ZTTA 4O44A 2B6AB 4ZPDA 1DTQB 4K4YA 4CHZA 4I7FA 5CYQB 3CJ4A 2O5DA 4TXSA 4J9MA 1JKHA 4CEFA 2LSNA 3SFGA 4C8MA 3MXMA 4FLXA 2E4LA 5HP1A 1TK5A 1RYRA 2IMWP 4DQIA 3TAPA 1RTJB 3PX6A 1WAJA 1GOBA 4ZPAA 3DRRB 3PZPA 3L3VA 3ASMA 2W8LA 4H54A 5F9LA 5FROA 3I5BA 3I5AA 4W5NA 2KFNA 5FRNA 1S6PA 1S1XB 2IM2A 4NLXA 4JV0A 5DLGA 2HWIA 4NRUA 1MU2A 3H4BA 4I7FB 5KFLA 3V81A 1JKHB 3GV8B 1S48A 4BACA 4ECZA 3AVCA 4CGIA 2BR0A 5J2MA 4IH7A 1J5OA 3OJUA 4FK4A 3FQKA 3VQ8A 4FM2A 4MIBA 4CEZA 1VSDA 2W9BB 2Z1JA 2OPQA 2XC9A 2AJQA 3HM9A 3QETA 1NNDA 1NJYA 4B8CA 4I2QA 1S6PB 3U6FA 4F50A 3OL8A 2PZSA 4J2BA 3K5NA 2HNZB 4K4WA 4CEAA 4O3NA 3T5HA 2VG5B 4RNNA 2ATLA 4BE1A 4PY5A 4HVJA 3F9KA 3UQSA 2RKIB 2BRLA 4TN2A 1VSLA 4FW2A 2ASLA 5J2MB 1J5OB 5DQHA 1IKWA 1SKWA 5F8LA 2YHAA 1HYSA 2R2UA 3L2RA 3MFIA 1FK9B 4I2QB 1QAIA 4CEQA 4FLTA 4FZZA 4JLHA 3PVXA 4DTXA 3T1AA 1B9FA 4ZP6A 4CCHA 1JLFB 5C42A 3M8RA 2A1RA 4YQWA 3UIQA 4NCGB 4XPCA 2OH2A 3RMAA 4OPJA 1WLJA 3V6DA 3JYTA 3NGDA 3KK1A 5FDLA 3C94A 4CIFA 4NRTA 3OJSA 3NGZA 3LZJA 4L8RB 3PY8A 2D3UA 1SH2A 1KSPA 3MR6A 1TVRA 2PYJA 3GQCA 1HYSB 3AA4A 4B9LA 4CGDA 2IA6A 5KG0A 4FS2A 4WZQA 3PJXA 5KFRA 4OLAA 1C1BA 2YHBA 4W5OA 2YNGA 3V9XA 4I9QA 3I8DA 1S9EA 1YT3A 4KHMA 1T3NA 4H8KA 2VWKA 4DF4A 4F2RA 1WSEA 4E0DA 5KFSA 3JYTB 2XO7A 4X2BA 2FBTA 2IM1A 2UUTA 4ELUA 1TVRB 3IN5A 4RG8A 4NCAA 3JSMA 4CJKA 2BRKA 2ETJA 3CDEA 5L1KA 5JS1A 1RDBA 1VSJA 1LAWA 1RNHA 2QE5A 3VQ9A 1RDAA 4CIEA 4ZP8A 4O0JA 1R0AA 3NGYA 1S9GB 4FBTA 4DQPA 1JLGB 4QW9A 3SYZA 1C1CB 5KFNA 2JGUA 1U04A 1K1QA 4B08A 5FRMA 4C8LA 1X9WA 4MK8A 3LP1A 3MF5A 3DLHA 4FJIA 2JEIA 1IKXA 1JLEB 3LP2B 4NLUA 3GIKA 3AVHA 4CFBA 3RMBA 1ZBUA 3SPZA 1C0TB 4M42A 4NLTA 4ID5B 3ZSOA 3JSMB 4JV2A 4ED6A 2HNDB 3G6XA 5T14A 1ITGA 2IBKA 3QEIA 2B5JA 2RF2A 1NK8A 4BE2A 3EZUA 4FBUA 3VQ4A 4JS4A 3V9UA 2FLNA 4IRCA 3H2LA 4WFZA 4TY8A 3NE6A 3AVKA 2IJNA 3AA5X 3EPIA 4O3QA 5L1LA 4B9NA 3BGRA 2VG6A 3P1GA 4HCBA 4O4RA 4CK3A 5SWMA 4HTUA 1CXQA 4MFBA 3KLHA 3QESA 3DM2A 4H4MA 3BSOA 1T7PA 2AGPA 1FXXA 2FVCA 2C28A 3G86A 4J9NA 2R8IA 4G3IA 3M9NB 4PWDB 1WSIA 1BI4B 3NF8A 3UPFA 4J9RA 2ITGA 3BDPA 3NH0A 4B9MA 3KLGB 3IS9B 4URQU 3LAMA 3BSAA 2GUIA 3MEGB 4IFVA 4BWJA 2VG6B 3TAGA 1J9AA 2Y1JA 3EPGA 1LWFA 2IAJB 3NGIA 4H4MB 5KI6A 4DL4A 4EYHB 5J2QB 1WSGA 1HRHA 1KVCA 1XC9A 4CIGA 3HVTA 4O5BA 4DLEA 1JL2A 2D3ZA 3D45A 1L5UA 1DTTA 1JIHA 3KKSA 3QEVA 4RW4A 4DSJA 3FRZA 4ZP7A 3MXJA 4GW6A 2UVRA 4CJTA 5HROA 1B9DA 1CXUA 3KJVA 4Q45A 4CK1A 3TABA 1EETB 4FJKA 3SQ4A 3VN5A 1LWFB 2HMIA 2OPRB 2P51A 3QIDA 1D9DA 3K57A 3K5MA 4DL2A 4M41A 1XHZA 3DLRA 3HVTB 4IR1A 3D5MA 2GC8A 1D5AA 3NAHA 4IDKB 2X74A 2XY6A 1TK8A 1Z26A 1RT6A 4LY7A 4KFBA 4CHYA 5JS2A 1JX4A 3CVKA 1EX4A 3DLKA 2C22A 1LW0A 4ZHRA 2BGGA 1SUQA 3V1QA 4UQGA 3HKWA 2JEFA 4J9LA 3CJ5A 4DTRA 1TV6B 5I3UB 4I2PA 3QZ7A 3CIZA 4G1QB 1T8EA 4DSIA 3OYNA 4IQXA 3RB4A 1A5XA 1NOZA 3P83D 2X6NA 2HW3A 1VSKA 4E7IA 3H5YA 4YP3A 4RW9B 4Z4FA 3V1RA 4KKOB 3QLHB 4RNFA 3DLKB 1LW0B 2C2EA 3HT3A 1LW2A 2G8KA 5CYMA 4KTZA 1RA6A 4ZVFA 3P5JA 5CZ2A 3V6JA 3V6HA 2BQRA 1JXEA 4I2PB 2VA3A 3KK2A 2QKKA 5KFVA 1VK0A 4KB1A 2FVPA 4F3OA 1CZBA 3A2FA 4OKJA 4GVMA 3GIMA 4RNMA 1S0MA 3AVIA 2VWJA 4RNOA 4CGHA 4KPYA 2V9WA 4MKBA 3OYBA 2F8EX 1NK0A 1HNVA 1IG9A 4DSFA 4CJUA 3U3YA 5HRPA 1RTDB 4ECVA 1K6YA 4WZMA 1JLAA 4ED7A 4URSA 3RAQA 4W5RA 5HBMA 2RDJA 3OYJA 1TKZB 1XR6A 3Q8PB 1DLOA 5KT4A 1J54A 1QTMA 3KLEA 1NOYA 2R7YA 4DQSA 4Q44A 4BWMA 2FVSA 4FJJA 2B4JA 3M9OB 3LDSA 4J9QA 3TAMA 3ZSVA 5C25B 4WE1B 4BE0A 1S0NA 1LWEA 3ZCMA 1S1WA 4YR3A 3H08A 5K14B 3AVLA 2P1JA 3ZSWA 2QXFA 3V9WA 3IG1A 4B9SA 3HYFA 4R8UA 3DI6A 4ZVGA 4LH5A 3F73A 4QWCA 5F8HA 3DLGA 5J2PB 3G6VA 4ECYA 3GYNA 3AVBA 3I0RA 3CG7A 5DG7A 1RA7A 4JRPA 3CQ8A 5HRSA 3TAMB 4H4OA 4CF9A 1TL3A 3RMDA 1KTQA 3QIOA 1BQMB 4LQ3A 1ZTWA 2F96A 4DL6A 3FSIA 1TAUA 4E7LA 2I5JB 4R8UB 2G8IA 3DI6B 1EP4B 2YKNA 4TQRA 4CE9A 3DLGB 3SFUA 4FJLA 4R5PA 1NJWA 1J53A 1RT1A 3DOKA 4J9OA 1D8YA 2OZSA 4M3YA 4WYLA 3CFPA 4N56A 2XGQA 1N4LA 2ZD1A 2BANB 3VQEA 1TL3B 4CHOA 4FLUA 3QZ8A 1HPZA 2D0CA 1NK9A 1TK0A 2ALZA 3CM6A 2WONB 1TKXA 5DG8A 1UWBB 2FLLA 3VQ5A 2YKNB 3T19A 3IRXA 1S1TB 3HL8A 3KD5E 1XHXA 4KRFA 4K4SA 1QUVA 2XY5A 4ZPBA 3MEDB 1S1UA 3S3OA 2Z1HA 1GOCA 2EHGA 1RT1B 5DGAA 3DOKB 1Y97A 4CHNA 3QIPB 3ZT3A 1U09A 4C8OA 4B9UA 2PYLA 4TY9A 1YTAA 2ZD1B 1N6QA 1VRTA 3OS0A 3SNNA 4O4GA 4LSNA 1RT3A 3OYIA 4F4KA 4IOBA 3DOLA 5KFEA 2F8SA 3FFIA 3VQSA 4DEZA 4ED0A 4KO0A 3RRHA 