3DM2A

Crystal structure of hiv-1 k103n mutant reverse transcriptase in complex with gw564511.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
539
structure length
531
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
molecule keywords Reverse transcriptase/ribonuclease H
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 146
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dm2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dm2A05
4DLGA 1S10A 4DFKA 4DSJA 2ATLA 1GOAA 1TKXA 1A5XA 4N5SA 4KI4A 3EYZA 4QW9A 4NCAA 4LH4A 2B43A 1I39A 3IGNA 3L8BA 5DLFA 4IQXA 1NJWA 4J9QA 4N56A 2BDPA 4O3OA 3RBDA 3VQPA 1D1UA 2IS3A 5KFKA 3NE6A 1S1WB 1WSEA 3QIDA 5I42A 1HRHA 1RTJB 1X9WA 3CO9A 3M9MB 3EPGA 2R8JA 4PQUB 3LP0B 3QGIA 1RDDA 3DLKA 4G3IA 4I7FA 3AO3A 3M9OB 5KFJA 3H5XA 4CJUA 4WXOA 4EYHB 4Z4CA 5HRNA 1QS4A 2RN2A 5DGBA 4MQ3A 3L2WA 4O3PA 1BQMB 1B9FA 5KFCA 4ECQA 2W9AA 1NK8A 4WZQA 4CIGA 1HNVB 1Q8IA 1UA0A 3TWHA 1TL3B 4Q8FA 2VA2A 4CEQA 4ICLA 4DS4A 4TYBA 4RW8B 1C0UA 4ECRA 4TXSA 1RDCA 2UUWA 1S1UA 3KK3B 2X6NA 3DLGA 4M3TA 2YNFB 2RPIA 4QWBA 4QWCA 4ED3A 3LP2A 2HNZA 2ILYA 5F8JA 3S3NA 4ZMMA 1NOZA 1D9DA 2R8GA 3SI8A 4WFXA 3AVFA 4KB7A 3AA3A 2RKIB 3CYMA 4FJ8A 1HJRA 3GIMA 3WNGA 3PW0A 3KLIB 5KFRA 3DM2A 3SYZA 1LW0B 4W5NA 3QNOA 3N6NA 3QZ8A 1R0AB 1S9GB 1SV5A 2R2SA 4ELTA 1IM4A 3DOLA 1JXBA 2IM1A 3RWUA 4CESA 3DLRA 3SPYA 3S3MA 4I9LA 4KHUA 4JRQA 3IG1B 4CGDA 4HKQA 2XCAA 4CE9A 3MEDB 3NGDA 2HHQA 3DDKA 4RU9A 1IKVA 3OYKA 1ZBLA 4N76A 3C6TA 1HQUB 3N6LA 3KHRA 2XGQA 4FW2A 3SUQA 2HHXA 3DMJA 1DLOB 3K5NA 4CGGA 1QE1B 5HLFA 1NK6A 3TR8A 4FM2A 3OYCA 4GC6A 3RB6A 3ZCMA 3VQ6A 1ITGA 1LAVA 4E19A 3M8SA 3I0RA 2EHGA 3KLHA 1EETB 3LAKA 3AA5X 1RT4A 4J9NA 1RYSA 2HMIB 3MEEA 3LZJA 3SQ4A 3PY8A 1ZBIA 4ZVFA 1TAUA 2F96A 2ZE2B 4DL2A 1LWCB 2FJXA 3HPGA 3SI6A 4KO0B 1B92A 4Z4EA 4KAZA 4Y34A 4ED6A 4TN2A 5KI6A 3KK1B 4HUEA 4NYFA 1WSJA 4CHZA 3V6DB 1U47A 1S6QA 3MF5A 5K14A 3OS1A 3SPZA 4PA1A 4R8UA 1LWEB 1RILA 3M8QB 4IH7A 1VSLA 4M45A 4CEOA 1TKTB 2G8IA 2IJNA 3C95A 3C94A 4H4MB 1T94A 1IKWB 5JXSA 3VQAA 4C8MA 1BIUA 4ZVHA 3I8DA 3QEVA 3KLGA 4EBEA 