3DM2A

Crystal structure of hiv-1 k103n mutant reverse transcriptase in complex with gw564511.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
539
structure length
531
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 146
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dm2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dm2A05
3G6VA 1C1AA 2C2EA 2DFEA 5DG8A 1T3NA 1YTAA 4IKAA 1EX4A 3UQSA 4WFYA 4J9KA 1SUQB 3LP1B 1RA6A 4IG3B 4DEZA 5C25A 3DLBA 3OYBA 5F8HA 3DRPA 1RTIA 3LP2B 4KPYA 2D41A 4O4GB 3QIPA 3DLKA 3AVNA 2QV6A 4QW8A 3ZCMA 2GBZA 2BR0A 4C8NA 4N56A 5HP1A 4CGGA 4IH6A 3QEVA 1U4BA 1RBSA 2X6NA 1L3TA 4RUCA 3I5BA 1JXLA 4BDPA 1JL2A 4DSIA 1BQMB 4H4OA 1J9AA 1TQLA 3KLIB 2G8FA 3V9SA 3QESA 4EBEA 4OVLA 1IKYB 3I5AA 3NF6A 5DQHA 3KKRA 3L2QA 3OS2A 4J2DA 3QO9B 4ECTA 2DPIA 3DM2B 4NLRA 5L1IA 3N6NA 1N56A 4I2QB 1WSFA 3VQEA 1A5WA 3BJYA 1C6VA 4WE1A 4CFAA 4OGEA 4O3QA 5L1LA 3KLGA 3RMAA 3AVHA 1FKPA 1REVB 1SKSA 4CESA 5KT6A 2E9RX 1IKXA 4CEBA 2IM1A 4JS4A 4CJ4A 4TY8A 2R8HA 4PWDA 1TKZB 2VWKA 4J2AA 4DL4A 2CKWA 2F8EX 1KFDA 1TL1A 3QYYA 1DLOA 4ZPAA 1S1UA 1TK0A 2W7OA 2G8IA 3KD5E 4O44B 5CYMA 4DQQA 4QWEA 4W5NA 4MK9A 1QE1A 3HYFA 5KFDA 4WXOA 1O1WA 4CE9A 4TQSA 4E3SA 3ZT0A 2DFFA 4ZHRA 4EP4A 1T03B 2R8KA 5E41A 5T7BA 4K4TA 1XR5A 1HNIA 3QINA 2FVCA 2RKIB 3H08A 1HQEB 2IGIA 4KTQA 4ZMMA 4Q44A 5HRPA 3DLGA 4B3OB 3DLEB 4HUFA 3E01B 4FS2A 4YFUA 5F8IA 5HLFA 3O4NA 4B9UA 1SH0A 4ECYA 3DOLB 3RR8A 3NH2A 1TK8A 2I1RA 2D3UA 5KFEA 4DF8A 3AVLA 1U09A 2VG7A 3PW4A 1HJRA 3V6DB 1BQNB 3G0ZA 4YR0A 3C6TB 1JLGA 4PY5A 3KOAA 5KT2A 2JEGA 3GQCA 2D7SA 4OGCA 1LW0A 1Y97A 4NCGB 3G10A 4RNFA 5KG4A 3OLAA 1DTQB 5DLGA 1L3UA 3UPFA 3PY8A 4HKQA 1UWBB 2YNIA 4NYZA 1S97A 4CJUA 2BQ3A 3ZSVA 4Z4CA 4FLZA 1S1VA 1SL2A 2BANB 4B8AB 3OYDA 2BGGA 3OYFA 1JIHA 4DFPA 2JGUA 4AHRA 4EZ6A 3V9UA 3JYTB 3EZUA 1N6QA 4XPEA 3MAQA 4EZ9A 5EWEA 1I39A 3TAGA 2D0BA 4ED2A 2D5RA 1B92A 3KIOA 4FJIA 4Z4FA 1TKTA 1SUQA 3PW0A 1ZTWA 5J2MA 4CEOA 4FM1A 4M3WA 4MKBA 3M9MB 1TKXA 5I3UA 4ZVFA 3H5YA 4CIFA 3SUOA 5C42B 2RDJA 4U7CA 3SV4A 4HYKA 2YKNB 4DFKA 1DTTB 3MXMA 2JEJA 3MFHA 1GX5A 4WZMA 5KFBA 4DTUA 5KG7A 1T94A 1A5XA 3LAMA 3TARA 4O3RA 4CJPA 3ZSWA 3PZPA 3K2PA 4E89A 5KFYA 4MK8A 1XWLA 3VQQA 3C94A 2FC0A 2EHGA 2E9ZA 4J9PA 4B9LA 3AVAA 4CJFA 3TI0A 2YKMB 4ID5B 4ZVGA 3CJ4A 4ZVEA 4FM2A 5KFNA 3T5HA 4Y2AA 2OYQA 3AVJA 4ED7A 2IC3B 2ZD1B 3DRSB 4N5SA 1BCMA 4K50A 3PX0A 3V1OA 2RF2A 4YQWA 2XHBA 3NMAA 4W5TA 3SQ2A 4XPCA 3EY1A 1JLFA 1LW2A 2W9CA 2X6SA 3IS9A 2BQRA 4KKOB 2OZMA 1RDBA 3B6PA 1VRUB 3H98A 1HMVA 2BQUA 2W9AA 4CK1A 3EZ5A 4CJ3A 3ZSQA 1S1TB 3NH0A 3KJVB 1KVBA 2GUIA 3V1RA 3IG1B 3RB0A 3CDEA 3LAKA 4JRQA 3NFAA 4ZTJA 1K1SA 5KFLA 1RBVA 4C8MA 4OPKA 4CIGA 3OYMA 3KLEB 4F3OA 4FXDA 4NLOA 3BGRA 4TQRA 1VSFA 3CQ8A 2P51A 4MFBB 3OYNA 4KHWA 2FJWA 1HQEA 4K4YA 5KG6A 3MR3A 4O3PA 4I7FB 4LQ3A 2HNDB 4KHSA 4TYBA 4E7HA 3CYMA 2BE2B 2VG6A 4NRUA 1NOZA 2V4RA 5KRSA 2UUTA 3P83D 3L8BA 1X9MA 4DG1A 4E1NA 2D3ZA 3SQ0A 2O5DA 4O3SA 4NYNA 4LSNA 3ZSYA 3C6TA 2WOMB 3OY9A 3ICLA 3RRHA 4KO0B 1HYSB 1RT6A 4RW6B 3CVKA 4KTWA 3ZSRA 3QEWA 2WB4A 1ASUA 3NGZA 3S3OA 2AQ4A 4WZQA 4DTOA 5F9LA 4DSEA 3K5OA 1MU2B 1C1CA 3DMJB 2I5JB 1EETA 3RRGA 4NLYA 3HVAA 1DTQA 2X78A 4RW4B 4Q43A 4NYFA 4AH9A 4N47A 3CFRA 4E7KA 4OKKA 2E9TA 2FJVA 4GW6A 3G86A 1CZ9A 2W42A 3I0SB 2FLLA 2FBVA 3HPGA 4FYDA 1X1PA 4EYHB 3O3FA 3HSTB 3CIZA 1U49A 4DL3A 4EO8A 1NJYA 2V4QA 1LV5A 4CEZA 3OYJA 5J2PA 4CJKA 3RWUA 4IRCA 4ECZA 2QXFA 1NJWA 4FBTA 1TAQA 1SV5B 3KTQA 1ZBIA 4KAZA 2EX3A 2FLNA 4C8LA 4AHTA 4TXSA 2JEFA 1QS4A 2HMIB 3AVFA 2RN2A 4BDYA 1D5AA 3DI6B 1TL3B 3TAEA 3PO5A 4M3UA 2YNHA 3HL8A 2DTUA 3HHKA 1VSJA 4FJNA 1JLBA 1C0UB 4OPJA 3OYGA 3N6MA 3HVTB 3O3GA 2G8WA 1RAJA 4QWAA 5C42A 1NK0A 3LWMA 4WYLA 3K57A 5F9NA 1C1BB 4Q0BA 3LALA 1S9GB 1JXEA 4DTSA 3MFIA 4J9QA 5FRMA 5KG0A 4AHSA 4K4WA 2YHAA 1F21A 2UUWA 3MECB 4XO0A 4CEQA 4EBCA 1WNEA 1S1XB 2ATLA 4E7JA 2A1RA 3GYNA 4NLPA 3LZJA 1TV6B 4DL6A 2IJNA 3V9ZA 2B5JB 3CFPA 1RT2B 4ICLA 1ZETA 3Q8QB 3U6FA 5KI6A 4YR2A 4ED8A 3BQ2A 4KHRA 5JS1A 4B9VA 3NCIA 4RW8A 3KLHA 2W7PA 3ZSZA 1D8YA 4B9NA 3QEIA 5KG1A 3RB3A 4CEDA 4CHQA 1RT7B 1WSHA 1RTHB 2W8LA 3HVWA 3AVIA 3NHGA 3NGYA 3KK2A 5DMRA 2WCXA 4FLTA 4DSJA 3T3FA 4IOBA 3TWHA 3VQAA 3CWJA 3CM6A 3RB4A 3VQCA 3PW7A 1S0NA 1BGXT 4FZXC 4CJQA 1RT1B 2FBXA 4ZP8A 3L3UA 1NKCA 5EUHA 4RUAA 1S6PA 4CJ5A 2OPQB 4ED3A 3IRXB 3NF9A 3ZT4A 3FFIA 3I8DA 4DMNA 1JLAB 2X74A 4IDKB 4OLAA 1QTMA 5FDLB 3AVBA 3CG7A 3UDLA 1MMLA 2XRIA 4RU9A 3UR0A 3MEDB 3IAYA 4K4UA 3RAQA 1HYVA 3NAHA 2XC9A 2W8KA 4CJEA 4R5PB 2JC0A 1RTJB 3ALYA 2C2DA 3PO4A 4MFBA 4NLWA 3KMSA 1C0TB 3G6XA 4FJMA 3V6HA 2OPPB 3NAIA 2HNDA 3KMQA 1C0MA 3ITHB 1VRTA 1IO2A 4B9TA 1IKVA 2YNFA 5DK5A 4KE5A 3NL0A 1LWCA 1IH7A 4LH4A 1FKOA 1BHLA 1WAFA 2R2SA 3MEEB 4MKAA 4IFVB 2WOMA 5KG5A 2YV0X 2DPJA 2ZQBA 3H40A 1JXBA 4RG8A 2F96A 1RT3B 2FBTA 4Y3CA 3GIJA 4DTJA 3MEGB 5KT4A 3DMJA 3AO4A 2I5JA 3C6UA 3RAXA 1QSLA 1UAXA 1U45A 4N41A 1J5OA 2W9BB 1IKWB 1U04A 2ZE2A 3BQ0A 2O4GA 2F8TA 4RW9B 2VA2A 5KFIA 3I0SA 5D3GB 2HNZB 2WONA 2JEIA 1I6JA 1RTDB 1QAJA 1NKEA 4CJWA 1ZBLA 4XIUA 1UA0A 3S9HA 