2IJFA 1RBUA 4J9PA 3QO9B 4R0EA 2ZE2B 4NLGA 1RBTA 1TQLA 4M3RA 2GIRA 2XY8A 4ID1A 4W5QA 1RT3B 3O3GA 4QW8A 1RT5A 4KTWA 5F8IA 4O44B 4IH5A 3FFIB 4F4WA 4M94A 3VQCA 4KO0B 3TANA 1BCMA 3OS2A 1NJXA 1C0UA 5HP1B 1KVAA 4CGGA 3M9MB 3RB0A 4CGFA 4J9KA 4CJQA 3AVMA 2X78A 4O3SA 3CJ0A 5J1EA 1S1VA 2HAIA 1KFSA 2C2DA 2G8VA 2IC3A 5KT7A 3OYHA 4HUEA 4O3OA 3MR2A 1RDCA 1SL2A 2DFFA 3LWLA 4IKFA 5CZ1A 1MU2B 5KFUA 4E7KA 4CEOA 4LSLA 3V81B 3SV4A 4TYBA 1C0UB 2E6LA 3ZSZA 4RU9A 1U4BA 2UVWA 2OPQB 4WYWA 4KHQA 5J1EB 3GV7B 3LANA 1TKTA 4M3XA 4N5SA 2R2TA 4IKAA 2UVUA 2GIQA 2IC3B 5EUHA 1S0OA 3Q8SB 4E1MA 5DMRA 1G15A 2HHQA 4LSLB 3MECA 4CJSA 3QNNA 2R8JA 4E7JA 1FKOA 4U6PA 4F4XA 3LWMA 3SPYA 3SQ0A 3VQDA 1RT2A 2HWHA 1IKWB 3DLBA 3CFOA 4Z4EA 1VRUA 1TKTB 3RBEA 3DRSA 5KFFA 3C95A 2YKMA 3ZT0A 1RTHA 1UA1A 4KI6A 2IOCA 5C42B 2D7SA 3QEXA 3RB3A 1HQEA 4QWEA 1SH0A 5I42A 4FVMA 3MECB 4NLWA 1FKOB 4RUAA 4AH9A 2HB5A 2P5GA 3V6DB 3KK1B 4KI4A 5FDLB 3N6MA 4N76A 4NYZA 4K4XA 1NHVA 2D0BA 1QSSA 4M3UA 1RT2B 3OS1A 1X1PA 5KG6A 3H40A 4HUFA 4JV1A 3ISNC 1TL1A 1VRUB 3NL0A 3DRSB 2AGOA 4CK2A 1C1BB 1RTHB 1BQNA 4MKAA 2YNGB 1W9HA 4FJHA 1KLMA 1HQEB 1S9EB 4E7HA 3SI8A 3VQ7A 5I42B 1SL1A 2O4IA 2J6SA 4MQ3A 4KV8A 3DMJA 3L2UA 2E9ZA 2V4RA 1REVA 2QKBA 1CZ9A 4Y1DA 5KRSA 1EKEA 1N48A 3OYGA 4RW8A 2JEGA 3U3GA 4IG0A 2AU0A 3EY1A 1BQNB 4RW6A 1RDDA 4NLPA 1ASVA 3S3NA 1S49A 1R0AB 4PUOA 3V6KA 4Z4GA 4ZPCA 3AO2A 2VG7A 5HRRA 3SI6A 4JRQA 4EZ9A 4OKKA 4EP5A 3VQAA 4F3TA 1NJZA 3RR7A 3LP1B 4DFPA 1IKXB 4QWDA 4CHQA 4BDYA 3Q8RB 1C1AA 1GOAA 2G8FA 3C6UA 4AHTA 1WSHA 1NK4A 2WB4A 2HVHA 4FLZA 4KBIA 4AHCA 1WNEA 5KFHA 4RW6B 2B5JB 2RF2B 2W7PA 1A5VA 4DS4A 3PUFA 3FDSA 3H59A 2R8KA 3PX4A 4DFKA 4TY8B 3TQ1A 1SH3A 1JXBA 5L1IA 4QCLA 4CJ3A 3BGRB 1XR5A 5L1JA 4KHWA 5JXSA 2E9TA 1LAVA 5EWEA 1EXQA 4NCBA 3E01A 4MFBB 3KLHB 4RZRA 3DM2B 3K5OA 3MXIA 4NLSA 4WXWA 1T03A 2HHWA 1JLQA 3ALYA 4DL7A 3T3FA 4E3SA 4E19A 4CJRA 5E41A 4TQSA 3RWUA 1BGXT 2WOMA 4TSXA 3NMAA 3HPOA 3AO4A 2FJVA 2R2SA 4ZTFA 3KHGA 4OVLA 4IFVB 1JL1A 4ECWA 5KTQA 3TAEA 4FYDA 4NLYA 3HVWA 4U7CA 3LP0A 4NLVA 3LAKA 2AQ4A 5J2NA 4DFJA 1DTTB 1T05A 4RW4B 4O3PA 2FBXA 3OY9A 2WOMB 2W7OA 3NAEA 5DK5A 5HROB 4Y3CA 1X9MA 3KJVB 1NKEA 5KFYA 4EO6A 4NLQA 3ZSRA 2GV9A 3AVGA 4DSLA 2HMIB 5KRTA 2OA8A 2B43A 4KHRA 3PW4A 2E6MA 2D5RA 3NH1A 1RT6B 3SUQA 4KFBB 5KFTA 3AVNA 3OVNA 2ASDA 4EP4A 3EZ5A 3CJ3A 1IKYA 2Y1IA 4ZHRB 1N56A 1SUQB 4KHSA 1Z4UA 4OL8A 5C24A 3OYDA 2KW4A 2ILYA 4WFYA 4ECXA 4IFYA 3SZ2A 4O0IA 1WNSA 3M8QA 4Q5VA 3DLEA 4Y2CA 3T5KA 3KOAA 4ZVEA 3N6LA 2PY5A 4Z4IA 3NBPA 3LPTA 4DS5A 1RT7A 5DQGA 3BREA 1IKYB 3HPGA 2XI2A 3PW5A 1LW2B 3RB6A 3K5LA 5CYMB 4DU1A 3K59A 1D9FA 1BIZA 1VSHA 2IGIA 1I3AA 1HNIA 4ICLA 3CO9A 5D3GA 3KK2B 3L3UA 4IFYB 3ITHA 2X6SA 3QEPA 5HRNA 3KHHA 3M8QB 2BQUA 3E51A
chains in the Genus database with same CATH superfamily
5TKWA 5ETSA 3TVYA 1CEZA 3DYAA 1MSWD 2P9SB 5IWAK 5KGWA 1X5SA 2WVEA 2UXBF 4B9VA 5K8NA 1ASUA 2X51A 4F0HA 4Q0BA 4ENOA 2FJAB 4LF5F 3QGPA 3C66A 5DM6Q 2N82B 4ZTJA 4CT9A 5HBMB 2NCKL 1MROA 2CPZA 4F4ZA 3CMQA 3DYAB 1HX1A 5AQIA 2AEFA 4QIGA 1YBTA 2X1BA 2W4PA 3O1WA 3O9SA 2XGPA 4N8NA 3NDKA 1FVQA 2FHKA 5JVGQ 4V19S 1ESVA 2RPIA 1LWEB 4DDFA 2DH7A 4FJ5A 2Z57B 4DL3A 2KHDA 3C6TA 1H1VA 3IG1B 4OJRA 5GINA 2ADBA 3LM9A 3LDPA 9RUBA 2Q97A 1QSYA 1VK3A 4DCJB 1KQSM 3VEWA 5IS2A 2HVDA 1RBRA 3H4DA 2HS3A 2NXUA 2ZUAA 4B3MJ 1N36K 2NQPA 1FRMA 3M8PA 1GX6A 4DR4J 1WB9A 3EGNA 4LF7F 4LFAJ 1Z6RA 1ELOA 1S12A 4O8UA 3C16A 1NGEA 4BQZA 4R5PB 3CEDA 5DM6L 3VCDA 4PL7A 1LEOA 2UUWA 3R6GB 1B4SA 2WVCA 1F21A 1NSQA 2FSKA 2OYQA 4K4VA 4UZBA 3MGJA 2R2RA 3RW6A 4CQ1A 1WKLA 3NOCA 4JS5A 1HPZB 2KO1A 2P8IA 1U47A 2QLXA 1J27A 4CJFA 2E5HA 3M1FA 3I4PA 3M8PB 1DQAA 5LMUJ 1TKXB 5JVGL 2ITMA 2RH3A 3DKDA 3C65A 3NKYA 1EAYC 4XH4A 1S1UB 4OMFG 1PGZA 1T6CA 2P5OA 5EDWA 4HKQA 3S8SA 4F4YA 2YNIA 4ISFA 2DRBA 4L76A 5M2RA 1VQMN 2BABA 2IYIA 5DJBA 3PCOB 2BE2A 3DOLB 2QV6A 2QO3A 3D6RA 4ZIVA 5F8JA 4Z0UA 1T94A 4DWIA 3ZT2A 5DM7L 1T6DA 5T7BA 2W9BA 3NF7A 2QK9A 2PFDA 4DR2J 3PW0A 4FO0A 2OD6A 5C10A 2YNIB 3P4IA 3WNGA 2L9DA 4RWXA 3B6PA 3PYDA 2IM0A 1V3ZA 4IRKA 4WXOA 2DK2A 1S22A 4DV1F 2BE2B 2RKIA 1V5IB 4YB1P 1RT5B 4YDDB 3FGUA 4CM2A 3W9JA 4MK9A 2GJIA 1NHUA 2C3OA 3C14A 1FE0A 3THPA 3SMSA 4CO4A 2LMIA 3CD7A 4BCAA 2B8QA 1K44A 4D3HA 3SK3A 4USUA 4UT4A 1IWAA 4JKHA 3POTB 1W25A 1JLFA 2W4CA 1HR0J 2L9NA 3V4IA 4AQYK 4WYBA 3SSRA 1YRTA 2CJQA 4N47A 3JS9A 1A6LA 