1JLGA 5C25A 4LSNA 2P1JA 2W8KA 4CK3A 3H98A 5FRMA 4O4GA 3P1GA 4B9VA 1JKHB 4W5OA 2HHSA 2OH2A 3KLEA 4KB1A 5L1IA 4IH6A 4O44B 2Z1HA 3S9HA 4ZPCA 4KTQA 3QZ7A 2D0CA 1S6PB 5KFOA 3ASMA 4FZYA 1K1SA 3TAGA 1S1VB 1SKWA 1NK4A 3MXJA 2IC3A 2C2RA 3K2PA 3RMDA 4E7LA 2OPPB 1KLMB 2E9TA 4B9UA 2W7PA 3BREA 4NZ0A 4ZHRB 5KFPA 3ZT2A 4E0DA 3OS0A 4B3OA 1SKRA 1EKEA 4J2EA 1LW2B 1RTIB 1SL1A 4OGEA 3V9UA 2BE2B 4DMNA 3AVKA 4B8CA 4RNNA 2B6AB 4KKOB 3TANA 3RMAA 1ZTTA 2KFZA 2I5JB 1RT2B 1NKCA 4RW7B 3T5KA 3NAEA 2DPJA 4CEDA 1VRUA 1WSHA 1Z26A 1WAJA 5HRPA 2AGPA 3FDSA 4M3YA 4FM0A 3AVCA 2UUTA 1RT1B 1BCOA 2R2UA 2ILZA 3DYAB 1ZTWA 4FXDA 3TAQA 1QSYA 4OL8A 4AHCA 2KZMA 1SL0A 5KFBA 4LQ9A 2ZQBA 5JS1A 4HHTA 1N5YB 4ED0A 4OPJA 3NGZA 2WHOA 2NUBA 3DRRB 2IAJB 1C0TA 1HQEB 3NGYA 2FVQA 1SKSA 3JSMB 5HBMA 4F2SA 3HYFA 3HHKA 2IMWP 3KMQA 3Q8SB 3TAMB 4KRFA 1N6QB 4OKKA 2UVWA 1ZYQA 4ZP7A 4EZ9A 4F3TA 4B9LA 5EWFA 5KT4A 2XY6A 3AVGA 3LPUA 1TVRB 2HNYB 4KHQA 4XO0A 2BGGA 4ZVGA 1CZ9A 4J9RA 2DFFA 4MFBA 1BI4A 1RDRA 3BSOA 3GILA 3H40A 4HYKA 4M3UA 4NLQA 1L3UA 1JLQA 2QK9A 4NLRA 4X2BA 3LP0A 3IS9B 4CEEA 4KPYA 2YV0X 2UVVA 4CGFA 2R7YA 3RMCA 3AVLA 3PV8A 1J53A 1WSGA 1YTUA 1RTDB 4NCBA 4GVMA 2QE5A 3V9WA 3LP1B 2A1RA 3ZSWA 1J5OA 2XC9A 2B5JB 3OYFA 3OYJA 3SUOA 3QIPA 4RW8A 3KHGA 4M42A 3DOKA 4MK8A 4WYLA 4I2PB 3GIIA 3KK3A 1KHWA 1RT5A 4M3RA 3D0PA 1UWBB 1HPZB 1C1CB 4BDPA 4HCCA 3H5YA 5J2MA 4F4WA 3UR0A 1ASUA 1IG9A 3OLBA 1W9HA 1NJZA 4CJEA 3CVKA 2HHVA 3VQBA 5DQHA 1JL1A 4WFZA 3OYHA 1BCMA 4K4UA 1HMVA 1U09A 5L1LA 4HVJA 1RA6A 4K4VA 1KVBA 4KHWA 4E1NA 1S9GA 3VQCA 4E7KA 5HP1B 1TK5A 1S1TA 1VK0A 3SUPA 1JLFA 1DTQA 2FBXA 3CJ2A 2IM0A 1N56A 2D5RA 3H4BA 1S0OA 1TGOA 3OYMA 3MEGB 4RUCA 1S9FA 3HVRA 4R5PB 4CIFA 1CLQA 4EYIB 1VSIA 3E01B 5D3GA 4Q8EA 1QAIA 4KHSA 5I3UA 5C42B 4KE5A 4LY7A 4H4OA 3OJSA 2YKNB 4KHYA 1D0EA 4XPEA 2ETJA 4KREA 4MK7A 4FLZA 4KB0A 3QGHA 3AA2A 5DG9A 4QPXA 4RZRA 3CDWA 2B4JA 2OPSB 4ZPAA 3UIQA 4J9MA 3OHAA 3U6FA 1RT3B 3OS2A 3LANA 3HT3A 4MKAA 4OLAA 4TY9A 1RYRA 1KRPA 4Q0BB 4ELVA 2ALZA 3K5LA 4DFPA 2V4QA 3HXMA 1QHTA 1FK9A 2E9ZA 1XC9A 3ULDA 1NK9A 1HNIB 4LD0A 3MTKA 3BGRB 2JEIA 3OYEA 