2B6AA 4ECWA 3NKYA 4YMEA 5HRSA 1SV5A 1RBTA 3SQ4A 5F8GA 1LWFA 4KB1A 2ETJA 1L5UA 4CGFA 4F4WA 2HMIA 3PVXA 4E7IA 5HROA 2XI3A 5KFZA 2HW3A 5SZTA 3DI6A 2E6LA 1TL3A 3QLHB 4IR1A 3OLBA 5KGXA 2FVQA 1BIUA 1SKRA 1C1BA 4IG0A 5CYQA 3V81B 2P5OA 4DQRA 1T05B 3DRRA 4FJ8A 4RNMA 4WFZA 1NOYA 4CCHA 1D9DA 4H4MB 2OPSB 2AX1A 1D9FA 1CXQA 2B43A 3L2RA 4Q8FA 2R8JA 3HP6A 1YT3A 2E4LA 1FK9B 2P5GA 4URSA 3SQ1A 1U47A 1IG9A 4DTXA 3DLHA 3NAEA 1ZTTA 2OH2A 4CHYA 1U48A 3V1QA 4ZPBA 3DYAA 4DTPA 2ZKUA 2IAJA 2XY7A 3GV8B 4I9LA 3BSCA 2KQ2A 5K14B 2OPRA 1JLEB 3KK3A 5FROA 3T5LA 1S6QB 2AWZA 3MF5A 5KRTA 1XC9A 4BWJA 4DTMA 1TVRB 1QHTA 2YHBA 4J9LA 4KV8B 3L3VA 1RBRA 4IRKA 4PUOB 5F8LA 5I42A 3VQBA 1RTHA 1EP4A 1RBUA 3OYHA 3H4BA 2HVIA 4AILC 1T7PA 2CJQA 3KLFA 3RBEA 1BCOA 1BI4B 1K6YA 4G3IA 5KT3A 3MTKA 4DL5A 3HPHA 1KVAA 3I0RA 2Z1HA 3C95A 1R0AB 5J1EB 2WRMA 3KK1B 3H59A 2A1SA 3NF7A 3VQ4A 3ASMA 3V6JA 1S9EB 3OL9A 1S1WB 4RW7A 2OPQA 3JSMA 4Y34A 2VWJA 3V9WA 1D0EA 4YP3A 2HWHA 1JLAA 3OL7A 2PYLA 4R8UA 5JXSA 3VN5A 1JLQA 3MR6A 4Q5VA 2YNGA 4B08A 3KHLA 3TAQA 3BSAA 4CHNA 4FLVA 3MEDA 4MQ3A 1N5YB 1NK9A 2PZSA 3CDUA 3AVCA 4DU4A 4EP5A 4ELVA 3B6OA 4E7LA 3LP1A 4LSLB 4TYAA 4IG3A 1CSJA 3FRZA 5KFXA 3LP2A 2D0CA 4O4GA 4FJXA 1HQUB 5DGAA 4BACA 4ZP6A 2OPPA 4J9NA 4HCBA 1T8EA 4NCAA 4FLUA 2ATQA 4O3OA 4QPXA 4JRPA 3M8PB 3THVA 4LY7A 1RCHA 1QSSA 4DF4A 3PJXA 4CFBA 1BQMA 4NLTA 1SH2A 3KLIA 1LAWA 3CM5A 1W0HA 4W5OA 3OYAA 2QKKA 1YTUA 1IKYA 4ED0A 3WNEA 3HKWA 1UA1A 1BL3A 3PX6A 2Z1JA 4ZVHA 4CGJA 3QO9A 4KI6A 4KHYA 4ZP9A 3DM2A 5DQIA 1WAJA 2OA8A 3SFUA 3AA5X 4I2QA 3VQ9A 3QGGA 4K4ZA 4RZRA 3NGDA 1RDAA 4MK7A 4WYWA 4CK3A 1HPZB 1WN7A 3K59A 4M3TA 1B9DA 3T5JA 5T14A 1VSDA 1REVA 2IBKA 3D45A 4U6PA 3K5MA 2WTFA 3S3NA 4CJLA 5KFOA 3H5UA 5KFRA 4BE2A 1TKZA 3FQLA 4ZPCA 1S0MA 1ZBFA 4YNQA 2G8KA 2HHUA 4PQUB 1HNVB 1LWEB 4DS4A 5HRRA 2C22A 4CJTA 3AVKA 3V4IB 5DG7A 3KLVA 4O0JA 2D0AA 4O44A 4DL7A 3CO9A 3TR8A 3FQKA 1GX6A 3MR5A 1KLMB 3O4QA 2VG5B 2NUBA 3PX4A 1RT4B 4G1QB 1T03A 3SJJA 4OKJA 4KAIA 3QIDA 5KT5A 3H2LA 4IR9A 2R2UA 2J6TA 5C5JA 2RKIA 4IFYB 2HNYB 3BSOA 1QUVA 2AGPA 2Y1JA 4B3OA 2C28A 3DLEA 4M3YA 5F8NA 3AV9A 4CF8A 3E01A 4K4XA 1TK5A 3QNNA 3RB6A 2UVVA 5C25B 1QSYA 3DOLA 1VK0A 4FLYA 3DRPB 1RTIB 3O3HA 4R0EA 3QIPB 5KFHA 3DLKB 4OLBA 3BQ1A 3V6DA 1S6QA 1BQNA 3CJ0A 3HXMA 1ZBHA 4ZPDA 4BE1A 1TVRA 2ILZA 4IQXA 3RMDA 1Q9YA 1JLCB 4HHTA 4PUOA 2ILYA 4H4OB 1JL1A 4NCGA 3GV5B 3VQSA 1XHZA 5KT7A 4FJ5A 1HRHA 4CF0A 1UWBA 1B9FA 4KB0A 2QE5A 4B9MA 3ZSXA 4ED6A 1IM4A 4CECA 4KHUA 3OJUA 5KTQA 1W25A 4LD0A 5DQGA 4B8CA 1JKHB 2BANA 3AVGA 3N6LA 4N76A 1KLNA 2BRKA 2WK4A 2XGQA 1X9WA 1XI1A 2XCAA 2RDIA 2IM0A 3QZ8A 4O5BA 1WSJA 3P1GA 1KSPA 3JYTA 3KLGB 5DG9A 5KGWA 3QEPA 2XWYA 4QOZB 2KTQA 1FKPB 4DS5A 4CGHA 3VQ5A 4DTRA 3KHRA 2KW4A 4HUEA 5KFCA 3M8QB 4AHUA 3QZ7A 2KFZA 3EPIA 4F3TA 1IKXB 4ELTA 3OYCA 2JC1A 2FBYA 4PWDB 3TABA 4FW1A 4FJ9A 1I3AA 4KHQA 2XO7A 4C8OA 3LP3A 1TL1B 1Z4UA 1DLOB 3FSIA 5KFUA 4CIEA 4F8RA 1S1UB 2YKNA 3M8PA 3KHHA 3F9KA 1DTTA 5CYMB 1CZBA 2IOCA 4FJHA 1RILA 4I2PB 4JUZA 4Y1DA 4QWCA 1XHXA 4J2EA 4ZHRB 3V9XA 1XR7A 4ZTFA 2AGOA 4E19A 2C2RA 5KFAA 3IN5A 4NLGA 1HNIB 1RYRA 1RDRA 4M45A 3HVRA 4FJ7A 3ISND 2YKMA 4ID5A 3WNHA 4B9SA 4Q8EA 1WSEA 1TGOA 3DLGB 3TQ1A 4KHMA 2G8HA 5KFKA 3WNFA 5HLFB 1SL0A 4DLEA 1S0OA 2IC3A 2ZD1A 3DRSA 3VQPA 1YVFA 2PY5A 2VG7B 1GOCA 4Z4EA 4CHOA 4M95A 3Q8PB 3K5LA 4KKOA 1JLGB 1VRUA 3QGIA 4Q45A 3QNOA 4NCBA 3PR5B 1KCFA 1L3SA 1LW0B 3QGHA 1HNVA 4DL2A 1S1TA 2ALZA 3KJVA 4JV1A 3NF8A 5KFJA 3MXIA 3VQDA 3AA4A 2Z1IA 3IG1A 5EDWA 1S10A 3QERA 3EPGA 2YNIB 3TAMB 1KLMA 2VG5A 3BREA 1RT5B 5HRNA 4CEAA 4J2BA 3KLEA 1S1VB 5JS2A 4RNHA 3D5MA 3AA3A 5J2QB 5DLFA 2BRLA 4DU3A 2O4IA 3AO2A 3K58A 3AO1A 4GC6A 3RBDA 2E6MA 4KTZA 2HHVA 4I7FA 1N6QB 2PYJA 1OS5A 3RMCA 4DSLA 3I5CA 4ECRA 2HHTA 4E1MA 1RDCA 1ZBUA 1TKTB 5L9XA 2ASLA 2BE2A 5J2MB 2AGQA 3BDPA 3ULDA 3SZ2A 3LWLA 1TKXB 5I3UB 4GVMA 3DLRA 4CFDA 3SNNA 4M42A 3PR4A 4FJGA 3TAFA 4J9OA 4KO0A 1HYSA 3OVNA 1G15A 1KFSA 3TANA 4RW6A 2UVWA 1JLCA 3HM9A 4NLVA 1N4LA 4E0DA 1MU2A 2IM2A 3GIIA 3OL6A 3LP0B 3PW5A 4FJLA 3SV3A 4F4KA 4M3RA 4NRTA 3VQ7A 4RW4A 1KTQA 4KREA 3P5JA 2KFNA 3CDWA 3M8SA 1VSMA 4ECUA 4MH8A 2G8UA 1NHUA 4MIBA 4FVMA 1JKHA 3QEXA 5KFGA 4CFCA 3TVKA 4O4RA 3HO1A 5KFFA 4CEEA 4CJRA 3H4DA 2IMWP 1D1UA 3SYZA 5KG3A 4F4ZA 2RF2B 4NLXA 4NLDA 3M8QA 1JLFB 1LW2B 3PUFA 2W9CB 1YVUA 1SKWA 4QWBA 1S49A 3IS9B 2XCPA 4FLWA 2UVRA 4IKFA 1HMVB 5KFQA 1NK6A 5L1KA 3MXJA 3U3GA 1C0UA 3HVTA 4ECSA 4FS1A 1S9GA 2XY6A 4Y1CA 4DWIA 4KSEB 1HYZA 4I2PA 5CZ1A 4LQ9A 2IA6A 2B4JA 3MECA 3ZT3A 4M3XA 3OHAA 1S1XA 4GMJB 3RR7A 5KFSA 3EYZA 3F73A 1TV6A 2LSNA 3BGRB 2Z1GA 2B5JA 4KI4A 3M9OB 1RT2A 4YR3A 4ELUA 3SFGA 3DOKB 3AO3A 4ECVA 2AU0A 4UQGA 4FW2A 1LAVA 3KKSA 4M94A 5CY4A 4Z4HA 4KB7A 4IH5A 4EYIB 4K8ZA 4HUGA 4CGIA 4CJVA 2VG6B 3ZT2A 1ASVA 1RT7A 4IH7A 4DG1B 2V0NA 3OYKA 5F8MA 3D28A 1K1QA 4LSNB 1VSLA 2HHWA 4TLRA 1NJXA 1RT6B 3UIQA 4FJJA 1RT1A 3TAPA 1RA7A 3SI8A 3LZIA 5KFWA 3PW2A 3FDSA 4CERA 3OS1A 4FCYA 4NLUA 4FZYA 3IRXA 1C1CB 3LDSA 4K4SA 1EETB 4IDKA 1NJZA 1QAIA 3NGIA 4OJRA 1WLJA 5FDLA 3SUQA 5SWMA 3G6YA 5FRNA 4CF1A 