2RRBA 3QQCD 2ZJRQ 4MYTA 2HHXA 4DTPA 3EE9A 2IRXA 3LUYA 4AHUA 1VSEA 3RSEA 3DWLA 3MPVA 1M90O 4FXWA 3C14B 3RVCA 2QW9A 3EXCX 1O0PA 4YOEA 2FJDB 5BYQA 1AFIA 1GLAG 3MR5A 4LRDA 2I8EA 3V4IB 2AX0A 2ACYA 4CESA 1X31C 1S10A 3R2CJ 3OTEA 3M8SA 3KKFA 3UVJA 5LMNJ 3DLLQ 1Y5NB 1E6YA 4KAIA 3CJ1A 2B0GA 2H3GX 3W5ZA 2PD1A 1RTIA 3BO4A 3MN5A 1S9GA 4HYKA 2BEFA 2ZBQA 3TAQA 2P9KA 1N32F 3RBZA 4XIUA 4MLHA 2EVZA 3IFRA 4OIXA 4FPAA 3FK4A 1NK6A 3QNOA 4DR5K 1U1QA 4A8SA 4NXNJ 3VGKA 1Q4RA 3W2VA 2ZFHA 2YWHA 3AA2A 4HTIA 2ZJRL 5KFKA 2MMYA 1L3TA 3WQUA 3OYMA 1NDPA 1HBUA 1XNRJ 3CW2C 4H0OA 2YY3A 1YWXA 4GC7A 4QJVA 1RTIB 3M6VA 4DN0A 5H9FK 4A57A 3NH2A 3FKBA 3D9BA 1PYOB 4YFUA 4ZVTB 5KG5A 4CGJA 1KD1O 2YJFA 2ZH1A 1WSRA 3J7AP 1GQEA 4EFAC 3DMJB 3OL9A 5KG2A 4IRDA 1HBUB 2FC0A 3Q7BA 3DLJA 1RHQB 5KG7A 2F63A 2QYGA 2ZDOA 3DLLL 4RW8B 1XJWB 4CFDA 3IS9A 1IR1A 3O6WA 4K41A 1P9YA 3PIPL 2UXCJ 2OUGA 1PSDA 2QLJB 4PUOB 4PL8A 2IAJA 2VG7B 1RBOB 1DZ5A 4MO4A 2VPXB 3EVOA 1HNWF 2VFVA 2UU9J 2Q1LA 4DV6F 5ETTA 1RK8A 4RUCA 4M95A 4IQMA 5H9EJ 3W9IA 3R5AA 4OHYA 2VQFJ 2W9CA 1WD6A 3TA2A 3WNFA 1F9EB 5ETLA 4JI6F 3CYMA 4JI2J 1WSFA 4OZ0A 2R7OA 3MFHA 1FKPA 1EETA 5K8PA 2Q1NA 1MWZA 2DNGA 2EC0A 1BC6A 5EXWA 1Q7YO 3H0PA 4BRHA 3QINA 3JXUA 4XEIA 3JTNA 5BPNA 1HBMA 2W9CB 2I1RA 1EX8A 4ZVSB 3PR4A 3K0JA 2XYPB 4LH4A 4K8XA 1JLQB 3OYEA 2KH9A 3Q7CA 3R1LA 3W3SA 1VQ6S 1RCOB 4P9SA 4BBYA 1YUWA 2Q6BA 5F1XA 3MAAA 4L3QA 1FKPB 3F44A 4FLWA 4OLPA 1W7WA 2E1MC 4OI2A 1WJ9A 4OGCA 2A2DA 2ZH7A 4ED8A 3NGTA 4OX6A 3LP0B 1KHVA 3QLHA 2B56A 4FVUA 1N34J 2YKOA 4DU4A 4DSEA 1DY3A 3SQ1A 1SJ3P 1T9YA 4QS7A 5CHIA 3KLVA 3CC4N 1XQIA 5EU7A 3H5SA 2PMZD 3D6FB 3UD3P 2HFZA 2P9NB 1R6VA 2W8KA 1RT4A 3CJKA 1T9XA 2HZCA 4OX9K 1CC7A 4Y2AA 3A8IA 1EWQA 1VRQC 3RBDA 1KR4A 1ZOTA 3O9UA 3TR8A 4FZVA 3D3BJ 2ZITA 1SL0A 5KFBA 2DGOA 2K06A 1TKZA 3OTOK 3ULDA 3PR5B 5KG4A 2QWLA 2N3OA 5KFPA 4WJBA 2ASYA 3DLEB 3M6UA 1Q81O 5E5NA 4LF4J 3TEGA 3SCJE 4BROA 3ISZA 4PG7A 1RT4B 2KFZA 1YAGA 1BIUA 4LBPA 2C3PA 3P3DA 1QSLA 5C25A 5E2QA 2H51B 1D9AA 3VQ6A 1QJHA 2V5HG 5K14A 4CLUA 2DO0A 4ZVPB 1URNA 5AXKA 4JOUA 1HNIB 4CF1A 4LFCJ 4USIA 1YJNN 4LD0A 1OH7A 3ITHB 2F8TA 5HJYA 2V0NA 5JICA 1ZM4A 1ZBLA 2F9JA 4DPWA 2HG4A 3VQQA 4P6QA 1YJ9N 2G2YA 5HVFA 2HHUA 3SQ2A 1IR0A 2K3KA 2XLIA 5AQKA 1JCEA 3VR1A 1BQMA 2AGQA 3MWPA 2FSNA 3QNWB 4HVZA 3TAFA 4KHPJ 4ATNA 2Z4PA 2PDAA 1EQ0A 1Q9XA 1WC5A 2UXBK 3EXYA 3KJFB 1RBSA 4PPDA 3I82A 2HWTA 5CY4A 3LTOA 2RD5C 3O08A 1D3WA 3KJNB 3ZSXA 3KWMA 4ANDA 2Q3SA 3ADAC 5D0RA 3CHWA 4CF0A 3FJ2A 5EWGA 2ZVIA 4JUZA 4DV7J 4ECTA 2JSXA 2I9SA 1VC5A 4HHJA 1BHLA 2EWHA 4LIWA 4JV5J 3IAS9 1MMLA 1SKUB 4DU8A 4HT7A 2EPIA 4C8KA 3AB4B 4ZJLA 4C23A 3CCJS 1TL7B 3NWRA 4KB7A 3TVKA 5LM7E 4OPHA 5KFGA 1B70B 3GCXP 3LALA 2A0FB 3Q89A 2WTFA 3VA0A 2J0QD 3G71S 2JVOA 2R8HA 1VS3A 2ASPA 4UOGA 5CYQA 1S7HA 4FJMA 1HNZK 4WIIA 2VBWA 3KG4A 3BQ2A 3ZZTA 4K4TA 1OY9A 2UUCJ 1X4EA 3D68A 3OXLA 3GDQA 2QMWA 2W7AA 1LWCB 2VJUA 4ZITA 1VQNN 2HLUA 3CI5A 5GAGU 3R5CA 4KB0A 4BR5A 3CCTA 4ZPWR 3QSIA 2YXLA 4ECQA 4HACA 1F0XA 4RX6A 4CHZA 4I7FA 5CYQB 2W40A 4CEFA 4FLXA 1MWMA 3TJAA 3AODA 4JI5F 1J6ZA 3J7YP 3EGWB 2DNRA 3TAPA 4DQIA 1OYEA 5AQZA 3L3VA 3PZPA 4DV5K 3ASMA 2QM1A 2NRZA 1IBLF 2KFNA 3MI7X 5JVHQ 4JNEA 2IM2A 2HWIA 1PCAA 4ILJA 4I7FB 5KFLA 2NZTA 1KQGB 1TUWA 5A6PA 3JQMA 1VC6A 3GG4A 4BACA 3A0IX 4CLKA 1U02A 4CZJA 3L4QA 4CEZA 5IFMA 2Z1JA 2OPQA 1RAIB 1S57A 2KKZA 4HTJA 2PZSA 2XS2A 2HNZB 2ROPA 3T5HA 4RNNA 2ATLA 3VEYA 5IQ6A 2H9ZA 5AQUA 4H4KA 2MKKA 3JQKA 4TN2A 1DQ8A 5GAHU 3I56S 2QC3A 2O8DA 3KUGA 1R31A 2J0WA 1YHQN 3BF3A 7FD1A 4DV1K 1HYSA 1X4CA 4S0MA 4GRSA 4IOCL 1FK9B 4OHZA 4CEQA 3PVXA 2OTJS 3T1AA 4DX8H 2DGWA 4CCHA 7FDRA 5BRHA 3W64A 4XPCA 5JVHL 1YTYA 4CDIA 2MZJA 3I8BA 3NGDA 3KK1A 3BF1A 5FDLA 1UEVA 4ZOSA 3CXCR 3IMXA 3MUTP 3PY8A 2D3UA 3MR6A 2AHOB 2PYJA 1HYSB 4RU2A 4WFBQ 1QTNB 3CPWM 1VLYA 5KFRA 1C1BA 4M7YA 4W5OA 3PEJA 2HRYA 3T1YF 1YT3A 1B3TA 4LF8F 2PT0A 4H8KA 4DF4A 3RUBL 1TR0A 5KFSA 2A3JA 4L75A 2XO7A 4CH1A 3BGLA 2C2KB 2O3DA 3LPEA 4NO7A 2AA4A 4NX9A 3IN5A 3QT6A 3C46A 3LF0A 3JSMA 4DR3F 2ETJA 5L1KA 3EZWA 3H3NO 1I94J 5JS1A 1VSJA 1RNHA 2VGMA 2GV1A 1KP6A 4BR4A 4GKJJ 2BACA 3A8EA 1YLXA 3CJ9A 1JLGB 1C1CB 2V2ZA 4L3KA 4LF6J 2JGUA 3VENA 5A2QO 3MF5A 4DUYF 2XB2D 1SCJB 4AXJA 4CFBA 3RMBA 1ZBUA 4KGXB 2OAUA 3IM8A 4M42A 3JSMB 4CM0A 4XDCA 2NUUG 4OZ5A 5GAGI 2BJ3A 1TUVA 3EZUA 5AQNA 3DU5A 4WFBL 2FLNA 1NNEA 3H2LA 2EG1A 