4ECVA 1NKEA 5KG6A 1JIHA 4RW4A 4AHVA 4I2QB 2UVUA 1IKXB 2W8LA 4L8RB 4TQSA 4KHMA 4CEZA 4TSXA 4E7HA 2X78A 3BQ1A 2FLNA 1TKZB 2YKMA 1REVB 1W25A 3KD1E 3KLFA 1TL1B 4CEBA 1U48A 3ZT4A 3BJYA 1WSIA 2Z1JA 4ZP8A 3H5SA 5J2QB 1S97A 3AVJA 1YVUA 2ATQA 1JLAA 2HHUA 5KFHA 4RNOA 3V9XA 2FVRA 3TQ1A 5KFDA 2V4RA 4ED7A 3SQ2A 1NHVA 3NHGA 3HPHA 3RAXA 5J2PA 1J54A 4GMJB 2R8IA 2AJQA 4WXWA 4DU3A 3G86A 4DTMA 4WZMA 4QWEA 3QEXA 5DLGA 4HUFA 5CYQA 3LPTA 4CFCA 3FQKA 4JV0A 3I0SA 1D5AA 4BACA 4JLHA 1LAWA 3K5MA 2QKKA 2XI2A 2XWYA 4ELUA 2IOCA 4TLRA 4FM1A 4KFBB 4KKOA 3NL0A 4IG3A 3PHEA 3TAEA 3MR5A 4RW7A 3QERA 4WE1A 3F73A 3S3OA 4M41A 1S48A 4JV2A 1NK5A 4F8RA 1SUQA 3RR8A 2BANB 3AVNA 3OSNA 1T03A 3GV8B 5CZ2A 3OYLA 3L3VA 3RB4A 4FLWA 1IKYB 4XPCA 4O3RA 2WCXA 5F8IA 2VG7A 5F8GA 4CK2A 4MH8A 3PJWA 1ZBFA 3L2RA 4Y1DA 1T05B 3QO9B 3SFUA 1HQEA 4NCGA 1WNEA 3TABA 4IG0B 1VRTA 4DEZA 1HYVA 2AGOA 1G15A 4E1MA 4U6PA 1S1XB 5FROA 1C1AA 4KBIA 3C6UB 3AO4A 3G6XA 1SH2A 3AVAA 4Z0UA 3U3YA 3DI6B 3G6VA 5CYMB 1RBSA 3M8PB 1J9AA 1TVRA 4FK0A 2HNYA 1DTTA 2O4IA 4YQWA 3DRSB 4NLPA 3DRPB 4J9SA 3RAQA 3B6OA 5EDWA 3ZSZA 1C1BB 1FKPA 5KFGA 3I5BA 4ZTFA 5EWEA 4LQ3A 4DQPA 4FJKA 4NYZA 3HL8A 5J1EB 4F3OA 4CECA 1LWFA 3QEPA 2BRKA 4F4ZA 2IM2A 3QLHA 3QNNA 4DTSA 5KGWA 3VQ9A 4NYNA 3HKWA 4LSLB 4FS1A 4FLXA 3BSNA 4DQRA 5HRRA 3CIZA 4CEAA 4W5QA 2W9BA 1FKOB 4B8AB 4Y2CA 1S5JA 1X1PA 5KFUA 3IGVA 1RT7B 1N4LA 2OPRB 4URGA 4CERA 5KFZA 1S9EA 4IFVB 1XI1A 1RTHB 4CHYA 1MU2A 4OVLA 3OYNA 1RT6A 2BQ3A 1JLEA 4F4XA 4CJ4A 4J2AA 3K58A 2I1RA 1EP4B 3OLAA 2QXFA 1A5WA 3ZSRA 3FRZA 4CHQA 4G1QB 3SQ0A 3KJVB 4JRPA 3V9SA 1VSHA 1HYSA 3V1OA 3MECB 5EUHA 1S0NA 4RUAA 2XCPA 4B9NA 2IBKA 4DF4A 2AX1A 4FW1A 1XR6A 1QQCA 5DMRA 4ID5B 3ZT0A 3FFIB 5HROB 1BQNA 3ZSXA 3M9NB 3L2QA 2GIRA 4RW9A 4J2DA 4W5RA 2ZD1B 4KV8A 2GUIA 3MFIA 4DL4A 4FJXA 3E01A 3V4IA 4CF2A 2YNIB 1UA1A 1TAQA 4CJPA 5C42A 4EP4A 4CJ3A 5CZ1A 3HSTB 4URQU 4BWMA 3HP9A 2W9CB 4RW6A 3Q8QB 3TAPA 3DLEA 3NBPB 2FJWA 3MXMA 3HVAA 4IDKB 3ITHA 4YP3A 4PUOA 3AV9A 1TK0A 2OPQA 2WONB 5KT3A 4DQSA 2C28A 1TV6B 4ECYA 3OL9A 3T5JA 2D0AA 3QYYA 4M3XA 4OLBA 4IOBA 5SZTA 4NLWA 3P83D 