3VQ6A 5CZ2A 4EO6A 3TAMA 2IM3A 1KRPA 1RT5A 2AX0A 3Q8RB 4H54A 4ECXA 2DY4A 3LPTA 4IRDA 1KHWA 5J2QA 5J2PB 4R5PA 3Q8SB 2JLEA 1RTJA 5J2NB 3IGVA 4O3NA 1SH3A 1C0TA 1JX4A 4EEYA 4F2RA 3ITHA 3BSNA 1NK7A 4I9QA 3S3MA 4DFJA 4FLXA 3ISNC 3OJSA 4CJSA 5EU7A 1VSEA 2XI2A 2YNHB 5EWFA 1N48A 4KFBB 1Z26A 1S5JA 3M9NB 4CGDA 1JLBB 2FVPA 4X2BA 3MEEA 3NBPB 4ECQA 1NHVA 4QAGA 4IFVA 3OS0A 4Q0BB 2RPIA 5KFVA 4W5QA 2XY5A 3LANA 5JUMA 3KNAA 1RT3A 3T19A 1X9SA 4BWMA 4BE0A 3MEGA 4F50A 3LP0A 3OSPA 1TKDA 3E51A 4KRFA 3QIOA 2XY8A 4NLQA 2W9BA 1IKWA 4RW9A 4BDZA 2Q3SA 2HAIA 5D3GA 4DSFA 4DQPA 2HNZA 4QWDA 5C24B 2J6UA 3AO5A 4ICLB 4J9MA 1RTDA 2P1JA 1XR6A 1BISA 4K4VA 2HHQA 1EKEA 4RW8B 3KLHB 2OZSA 3BR9A 3CJ3A 2GC8A 3CJ2A 1VSHA 4CHZA 5F8JA 3KK2B 4J9RA 2DFHA 1A5VA 3GIKA 3RTVA 1UOCA 3PHEA 3QLHA 1GOBA 1BIZA 2ITGA 4DQIA 1J54A 4NLSA 3AVMA 5L1JA 1S6PB 3FFIB 2R8GA 4Z4GA 2GIRA 1Z25A 3V81A 4KBIA 3L2WA 1T05A 1WSGA 1ASWA 1TAUA 4J9SA 4H4MA 1RNHA 5HBMB 2UVUA 2OPSA 4Z0UA 3VA3A 3SPYA 2GV9A 4F2SA 4QCLA 4DSKA 4TSXA 4FM0A 1FK9A 4GC7A 3AA2A 3H5XA 3MR2A 3GIMA 4O0IA 4FK0A 2KZMA 3OYEA 3DOKA 2Y1IA 4ED1A 4W5RA 1WNSA 5K14A 2R2TA 4URQU 2V9WA 3NDKA 1L3VA 1JLEA 4Z4IA 4FK2A 4OL8A 1VRTB 3H5SA 4JLHA 3NH1A 3PJWA 3HPOA 1IKVB 4WFXA 3SUNA 5HP1B 2YNFB 4KV8A 3V6KA 1NNDA 1LWCB 3QETA 4TN2A 1FKOB 2FLPA 4QW9A 2BDPA 1J53A 1BI4A 1QQCA 4FJKA 1R0AA 5J1EA 5KG2A 3KK1A 1FXXA 2HHSA 2AJQA 1S9FA 3RMBA 4M41A 3KD1E 1S9EA 4JV2A 1S1WA 3SPZA 2HVHA 3C6UB 1WSIA 5KFTA 1RYSA 4WE1B 1J5OB 4LH5A 3LPUA 3SCXA 3HJFA 2ZE2B 4HVJA 2XGPA 2WONB 2GIQA 1N5YA 4H8KA 1ITGA 4DU1A 4KHNA 4MIAA 4LSLA 5J2NA 2B6AB 4TY8B 1RDDA 3HT3A 4HTUA 4NZ0A 2FVRA 4CF9A 3CFOA 4Y2CA 1SL1A 1S48A 3ZSOA 2G8VA 4CEFA 1HQUA 1LWFB 5EWGA 2FVSA 2ASJA 3OYIA 1GOAA 3SUPA 4JV0A 3HK2A 3D0PA 4IBNA 4OKEA 1ZYQA 5HROB 4FK4A 4DTNA 4WXWA 1QE1B 3T1AA 2R8IA 4F4YA 3U3YA 4KFBA 2HWIA 3K5NA 4O55A 4HCCA 1C2PA 3NBPA 1EXQA 1S4FA 1NK8A 3OL8A 3VQ8A 4IG0B 5CYQB 3A2FA 3DRRB 2F8SA 3GILA 1Q9XA 1Q8IA 4F4XA 4CK2A 4L8RB 2FJXA 3L2VA 1VSKA 2IS3A 2QK9A 4URGA 3VA0A 2WHOA 2KZZA 1NKBA 1W9HA 1HPZA 4TY9A 4FZZA 3DYAB 2J6SA 4ZP7A 5C24A 3WNGA 2IAJB 2ASDA 4AHVA 3OYLA 4AHCA 3NE6A 2OPRB 3HP9A 4K8XA 3KHGA 3KK3B 2R7YA 2IJFA 3DDKA 4DQSA 4CHPA 1CXUA 3GV7B 4CF2A 2IDOA 4PA1A 5I42B 2R2RA 1NK5A 3OHBA 4EBDA 1EP4B 4PQUA 4ID1A 1LWEA 1HARA 1TP7A 3V4IA 3CJ5A 5DGBA 2VA3A 3KLFB 4RNNA 5KFMA 3PV8A 3I0RB 4RNOA 1KVCA 5KFPA 2HB5A 3ZT1A 1RT4A 4G1QA 3OSNA 4RW7B 3JSMB 3T5KA 4R8UB 3SI6A 1KHVA 2QKBA 2HHXA 4M3ZA 1JLQB 1NK4A 2YNGB 4DLGA 4C8KA 1VSIA 4IFYA 2HNYA 5HBMA 3M8RA 4FBUA 3L2UA 4JS5A 4DFMA 3IGNA 1CLQA 2EC0A
chains in the Genus database with same CATH superfamily
2ZH9A 2KVQE 2P2CB 2M52A 1EX4A 2Z8QA 4J9KA 4Z7CA 4DEZA 1H1VA 3KG1A 2H5EA 4IOAQ 4KPYA 3HHDA 5JMVA 2VV5A 2YX4A 1Q7LB 1HKAA 4F4AA 2E2QA 3D3CJ 1D9AA 4ILHA 5BPMA 5KQ8A 4C8NA 2DXFA 4N56A 2L9WA 1L3TA 1YITN 5KOWA 4RUCA 3I5BA 4RX6A 1RU2A 1YBAA 2F65A 3V9SA 5KOXA 4OVLA 3W8GA 3SBMA 3UD4P 2GWKA 4DR7F 4KBOA 4C4WA 3I5AA 1UJ5A 2Q0RA 4MKVA 4ANCA 1MWYA 5D4LA 2ASPA 3AD7C 2DPIA 4NLRA 2BA9A 4A8KA 3F2KA 2GJFA 3FEYB 4I2QB 1WSFA 4U67Q 4CZLA 4DV1K 4KR0B 3C3LA 1SPBP 4RTFD 2JVOA 1FXLA 2MLZA 4O3QA 2JLGA 3RMAA 1REVB 1UEUA 1SKSA 1R59O 1GK8A 2WVEA 2E9RX 2IM1A 4JS4A 2I9SA 3AA8A 2R8HA 1ATNA 3D6FB 2MXYA 2VWKA 4CI0B 4Z94A 3TUZC 3O1LA 3NOGA 3QYYA 4ZPAA 2OEJA 2ZF5O 3KD5E 4DQQA 4PWUA 4QWEA 4YHHJ 4TQSA 3M2VA 4YUDA 1IR1A 3ZT0A 2CQCA 2DRBA 2DFFA 3W5YA 3D0GE 3R5BA 5A8KB 5E41A 1FTCA 5T7BA 1T9XA 1OO0B 5E3QA 3RGIA 4RL1A 3NCRA 3QINA 2XYHB 3M30A 4BS2A 1KC8O 1NRKA 2IGIA 5EHHA 1RI7A 3A3OB 4B3OB 4O8UA 3AJ1A 1VC6A 4NA1A 1RDWX 5RUBA 3ET6B 3EE8A 2OHDA 1RAOA 3H1VX 2HFZA 4NX9A 3RR8A 4LFCK 4XH1A 1YRUA 1DKGD 5LMNK 1OKJA 1NDKA 3FVYA 2RRBA 2V52B 1TELA 3J81O 4IYQA 4Z37A 5AE2A 1QAXA 2JEGA 2CQIA 1VISA 3B6BA 3ZETB 4RNFA 1S12A 3VGVA 1HNWK 4KGXB 1NGFA 3OXLA 4WKYA 1EKSA 1NCLA 2R9LA 5ETVA 4C8ZA 3PY8A 1UWBB 4UOHA 4CI6A 2WBMA 4X4TA 2BQ3A 4N7TA 4OLOA 3CCZA 3TJ9A 2LDYA 3D2EB 3GIRA 2RD5C 1GLJO 4M7YA 2VFUA 1G2EA 4DV3K 4FLZA 3NMRA 3CCQN 2AF6A 2J9EA 1M1HA 4LRDA 4OV1A 2BTFA 3OYFA 2JGUA 4AHRA 3CCJN 1KVIA 3TZZA 4XPEA 2NYIA 3MAQA 3HFKA 2I7PA 1I39A 5KPRA 3TAGA 4K59A 3R1LA 3WIVA 3S7RA 1I1GA 4Z4FA 3RUBL 5ETNA 4BR7A 3BKTA 1ZTWA 4L3KA 3JTOA 3AJDA 3U4LA 4RWXA 2YI1A 2UXBJ 2NXUA 1U1PA 2DGSA 3H5YA 3SUOA 2V51B 2DBBA 3LOUA 1F9EB 4ER8A 2VOOA 1PJ7A 4AQYJ 1DTTB 4ZJLA 3HRGA 1HFEL 5AQQA 4WF9Q 2HS0A 3LAMA 3TARA 4JKGB 3ZSWA 1MN7A 3K2PA 4E89A 4F0KA 4MK8A 1K8KA 3DXKB 3CE8A 2FC0A 2EHGA 2W01A 2QWLA 3HX9A 3TI0A 4CJFA 2YKMB 3SSRA 3CJ4A 3T5HA 4A8QA 5B0EA 2QN6B 2CQPA 2G13A 2IC3B 2U1AA 1BCMA 3PX0A 3V1OA 4ZIWA 1D09B 3AOCA 3NMAA 2VBZA 4W5TA 2X3DA 1JLFA 1LW2A 2JZ5A 3M2RA 1ESVA 2X6SA 3IS9A 4KKOB 1HMVA 3TYTA 2O8BB 4CH0S 2PAVA 3TSPA 4CJ3A 3LGMA 3NLCA 2EPIA 2RMLA 4D3GA 3KJVB 3V1RA 3RB0A 2VJUA 4JI1F 3M6GA 2RHSB 1NM1A 2ZVIA 1N8RO 2KRBA 2YWEA 3C19A 1CJUB 1HNZF 4DUYJ 4JK8A 2P51A 5ETTA 2LQ5A 3A12A 5KG6A 4USMA 4ZLJA 4P9SA 4LQ3A 4KHSA 2Y1LB 2K3KA 4TYBA 2YQ1A 3GG4A 1ATRA 4QIFA 4E7HA 2KXHA 2BM1A 2F9TA 2VG6A 4NRUA 4RJVA 2V4RA 3P45B 1NOZA 1V4SA 1SQKA 4E1NA 2QWRA 3SQ0A 2OTLS 