1QVFM 2BJEA 5SUHA 2CG4A 4X65F 2VG6A 3MDFA 2CPDA 5SWMA 2PAVA 4HTUA 3KLHA 2VB6A 3THTA 1Z05A 3BSOA 3K5PA 2YBVA 3G86A 4J9NA 1P8GA 4G3IA 3H20A 3M9NB 3WXLA 2KXFA 4PWDB 4Y28C 3WT0A 1BI4B 2ITGA 1ZXOA 3VEXA 4LFBF 1CJUA 3HZEA 2VG6B 3A3OB 5ETNA 4DL4A 4EYHB 5J2QB 4DZ6A 1XC9A 1NSPA 2N4CA 2IRUA 2MJNA 2BOAA 3D45A 3QEVA 4RW4A 4LR8A 1YJTA 1HNWK 3FZKA 3FRZA 1OJ4A 5B0DA 3TUJC 1OSCA 3IR5B 3S6EA 1YGYA 5GAHI 1LOTB 2P51A 2MHNA 1NMDA 1GAOA 4JI0J 5HQMA 4M41A 1XHZA 4IR1A 1U1LA 1D5AA 1FJCA 4IDKB 1KKHA 1HD0A 2QTDA 4EUVA 4CHYA 1C4CA 1R27B 2C22A 2I38A 1UZHA 5HMYA 4FWSA 2Q0UA 3FE1A 2JEFA 1GLDG 3SAGA 3CJ5A 2FHJA 1TV6B 5A8WB 5HN0A 4G1QB 1Z2LA 1T8EA 4IQXA 1NOZA 3P83D 4F0MA 1MMNA 1RTZA 4E7IA 3H5YA 5BPMA 2GO8A 2AJ2A 1NDCA 4KKOB 4USHA 4DV0F 3CCUS 3I31A 4OHXA 4ZVFA 2VJVA 3P5JA 2BQRA 1X3NA 3KK2A 1GXLA 4LBIA 3DXMB 5CD4A 2DITA 5IT9O 1VK0A 4KB1A 2CDRB 2FVPA 3JTPA 1NM2A 2CZ4A 5BR9A 2XTJP 2PMWA 2WB1D 4GVMA 3UE5A 2XZDB 2NREA 2O8CB 3L09A 1S0MA 3AVIA 1V3RA 2V9WA 2F8EX 1NGCA 2R7SA 1X5PA 2ERRA 4CJUA 1RTDB 4ECVA 1OO0B 1VQSA 5HL7L 1RZMA 5A0YA 2RDJA 2VOPA 3QAUA 1UVLA 1RKJA 3Q8PB 1DLOA 3PEHA 1J54A 2V2KA 3JAMY 1NOYA 1NO8A 4P72A 2R7YA 4RKUC 4Q44A 4CD3A 3KDNA 3EEQA 4FJJA 4BRIA 1N88A 3ZSVA 2F8HA 4YOYA 3PYEA 1R8BA 1SBRA 3H08A 2E7XA 5D4NA 3W0LA 3J81Y 4ZVGA 4DPYA 3F73A 4LH5A 2HBYB 2UXDF 2P9CA 3G6VA 2QWPA 2DGTA 2XMVA 2W2NP 3AVBA 3I0RA 3CG7A 5DG7A 2KKHA 3MMAA 4I6YA 2CWKA 1RWMB 4LQ3A 2RVJA 2F96A 5KPRA 4E7LA 3BKTA 3DGPA 3SFUA 3WEEB 1RDUA 3HLUA 1JJHA 3M8YA 1D8YA 2OZSA 4M3YA 2G2ZA 4N56A 3OV7A 3MMAB 2QWNA 2DEJA 4NYOA 4ZJQA 4YOTA 5JMVA 3AAWB 2E5LF 2WONB 2RJZA 2KVIA 2E88A 2YKAA 4A8MP 4LC9B 3T19A 1NUEA 1P90A 4KRFA 3GLJA 3KHYA 4ZPBA 1YBUA 1IBKK 3AAPA 2Z1HA 3GP9A 4IYQA 4A8WA 1WDDA 3TX0A 2LDIA 1S6OA 4J7CA 4ZCIA 3ZT3A 4C8OA 4QIEA 2YQ0A 3ATVA 5KPTA 3OS0A 4F4KA 3E9PA 2JL9A 1RI7A 2Z8QA 5BR8F 2GJ2A 2F8SA 4QIVA 5A8RA 4CO0A 2VL1A 5C2DA 2A1BA 2HPUA 2DVIA 4U9RA 3RRHA 5DRKA 5HMWA 2H4YB 3O44A 5IWAJ 2ZE2B 3QPIA 3VVTA 3OW2M 1TQLA 1LWXA 3HHLD 2GIRA 4DR7F 5LJVA 1HBNA 3DNCA 3NP5A 4RO0A 4W5QA 3O3GA 2EBEA 4USTA 3N4QA 3EDRB 4Z94A 2QWQA 4BRPA 5F8IA 5A8RB 4GKKF 1I1GA 4C1NI 3W7BA 1BCMA 3OS2A 2W6KA 2Z2LA 3Q8YA 3AOAA 2M0GB 1IN0A 4O5FA 3NRBA 1EARA 2AJ4A 3P8BB 2XHCA 3H2VE 1DJ0A 3K9JA 3CJRA 2X78A 3KWGA 5M1NA 2VICA 4O3SA 5J1EA 1TYQA 3TOQA 4JI5K 1PKUA 2C2DA 2G8VA 5KT7A 4HUEA 4OX7A 3MR2A 4WCEQ 3GFXA 3LWLA 5CZ1A 1MU2B 5KFUA 4WP8A 4IEIA 3FSYA 3TUPA 3SV4A 4Y0WA 4YUDA 1OVYA 3GG1A 2YKQA 1AFJA 5M2PA 1PC5A 1Q79A 2E6LA 1N0UA 1MN7A 1VHXA 4RU9A 1U4BA 5MLCV 1B0VA 3IWNC 4OPAA 3R6LB 3HHLB 5AT1B 3L95X 5J1EB 2RE2A 4IKAA 2GIQA 3C15B 4UW2A 1N36J 4E1MA 5H1SQ 4ER8A 2GCFA 4CJSA 3FEYB 2DHHA 3AJ1A 3I6PA 3B6BA 1UJ6A 4U6PA 4ZLNA 3R7NB 3CD0A 4YB7A 7AT1B 4K0KF 1N8RT 2E7WA 3SPYA 1PAUB 1IKWB 3BPSP 2GIFA 3DLBA 3OHRA 2HFNA 3CFOA 4JP8A 4Z4EA 2FLOA 2BKPA 3QDKA 1VRUA 4GO7X 4H5TA 1VJQA 3DRSA 3OVBA 1RTHA 3ZTSA 1UA1A 4PXBA 3FSXA 4HHUA 2YJEA 1NG9A 1Q7LB 4RUAA 3CCWA 2HB5A 4WCEL 3V6DB 3KDOA 3R1HA 3CD6N 2VQEF 1BWEA 4N76A 4M5DA 5K8MA 4NYZA 4K4XA 2VOOA 4M3UA 3VGLA 4B1ZA 1RJJA 4BRAA 3WXIA 3Q23A 1VRUB 4A8FA 4NA3A 3DRSB 2AGOA 1UCNA 1WELA 2CAJA 2FQQB 1RTHB 3ZZZA 2VCPA 1BQNA 2YNGB 1I3OB 1X0PA 1W9HA 4HEA9 1K47A 4FDFA 1KLMA 4HHHA 3VQ7A 2O4IA 2NSBA 2WBMA 3L7PA 3PYFA 3C3LA 3OPKA 3L2UA 1WKJA 4M5DB 2HZVA 3T1YK 2V4RA 1REVA 1VBKA 1CZ9A 3TSUA 3G6EN 1N48A 4BG8A 4HT5A 2RUGA 2MQPA 4W4MA 3U3GA 4IG0A 2AU0A 1VQ8S 1BQNB 4QS8A 5AJ3F 4NLPA 1R0AB 4F26A 4C11A 4DV3F 1V5VA 3SCLE 4EP5A 3RR7A 1HI0P 3LP1B 2FY1A 2NZ4A 4QWDA 4BDYA 4FYWB 1CQMA 2M8HA 3C6UA 1OH8A 4KBIA 2M9KA 4AQYJ 3FEZA 4L6V3 4K42A 2ZJQQ 4UTGA 1HNXK 4QCLA 5G0RB 5L1JA 1PAEX 2E9TA 1JCGA 5IOLA 2GMHA 3E01A 4MFBB 3DM2B 3K5OA 2DNLA 3THWA 1VQPN 1T03A 1RWWB 5JLFA 4X65K 4E3SA 5U47A 2MKSA 3TJ9A 3BS9A 1BGXT 2PO4A 3NMAA 2F4VF 2IVMA 1CJVB 1XMBA 1EWRA 3TAEA 3NWGA 5ETPA 1WHVA 2BE7D 3LAKA 3UB5A 3BO3A 3THWB 3KJQB 4AL6A 3N4WA 5ETRA 1WOSA 1FNXH 3FBCA 4DR1F 2CQDA 3VF2A 1Y0HA 1T05A 2E44A 2W25A 4O3PA 3U1NA 3VOVA 4E1JA 3HSGA 2W7OA 5DK5A 3GMGA 4ZVQB 4DR5J 1AA1B 3A8YA 1X9MA 1QY7A 5KFYA 3CQYA 5EX0A 2ZJQL 3X3UA 4NLQA 2GV9A 3H8YA 3ZEUA 1R0BG 2VODA 2OSRA 3SJHA 2OA8A 5FLXU 1CJKA 4CZEA 5H9FJ 1U2FA 2LQ9A 5KFTA 2R7VA 3LDOA 1RDWX 3LDQA 2XMTA 2Q36A 4BC3A 1IKYA 1AROP 4ZHRB 3HZ6A 4A8QA 4KHSA 4OL8A 2LXIA 2EKNA 4WFYA 2UV8A 5ELZA 1VBZA 3SSQA 2CPEA 4ECXA 4IFYA 3LH2S 1WNSA 5LXYA 4ES2A 1CJKB 1DHMA 