4Q0BA 5C24A 2F8EX 2R8HA 1VSDA 3RMBA 3CM5A 4UQGA 4FJ9A 4DG1A 2JLEA 1VSEA 3SV3A 4CF9A 4F4YA 1BHLA 4AHTA 4EEYA 3AO2A 4ID1A 3DLHA 2RF2A 1MMLA 1NK7A 1KTQA 5I42B 4DSLA 4CGIA 1HARA 3LZIA 3KHLA 3DLKB 3QGGA 3T5HA 4I7FB 2D0BA 2WOMA 4Y2AA 3V81B 4AHUA 2ITGA 2VG5B 4ED8A 4PWDA 1ZBUA 3G10A 3NH0A 3CJ4A 1QTMA 3HO1A 4ED1A 4QCLA 3O4QA 5KFWA 2BRLA 3N6MA 1TK8A 4ICLB 3BDPA 4Z4GA 1C0UB 3LAMA 4RNFA 2AWZA 3KNAA 3AO5A 3DLGB 4IKAA 2KFNA 4FVMA 1X9SA 4LH5A 2W7OA 3LP2B 4OKJA 2HNZB 2EC0A 2HW3A 4DWIA 1KHVA 5KT5A 3NH2A 4EZ6A 2C2DA 3GV7B 4DSKA 3IAYA 4NLXA 1I3AA 3PX6A 4ECUA 3OJUA 3KKRA 3CFRA 4DTJA 1S1WA 2PY5A 1RTJA 3LALA 1K1QA 2CJQA 4PQUA 3DM2B 4KHRA 3VQEA 3FQLA 4QAGA 4URSA 3PW2A 1SV5B 5KFIA 3TAFA 4ZP9A 3DOLB 3HK2A 4K4XA 1BQMA 1KCFA 2AQ4A 2IDOA 2BANA 3O3GA 1HNVA 2KZZA 1U45A 2FLLA 3ZSQA 4NLOA 2VG6B 1TL3A 1U4BA 4FJHA 3NMAA 2ZKUA 2QKBA 4JS5A 1IKVB 3RTVA 3BR9A 2J6TA 1ASVA 3C6TB 2J6UA 2GIQA 2IGIA 3DMJB 2YNFA 1RBRA 1T05A 2G8FA 1WNSA 1L5UA 5HLFB 3QO9A 4DFMA 2UVRA 3PO4A 4J9KA 4K8XA 2HWHA 3ICLA 3I0RB 5KFVA 3KLHB 2RKIA 5T7BA 3CFPA 1YTAA 1UAXA 2FVSA 1RT4B 1Q9YA 4M94A 1ZBHA 4OJRA 3KLIA 4NRUA 3MEEB 1TKDA 1LW0A 2DTUA 1R0AA 5CYMA 4C8OA 2HHWA 4OPKA 3KOAA 1D9FA 3NF8A 3LDSA 3WNHA 3OYAA 1KVCA 2P5OA 4FK4A 3MR6A 3P5JA 2FBTA 3NAIA 3IG1A 3CDEA 3PZPA 2D3UA 1S6QB 1CSJA 1T7PA 3MEDA 1CXQA 5K14B 1RCHA 4EBCA 4R8UB 4FLYA 1C2PA 1YT3A 4FJGA 4MKBA 3CM6A 4BE0A 2XY8A 1HQUA 5DG8A 2XRIA 1D8YA 1S0MA 4ECSA 2ASLA 3ISND 3MR2A 2WTFA 1DLOA 3E51A 4FLTA 1QE1A 3AA4A 3KLGB 2GBZA 1JLGB 5C25B 4LSNB 3AVBA 4DSFA 3EZ5A 3CFOA 3NFAA 1Y97A 4K4WA 3SCXA 4DL6A 1GX5A 3LP3A 3VQ8A 1NJYA 4O4GB 4FBUA 1EETA 3KLEB 3O4NA 3NGIA 2HMIA 2RDIA 1L3TA 2Z1IA 2C2EA 3SFGA 4O3QA 5DGAA 4DTRA 3B6PA 3KMSA 1EP4A 2ZE2A 4F50A 1LWCA 4G1QA 1LV5A 4KO0A 1BGXT 2IC3B 3H59A 3MECA 2DPIA 3TARA 5KFLA 3KK1A 3ZSOA 3V6DA 5KFNA 2DFHA 2KW4A 4B3OB 3PX0A 2AU0A 1LWEA 3M8QA 1S4FA 1JLCB 1TKTA 4DTUA 4QWAA 4TY8B 3TI0A 3SNNA 3PJXA 1BIZA 3KLVA 4H4MA 1IKWA 3OL8A 4TQRA 4FCYA 5FDLB 4DQIA 2G8HA 1XHXA 1EXQA 2WB4A 4ECTA 3D45A 1JKHA 3HVWA 1RBUA 4O44A 1RDAA 1WSFA 4M95A 3AVMA 2ASJA 3HPOA 1S6PA 4HUGA 1O1WA 