2AEMA 4NYNA 3ZSYA 1LOTB 1ILYA 3BBFA 2H4WB 3OY9A 3ICLA 3RRHA 1HYSB 1RT6A 4LF1A 3ZSRA 3QEWA 2E20A 3NGZA 3S3OA 2AQ4A 4WZQA 4DSEA 3DMJB 3RRGA 3H3NO 3HVAA 4IDHA 1WOOA 5U47A 2E9TA 1YF5L 2CH6A 2HF4A 5HOOA 3I0SB 4ZITA 1CLFA 3OVAA 3KVGA 3SCIE 4U7UK 1N8RT 3HD2A 1U49A 2QEXS 3MWTA 1NJYA 3RWUA 4CEZA 4IRCA 5AQTA 4DR1K 1OVYA 2BZ2A 1TAQA 1SV5B 1MMDA 3KTQA 5GMDA 2P9NB 1RBOB 2EX3A 1CULB 4C8LA 4L73A 2IFXA 5AQWA 5IQQA 2RN2A 2I38A 4WQ5C 4ILRA 4OX7A 2YNHA 5I3QA 5EXWA 1T9TA 1VSJA 2WBNA 1IBLJ 1C0UB 3CI5A 3QFUA 4YDUA 2G8WA 4MIWA 3THYA 2LU1A 1NK0A 5T7LA 4FOEA 3CULA 5AFUH 2HFNA 4L74A 4RLEA 3T7ZA 1S9GB 3QPIA 4DTSA 3MFIA 1GXTA 3W3SA 2YY3A 2YHAA 3V4MA 2UUWA 3TUIC 4EBCA 2OFHX 2QWNA 3GYNA 2V50A 3SMZA 1HW9A 2IJNA 1RT2B 3U6FA 2RU9A 3LTOA 4KHRA 1VI7A 3EVOA 1LQ9A 1PYOB 1IR0A 1D8YA 3GYXB 3DNCA 3QEIA 5KG1A 4CEDA 4CHQA 4RUBA 4MYTA 1LEOA 4WFNL 2W8LA 4X64K 2EVZA 3DOMA 3GCXP 2P9KB 4ZPWR 2E5GA 4DSJA 3B54A 3T3FA 4BRCA 2NNWA 5JVHQ 4KH1B 4PYDA 4IOXA 5JVGQ 1BGXT 2BVZA 4CJQA 1M5VC 2YQ3A 4ZP8A 2HBMA 3WZ0A 4CLYA 5HVHA 4UZBA 3MTJA 4ED3A 3IRXB 3ZT4A 2V2VA 2MQNA 4IDKB 2YX7A 1QTMA 3AVBA 1MMLA 2XRIA 3LDQA 1BOTO 5FPEA 3IAYA 4W4MA 4O23A 4K4UA 4FPBA 1NZAA 3NAHA 1YZ6A 1CJUA 2W8KA 3HBTA 4LMZA 1HNZK 1RTJB 1O5JA 3KMSA 4NLWA 2OANA 2JFKA 3OPKA 3F0NA 1FD8A 3D66A 2OPPB 3EDQB 2AV5A 1C0MA 3NEKA 3O8WA 3ITHB 3HJVA 1VRTA 1F5BA 3GJTB 1PGZA 3UVJB 3AB2B 4KE5A 1LWCA 3B8HA 4DOZA 2DNPA 3W9IA 2AJ1A 1UZDA 1BHLA 1WAFA 2HK3A 4A57A 1IBCB 4L6V3 3MEEB 3TOQA 2LXIA 4UY8T 4BR2A 5KG5A 2YV0X 3R5GA 1NGBA 1WOPA 4Y3CA 4CLUA 3GIJA 3MX5A 5KT4A 3DMJA 3AO4A 2W6KA 1QSLA 2M2BA 1UVJA 2QFIA 1U45A 4LFBF 1U04A 4P75A 3I0SA 4DR3F 3S41A 9RUBA 1QAJA 1T6CA 1ZBLA 1FJGF 2O8FA 4RKUC 2EXUA 4ECWA 5HRSA 1SV5A 3CJAA 1WELA 3MAAA 5F8GA 2DCUB 4PYAA 1L5UA 4CGFA 2UU9F 5ETKA 1S6UA 1SQGA 5KFZA 1YDLA 5SZTA 4FWNA 3QLHB 2J8AA 4IR1A 3BY5A 3O80A 3C7NB 1FKAF 3OLBA 2XLJA 2YJFA 4DR4J 2FVQA 3HHLC 1WEZA 5CYQA 1EO1A 3THTA 4JKHA 1NOYA 4R79A 4CCHA 4H4MB 3KKFA 3POTA 5BR9A 2PE8A 4IUFA 3L2RA 1BMQB 5D0RA 4Q8FA 2R8JA 2P5GA 2EFOA 2HHHJ 1QZ6A 2WBRA 2XLKA 1UPMB 4DTPA 3VGTA 5GAHI 4GKJK 2IAJA 3BSCA 3MMBB 5FROA 5KRTA 1OY9A 3DN9A 3O8MA 2YHBA 4KV8B 3L3VA 4JI3K 1ZA1B 4PUOB 2CQ3A 3VQBA 3PIPQ 3VALA 1R6YA 2WC9A 5LJWA 3ZX2A 3AAPA 3GONA 3KLFA 5H1SQ 4G3IA 3HPHA 4DZDA 3C95A 1CQNA 2VWBA 5B7WA 1IR2A 1ZBSA 2A1SA 4UOGA 3FSXA 3OL9A 4ES1A 4XH5A 1WDDA 2DHGA 3M4XA 2VWJA 4OHYA 5H9FJ 3OL7A 4H5TA 2ZJPL 2C2MB 2GGPB 4H0XB 2HRTA 4B08A 2QZ8A 3KHLA 1U1KA 4X4RA 4CHNA 1VQ9N 2MSSA 2HSEB 1K47A 2UXBF 2A1BA 2DGXA 3AVCA 2BJ3A 3PACA 3NWGA 2EI5A 4TYAA 4YOWA 4AQYF 4P71A 1CSJA 3BZKA 4ZLLA 4GY2B 2R7UA 5KFXA 2PA3A 4QIEA 4B1VA 5G0RA 2OPPA 2JX2A 4I6MB 2W4PA 1CJVA 4FPRA 1PAUB 3QRRA 2ATQA 4AE5A 4O3OA 2GMLA 3M8PB 1H98A 1Q1KA 4NLTA 3UDCA 1VQKS 1SH2A 5DZ7A 1W0HA 3MM6A 4W5OA 1Q7YO 3OUYA 2CPXA 2QKKA 1YTUA 2GUPA 4ED0A 3GSDA 2F7TA 1YJ7A 2FHMA 3HKWA 1UA1A 5HMZA 1WKKA 1MSWD 2Z1JA 5DQIA 1RE1B 5AQSA 2OA8A 3KDNA 4Z7YA 5JJBA 4XH4A 5CABA 3G6ES 4WYWA 4BRIA 3CJKB 2K1RB 1VSDA 3TJAA 4AFFA 3ULEB 2R7WA 4U6PA 2WTFA 3J81Y 2C2NA 1OJ4A 5KFOA 1DARA 2QMXA 4YOVA 3H5UA 1H0HB 5FLXY 3P5BP 3FBBA 4BE2A 2I7NA 3ZX3A 3VEWA 4I64A 3TNVA 4YHHK 1U26A 1ZBFA 2G8KA 4OYBA 3TZYA 2HHUA 4JI4J 4PQUB 3P4UB 3KZBA 1LWEB 3QT7A 5HRRA 2ZC4A 5GIOA 3PCOB 3ATUA 4C9DA 5AQMA 4O44A 3FQKA 2XS7A 1ZC6A 2VG5B 3NXZA 2EBEA 2NUBA 3BDEA 3ZNUA 3O6QA 4OKJA 1FX2A 1Q7YT 1RBAA 3ILIA 3C0BA 2YCHA 4F9OA 4JHDB 1KVKA 4IFYB 2HNYB 4FPAA 1QUVA 2AGPA 3ZYYX 1NZ8A 3QT8A 3DLEA 3OR2B 4M3YA 5LM7E 5F8NA 1ZM9A 3AV9A 2X1FA 3GFZA 3Q7BA 5K8PA 4CTAA 3QNNA 3RB6A 1ZH5A 2UVVA 2KT3A 5ETLA 1VK3A 1RTIB 1X4GA 2GVDA 3RSEA 1RFQA 4R0EA 3DLKB 2E1AA 2DO0A 4OLBA 4ETZA 1TMJA 5A8RB 1VBZA 3HXMA 2O8CA 4IEIA 4OI2A 2IVOA 3MM8B 2JRSA 2PC6A 1Q86O 4HHTA 3QMLA 4PUOA 4DR6K 4B3RJ 2VQEK 3P4IA 3M2UB 1VQNN 4NCGA 3M3ZA 2LEAA 3GV5B 1Q82T 5C15A 4OZ2A 4KB0A 2HZAA 4ED6A 5GAHP 4CECA 1WWHA 3BP8A 3MCOA 4B8CA 3AVGA 3RYLA 2DXEA 2CQGA 1XI1A 5AQUA 2VODA 1FEHA 2IM0A 2NSBA 2VBYA 3GPAA 3KLGB 2KTQA 2QLBB 3CCLN 2UXBK 1FKPB 3D2FB 4CGHA 1YJ9S 3KHRA 2KW4A 2J9DA 2WTUA 5BJRA 1FI4A 2UXCJ 1IKXB 5AQNA 4ELTA 4TLQA 1WEXA 4CLTA 2ROEA 4AQYK 4PWDB 4FJ9A 2AW0A 3U1LA 2EEYA 4C8OA 3TA1A 1DLOB 1JK9B 2ASMA 4ZVTB 3KUGA 1S1UB 3M8PA 1QQNA 3J81j 1C0GA 3GG0A 3WIUA 4I2PB 2BOPA 2K7JA 2F7VA 1X4FA 4QWCA 4BR4A 4RWTA 2ZH3A 1FFGB 4CLFA 2BABA 1S77D 1W7WA 1VOMA 3BH7B 3IN5A 3KFWX 4OX8A 3TPQA 3L0QA 1RYRA 2NRVA 2MYFA 1APSA 2MSTA 1WSEA 3TQ1A 2G8HA 2G0IA 3MMCB 3IBCB 4UUXA 5KFKA 1F9FA 3WNFA 5LL6Z 2ZD1A 2H1YA 2MTLA 3VQPA 3ZZUA 2XSFA 1IWGA 4U96A 1HBNA 2VG7B 3MXHP 1GOCA 4OHXA 4CHOA 3FZBA 4A8XA 3TWZA 4K25A 2FLOA 1JLGB 1VRUA 5DZ6A 1WTFA 4DV0J 3PR5B 1L3SA 3O5BA 1X4AA 3QGHA 4CD1A 2YJEA 4YDDB 3CCMS 2ALZA 1S1TA 4DUYK 2HGNA 3EPGA 2E5JA 3WXLA 2HEKA 2VG5A 4RBUA 5HRNA 6AT1B 5DLFA 3K58A 5M1KA 3AO1A 3NCPA 3O9TA 5IZHA 1FRHA 1YIJN 1ZAVA 1X5OA 4DBQA 1X5PA 2WVBA 4I7FA 3C6HA 1N54B 3OTCA 1J5EK 5E3PA 5HO4A 3BF4A 4ECRA 4FDFA 1RDCA 3ZC4A 2M9KA 1QTNB 3W9HA 2Y0BB 2GS8A 3PEHA 4HR2A 2VPWB 3O1BA 3PR4A 4JKFA 2HKEA 4LF9F 5A8RA 1PJ6A 3IFEA 4J9OA 3OVNA 2UVWA 5LT5A 2DRDA 2XO6A 