1RISA 1WG5A 2PFFB 3NBPA 1A0OB 4EHUA 2YCHA 2OANA 4OZ2A 2HYIB 4G1IA 3L0QA 4DS5A 4A8XA 4BC2A 3BREA 4BGAA 1IKYB 1E6VB 1SJRA 3GJTB 3AT1B 3G82B 5CYMB 4M8LA 1D9FA 2HBRB 1YVNA 2IGIA 1I3AA 4FWMA 3CO9A 2BTFA 2W4DA 2IMOA 4IFYB 2X6SA 3QEPA 2YQ1A 3VGUA 3VF6A 4H0PA 3CJTA 3HI0A 3OYKA 3DOMB 3NBPB 5F9NA 4Z4HA 3BBFA 3B78A 1CQNA 3KNAA 4QPTA 3AA8A 2GQCA 2HNYA 1L3SA 3AVJA 1IJFB 1RCXB 2A3ZA 2YV0X 4NWBA 3JSRA 2DPIA 1MNEA 4MJKA 3L4IA 4Q8FA 2XY7A 2FLPA 3NCQA 4CECA 3GIIA 4YNQA 3HPHA 3MR7A 3DRPA 2OHDA 4IG3A 1XTZA 4GC6A 5B0FA 3G87A 1EKRA 1Z25A 2KTQA 1ASWA 3VQBA 1SV5A 2V4JA 4F2SA 1S1WB 2XWXA 3UNGC 2HQ3A 3CJ8A 3OHAA 1GMWA 4DMZA 3OHBA 1U7LA 2MLYA 4WQ4C 3KK3A 3SUOA 1F6TA 3PV8A 2IM3A 2V94A 3V9SA 5AQTA 1WC3A 3FGVA 5T7LA 2BUNA 2NRRA 5LY3A 4EK2A 3DRPB 1K1SA 1T9WA 3IRWP 4IG3B 4RW7A 3U9DA 5CHCB 3TU5A 2UXDK 5F3TA 3QJPA 2VDIA 3GE1A 2HHHF 2LA6A 3F5TA 4B1WB 4OZ3A 1HWUA 2MQMA 4ED2A 2CQCA 1PBAA 3EE3A 3WNEA 5HVHA 1FXLA 3HX9A 4BG9A 3HP9A 3R8YA 5T7LB 4ETXA 4ALZA 4TLRA 1FDNA 2VASA 1Q86T 1C0GA 4NB4A 5KOWA 3MEEA 4OX9J 4KH1B 3JB9k 4E1NA 3L9ZA 3KMSA 4KSEB 2M3DA 1PILA 2DTJA 1Q5VA 2FHOB 2YHXA 1RAHB 5AQQA 1R0CB 1D0EA 3ZZUA 3AO1A 2J9DA 4OHVA 2EKYA 2MY7A 4ANEA 4KH0B 1JB0C 2HZAA 3CC7S 3THXA 4DKWA 3OTOJ 3PJWA 4KHNA 4F04B 1LK7A 3FRYA 1HARA 4K50A 5KFIA 4MMOA 5TKYA 3DRRA 1WUAA 5KFXA 5EHHA 2UUAF 1NKBA 1U26A 3MCAB 4BREA 3SBGA 2PC6A 3MEEB 2APOA 3TZZA 1WOOA 1S99A 3SQGB 5E3RA 1ZBIA 3LM2A 4JD2B 2MGZB 4FCYA 4OZNA 2HKEA 4O4GB 1QAYA 3WX8A 5LJWA 1BL3A 2LU2A 2ATCB 4X62K 1FD2A 4NXNK 2GHPA 4DLGA 5CABA 4M3ZA 4C8NA 3L2QA 2KL8A 4B3TF 2KJWA 3VGVA 5AXNA 3R7BB 4B9TA 1N33K 5BR8K 3HZGA 1ZC6A 1KBRA 2QMXA 5KFCA 2KYZA 3V1OA 2QA4G 3TQEA 1Q8KA 4FN5A 3NFAA 5KFDA 1SC6A 2KFYA 3RRKA 3FFKB 3BR9A 2ZBRA 2UXBJ 4DV4K 2GMLA 4RWTA 3IM9A 1QQMA 2VH7A 2MLXA 2A2CA 2RUSA 1SQKA 5B0EA 1IV0A 2LEBA 4GKKK 2LECA 3SDEA 5A2QY 3HO1A 3MR3A 4H5RA 1RWUA 4LF9F 2OPSA 4JKBA 2AIRB 1RHJB 4CLFA 1N5VA 2MZRA 4LSZB 2E1ZA 5KFZA 1FF2A 2VFUA 2PIIA 4Q7AA 3VA3A 2D1CA 4OLBA 1XNQF 2KG0A 3K2YA 2AWZA 4B3RF 2QN6B 4MLEA 5MAOA 1LFPA 2OPSB 1HQ2A 2DISA 3SMZA 4GVEA 3L2WA 4KC5A 1CVJA 1ZETA 2ZH6A 4DUZF 3AGRA 1HNZJ 1AUSL 4DHVA 3EVWA 1KRPA 2VPZB 2XZWA 2JX2A 3TZYA 4CYUA 1UTAA 1X4GA 3BZQA 2IJRA 3T69A 3ZZPA 1RAFB 3RTVA 3TPQA 4GV9A 5M1KA 1FXRA 2BJ8A 1FRXA 5AQXA 1NWKA 4LT6A 2FDNA 1JLBA 4K0KK 5KGXA 2XLKA 2ZGZA 2YKMB 1FHTA 3VAFA 1WAFA 1C6VA 2YX1A 1RCHA 2DR5A 3CDUA 3U4LA 1JLEA 4CTAA 3LP2A 4CJ5A 4V19X 2VA2A 4CYUB 1XUPO 4USMA 2HQIA 3J7YI 5DETA 4DV5J 5ETMA 4RBUA 4DCOB 2CH6A 3DU6A 5HI7A 3W2WA 4A2BA 2IFXA 5KT3A 3U9ZA 2FVRA 1JLBB 5D4OA 4DFMA 2Z58B 4BDZA 3FVYA 3ZZRA 1S4FA 4K4ZA 2DNOA 1F3VA 4AE5A 1RBVA 5ADXA 4CTAB 2CJYB 2K2PA 4DX6A 4DG1A 4IOXA 4EBCA 5RUBA 3KWIA 3TRGA 2KM8C 4V1Ak 3BSCA 1WI8A 5HATA 5F3ZA 3OVAA 4NI2A 4YN3B 5F8MA 4LJMA 2DHGA 1VHFA 2PA8D 1AB8A 4OJHA 4OYPA 1HWJA 3KLGA 5KFWA 1VQ6N 1YSJA 3KYLA 2FC9A 1IM4A 3NMRA 4QOTA 2ZZMA 2OELA 3KD1E 1N8RO 1QHTA 2BJDA 3FQLA 4DG1B 2LYVA 1C0MA 4N41A 2XS5A 3K9KA 4GY2B 4DV1J 5AJ3K 4WFXA 2A6MA 2LQBA 4DV3K 3J80Y 5C2GA 3GFHA 1QAJA 5IT9Y 5F8GA 2HBMA 2ASJA 2DEIA 3ULEB 4CZHA 1O5JA 4NXMF 2DNHA 1QAXA 3BYRA 2DKOB 3P6YC 1TGOA 2GVZA 2OPRA 2XWYA 2DR6A 4PXDA 4FM1A 1FW6A 3PNIA 4DF8A 4CBUA 1UVNA 1OQ3A 4CLTA 1RADB 4XO0A 9ATCB 4DOZA 1S77D 4IFEA 5A6WA 3ZX3A 4OX8A 4WQ4A 2CNLB 2JC0A 3TX8A 2DH9A 2R8GA 4B3MF 3JSBA 1UOCA 2OGUA 4DR4F 4PG4A 2XMMA 1VJWA 3P96A 5EX3A 3QGHA 4ELTA 3VEOA 5EVZA 4WKYA 5AZIA 4CHPA 2D4WA 2Q6CA 2R9LA 3I55S 5M1OA 2H4WB 3FEXB 5KG1A 3TUIC 2UP1A 3D1QA 4Z7YA 4QWBA 2F4VK 2OCEA 3OYAA 3KLIA 4CRJA 3PYGA 1RHRB 4XH5A 1RKIA 1CS4A 1H7WA 4X64F 3GIJA 2AX1A 4A46A 4GV3A 4JN4A 4TYAA 1ZBSA 3GZ7A 4DR1K 5AZIB 1JXVA 2QL5B 1TP7A 2KI2A 3F9MA 5E84A 3DRXA 3S9HA 2YNHA 5F2RA 4TU7A 1BE4A 4Q43A 2J7WA 4ZVRB 5IQQA 2O66A 1F5BA 3KLIB 3LPUA 1MWQA 4GMJB 4MKVA 1CS4B 2KZMA 2ZOFA 4LREA 3UI3A 3CD5A 4CZLA 2K1RB 5BPLA 2HEKA 4MAKA 3M7VA 5KQ8A 2OEKA 4H5NA 2QA4S 3GV5B 1R89A 3THYA 1RWVB 4DTJA 3D2FB 5HQLA 3W66A 2YNHB 2BUPA 3GJRB 5AR0A 4K8ZA 3E2EA 4BVPA 2H1YA 1HWKA 4J8FA 4PABA 3HK2A 5HK4A 3V4MA 3VQPA 3E3XA 3M1VB 4BQLA 1U6FA 3IAYA 3HOTA 3KVGA 1VDHA 3MM8A 4PKHA 4PXCA 2POKA 3QFUA 1KN6A 2MQ8A 2P9PB 1HQUA 2L08A 2IBOA 3CCJN 2PBDA 4YR2A 3VVUA 2EFQA 2CH5A 3O3FA 4P2SA 2XI3A 1HNWJ 5LJ3Y 4OKEA 4EAHD 4LF1A 4QAGA 2V8GA 1F5AA 2D0AA 3G71N 2P9IA 3UW1A 2RDDA 3GYXB 2I5JA 3MM8B 5DLFA 5HVGA 1NK7A 3OL7A 1HQUB 3IC1A 2ZDPA 1DBDA 