5CY4A 5KFSA 3HP6A 1S1VA 1TP7A 2YNGB 2WK4A 1FXXA 1KFDA 1U49A 3ZSYA 4KAIA 2OPPA 1C0TB 1KLMA 1TV6A 1XR5A 4OGCA 4ZHRA 5HBMB 4K8ZA 1RBTA 4HTUA 1QAJA 3PR5B 3QESA 3OYIA 3L2VA 3VQDA 4QOZB 3CWJA 1LW2A 2E9RX 4IFYB 2VWJA 5KFYA 2HVIA 1RTIA 1X9MA 2BE2A 4CEFA 3OHBA 1QUVA 2A1SA 3BSCA 4AHSA 4ZVEA 2B6AA 2I5JA 2X6SA 1RT2A 3VA3A 2G8VA 4FJNA 4ZP6A 4MFBB 1BI4B 3G0ZA 1OS5A 3H2LA 2JEJA 4C8NA 1RT1A 1JLQB 1IH7A 3K57A 5F8HA 3PX4A 3KTQA 4KTWA 3NCIA 3GIJA 2V9WA 4O55A 3KK2B 4DLEA 3DYAA 1JLBB 3VQ4A 2C22A 3TVKA 3CQ8A 4FJ7A 3V81A 3EZUA 5J2NB 1N5YA 4FLUA 2VG5A 4DTPA 4ED2A 1T3NA 3DRRA 2IAJA 4BE1A 3RB3A 2R2RA 2JC1A 4IRCA 1S49A 3ZT1A 1J5OB 3JSMA 1IO2A 3IN5A 4CF8A 4B9SA 2D7SA 4H8KA 3WNFA 4FJIA 3QIPB 4CGJA 1KSPA 3DOKB 3TAMA 3HVTB 1NJXA 1N6QA 1RT5B 3OYGA 2IM3A 2R2TA 1JL2A 3D5MA 5F8LA 2EX3A 4KHNA 4CFDA 4F2RA 2OZMA 4C8KA 4NLVA 4CIEA 1NKBA 4KSEB 4K4SA 5J2MB 3IRXB 4QW8A 4CF0A 4GW6A 3KIOA 4TYAA 3RRHA 5KFFA 4NRTA 3OL7A 4MIAA 5KG5A 3D28A 3K5OA 4FLVA 1HMVB 2XI3A 1W0HA 3IS9A 2F8TA 5KG4A 4YFUA 1S1TB 1RDBA 4Z4IA 3QETA 4E89A 1JLFB 1DTQB 5T14A 3SZ2A 3PW5A 2O5DA 4NLGA 1RTDA 3O3FA 3NAHA 4EO6A 4FK2A 2XY7A 4CHOA 2VG6A 3LP1A 4FS2A 4DTXA 1VSFA 4ZTJA 4DFJA 2HNDB 5KG3A 2B5JA 5D3GB 5I3UB 5F9LA 5KT6A 1VSJA 1GOCA 2XHBA 2J6SA 4DL5A 2FC0A 4I2PA 3NDKA 3SQ1A 4J9OA 4H4OB 5KFAA 1GX6A 1CXUA 3GQCA 1UWBA 2GV9A 1HPZA 1C1CA 4DS5A 5FRNA 2HHTA 2JGUA 2E6MA 2YNHB 1CZBA 3OL6A 5KRSA 4HCBA 2RDJA 1I6JA 3RR7A 2QV6A 1SL2A 1QSSA 4GC7A 4CJVA 4B9TA 3O3HA 1SH3A 3LWLA 3AVHA 4M3ZA 2LSNA 3I5AA 4EP5A 3BQ2A 4AHRA 4JUZA 3PW7A 4K4ZA 3PO5A 2E6LA 4CJLA 1XWLA 4FBTA 3RB0A 1FK9B 5HP1A 1WN7A 4Y1CA 3V9ZA 4Q44A 2Y1IA 1Z4UA 1RA7A 3CJ3A 5KG7A 1K6YA 4O5BA 3MEGA 4CJQA 3CJ5A 3L2UA 4DSIA 4R5PA 4CJTA 2PZSA 1BL3A 4E3SA 3JYTB 4RW4B 1VSMA 3NF9A 2BQRA 4R0EA 2FBYA 4BWJA 4FJMA 3QEIA 1U04A 5KFMA 1BISA 4YR2A 2XGPA 4CGHA 4E7IA 4CK1A 2YKNA 2W42A 4B08A 5DQIA 2JEGA 2YKMB 4QWDA 4NLUA 3V6KA 4CJKA 4JS4A 3KLFB 3RBEA 5JS2A 2OPSA 3QEWA 1JXEA 4RG8A 3U3GA 1RT3A 2R8KA 2Q3SA 1F21A 3HJFA 1JLAB 2D41A 3RRGA 2Y1JA 1TKXB 4O3NA 2D3ZA 1HNIA 2OYQA 3KD5E 4CJRA 5J2PB 4F4KA 3BGRA 5KFTA 2HWIA 5L9XA 