1QVGM 1OY8A 4NLVA 2ZH8A 1MU2A 2IM2A 3OL6A 3LP0B 3PW5A 3ENHA 2P9PB 4FJLA 2QWPA 3THWB 4RW4A 1KTQA 3EGZA 2YX1A 1PJ5A 2DHXA 3O1WA 1NPKA 2G2YA 2QO3A 5AQKA 4NL5A 2YKQA 4EI2A 3RW6A 2G8UA 3LA0A 1BDGA 3CC2N 3CD0A 5CA5A 1S22A 4FVMA 4WU3A 2CA9A 4F04B 2EG2A 5KFFA 4CEEA 3A8IA 1X7VA 1O6XA 2IMWP 1XEZA 2OTJS 3H90A 3SYZA 4TNOA 1IBLK 3BS9A 3THXB 2ROGA 4H5WA 4QWBA 2XCPA 4FLWA 2EFGA 2OAUA 1YLXA 2UVRA 4IKFA 1S5ZA 3UN2A 1NK6A 3Q0AA 4PCQA 3C16B 1WC6A 4R0JA 1I94J 2HHHF 2QA4G 3PKMA 4I67A 3HHLB 2E1CA 4I2PA 4JYAJ 4LQ9A 1Y9OA 3G4SS 3QDKA 2B4JA 1HLUA 2RNEA 1KD1T 1S1XA 1IBMJ 2MY8A 3IRWP 1X31C 2ZH6A 2XULA 5KFSA 4FL9A 3OV7A 2HZCA 2LSNA 4AM7A 4KI4A 1AUSL 3SFGA 2HVZA 2CJKA 2AU0A 1FFSB 4QJVA 4DCHA 3CCVS 1LAVA 4DQ8A 1TFYA 5AQFA 3C65A 4DN9A 2YKAA 4G6VB 4K8ZA 2J0WA 3UDVA 1B7FA 1RT7A 2V0NA 1LFPA 3OYKA 5F8MA 2PO4A 2EKNA 3HT0A 4C11A 4LSNB 4GV3A 3CHWA 5CD4H 3VQTA 1RTZA 1H2VZ 3CJQA 5KFWA 3PW2A 1RWUA 3C6AA 4CERA 1VQ4S 4DV5K 4FZYA 4OYZA 1C1CB 2E7WA 3FR0A 1QAIA 2FUG9 3NGUA 5DDOC 4OJRA 1WLJA 5FDLA 3SUQA 4OI3A 3U02A 5CZ2A 3VQ6A 2DNMA 2IM3A 3Q89A 3FEXB 1N34J 1KR4A 1KRPA 1F2GA 1RLCL 3GE1A 2HBJA 3ADAC 4IRDA 2P6SA 1KHWA 5J2PB 1OSDA 2JLEA 5J2NB 2RQ4A 1JX4A 1NGHA 1HWJA 3SQGA 2XMUA 5HQ8A 1IWAA 3DHXA 1NK7A 2ACYA 3S3MA 4DFJA 2KDOA 3ISNC 3CXCM 4CJSA 1VSEA 5AQYA 3JTPA 4CW7B 4KFBB 1WC1A 2UYTA 1JLBB 1XNQF 4ES2A 4YY3J 4QS7A 4X4NA 4QAGA 3LUYA 3R27A 4Q0BB 3JS9A 4WPAA 3OBIA 4W5QA 2I6WA 3LANA 2ATCB 1X9SA 4K0KJ 3LP0A 5GINA 2P9PA 2WVCA 3THWA 4KRFA 1OWXA 3QIOA 3L4QA 2YH0A 2W9BA 4Y2IA 5AQGA 3D6TB 4HTLA 3KXDA 4CZJA 3AO5A 3SSQA 1YRTA 2H5IB 1I3OB 3M1VA 4JI4F 4F3QA 2ZH5A 1VBXA 1Q53A 1XR6A 2P9UA 2H3GX 1X3MA 1U2VB 3TO8A 2XEXA 4RW8B 5ADZA 2Z2MA 3CJ3A 1XMBA 5BYSA 3NGKA 2GC8A 1VSHA 4EHTA 4M7XA 1F60B 5TKWA 1NJIT 1W7AA 3KK2B 4J9RA 4DR4K 1H7WA 1WG5A 2AZ3A 3KJNB 1UOCA 4H0PA 4I56A 3PHEA 5I4MA 4DPUA 2N3OA 2H65B 1GOBA 2C2KB 1BIZA 4QBUA 4NYPA 2ITGA 5A2QU 2M5YA 3TX8A 5ETMA 1J54A 1S6PB 2UUCJ 2UUBJ 1PAEX 3H20A 3M32B 2E66A 4OYXA 3MM9A 2RQKA 5L9NA 2KYXA 3V81A 2HHHK 4KBIA 3L2WA 1T05A 1QHAA 4FN5A 5K8OA 3AD8C 1MWMA 2UVUA 4X4OA 2OPSA 3DGVA 4NXNF 1DBDA 1AB8A 1QVFM 2KHDA 1RAHB 4QCLA 4FM0A 1VQPS 1KVJA 5MAOA 4GC7A 3AA2A 1UVKA 2Q6CA 1VQMN 1F3FA 2Y1IA 1MMNA 4W5RA 2HBRB 1WNSA 4PG6A 3BGFA 2R2TA 1Q5YA 4URQU 2V9WA 3NDKA 5E5NA 1L3VA 3MAHA 3KNGA 3VF2A 4U8YA 3PJWA 3SUNA 5HP1B 4LUBA 1AFJA 4BQLA 5AZIB 2CPJA 3LM2A 4BC3A 2V8HA 4E2FB 4MLEA 2RIJA 4OX9F 3DKDA 1BI4A 2XMWA 3VEXA 3G8TA 1VC0A 5HL7Q 4LFAJ 3KK1A 1UW9A 2AJQA 1Q78A 3ID8A 4A62A 1Q95G 5M1FA 1UEKA 2UXCF 3OR1A 2M0GB 2UXDF 4KIAA 4HHHA 1IQZA 3LPUA 3SCXA 4P7VA 1RWKB 4LR9A 4ZVRB 2CZ4A 4NA2A 2P9IB 5DRKA 1JNRB 2ZNYA 3UCZP 1WSVA 2MQPA 5J2NA 3J7YU 3HT3A 1RDDA 4HTUA 4TVAB 3IMQJ 4Y2CA 3Q24A 5IOLA 1SL1A 1S48A 2G8VA 1HQUA 1R43A 3TSQA 1LWFB 3HI0A 2HQ3A 2FVSA 2IJRA 3O9SA 3OYIA 1RHQB 1GOAA 1XNRJ 4ISEA 2E44A 2DNOA 3UN5A 3ZNJ1 1M1GA 1YBTA 3SIPB 5IQ6A 4LREA 1ZYQA 4WXWA 3MM5B 4WTOB 2IYGA 5GMEA 4C0OC 1Y4ZB 1NGGA 4KFBA 2IIRA 1RU1A 2YWHA 3TA0A 1S4FA 3K7RA 3UI3A 3OL8A 1RWOB 2MKHA 1WB9A 1M5PC 1ZBTA 3DRRB 2F8SA 3GILA 1EARA 2H3EB 3T1HJ 3A8JA 2FJXA 2W2NP 1YHQN 2QK9A 4Y2KA 3NP5A 2KZZA 1HPZA 2QWOA 4TY9A 3BUZB 4DV0F 3HOSA 3N4QA 1RWPB 4AHVA 2OPRB 3NRBA 3HP9A 5C2DA 1VQOS 4KC5A 1U2VA 3O08A 4CHPA 3JQKA 3CDBA 4PA1A 2DY9A 2EG1A 3H8YA 5I42B 2KLAA 3HZ6A 2H5JB 1W2BR 2HQDA 1EAYC 3GL1A 1M90O 1HARA 3IMXA 3PYFA 4RNNA 1N36J 2ZFHA 1FTRA 3ZT1A 2R7XA 1RT4A 3HFVA 1YRXA 3SCLE 1R6VA 3T5KA 3M32A 1RAAB 3Q83A 2OIHA 2HHXA 4CVNE 3EICA 1M1KT 1JLQB 2WSEC 2DO4A 4C8KA 4DUTA 3LO3A 4DR2F 3IGNA 4A46A 3A0IX 3KHYA 3A5LC 2QA4N 1U1MA 5DG8A 4PG5A 3LP1B 2NS1B 5C25A 1XK8A 3MPYA 3DLBA 4BRPA 3OYBA 2B4VA 3BPDA 4B3RK 3LP2B 2D41A 3RBZA 3TU5A 3VEOA 1WACA 4FWSA 4QW8A 1S57A 2BR0A 3N01A 5HP1A 3O5TB 1S72N 3QEVA 1QDUB 1RBSA 3OT9A 4DSIA 1JXLA 1JL2A 1J9AA 4H4OA 3MCSA 4ISGA 3KLIB 2GAHC 3QESA 3KDOA 5HN0A 1IKYB 1JJ2R 2DTJA 3KKRA 1YUWA 1BC6A 3CJ7A 2LDIA 3QO9B 2ZM6J 4ISFA 3N6NA 3J80Y 1N56A 4FOIA 2DJWA 3EX7B 3VQEA 4PXBA 1RXOB 1C6VA 5D0GA 2BV3A 3W2VA 1G1XA 2VIHA 1ZM2A 2FHOB 1PYSB 3RVCA 2P9IA 2E7VA 2R7OA 2X1BA 2FHKA 3HOTA 5AQHA 4CJ4A 2JFDA 4JI6F 1IVZA 2WUSA 1K8AT 2FQQB 2CKWA 5ADXH 1KFDA 2VFTA 1IBMF 2CZVC 2FZGB 1N0VC 2W7OA 1FDNA 5K8NA 4UT4A 3C15A 1R8AA 5LSLA 3HYFA 5KFDA 4WXOA 1GMUA 1O1WA 2AEJA 5IM0A 4DI6A 1T03B 3HM8A 3JAMO 1BE4A 4F3MA 3H45C 4K4TA 1CBKA 3LM9A 3CCSN 4DR5F 1U0HA 2FVCA 5GAGU 2MKSA 2VDHA 4Q44A 3DLGA 2JH3A 4HUFA 3E01B 1WBDA 3CT9A 5F8IA 4V19X 5HLFA 3O4NA 1XMQK 4B9UA 1WC0A 2HG4A 3R1HA 4DV6J 2I1RA 2PN6A 2D3UA 4X4VA 4DF8A 1U09A 3PW4A 4BRLA 4YR0A 3BN4A 4AM6A 4PY5A 2GJ2A 1AUDA 4ZVUB 1N34F 4E1JA 3ZZZA 4OGCA 3CETA 4WF9L 3I6PA 1XJWB 2E5LF 3EEQA 1RBLA 4TU9A 1L3UA 5K5MA 2ZVSA 5I9EB 1S97A 2NQPA 1E6VB 4LF5J 2B3TB 1S1VA 3ENBA 1SL2A 4MDBA 2BANB 2BGGA 2PI4A 5BXIA 3GZ7A 1MROA 1OYEA 2O8DA 4EZ6A 2XZDB 3J7A1 1N6QA 4B17A 5EWEA 3HFZB 1OH8A 1VHFA 1B92A 3KIOA 3GDQA 3CC4N 1TKTA 5IT9Y 5GAGP 5J2MA 4A8OA 5G4DA 1YXQA 3I33A 4X4SA 3FMBA 3FMWA 4K5RA 3GTYX 1TKXA 3MPUB 4F7VA 4CLKA 5C42B 2K8GA 1VQ8N 4RPFA 3QICA 3QJLA 4ENOA 2YKNB 5FPNA 3BBBA 1RCXB 2J9DE 3MXMA 