3L3CA 3SJJA 4CZCA 3VERA 1UA0A 2O4GA 3PO5A 2PI5A 2H5IB 3R5DA 3D28A 1XMQF 3VAKA 4FJ9A 1S6QB 1XR7A 3H46O 3NCIA 3OQ2A 2P9IB 4U67L 2QWRA 2R7TA 1UWBA 1W0HA 3HJVA 4AFFA 4CEDA 4USKA 5LMNF 1SIWB 1VQ7S 2GBZA 3S7RA 3BYPA 3VESA 3MEDA 1VC0A 3I33A 1RWOB 2BW2A 3CJAA 4DTUA 1BUPA 1KQSR 2DXFA 2EBGA 3BGOP 4UUXA 1SKRA 4OYMA 1FD8A 4KREA 4DQRA 2EFGA 3U27A 1U45A 3M2UB 1S3XA 2CQ0A 3NNAA 2XNRA 1V6HA 4BS2A 4I69A 2MKYA 1RWNB 1NGGA 3FCVA 3E1YA 2CKWA 2HSEB 1XNRF 3CMES 2DFEA 3QO9A 2J6UA 5K9FA 3M2VA 4I6MA 4M3TA 3O3HA 5E3AA 1HW8A 2HHHK 1T9TA 4OYAA 4PWUA 4GVBA 2ROEA 4MH8A 1N5TA 4PAAA 4DL5A 3KKRA 1OH5A 4PCQA 4I6AA 4O44A 4ZPDA 4ES1A 3MM9B 2O5DA 1YJ7A 1BUXA 1U24A 3I56N 3SFGA 3MXMA 3OTDA 2DNZA 2E4LA 4V19J 5HP1A 1S5ZA 1APSA 1YQHA 1RTJB 3R3TA 3PSIA 5F9LA 2OTJN 3I5BA 3J81j 1J5EF 3I5AA 1U1RA 5FRNA 2HHPA 3HI9A 2ZH5A 5HANA 5DLGA 2VIHA 4B3SK 1UETA 2H48B 3BP8A 2UUAK 4JKGB 2P9UA 2D74B 2PEHA 1Q53A 4R79A 3AVCA 3ZETA 1B7FA 3EUNA 2BR0A 5LL6Z 2CPIA 3EMTA 4IH7A 2B4VA 3CJBA 4MIBA 4M7XA 5GAGP 5E3QA 4X4PA 3QETA 1NM1A 1K0TA 1KQKA 4I2QA 2JDJA 4F50A 2O8FB 2VONA 3D2EB 4CEAA 2VG5B 1UJ5A 4B3TK 3EM1A 4HVJA 3F9KA 5EY4A 1JJCB 2BRLA 4CW7B 2I2YA 3ZETB 1HJOA 2ASLA 3WC0A 1Q86O 2MQLA 3FMWA 4JK9A 5DQHA 1SKWA 2YHAA 2E1YA 4PXEA 4A2AA 1R8AA 2KYXA 4MKYA 3MFIA 3CXCM 4I2QB 3MN7A 4FZZA 3IFEA 4ZP6A 1N52B 2QSWA 5C42A 2RT3A 2A1RA 3ENOA 3CCMS 2WFBA 3UIQA 4NCGB 5BRDA 1HLWA 2OH2A 2IPOB 3G9CA 5BJRA 2Z2ZA 3VETA 4NRTA 3OJSA 3D1OA 1IBKJ 4LF9K 3OFFA 1SH2A 2G0JA 1KSPA 2HVEA 1TVRA 1UFKA 3GQCA 3AA4A 4YDXA 4B9LA 3BN7A 1VQOS 3FMBA 4E2FB 4WU3A 4LRFA 1X4HA 4USWA 1XNQK 1S9EA 4ID8A 5E7OB 2CA9A 1T3NA 4YOWA 4K2XA 2FUG9 3N28A 5GAHP 4B3RK 2A41A 2P9LB 4Z2XA 3I9ZA 3CJSA 2HS0A 2V2QA 1TVRB 3MHYA 4DUZK 3AOBA 4CJKA 2DIVA 3VQ9A 1RDAA 1UP1A 3NGYA 3CCZA 4OYWA 4FBTA 3MMVA 4DQPA 2BJ9A 3SYZA 3CETA 1F2HA 5KFNA 1U04A 3CC2S 1X9WA 4MK8A 4FWQA 4BRNA 3GIKA 1NGAA 3AVHA 3SPZA 2DY9A 4LF4F 2CPJA 1C0TB 4ID5B 2VKZG 2JNJA 2HNDB 3U1LA 2F65A 4P2MA 4JI5J 2B5JA 2RF2A 4QR0A 2FD2A 4XDDA 4BE2A 4LVNP 4FBUA 3VQ4A 3V9UA 1VYAA 4AD6A 1NPPA 4HWIA 2IJNA 3AA5X 3EPIA 4O3QA 2G0IA 4WPAA 4CK3A 3HULA 1CXQA 2C1EB 4WK1A 1X3MA 1Q1KA 1T7PA 3WXMB 1FXXA 2C28A 3CB4A 4XK8C 3R5GA 2JWLA 2DRDA 3J8AA 4CZKA 2WZ1A 5IC4B 2M4MA 3BDPA 4B9MA 4KHPF 3NNHA 4URQU 5AZJB 2SXLA 5IZHA 4ILRA 2KDOA 1F9FA 2BVZA 2VU5A 3BSAA 3MEGB 4IFVA 2GUIA 1WHYA 2BM1A 1U6BA 1P1LA 5AQSA 3TAGA 4PZVA 5IM0B 4ED4A 1LWFA 3AQPA 1U8SA 5KI6A 1SJ1A 1WF2A 1WSGA 3BUZB 2AJ0A 1QM9A 3GFZA 4DV7F 1L5UA 1DTTA 2V63A 1M5HA 1YBAA 3CCUN 4CH7A 2UVRA 2O67A 3H6EA 1B9DA 3NGSA 1CXUA 3KJVA 4B17A 4Q45A 3SQ4A 5FPDA 1LWFB 2HMIA 1CJTB 3Q8VA 2GHWA 3QIDA 4FVCA 2UZAA 4DL2A 1BXNA 1SAZA 4NXMK 4MDAA 1TK8A 4I6WA 1RT6A 1Z26A 4KFBA 3MM7A 5JS2A 1WBBA 2XZTB 2G0CA 4H5WA 3K0SA 1LW0A 3H2UB 2BGGA 1SUQA 3O9QA 1U0HA 3V1QA 2D0OA 3BM7A 5DZ6A 1FE4A 2N7CA 4KRWA 1WACA 4DTRA 5I3UB 3QZ7A 4FKYA 3T1YJ 3OYNA 3RB4A 1B7YB 1NPKA 3CULA 1FDAA 1MN9A 2VFTA 5CD4H 4KYZA 3AH6A 2DGUA 4A61A 4RW9B 4Z4FA 4NLBA 2GO9A 1LW0B 2C2EA 1FTRA 2FJEB 3K8VA 4CO5A 1X5TA 4KTZA 3V6JA 2IVOA 2PA3A 2FPHX 2OP5A 1HI1A 1YG0A 5KFVA 4JHDB 4UOFA 2DNPA 4BRCA 4X64K 1T9UA 3R97A 4F3OA 3EWGA 2J9DE 2NRTA 3J7A1 4X84A 2B8PA 4RNMA 4KPYA 4MKBA 4X4SA 2ZF5O 1HNXJ 5G4DA 1Z1ZA 5HRPA 2YVSA 1Q0NA 5AQVA 3IBCB 4ED7A 4URSA 3ZX0A 4UF4A 3JAMU 3AD7C 5HBMA 4K5SA 4X65J 1R43A 3D0GE 1WI6A 5KT4A 5GADU 5IXUA 2R7UA 3N9UC 3ILIA 1F2GA 1PG5B 3M9OB 2HAFA 1NHKL 4WE1B 3J81U 1RHKB 2CQHA 1LWEA 3UDVA 4DXLA 2R7XA 2BKOA 3NS6A 3ZSWA 1VBYA 3V9WA 3IG1A 1FA0A 4UQTA 5FLXO 3DLGA 5J2PB 4WFNL 2EFOA 4X4VA 4Z7CA 1G7CB 4ECYA 3GYNA 3Q83A 5LSLA 1NGHA 1FT8A 2XSJA 3VF0B 1ZZNA 2HFSA 3RW7A 3CQ8A 3TYTA 4CF9A 1TL3A 1XMOK 3RMDA 2K3IA 1WEXA 1EJ7L 1TAUA 1RACB 1EP4B 4CE9A 3H1QA 3DLGB 2D1KA 4FJLA 4R5PA 2B9YA 5LL6d 3TZXA 2H5JB 1NJWA 4BRMA 1WEZA 3DOKA 3ENBA 3KFWX 2XSJB 4WYLA 3AAQA 1HHQA 1N4LA 2BANB 1NSKL 1TL3B 4FLUA 1HPZA 2D0CA 2ALZA 3A8KA 1RGIA 3CM6A 2RU3A 2CQ3A 4OZJA 1TKXA 3VQ5A 5HMXA 4U96A 1XMQK 2U2FA 1HBOB 1S1TB 3D7EO 1X8DA 2XY5A 1S1UA 1FO1A 4KIAA 3DOKB 1Y97A 1M0SA 2DY1A 2GWJA 2Q0RA 3QIPB 3CCVS 2AEJA 4TY9A 4LF2A 4C9DA 4TVAB 2GWKA 3SNNA 3DOLA 5KFEA 3BN4A 1YJRA 3VQSA 4DEZA 4NEYA 4KO0A 4MYUA 1SJQA 4OI1A 1BMQB 3D6TB 1H2TZ 4ISEA 5D0HA 2B4OA 2XY8A 1OPIA 4OI6A 4JBCA 1RT5A 3LGHA 1VQ4S 1VQ9S 2HBLA 4F4WA 2BKNA 1S72S 3O80A 4KO0B 3BGUA 1SI9A 5AXMA 4ZN1A 3O5TB 2QSFA 3BEGB 2BOPA 1VISA 3ILJA 4M63A 4P2FA 