3UPFA 2IA6A 5HRSA 2JC0A 4EBDA 3SV4A 3OYDA 2E4LA 1JLCA 5CYQB 4I2QA 1IKXA 4TY8A 3I0SB 4CHPA 1ASWA 2JEFA 5L1JA 3K59A 2G8UA 5F9NA 3AVIA 1NK0A 5FDLA 4IG3B 3NH1A 5DG7A 1TKZA 4WE1B 3HM9A 3LWMA 2FLPA 1REVA 3EY1A 4EO8A 3MR3A 1TL1A 4J9LA 1SUQB 4Q5VA 2FVPA 4H54A 4U7CA 2CKWA 2HAIA 3PR4A 1T03B 5SWMA 5J2QA 4Q43A 3EPIA 3T5LA 1RNHA 2PYLA 1N48A 1WAFA 5KRTA 4FZZA 4WFYA 1S1UB 2VG7B 2YHBA 1JX4A 4PY5A 2X74A 2YNGA 2OZSA 4DTOA 1RAJA 4JV1A 1KVAA 1WLJA 3V6JA 2FVCA 3OY9A 3V6HA 3NF7A 4NCGB 4K50A 3H4DA 4ZPBA 1VRTB 1QSLA 1NHUA 2AX0A 1Q9XA 4IFYA 5KTQA 4FYDA 3QINA 3PW4A 3T3FA 4YR3A 4BDZA 4DL3A 4FJ5A 4K4TA 4RNMA 3T1AA 2ASDA 4KFBA 3NKYA 3VQQA 2HVHA 1DTTB 5DK5A 4WYWA 4ECXA 3MXIA 4B9MA 4IH5A 4Y3CA 4ZPDA 2XO7A 1FKPB 2G8WA 3ZT3A 3KHHA 2OA8A 3KK2A 4I9QA 1JLBA 4ECZA 1IKYA 3ISNC 1LWFB 2IJFA 3AO1A 3F9KA 3QLHB 4IR9A 2WRMA 4IRDA 4O0IA 4CF1A 5J2NA 5KG1A 3OYBA 1B9DA 4DSEA 4CFAA 3H5UA 2W9BB 4MIBA 4AH9A 4NLDA 3THVA 1T8EA 1NOYA 4IG0A 4YMEA 4IBNA 4CFBA 1JXLA 4MK9A 3BSAA 3HVTA 1S1XA 5JUMA 4CCHA 4DTNA 3DLBA 1S9EB 3C6UA 3CG7A 3VA0A 1Z25A 1MU2B 3WNEA 4CJSA 4IR1A 1VSKA 1RT6B 1JLEB 3DI6A 3PUFA 3Q8RB 3M8PA 1XR7A 3IRXA 1C0MA 3KKSA 3GYNA 4Z4FA 3MAQA 4NLYA 2V0NA 3VQ7A 5DQGA 3DRSA 1HYSB 4J9PA 1EX4A 3GV5B 3DRPA 1KFSA 4M3WA 1TQLA 3H08A 1C1BA 4FZXC 3OVNA 4IRKA 5F8NA 2Z1GA 1YVFA 5J1EA 4CJFA 3NF6A 3CDUA 2FBVA 4YNQA 2DY4A 1L3SA 2VA3A 4AILC 2XY5A 5KGXA 4DL7A 4CJWA 4CJ5A 1NNDA 1BQNB 2VWKA 4E7JA 4LSLA 2BR0A 5KT7A 4RW9B 2HB5A 4KV8B 3I5CA 2HNDA 3GIKA 3V4IB 3UQSA 5C5JA 1FKOA 4DF8A 4C8LA 4OKEA 4J2BA 4FJLA 1XHZA 1RT7A 4NLTA 2OPRA 3UDLA 3ALYA 4IFVA 2KQ2A 1RTHA 4RW6B 3T19A 3L3UA 4Z4HA 2P5GA 2YNHA 3DLEB 3VQ5A 4KTZA 3V1QA 1RBVA 3ITHB 3KJVA 4PUOB 3VN5A 3SJJA 4DU4A 5KG2A 3Q8PB 3V1RA 2PYJA 2P51A 2OPQB 5F8MA 4XIUA 4BDYA 4N41A 5L1KA 3VQSA 5KFEA 4N47A 5C24B 1UOCA 2G8KA 5EWGA 3G6YA 2DFEA 4ID5A 2GC8A 4O4RA 3FFIA 3SUNA 4DG1B 5HROA 1C6VA 3FSIA 4BE2A 3BQ0A 5EU7A 2FJVA 4FJJA 3PVXA 2AGQA 2ZD1A 2RF2B 4DQQA 3OSPA 5E41A 4IKFA 5KFQA 1VRUB 4YR0A 3M8RA 3JYTA 4K4YA 2KTQA 3ZSVA 5KFXA 2YNIA 1SH0A 4DU1A 1KLNA 1A5VA 1L3VA 5KG0A 4O3SA 4ECWA 4Q45A 2F8SA 2YHAA 1GOBA 5KT2A 1ZETA 2W9CA 4KI6A 2WOMB 3QIOA 4O0JA 4NLSA 3NBPA 3A2FA 4W5TA 4IDKA 2BQUA 4PWDB 2WONA 2O4GA 3MFHA 4CHNA 3CJ0A 1HYZA 4RNHA