2HGMA 2JEJA 2XLIA 1GX5A 4WZMA 5KFBA 5IWAJ 1SJ4P 4BGBA 4O3RA 4CJPA 4C48A 3M6WA 1SBRA 3VQQA 3C94A 2C1EB 1MG7A 2M8HA 4AL7A 2KG1A 3OTOJ 3L4BC 4J9PA 4X84A 3FEZA 3PSIA 3AVAA 3G71N 1H7XA 3I56S 3UD5A 5KFNA 3P8BB 2A18A 1RHUB 4ZOSA 5AJ3J 1GLEG 2EWHA 5J1PA 3VZHA 4K50A 2RF2A 2UUCF 5E33A 5C12A 2DT9A 3H42A 4XPCA 1I94K 2W9CA 1R8CA 4ES3A 3O9RA 2KL8A 2V4JB 1NPRA 2FYXA 3CCUS 4WFBL 2OZMA 1RDBA 1D8ZA 3H98A 2ZGYA 3CD5A 3EZ5A 3NNCA 2BJ7A 3T1YK 2DH7A 3ZSQA 4JYAK 4L3QA 1HD0A 2AIRB 3WC0A 3CPWM 3GCWP 1YGYA 1IBMK 1KVBA 3IG1B 1V3RA 3NFAA 3H2VE 1SJRA 1YJUA 3A5OC 2JWNA 4C8MA 1RBVA 4HTJA 3OYMA 2HQFA 3AAQA 3GMGA 1CEZA 2D0PA 2BM0A 4MFBB 3OYNA 4KHWA 4JI8J 2Q1LA 4O3PA 2Q79A 4PKDB 1R89A 3BZQA 2B8QA 2L9DA 2BYCA 2QWMA 2Q2RA 2BE2B 1YJNN 2E1PA 4DCOB 3Q7CA 1GFWB 1WHVA 3L8BA 3W64A 4DG1A 2MKYA 2AT1B 1N5VA 2VU5A 2OMLA 4USHA 3D6MB 1MWKA 4KO0B 3JXUA 4RW6B 2RHQB 4KTWA 1ASUA 1SC6A 1A0OB 4M5DA 3K5OA 3N79A 1EETA 4NE9C 2EK1A 4NYFA 3DC2A 2FJVA 3AXKA 1CZ9A 3AGRA 2QEXN 2FBVA 3VHQA 1X1PA 4EYHB 1ICEB 1B64A 4H03B 1T9YA 3RBXA 2QWQA 1LV5A 4JKBA 2C3YA 4CJKA 3R6MA 1NJWA 1HQ2A 5ELZA 1FNXH 3JSBA 3IXQA 3W5XA 4YY3K 1R7IA 4LF6F 4FWKA 2HMIB 4HDGA 3AVFA 2EFVA 4UUWA 1ZAXA 4CQ1A 3DI6B 3DDIA 4KH0B 4M3UA 3HL8A 5JVGL 3EM1A 2EFPA 3MDQA 1FRKA 4K0KK 4OPJA 3OYGA 3O3GA 1ZXOA 3VAMA 5C42A 2QC3A 2OO4A 4WYLA 3K57A 1C1BB 3L09A 1QQMA 1UETA 2GZOA 4HEA9 4KJIA 4J9QA 1DQ8A 5B0DA 5KG0A 1GT8A 4P73A 2DB1A 2RILA 4CO2A 3BEGB 1VQ6N 1WNEA 4E7JA 1W26A 3V9ZA 2VUGA 3G96A 1V3ZA 1WORA 3WQPA 4M5LA 3F44A 4IOCQ 4ED8A 1ZZFA 2HLTA 5B0CA 2DY1A 4I1TA 3O4WA 2QA2A 1YK9A 1X4BA 2NUUG 5CHCB 1WSRA 3IWXA 1Q81T 2NXNA 1RCOB 1RTHB 1NMNA 3NHGA 2UUBK 3ULHA 4WFAL 4IO8A 2V4JA 4ILMA 2IMOA 4IOBA 3TWHA 3VQAA 1TZ0A 2V68A 3CWJA 3CM6A 4AXIA 1K73O 3MHYA 3L3UA 5AQLA 2ZH1A 4YOTA 4LFCJ 4KQZA 2XNRA 5EUHA 4RUAA 3NF9A 1GMWA 4DMNA 1JLAB 1TUWA 2CDQA 4DUZJ 2AYGA 3UR0A 1F2HA 1Q5VA 2GMHA 5ETRA 3SK3A 1N52B 1Q8BA 2RUSA 2ERRA 1RABB 3CD6N 2KHOA 4R5PB 1QAYA 3ALYA 2C2DA 3PO4A 2ZZTA 4MFBA 1C0TB 2J9CA 3G6XA 3J7AP 3SLCA 1GMWD 3W9JA 1IKVA 2YNFA 3SAHA 4LFAK 1FKOA 3QJPA 1YITS 4USUA 2R2SA 5D4OA 3G25A 1VBKA 5A6PA 5E3CA 5LMUJ 2YX6A 2DPJA 2MB0B 3A3PB 1GXUA 2F96A 2F3JA 1RT3B 5DO2A 3E8OA 3MM7A 4DTJA 3MEGB 3GFHA 2CPEA 2DNRA 3C6UA 3RAXA 1YG0A 2P8IA 3DXBA 1J5OA 3I55N 3E9PA 1IKWB 4FXVA 2ZE2A 2O4GA 2J5AA 4RW9B 4CD3A 1FRLA 2WONA 3IUCA 1RTDB 1FJCA 3UKUA 1NKEA 3EVMA 4XIUA 3KK7A 1KOOA 1XNRK 3S9HA 2B6AA 1TTHB 3US5A 3MK6A 4FSVA 3SQ4A 1N32K 1URRA 2HMIA 3ISZA 1QLNA 4E7IA 5HROA 5M1NA 2HW3A 2RUGA 2XS2A 3DI6A 1S59A 1H2UX 3TZXA 2DR7A 1NU4A 3UW1A 3T1HK 1C1BA 1QQOA 4IG0A 1FHTA 4RNMA 3U9DA 4LF4J 1D9DA 3KJQB 4L75A 2R7SA 5E26A 3HMJG 4O8KA 2F1FA 3IC1A 1P9QC 3O2IA 4NZ7A 2MGZA 3HP6A 3SQ1A 2CH5A 3TA2A 3DLHA 3FBEA 1ZTTA 2KXNB 3V1QA 4ZPBA 3DYAA 2B0GA 2XNQA 2XY7A 2M7SA 3GV8B 4I9LA 5K14B 8ATCB 3D6RA 1JLEB 1GLDG 3LH2S 3T5LA 2SXLA 1NB2A 1QHTA 2J7KA 4YORA 1N36K 1O13A 1NGJA 3B4DA 4A2AA 5F8LA 1RTHA 1RBUA 1KEKA 2GQCA 3PXGa 5DDPC 3HCXA 1O0PA 2HVIA 5DM6L 4AILC 2CJQA 1DHMA 1IUJA 2Z1HA 2FY8A 2VC1A 1D4XA 1R0AB 2H9ZA 3NF7A 1DAXA 3VQ4A 3SSSA 3ASMA 5BREA 1S9EB 4B3TF 2O66A 2UP1A 2DEIA 1JLAA 1ZPWX 3VN5A 4P2SA 4QYRA 5D77A 3MR6A 3CCQS 2YNGA 4ZVSB 3ENAA 1TYQA 3TAQA 2QSWA 4KT0C 4GKKJ 4FLVA 4EAHD 1SC3B 1N5YB 4LVNP 3CCJS 2PZSA 3CDUA 1VC5A 2DNQA 4WYBA 4AD6A 3CO0P 2NR0A 2L48A 4E7LA 4LSLB 4IG3A 2I8EA 5LY3A 3CJCA 1TL4A 4JKCA 3FRZA 3AQPA 2D0CA 2D1KA 3MZIA 4TKTA 4O4GA 4FJXA 2RJZA 3ZEUA 4BACA 5IWAF 2Y9HA 4H0YB 3VAFA 3P96A 4QPXA 4JRPA 3THVA 4A2BA 2VD3A 4LY7A 4DF4A 2LQBA 1BQMA 4YDUC 1O8BA 2JNJA 2ZM6K 3JAMY 4V19S 3DRYA 4ZCMA 2PMZD 4A8YA 3OYAA 2LP4A 2NZCA 1CS4A 1HPMA 3WNEA 3FNNA 1XMOJ 3EWGA 4FF3A 5L39A 3FK4A 5AXLA 5AJ3F 3PLAA 5FPDA 4KI6A 3DM2A 1KAXA 1WAJA 5BR8F 3SFUA 3AA5X 1M5OC 3PYGA 3FCWA 3VQ9A 1FJEB 5FJ4A 4YEAA 4M3TA 5T14A 5HVGA 3D45A 3D54A 2KO1A 1T44A 4NXMJ 2HVEA 4CJLA 3OA9A 4UOCA 1RAGB 3PHTA 1X4HA 1TKZA 2F63A 3QGPA 2YWWA 1S0MA 1LXNA 3Q22A 4DS4A 4CJTA 3AVKA 4BRMA 4O0JA 2D0AA 4OZ1A 3GWCA 2GNKA 3S01A 3CO9A 1GX6A 3MR5A 2B4UA 4ZCIA 3O4QA 3U7JA 1B3TA 2DR8A 1SVDA 2AYMA 2OEKA 2GA7A 3SJJA 4KAIA 5AZJA 4PG8A 3QIDA 1S76D 1QY7A 5KT5A 3QBXA 3H2LA 2R2UA 5BPLA 2RKIA 3WXKA 4QYZJ 4DV6K 4ANDA 3P49B 4C0BA 2VB6A 4A8FA 2C28A 2CQ2A 3IKMA 3BGLA 4X65J 2A2CA 1WG4A 2JHEA 4BC5A 2QL9B 2DHSA 3DOLA 1V5IB 1VK0A 3O3HA 1SB6A 1QM9A 5KFHA 1FNOA 3BQ1A 3V6DA 4DB3A 1BQNA 4ZPDA 5FIIA 4IQXA 3RMDA 4JI7J 4DV7J 2ILYA 4BR5A 3MCMA 4DCJB 3SXLA 2XHCA 1FO1A 1VBYA 2A10A 3FCHA 3U8XA 4LF5K 1XHZA 1IBKK 2QE5A 2GIFA 3ZSXA 3S1TA 4DN0A 4NLCA 4ILLA 4LD0A 5DQGA 3IO1A 1MWZA 4DX7A 4Q2LA 2AYBA 1KLNA 2BRKA 5GVQA 2XGQA 4FWLA 2RDIA 1YJ9N 1WSJA 1KSPA 3JYTA 1FDBA 4UOFA 3QSYB 2R7RA 2YH1A 4ZK7M 4HUEA 3P3DA 1NDCA 3M8QB 2KFZA 3IM8A 3VPZA 4F3TA 4EWTA 3AOBA 1PCAA 3EGVA 4FW1A 1BWVA 3MOZA 1I3AA 2ZBCA 4KHPJ 4KHQA 2FGCA 2NRRA 2XO7A 4N8OA 1Q4RA 1RWXB 3MCPA 5IWAK 2LU2A 5HJYA 1F1BB 3D9BA 2IVNA 1LOUA 4X62J 3KHHA 3F9KA 3VTHA 4I6AA 2IOCA 4ZVPB 1OSCA 3OTOK 3M2VB 4J2EA 5LXRA 1Q8KA 3OBWA 3EN9A 5H1SV 3OTEA 3M6XA 1T11A 2C2RA 5KFAA 4PHTX 3R6LB 3M30B 1J27A 2HBKA 3QSIA 4ID5A 2Z4PA 3AXMA 2YXLA 