4CGGA 5T41A 3O1BA 2F8MA 2LEAA 1T11A 4CJQA 3POTA 3MX2A 3CJ0A 1XC3A 4JI4F 3O4WA 2DGXA 1YITS 3OYHA 2DFFA 1Y5IB 1PC4A 4CEOA 3V81B 4TYBA 1J5EK 2FHMA 2OFGX 3UO0A 5D78A 4PG6A 3ZSZA 4M5LA 2ZWOA 4PG8A 3EO3A 3DN9A 2UVWA 5GADI 8ATCB 1YRXA 1BOTO 3GV7B 2CJAA 4M3XA 4N5SA 2UXDJ 1S0OA 2FIUA 3Q8SB 4JI0F 1OH6A 4EI2A 3ENQA 4F4XA 3OXGA 2UUBF 3LWMA 2GJFA 2Z0GA 3NLCA 3SQ0A 1EZZB 3IDHA 1VQ8N 2HLTA 3C95A 3ETMA 3VAMA 4NPOA 1R8CA 5C2CA 2D7SA 2RNEA 3QEXA 1HQEA 4QWEA 4DCHA 2KHCA 4FVMA 8RUCA 4NLWA 3NS7B 2J0XA 2P5GA 2CQPA 1HKCA 4JI7F 3CPWR 2D0BA 1QSSA 3OS1A 4FWPA 5B0CA 5KG6A 2F4FA 3ISNC 5DO2A 3ZX2A 1FNOA 3MCOA 3UFCX 2DRAA 4FJHA 2OI2A 1HQEB 4E7HA 3SI8A 1SL1A 1H73A 1CPZA 3IP0A 3QATA 4X62J 1MWKA 2ZVSA 5GIPA 2HFOA 3DMJA 5AFUH 1F5CA 1N33J 3BY5A 5BR8J 4Y1DA 5KRSA 1ZZFA 1RXOB 2FF3B 3MAHA 1SVDA 4RW8A 4CNZA 5F0WA 3A1YG 2DGQA 1OPZA 2JEGA 4RW6A 4DPTA 4EIAA 2GA7A 1RDDA 1AYEA 3GU0A 2YHYA 4PUOA 4DV4J 2VG7A 1V9OA 3AD8C 2HFVA 3VQAA 2J9EA 2ZJPQ 4AYBD 4I67A 1IKXB 1AXQA 3RYLA 1C1AA 2VKRA 4G65A 1GOAA 4GKKJ 2VUGA 1RBLA 2WB4A 2HVHA 4FLZA 1CC8A 2VPWB 5KFHA 4RW6B 4BC9A 2W7PA 4DS4A 2OD4A 2BXJA 3PUFA 2O8BB 1JCFA 4BRQA 3FDSA 3H59A 4TY8B 1VQKS 2GS8A 2HIQA 2BE9B 4ZDNA 3BGRB 1U1KA 3FZBA 5I3PA 1OMSA 4C8YA 4MIWA 2QA1A 4NLSA 4WXWA 1FX4A 2V6AA 4H4KC 2HRUA 1JLQA 3ALYA 1UFLA 1SC4B 3R6MA 2DH8A 3VMFB 3K8WA 3HHNB 1LCUA 2CJBA 5E41A 4TQSA 2MTLA 3AO4A 4ZTFA 1VQLN 2YWFA 4R25A 3KHGA 4ILMA 3N5FA 2MQQA 2KRRA 4I1TA 4FYDA 1G99A 4L73A 4WIQA 3WBZA 4TNOA 3LP0A 5I4MA 4LRCA 4P75A 3A5LC 2AQ4A 3KZBA 5FJ4A 2ZJPL 2QIFA 4DFJA 2QG9B 1OYDA 3SBMA 4K0KJ 4WK3A 3MOZA 4RBVA 4OI3A 4PWWA 2LCWA 2ZH3A 2FBXA 3D66A 4U7UK 1W2BM 2DR9A 1M5OC 4GV6A 1FKAF 5HROB 4C48A 4HLBA 4MDBA 3KUHA 1B0PA 4DUTA 3TO8A 3MEKA 2NSCA 5KRTA 2KJVA 2XQCA 2B43A 2BV3A 4KHRA 3PW4A 4CBWA 3G8TA 2P9NA 2CGLA 2QGFB 4QR2A 4OYIA 1NZAA 3SUQA 1EKSA 1ITPA 2VQEJ 1SC1B 4OJ1A 3OVNA 2ZOMA 3EZ5A 3CJ3A 2OMLA 5AE2A 4DHYA 2ZC4A 4U7UD 1JQGA 2EC2A 2BJ1A 4LUBA 4AXIA 2ILYA 4NMXA 5IWAF 1CLFA 1RWPB 3SZ2A 2HK2A 4HI2A 4RJVA 1NAQA 1QQOA 3DLEA 3N6LA 2COLA 2L9WA 2Y0BB 2AW0A 3M32B 3CCES 3HPGA 4NA1A 1LKZA 1LW2B 4DU1A 1QD1A 3K59A 1VSHA 2E2NA 1DKGD 1HNIA 2LFVA 5B09A 2YHWA 5D3GA 2DJWA 5AJ3J 3RGIA 2HF3A 3QBCA 3ITHA 3KHHA 4DV3J 1ZS6A 4ED1A 4DI6A 4O3RA 2MKIA 2ATQA 3IWXA 2FY8A 5AQOA 3GILA 3GIRA 5CH7B 1HNVB 3DDKA 3OBIA 2QLFB 3K2PA 5HLFA 2C2OB 5D3GB 4B3OA 4IWVA 3A12A 1FJEB 2ZGYA 1SC3B 3MM5A 1JLAB 4I0WA 2U1AA 2YWEA 3L7UA 4F67A 1HYZA 1HUXA 2GAHC 5KFQA 2A1SA 4DSKA 3OD2A 1HIYA 1JXLA 1K8KB 1BWFO 3KLEB 3SUPA 4OI0A 3N79A 2G8UA 3VEVA 4DZDA 3D3CJ 3ZZOA 5K5MA 4JI3F 4BY9C 1X4AA 3CC7N 1P9QC 5HLFB 4DL0C 1NB7A 1FEHA 5CR4A 4B3OB 3GR0A 3MM5B 1FNMA 3KMQA 3D0IE 2EFPA 3FLCO 2HRTA 4CF8A 3PO4A 4JKCA 1VFJA 2F4VJ 1TL7A 3BSNA 2P6SA 4PA1A 3PHEA 5DDQC 4LF5K 2W01A 3H5XA 3IAM9 2FZKB 2HHVA 4OYZA 3NGKA 1IH7A 1YX2A 4H4OB 3M8WA 3N4PA 1HI8A 4DR1J 2IS3A 3ISND 4YY3F 3WNHA 4YMEA 2MEWA 4BVOA 3QGIA 4FJNA 4DQQA 2QEXS 3HP6A 4IBNA 4OO1J 1LWCA 2V4QA 3HVAA 4ZP9A 4EFHA 1F60B 2D0PA 3CNQP 2K7KA 1M5VC 1U2VB 4CP5A 3ZFVA 3HXMA 3TSPA 1U8WA 1H2UX 3QYYA 4HI1A 5LJ5Y 3IRXB 3CJ7A 3CPEA 4KAZA 3T9NA 4CJPA 3NVMA 2DNMA 3K89A 4LF7K 3ZTRA 1UPPA 2ILZA 2DPJA 1Y00A 2QZ8A 4CLZA 5E0OA 2DXEA 1N6QB 2NR0A 1VRTB 1NRKA 3OR2B 3BJYA 4LSNB 1J2VA 4LRAA 3W62A 1VIXA 5B7WA 1QQCA 4B1YB 4CLLA 4DTOA 1ACMB 1O13A 4PYDA 2E5JA 3RAXA 4K8RA 4Y0FA 2AF6A 4LQ9A 3R27A 4CFCA 2Y9HA 3G10A 2KZZA 4NLOA 2KVQE 5BN9A 2HNZA 1KDNA 3F2KA 3IBWA 4NYFA 2HQDA 5B0BA 4ZIWA 3QJJA 3NNCA 3I0SA 4IO8A 1N54B 2LDYA 3O4NA 4I64A 4KJIA 3FCWA 4QIFA 4EHTA 3UDCA 1KVBA 4WF9Q 3RRGA 1FK9A 3OLAA 2HF4A 3ID6A 4CT8A 3OSNA 3LOUA 2GTDA 3UN5A 1S1VB 2DNKA 4FS1A 3H42A 1FCAA 3D4JA 4J2DA 4EO8A 2W2OP 3ZO7A 4E89A 3I0SB 5E3CA 2HHTA 4JYAF 2C42A 3ENVA 3ZYYX 2W2MP 3PW2A 4ECRA 2RQMA 3GPAA 2OMOA 3MAQA 3NMUA 3RMCA 4JI4K 4ZJOA 1FJGF 2HOEA 1ZH5A 1NBEB 5L9XA 1HHSA 2OZMA 1CLQA 1TAQA 1QVGR 2CJKA 4FW1A 1SQEA 2ZHBA 3NHGA 2FBYA 4C3LA 3ETOA 4FJXA 3CCLS 1IO2A 5M2UA 2ZZTA 1PO6A 3SIPB 2PGCA 4F4AA 3TI0A 1Q8LA 1SJ4P 1NSAA 2NNWA 4LRBA 4IXCA 5JLHA 3OFGA 2DTUA 3K7RA 1BD6A 3JS6A 4IJAA 4M45A 2N4DA 4PKIA 1Y11A 1KWMA 3IGVA 2HHHJ 3TUZC 5D4LA 4ED3A 1U49A 4KH5A 1FWPA 1IG8A 4M5IA 3CQXA 1UVKA 2B51A 4WWSA 1D1UA 4WF9L 2UUBK 1ZBFA 1JLGA 1C1CA 3LDLA 1EO1A 1WSJA 1UEUA 2VWBA 3OL6A 4B8AB 1ICEB 1Z2ZA 3US5A 5ADXH 1QE1A 1V4TA 2MDAA 3R7SB 3IGNA 1Q95G 4BRGA 2QFIA 3MDQA 5DQIA 3MURP 4HTLA 