chains in the Genus database with same CATH superfamily
5K8NA 2NRWA 1R89A 4X4RA 4YORA 1YRUA 4DSJA 3M05A 4J5OA 3MMJA 1QD1A 3ENBA 4KI4A 3DGPB 1BOTO 4QW9A 1I39A 3IGNA 2VB6A 3L8BA 3Q86A 5DLFA 4C4WA 5C12A 5A8WB 3CGIA 2ZWHA 1H2VZ 3SXLA 1D1UA 2IS3A 5KFKA 3NE6A 5M2RA 2VDHA 2WBRA 1S1WB 3UKUB 2LECA 3BGFA 3EPGA 4N8NA 4OZ3A 4G3IA 2HZVA 4DR4F 4EHTA 2F7VA 4Z94A 4WXOA 4EYHB 4I6WA 1HUXA 3IMXA 2RH3A 3P3DA 1I3OB 3OTOK 1BQMB 1HNVB 1MW7A 2A3ZA 1Q8IA 3QMLA 2R42A 1W2BR 3ZEUA 3AOCA 4RO0A 4JKFA 1FI4A 5E3QA 2VA2A 2QWQA 4DS4A 4OHWA 3GTYX 3MM9A 4OI6A 5AT1B 2DHAA 3KK3B 2X6NA 5C10A 3DLGA 4M3TA 2RE1A 5KAKA 1HWLA 2ILYA 5F8JA 4ZMMA 1NOZA 1QUPA 2ZVSA 4O0NA 3SI8A 2W24A 2RKIB 3KHYA 5M1FA 3ZNUA 4FJ8A 2Q6CA 3PW0A 2DH7A 3KLIB 3N0VA 5AXMA 1GTEA 3QZ8A 1R0AB 3TUIC 1IM4A 3B78A 1OH5A 2LKZA 4JI7J 2QLBB 4X66F 1WORA 3SPYA 3BBFA 3T1HJ 1XC3A 4I9LA 4JRQA 3DU6A 3SCIE 4CE9A 2J0SD 3JTPA 3EE8A 1IKVA 2B7CB 3TZXA 1WEZA 1H7XA 1HQUB 2YX7A 1RBLA 2HHXA 4GVLA 5BYSA 4KH1B 1UP1A 1QE1B 1NK6A 5AQQA 1Y3KA 2HFOA 5LY3A 3MM7B 4FM2A 3BN7A 4GC6A 4USJC 2UUCJ 4CI0B 3T6JA 5A8KA 4BGBA 2EHGA 1EETB 3AA5X 4BVPA 2V8VA 3KZBA 5T7LA 3TSUA 3DXBA 4OI0A 1ILYA 1I51B 1LWCB 2FJXA 3VALA 4KO0B 4Z4EA 2U2FA 4ED6A 3P5TL 3F44A 1RLDA 4ETZA 5KI6A 2ZJRL 3M7VA 4NYFA 1S6QA 2J7KA 3OS1A 2AJ2A 5D15A 2HURA 4R8UA 5LXRA 4IH7A 3TA0A 4CEOA 3MK6A 1WHYA 3V5RA 5G0RA 2IJNA 3R97A 2NXCA 4PXDA 3C95A 1TL5A 2XZWA 2CQ2A 1X4HA 1T94A 5AZJA 1K9MO 4ED4A 3I8DA 3UD3P 1JLGA 2A18A 2P1JA 2A6OA 2AW0A 2VQFK 1UCNA 2BOAA 1R59O 5FRMA 1Z05A 5JICA 1JKHB 2KYXA 2OH2A 3K9KA 1HD0A 5L1IA 3H7HB 3CHWA 4O44B 3UDVA 5HSPA 1R8CA 5AE2A 2E2OA 3S9HA 1S0VA 4ZPCA 3VF0B 2D0CA 2KT5A 2VJVA 1PBAA 2E66A 7AT1B 1K1SA 1S1VB 5ETMA 3QAUA 2IC3A 4KBOA 2C2RA 3RMDA 3PIPL 1KLMB 4FVUA 3FC9A 4YS2A 2F9TA 5L39A 1VHIA 1QVFR 2ZNYA 3ZT2A 4B3TJ 3OS0A 3QT6A 1SKRA 1EKEA 2V4JA 1UZDA 4OGEA 3V9UA 4JB8B 3E2EA 2CNNB 1WACA 4B8CA 3GMGA 1JJCB 2L9DA 1EIYB 1CJKA 1NM2A 4RNNA 2B6AB 3TANA 1RT2B 4PKHA 4CLFA 1NKCA 1U0HA 