3VAIA 3ZXWA 2NZ4A 3ENWA 1WC4A 3DJCA 5CQGA 2RS2A 5DETA 3DRSA 1W2IA 3W1YC 4LFCF 2VOPA 3EJMA 1YVFA 3GJRB 5LMNF 4LBHA 3I31A 3Q8PB 4DUZF 3L3CA 3J7Z5 2NZTA 4Q45A 4H0TB 2IVFB 4A8SA 4NCBA 4NB4A 3DLLL 2EC2A 1HNWF 1HBMA 2GEMA 5KFJA 4HT5A 3BR8A 2Z1IA 2DR6A 5HAOA 3TAMB 2O8EA 4V19J 4JI8K 2CNOB 3VGKA 1RT5B 3F9MA 4DV3F 1X0FA 4CEAA 2C2OB 4DU8A 3KLEA 4UTGA 5CR4A 4H5RA 5J2QB 4BCAA 2DGVA 3QATA 1WHXA 3AO2A 2BJ1A 2E6MA 1PIEA 1OS5A 2FSJA 2H4YB 4DSLA 4K8RA 3FGVA 4E1MA 5LMUF 5L9XA 3SBGA 2QL5B 3BDPA 4WFNQ 4PPDA 3H6EA 3LWLA 2QSFA 1NB7A 4CFDA 3DGPA 3LDPA 1GLFO 1WDTA 4FJGA 3TAFA 1XN9A 2G4BA 1FCAA 4LR7A 3L4IA 3L6QA 5B0AA 1G15A 3TANA 3AAWB 3GIIA 4FNHA 3QFPA 2F8MA 2MHNA 1RB0A 3W2WA 3T6BA 3OFHA 3W8PA 1K8KB 3BEXA 4BQZA 4ECUA 4CBWA 2GQ2A 3R5DA 2ZHOA 5KFGA 4O4RA 2IRYA 3HI9A 2GHWA 3CJ1A 4JK7A 4KGVB 1D1UA 1WEYA 4K2XA 3CC7N 4F4ZA 3CD7A 2ZITA 3FFKB 4NLDA 3M8QA 1JLFB 1LW2B 2CGJA 3M2RB 1S49A 3IS9B 4DV2J 1WUAA 1HMVB 3QJJA 4YB5A 1NBWA 3BO2A 3U3GA 3A13A 3HVTA 4JI5J 4IJNA 1YJWN 4C0HA 4Y1CA 4DWIA 2C2ZB 2N7YA 5CZ1A 1ELOA 3MECA 1K0VA 4M3XA 4MDAA 4OYIA 3IWLA 3EYZA 1TV6A 1HKCA 2Z1GA 2B5JA 3M9OB 3BH6B 3CCVN 3DOKB 2HF3A 1Z2LA 2PDAA 5GAEU 2MZTA 1N0UA 1XBWA 2JLFA 4M94A 3E3XA 3FBCA 5CY4A 4Z4HA 4KB7A 4EYIB 2VG6B 4WCEL 1QD1A 4IH7A 2FZKB 2OGUA 3R6GB 4F0HA 4A4JA 1YKWA 4G9ZA 4XDDA 1K1QA 1VSLA 1PYTA 1TR0A 2HHWA 1QZ5A 1NJXA 1NSPA 4DUZK 1RT6B 3UIQA 1RT1A 2OLWA 4CM2A 1RSCA 4FCYA 4NLUA 1F0XA 1TUUA 2Q0UA 4DHYA 4LRCA 3WQTA 3GP9A 3ZTQA 1S0VA 4CF1A 1H72C 3TAMA 4NASA 4DR6J 3RU0A 2VQEJ 5LJ3Y 3NVKA 1RT5A 3Q8RB 4OJ1A 2RRAA 4ECXA 2EBGA 3FC9A 3H3OB 1LK7A 3M5RA 1U6ZA 1X5SA 3AD9C 1CG2A 1FEEA 5J2QA 3IGVA 4DR1F 3NNAA 2DIUA 3EKSA 4BRHA 1A7GE 4EHUA 3KWIA 1KC8T 4F2RA 1HR0J 2AP1A 4FZVA 3DWLA 5C2CA 4I9QA 1JCFA 5LMUK 1HI8A 4FLXA 2M8DB 5EU7A 2XI2A 2YNHB 1N48A 5GAEP 1T02A 1SCJB 4X2BA 3U1MA 3THYB 4IFVA 2AJ0A 5T7LB 2RU3A 4M5HA 1BQXA 5JUMA 3MMAA 4OZ5A 3T19A 4BWMA 4BE0A 3D7SB 5AQZA 1CJTB 1M5HA 5CHIA 1TKDA 2ZJPQ 4CZKA 4PRFA 4B1UB 1EIYB 3L7OA 4CO0A 2Q3SA 3R5JB 2V7YA 4DSFA 5D3GA 2HNZA 2QMUB 3A8YA 2CPFA 1WBBA 3AH6A 4K4VA 4LIRA 4C1NK 2UUAK 4M5IA 3BR9A 2OZSA 2HGLA 2PEBA 4X64F 4OO1J 1W97L 4RWWA 2J7UA 3AODA 3DOMB 1A5VA 5A0YA 2A3ZA 2LFVA 4K7QA 4LF4K 2D74B 3CMAS 3AVMA 5L1JA 5E84A 3CF5Q 2JWKA 5LL6d 4Z4GA 2GIRA 1Y0HA 2JJ4D 4PR6A 4MO4A 2MKKA 3ID6A 4CLPA 5HBMB 2F9WA 4HHUA 2KB2A 1NG9A 2QRRA 4DSKA 1FK9A 3WEEA 2P9LA 3IFRA 4RBVA 2XM3A 3GIMA 1PBAA 5EY4A 4O0IA 4NYOA 2AA4A 2KZMA 1WKLA 2BW7A 1NDPA 4CT8A 3DOKA 3OYEA 2Z2ZA 2FTRA 4Z4IA 2E88A 4FK2A 4OL8A 2BACA 1VRTB 1ZM4A 3DU6A 3C14B 3V6KA 3NWRA 3JXOA 2D3OR 1LWCB 4TN2A 4QW9A 1VRQC 1QVGR 4JV5J 1V9OA 1J5EJ 1VQNS 2PD1A 1YJTA 3R9PA 4MAKA 2BH1A 1FDDA 5J1EA 2OUGA 4Y00A 4FP9A 2HHSA 3D0HE 4GKKK 1S1WA 2Q97A 3SPZA 3AJ2A 1WSIA 5F2RA 2DHHA 4PKIA 3TSUA 3LL3A 2XWXA 4WE1B 2XTJP 4OZLA 1TL7A 4P2XA 2RE1A 2GIQA 4H8KA 4KHNA 4CZHA 4P2FA 3CCLS 2NLXA 4LRBA 2CNLB 2W2QP 4MIAA 3B4MA 4DV4J 2PFUA 2O8FB 3AOAA 4NZ0A 2FVRA 3CFOA 3GFYA 3ZSOA 3MAAB 4CEFA 1CJKA 1R0CB 3IR6B 4WBFA 3HD1A 2KKZA 2ASJA 3R5AA 3SUPA 1RGVA 4JV0A 4ZS6A 2VH7A 3RAMA 1XMOK 3OVSA 4FK4A 4F4YA 3B78A 3TR5A 4O55A 1AZSA 8AT1B 2RAQA 1U2RA 2PBDA 1TMMA 1H74A 5CYQB 2GHPA 2BOAA 4LRAA 3POTB 1BWEA 2J76E 1IJFB 1CJTA 4CK2A 4NXMK 4EU0A 4URGA 4BG8A 5B0FA 2WHOA 1W9HA 4GKJF 2DCLA 2IAJB 2ASDA 2RE2A 1KTVA 2MZJA 2BKPA 3W3DA 3OYLA 3NE6A 4HT7A 1Q8LA 2GAGC 5J1NA 1HNXJ 3DDKA 3PRBA 4JI3F 3UD3P 3H46O 4HI2A 1YVNA 3OHBA 4GO5X 2JDJA 1WKJA 2N7CA 4ID1A 3CCRN 1U25A 1TP7A 3V4IA 3TEGA 2VA3A 4CLSA 3KLFB 3JSRA 3CCEN 5KFMA 5D78A 2E5IA 3N4PA 1KVCA 4H0OA 3G82B 4QYZK 3LDNA 2DEJA 4G1QA 3ETMA 1B4SA 4X65K 2FXUA 1KHVA 1WHWA 5HBMA 2Y8YA 4CT9A 2POKA 8RUCA 3ATVA 4USIA 4DFMA 4DV5J 1CLQA 1YIJS 3G6VA 3NOCA 1C1AA 1T3NA 2Z30B 4IKAA 4WFYA 4W92B 4JI7K 5F8HA 4DV7K 1VLOA 3DRPA 2VQFJ 3CXCR 4CZCA 3QIPA 2CQHA 5G0RB 2QV6A 3EL2A 3ZCMA 2HURA 1CJVB 4CNYA 4IJAA 4RUHA 4TU8A 1B70B 1VYAA 4CGGA 3C14A 3QWPA 4IH6A 1NSKL 3PFEA 3MPWA 3JTNA 2HQCA 1TQLA 1X4CA 2G8FA 2A2DA 5AQJA 3MM6B 3OUYB 2CFXA 3NF6A 5DQHA 2M4MA 3FUYA 3OS2A 1SAZA 3NGTA 1WF1A 1KKHA 2P9CA 1A5WA 1X3NA 3CC2S 3BJYA 4DR7J 4DV2F 4WE1A 3MWBA 2AYEA 2MLYA 4CFAA 3BO4A 4OGEA 4JKEA 1QJHA 4KHPK 2IDLA 3UR3C 2B7BB 2UV8G 3G2XA 5KT6A 4ZCLA 4X62K 1H38A 4YB7A 2CQ0A 3R1XA 4YHHF 4J2AA 1VIOA 1GMVA 2F8EX 3IWNC 1N5SA 1UAWA 5HI7A 1TL1A 4ERDA 2G8IA 4O44B 5CYMA 1SJ3P 3MCAB 1FNMA 4CE9A 1VQLN 4ZHRA 4CZMA 4EP4A 4DL0C 3CJTA 2R8KA 1QVFR 3R2CJ 3VV2B 3M8YA 1XR5A 3I9V9 4OFZA 1HNIA 1R27B 4KYZA 1EQMA 1T9WA 3MGJA 3H08A 4JI2K 4ZMMA 2FC9A 5HRPA 2XQCA 3DLEB 4WP8A 1FE4A 3TUJC 4FS2A 5I3PA 4YFUA 4CTAB 3NH2A 1TK8A 1VQSA 4H4KA 2D0OA 2MJUA 2GVDB 3RSEB 5KFEA 3IM9A 2KXFA 3MMVA 4FYYB 1XQSC 1HWKA 1YSJA 1RZMA 2HS3A 3G0ZA 2YTCA 2NSCA 2O8CB 1BUPA 3KOAA 1TUYA 4DR6F 1YWXA 2VQEF 1M0SA 2D7SA 1LW0A 4GVBA 4FKXA 4NCGB 1Y97A 3G10A 5KG4A 3OLAA 1DTQB 4HKQA 2MMYA 2YNIA 4NYZA 3G82A 1JNZB 1JWWA 3VGLA 1NM2A 4LF8J 1EHWA 4OYPA 1RWNB 3EDRB 4B8AB 1VQYA 3OYDA 3CERA 4OLPA 1JIHA 1DEJA 3D1QA 2VCPA 1GQEA 1GLLO 1VMBA 2PA8D 5HSPA 2CQ1A 4PL7A 4FJIA 3P31A 1Y5NB 2RQCA 4CEOA 4FM1A 4M3WA 1WD6A 4MKBA 3M9MB 