1S5JA 3O4QA 3H1VX 1TL1B 4B3SJ 3E8OA 4JI7K 2UUAJ 2IDLA 2G1HA 4TU8A 3V5RA 4ZN3A 4X66F 3OYLA 4OYBA 2B9WA 3EICA 3SAFA 3T6JA 4CO3A 3BDEA 1E4GT 1YVUA 1N32K 1SQFA 1NU0A 2NRHA 4KV8B 1T3OA 1OQ6A 2FGCA 2HFUA 3NGUA 1QE1B 3QBXA 3OBWA 1HMVA 2G8HA 4PWDA 4OZ1A 2MZQA 4FJGA 4U8VA 1BI4A 4JKFA 3DXBA 3BR8A 2AT1B 1IKVA 4ZCLA 5KOXA 5KFMA 2H3EB 4IR9A 2EX3A 3FZ2A 1FFSB 2YWGA 3CIMA 4MK7A 4B3TJ 2E1CA 2NYIA 1Q16B 3SSSA 1L3UA 2DCUB 3HHLC 4FLVA 1W97L 3L2VA 1RAEB 4DTNA 2BDPA 5J2QA 3J80U 1S79A 3ZT1A 3I55N 1HMVB 3QMQA 2H65B 2J6TA 1IKVB 1XIQA 2QTWA 5KT6A 4U8YA 3LZIA 2JC1A 2PFUA 1O51A 3AJDA 3HF5A 3EKSA 2NLXA 3CDBA 2MZ1A 1S4EA 4LF9J 2HSTA 3NCPA 1N5YA 1RDRA 4AILC 2OJ3A 4FZYA 2CQ2A 1FXDA 4IDKA 1U2RA 4TU9A 2EK1A 1VSFA 4P10A 5KFOA 2X1AA 2W9AA 1NJIT 1Q9YA 3J7AN 2FZCB 5EWFA 1XNQJ 4OGEA 1OS5A 4DV6K 3GWCA 3AD9C 1RILA 3F56A 3CCRS 4WP9A 3UDEA 5F8NA 2MJUA 2C2NA 4B3RJ 1TV6A 2DY4A 2QA4N 2WVBA 5A8WA 4JI6K 4G1QA 3L8BA 4OQJA 1N5YB 1Y9OA 3UKUA 2HBZB 2RN2A 4FK2A 3NG8A 3MN6A 1Y7PA 4DUZJ 3B6OA 2GHVC 2J0SD 3QGGA 2ZKUA 3UN2A 2ZNZA 1UW9A 4KKOA 4W92B 3B8HA 4L3NA 1DQ9A 5J2NB 2JLEA 4H0TB 4GMKA 3GBTA 1YJWS 4OLOA 3P38A 2GX9A 3S3MA 1K9MT 4CBXA 3T6BA 1X5OA 1BCOA 3CDWA 3DXMA 3HD1A 3UKUB 4CWBA 1RU1A 3AY9A 4ILHA 1BU6O 2NZCA 2CNKB 4R0JA 4FLYA 1TKDA 3ENHA 3K58A 2O8CA 4KBOA 2CUYA 4CLSA 3H5UA 4DTMA 2D41A 3CWJA 1RTDA 2Z1GA 3PLAA 4OHWA 2F5GA 3I5CA 4UOHA 3I9V9 2FVQA 2JFKA 5C24B 4CERA 3CF5Q 3BKFA 2IVNA 5AQYA 2RHSB 1NEEA 5KG3A 2RRAA 2RQ4A 1BY9A 5BRFA 4K4UA 2XRIA 4KH4A 3LPYA 2D9PA 2ZHAA 3VTIA 2CADA 5CZVA 3B4MA 4M1KA 3Q86A 3OYCA 1XI1A 4C4WA 3AO5A 1RT7B 4CEBA 2Y8YA 1X4BA 1TU0B 1GMUA 4Y34A 2YTCA 5D0EA 1VQ7N 2UVVA 4ITSA 2GNKA 1CSJA 2LQ8A 4YB5A 4ICLB 4J91A 4Q8EA 4ELVA 3RU0A 1VMBA 4Z4CA 3AXKA 2A5XA 4GVLA 4ECSA 1Q8BA 3HMJG 3PSFA 3HHKA 2ZM6F 4QBUA 2V69A 4Q0BB 3CMEN 3WEEA 2DNYA 4B1XB 4C0BA 2ROGA 4NXMJ 1TFWA 1KFDA 4QWAA 3CF5L 1MROB 4KHUA 3TARA 2JZ5A 2OPPA 5ETKA 1KHWA 3FBBA 3ENWA 3KLFA 1HNZF 4A48A 3TNVA 4NLCA 3CCSS 4JI8F 4BDPA 4ANCA 5F0XA 4KTQA 3HTVA 4FF4A 2WONA 3MCPA 2DYAA 3M5RA 3T5LA 5DGBA 5DM7Q 1SB6A 4MTPA 3GTYX 3PRBA 1HJRA 4A8YA 3C6TB 4EZ6A 3MM6A 2DNNA 4JI3K 1SJFA 4DMNA 3EJMA 4FZXC 3PRVA 2E29A 4L74A 3W5YA 2OPPB 3VGSA 2A42A 3M4XA 3KLFB 3SBTA 1HKGA 1VQYA 3THVA 2JVRA 4EBEA 3MTJA 4EWTA 1VIOA 4DV5F 2ZEJA 3JAMO 1CBKA 4X64J 1KLNA 2FJBB 3MM6B 1XK8A 3TWHA 2F7TA 1NPRA 2G8WA 1DFDA 1C4AA 3HBTA 1N5SA 2B4UA 5BREA 2ZE2A 3C16B 2PMHA 4CF2A 2UV8G 5KT5A 1RFQA 4YY3K 5BYRA 3G4SS 3VV2B 4X4OA 3JQJA 1IJJA 4PYAA 5DDRC 3J81O 1S1XA 3NVKA 3BQ1A 1ZTTA 3B54A 3KG1A 3I32A 3CJ4A 4TXSA 1R59O 1B99A 2KT2A 4C8MA 2OTLS 4NEZA 3TZWA 1WTFA 1KAYA 3H45C 1FWLA 4FWOA 2QT7A 1WAJA 1UW4A 4ZPAA 1GOBA 5HO4A 4H54A 4FPRA 3AHPA 2HBQB 3GONA 3WXJA 1S6PA 1S1XB 4N77A 3CCMN 3EGZA 2V8VA 3UWTA 1MU2A 4AL7A 3H4BA 1PJ5A 3GV8B 1Y4ZB 1WF0A 1S48A 2P5VA 2WAQD 2ZH8A 1HL6A 2ABYA 2RQCA 3VQ8A 1VSDA 5CAAA 2W9BB 3HHLA 1VQON 1VQ5N 2XC9A 2AJQA 4CI0B 3HM9A 1DEJA 3EVMA 5GIOA 3RG6A 1S6PB 1XMOJ 3U6FA 3C15A 2IRYA 1WF1A 3K5NA 3B8AX 4O3NA 1BA1A 4BE1A 1V4SA 2XMJA 4PY5A 3UQSA 2P6TA 1IBLK 2RKIB 4F02A 3WQPA 1VSLA 4FW2A 1EHWA 1IKWA 1LXJA 5F8LA 2DR8A 3TR5A 2AJFE 3L2RA 3MCNA 1WORA 4HL9A 1JLFB 2W41A 3M8RA 3GCWP 1H2VZ 3MX5A 3CC2N 1XMQJ 1I51B 2D3O1 1WLJA 3V6DA 2EI5A 3FBEA 5JJBA 3C94A 2JLGA 3NGZA 3LZJA 2E1PA 4HH0A 2UYTA 3RSEB 4JI1F 1SZ2A 4CGDA 2V8PA 2IA6A 3O8MA 1X7VA 2YHBA 1URRA 4JYAK 4OZLA 2ZBCA 2AYMA 2YNGA 3PIPQ 3BEXA 4K5RA 2M2BA 4I9QA 3I8DA 1U1PA 5IV3A 1FJGK 2VWKA 4F2RA 1WSEA 2AMCB 4KGKA 1NGJA 2IA0A 4X2BA 4LIRA 1WC4A 2FF6A 2UUTA 2VC1A 2GEMA 5C15A 1UL3A 4QS9A 3UVJB 4YHHF 3FZHA 3VEZA 4NCAA 4WTOB 2V50A 5LXRA 3CDEA 5M1FA 1F1BB 1E6YB 1UVMA 1LAWA 1YK9A 2QE5A 2IY5B 2GAGC 3UNYA 4ZP8A 1OY6A 3D7SB 1R0AA 1S9GB 4FOIA 3UN3A 2L41A 2P9KB 2DD8S 2ZZNA 5GVQA 4J9UE 2F3JA 3QFPA 4B08A 5FRMA 4C6AA 3LP1A 3DLHA 2F7VA 4H0XB 4LF8K 1U1MA 2B9EA 1WBDA 3W2VB 3ZSOA 2CQ1A 4JV2A 4ED6A 2R7QA 3G6XA 3OUYA 5T14A 1ITGA 2IBKA 2WTUA 2V7ZA 1NK8A 2O1PA 2XMAA 2QWOA 4L72B 2OFHX 5AFUA 4IRCA 3RZAA 4DR3K 2KLAA 3O3LA 3AVKA 2IHR1 5L1LA 5G0RA 4B9NA 1J5EJ 3P1GA 4O4RA 3BZCA 4MFBA 1YJVA 2XULA 3QESA 3DM2A 4H4MA 1WC0A 3L6QA 1BDGA 3ZNJ1 4X66K 3OUYB 2D9OA 3CIPA 4DUYK 2IIRA 3NF8A 2G2OA 2ZNYA 4CLWA 4DX5A 1O6XA 1KOHA 3NH0A 3IS9B 2QRRA 1YI2S 2Y1RI 3LAMA 3CT9A 1CJVA 2RILA 3FR0A 4K43A 2Y1JA 1J9AA 4C0OC 1WWHA 6FDRA 1Y3JA 2IAJB 4IOAQ 4H4MB 4NYPA 3NGIA 1WG4A 2HIYA 2VZ9A 2DXDA 4O5B