1FVQA 3OFFA 1HBOA 5I3UA 4BRGA 2KT5A 1UJ6A 2LMIA 4CIFA 1UFWA 1KQSM 2RDJA 3PIOL 4ED5A 3FSYA 2YPYA 2HFVA 2Z2LA 3WT0A 3MFHA 2HIQA 1E4FT 3N0VA 2GQQA 4DTUA 3TUPA 3G87A 5KG7A 1T94A 5LOQA 4CZEA 5KFYA 2AKWB 4B9LA 1JMTA 2AP6A 3HHNB 4I69A 4FM2A 3BO3A 4Y2AA 5DJBA 4DV2K 2QI2A 4IO9L 3AVJA 4ED7A 2Y1RI 2MPUA 2ZD1B 1FXDA 1YTYA 1AW0A 4N5SA 2WSFC 4YQWA 1G4CA 2XHBA 3ZLJA 1HBNB 4BVPA 3SQ2A 4JI5K 4PL8A 2W4CA 2PFFB 2KM8C 1FX4A 2BQRA 1SQEA 3NS7B 3B6PA 1VRUB 2VZ9A 2B56A 1Y10A 3CPEA 1BG3A 5EOYA 2CGKA 1S1TB 3NH0A 2GUIA 4DUYF 3VWSA 3TP2A 4ED4A 2C3UA 1MN9A 1DT9A 4J5OA 5GADU 2H48B 1JB0C 4CIGA 2KYZA 4FXDA 4NLOA 2B4PA 3HZEA 3M6VA 4B3MJ 3BGRA 1VSFA 4JI1J 3VETA 2FJWA 2Q36A 1NGDA 1OMSA 4K4YA 1SC4B 4I7FB 1J5EF 2V9KA 2HNDB 1EB0A 1RGIA 2BEFA 2EFQA 3IAM9 5HMYA 4YB6A 1FD2A 3LW5C 4UW2A 3CYMA 2GWJA 2Q66A 1U2CA 4WIQA 1X9MA 4HWIA 4TU7A 2D3ZA 2ADCA 2D1CA 1I5OB 2NPIA 4N77A 4UQTA 3DLJA 3WX4A 1WOSA 1BUXA 5ETQA 4PEOA 1FESA 4X4PA 2WB4A 5AQOA 2KKHA 5TKYA 1MU2B 4FYVB 2E2NA 4FO0A 1H73A 4X4UA 1P8GA 1P6TA 2I5JB 1DTQA 4RW4B 4FF2A 4Q43A 4AH9A 3CFRA 3CB4A 4ZLNA 1U1LA 3BKFA 1UVIA 2XMKA 1NGEA 3I9ZA 2D3O1 5IXUA 3HPGA 4FYDA 3O3FA 2DNHA 4KRWA 1HR0K 4IOCL 1N33J 2V4QA 4M63A 3KWMA 4DHVA 7FD1A 5C0YA 4NLBA 3AGKA 1T3VA 4K41A 1ZBIA 1IBLF 4KAZA 3QNWB 1KN6A 2FLNA 4AHTA 4TXSA 5F3ZA 2JEFA 2NRTA 2D9OA 5HATA 1D5AA 3F5TA 1TL3B 3PO5A 5B0BA 2DTUA 3HHKA 3QBWA 4F67A 4FJNA 2LLZA 3VEZA 3BGUA 4HH0A 3N6MA 2PMWA 1KAYA 2A6MA 4FF1A 2VPYB 5AXMA 4LBIA 1S3XA 5F9NA 3BF1A 1NNEA 3QRQA 4BRFA 3UCUP 1Q86T 5FRMA 2F9DA 4OI1A 4WK1A 4AHSA 4K4WA 2FD2A 3UCGA 2GV1A 3Q2SC 2Y8WA 1HNXF 2FF6A 1S1XB 2ATLA 2A1RA 3LZJA 1YHQS 4DL6A 4IZ9A 3FRYA 3I96A 4I6YA 1H2TZ 4A48A 2HS4A 3CFPA 4ICLA 4BR9A 1ZETA 1UZHA 1E6YA 3BQ2A 5JS1A 4B9VA 3KLHA 4PWWA 2W7PA 5AQIA 4B9NA 3RB3A 2GMJA 1RT7B 1RISA 3AVIA 3NGYA 4CH1A 5DMRA 2NREA 3UE2A 1NWKA 4FLTA 4C11B 1Y5IB 1NPPA 1XMQJ 1V5VA 2W41A 1SS6A 3RB4A 3VQCA 4YB1P 4FZXC 2ZWHA 1C0FA 2FC8A 4FWMA 4L76A 4U9RA 4DV5F 2J4RA 3MWPA 1KDNA 1NKCA 1RP5A 2RB7A 1Q79A 3FFIA 3I8DA 4WTYA 2X74A 5FDLB 1HBUA 3CG7A 3FKBA 3UDLA 2J0SD 4RU9A 2VQFF 2OSRA 2ZBRA 3MEDB 4JP8A 1PC5A 3MOJB 4QZVB 4H5NA 4CJEA 2QA4S 2JC0A 4FNIA 2ADBA 4L72B 3SQGB 3V6HA 2CRLA 3NAIA 2HNDA 4JV5K 3MN6A 4B9TA 4I0WA 5DK5A 2HLUA 4JI0K 2IBOA 2XB2D 3RRKA 1OPIA 1SJFA 2Z57B 2ZGZA 1S72S 4DDFA 1OQ6A 4MKAA 4FWQA 1LNQA 2VKRA 1RKIA 3IA0A 4CRJA 5IT0A 3OHRA 2YQ0A 3H40A 1EX8A 1JXBA 4RG8A 5JMNA 2FBTA 3CQYA 5GIPA 4HACA 2I5JA 2YWFA 4DV4K 2NRZA 3J7AN 4N41A 1DJ0A 2W9BB 1X5TA 2F8TA 3BQ0A 5KFIA 5HMWA 2AJFE 2JEIA 3W0LA 2XZWA 3M1VB 2KHCA 2VPZB 4R25A 2QG9B 4AF1A 2RH3A 2P9UB 1UA0A 4DPOA 4LJMA 3B82A 4LFBJ 4A59A 2ZKTA 3NKYA 1R0BG 2L41A 2FDNA 2CPHA 2ZUGA 3MUTP 4DR3J 4LT6A 3C2PA 1RBTA 4KB1A 4DR4F 1HKBA 2F8HA 4HL9A 1SZ2A 4O0NA 1FJGJ 3Q8UA 2XI3A 3CPWR 3G8SA 3J81U 2E6LA 1GNKA 1TL3A 2PMHA 5A6WA 1UTAA 5FLXU 4CO5A 1KQGB 2HRUA 5KGXA 1BIUA 1ZA2B 2UU9J 3MM9B 3V81B 2P5OA 4I68A 1T05B 3MURP 2KG0A 2JL9A 4PAAA 2R42A 2OPSB 3GJSB 5CAAA 3T1YJ 3CCSS 1D9FA 1CXQA 2B43A 2W24A 1YT3A 3QAUA 2E4LA 4C7QA 1IG9A 1HNXK 3NAEA 2OI2A 3NGRA 2OH2A 4CHYA 1U48A 1RHMB 2ZKUA 1ULRA 1FXRA 4EK2A 3JSYA 3KK3A 1S6QB 2AWZA 4A5BA 4BWJA 1DZ5A 4J9LA 1NMEB 3UNGC 1OH6A 2MHEA 1RBRA 5FLXO 3VVTA 4ETXA 1EP4A 1N5QA 4LF8F 4JD2A 2CUYA 5SUHA 3H2UB 1S7HA 1MA9B 3RBEA 1BCOA 1BI4B 1K6YA 5KT3A 4ALZA 3I0RA 3H59A 3KK1B 2EFNA 1FWKA 3R8YA 1WJ9A 5EX0A 2LECA 4RW7A 3JSMA 4Y34A 2PYLA 1D0EA 2HWHA 4R8UA 5JXSA 3OR1B 2LQJA 1NH7A 2Q1NA 1R8PA 4Q5VA 3JQJA 2QLXA 2I2YA 2NYHA 5F41A 4ZDNA 1GLAG 1ZAWA 3BSAA 3ETOA 2VQFK 3MEDA 3WXMB 1GLCG 3W62A 2E7XA 4XAKA 1MWQA 2NXCA 4DU4A 1PSDA 4EP5A 4ELVA 2KJVA 4C8YA 3CC4S 2NXJA 3AQOA 2ZNZA 1XUPO 1HQUB 3Q8VA 5DGAA 2F5GA 4ZP6A 4J9NA 4HCBA 4OI6A 1T8EA 2MKIA 3GOIA 2RDDA 1X4DA 5AQPA 1FRXA 2PSZA 1SIWB 3PYEA 3OW2M 4WU2A 1VQ5S 1RCHA 1XERA 1QSSA 2OELA 2C3OA 1VQ8S 4B1YB 5IC6B 2YVSA 1LAWA 3CM5A 4L3NA 2FSKA 2WVFA 4KH4A 1TFWA 3N28A 4DR7K 4IO1A 3PX6A 4CGJA 4KHYA 2Y3YA 4DPWA 4KH6A 2P9EA 5MLCV 3J7YI 4I2QA 3IDHA 4XEIA 1HWLA 3A1YG 2V2QA 4RCHA 1DURA 1FDAA 4ZKAA 3NGDA 4P6QA 3G71S 5C2FA 1RDAA 2HFSA 1HPZB 3K59A 1YI2N 1REVA 2IBKA 1V3SA 3K5MA 1HJOA 1PO6A 2CJBA 2JVRA 3HTVA 5KFRA 2CVEA 4ZPCA 2KM8B 2IVYA 2QM1A 1HNVB 1Y7PA 5HMXA 2C22A 2P9SB 5DG7A 4B3MF 5F3TA 2MKJA 4DL7A 3TR8A 3LQVA 2QLWA 3A8KA 5M2UA 3AFGA 3PEJA 3TJ8A 1RT4B 2VHGA 5A8KA 5DM7L 3QB0A 4IR9A 3NVMA 2J6TA 5C5JA 4BG9A 3OTBA 3BSOA 5IC4B 1YX2A 4B3OA 2BE7D 2V8VA 1UJ4A 2ZJRL 4K5SA 3CMEN 1AT1B 1K0TA 3ET6A 5C25B 1QSYA 4B3RF 4FLYA 1OVQA 3IR7B 3N9UC 2XYPB 1YJNS 1UPPA 2NPFA 2FHJA 4WFBQ 1S6QA 4ITSA 3CJ0A 4QS9A 4BE1A 2ILZA 4ILJA 4XDCA 1Q9YA 3MX2A 1B7YB 1JLCB 4GVEA 5LSOA 1DGKN 2YWGA 2V7ZA 5A2QO 3ZETA 4H4OB 4M1KA 1KQKA 3MEKA 2GX8A 4HHJA 2W25A 4J9UE 1ITPA 1JL1A 1Y64A 3FZHA 3SCKE 4LF8K 3IBWA 1N33F 1DRZA 1JXVA 2MZRA 3OXGA 4FJ5A 3DXSX 1UWBA 1LCUA 2DGUA 3R9LA 4B9MA 3W63A 3D2EA 1P1LA 2XMAA 3OJUA 4AL6A 2ZJQL 1JKHB 2YHYA 2DKOB 3W66A 3N6LA 2FHJD 2WK4A 1X9WA 4J7CA 1K9MO 3QZ8A 3W2VB 3P1GA 3VEYA 2DNNA 2CIMA 5DG9A 2HOEA 2XWYA 5KGWA 4GRSA 4DS5A 3VQ5A 4DTRA 4ANEA 1AA1B 4BBYA 3QZ7A 1UVLA 3PG9A 4GVLA 1HHTP