4M1KA 4LIWA 2DPJA 2IHR1 4CEDA 1WSHA 3CCVN 1WAJA 5HRPA 1PSDA 4M3YA 3AVCA 2UUTA 2QC3A 1FO1A 1HBMA 1RT1B 1BCOA 3U27A 2VFTA 3DYAB 2Q0UA 3QSYB 3HSDA 1OPZA 4BROA 5KFBA 2BMBA 3VAHA 2ZQBA 2C3YA 5M1PA 1N5YB 2ZZTA 3FEXB 2NUBA 3F41A 2R7OA 1SKSA 4M5JA 2HAFA 4ISGA 1B7YB 4F2SA 5C0YA 5CD4A 3KMQA 3ELHA 4H5TA 4HVZA 1NGFA 5BN9A 4HTLA 3K8WA 1ZYQA 3KXDA 3EX7B 3CQXA 1PYSB 2HBJA 2QTDA 4F3TA 2M4MA 4C0OC 3CCVS 4AT1B 1TUVA 2EWHA 2HBYB 2YX6A 3QATA 1CZ9A 2DFFA 3AAWB 3OR2B 1GEHA 2HVEA 3MOZA 3UKUA 4M3UA 4NLQA 3K17A 2ZDPA 1JLQA 1JNRB 4CM0A 4X2BA 4CEEA 2GNKA 2PT0A 3EL2A 2QI2A 3D7SB 2UVVA 3L4IA 3GP9A 4FXWA 2KG1A 3PV8A 2P9LB 3B8HA 3CJAA 4QYZK 3LDOA 1RTDB 4ANEA 4B17A 3A0IX 2XG8A 3BBBA 3DLLL 2MQMA 1NGGA 3ZSWA 4P7TA 2B5JB 3HKZD 4JAXA 3THTA 2UUAK 4A8MP 4DPYA 3KK3A 1GLFO 2LVWA 1UWBB 3ZX0A 4BDPA 3TZZA 4PR6A 4IOCL 4HCCA 1H2UX 3H5YA 1D09B 4LFAF 3VQTA 4F4WA 3UR0A 1IJEB 6AT1B 3CJKA 2NCKL 4CJEA 2OEKA 3VQBA 4KY3A 3BPDA 1F5CA 3OYHA 4OZ2A 5GAEI 5GAGU 2Q79A 5L1LA 1YG0A 2EI5A 4E1NA 1RDUA 5HN0A 4ZS6A 2BABA 7FD1A 3B54A 3GJRB 1VK0A 1J6ZA 1AZSB 1YJWN 1N56A 3MAHA 3H4BA 2E7WA 3IR5B 1HNXF 1UVIA 5L38A 1FXDA 4B3MF 3UDEA 4H0TB 1KXPA 3W1YC 1E4FT 4ZPTR 2VL1A 4LY7A 1NZAA 4L72B 4DV5K 3GFZA 4ZK7M 4NLCA 5LJ5Y 4CZGA 2LXUA 4XPEA 5KOXA 2FD2A 1K44A 4QIGA 1VJWA 2X51A 3PTWA 3UFCX 1DURA 4MJKA 2F63A 4QJVA 4J9MA 3QBXA 1RT3B 3FGVA 1VQYA 2VQFJ 2UXBK 4ELVA 4JI5K 4BC7A 4OX7A 4WU2A 3NP5A 2V4QA 1HNIB 3OTBA 3KYLA 1V3ZA 4LD0A 1U26A 3BGRB 4RWWA 3OYEA 4MYUA 4TLQA 1IR1A 3V4MA 1EZZB 1F5BA 2C42A 2ZJRQ 4AHVA 1IKXB 5F0UA 1YTYA 1WC3A 3IMQJ 5C15A 3GE9A 4E7HA 2X78A 4MDBA 3DXMA 1P1TA 1REVB 3KLFA 3D4JA 2B51A 1IBLF 1RWOB 3ZZZA 1VMBA 3VEYA 5H9FK 2HHUA 4I6MB 5KFHA 5BREA 3V2UC 5LMNF 4RNOA 2H65B 3V9XA 3TQ1A 1YDLA 4ED7A 3BKUA 1RADB 3HPHA 4UZBA 1RWUA 4JYAJ 1J54A 4ATNA 3A3PB 3G86A 4PCQA 4E98A 2KG0A 2FSJA 4QWEA 1Y5LB 3PIPQ 3QEXA 1H2TZ 2IMOA 3R3TA 4CFCA 5EN1A 4CBWA 4JV0A 4OYAA 4BACA 3G9CA 1Q7YO 3H46O 2XI2A 4ELUA 4CZIA 1XTZA 4TLRA 4KFBB 3PHEA 1NPKA 3TAEA 3ID8A 2A42A 4B3SF 5C2FA 3S3OA 3WEEB 4CLSA 2P6TA 4DV1F 3RR8A 1SC1B 3C7NB 3D7EO 3E8OA 3H6EA 3FLCO 1X31C 1T03A 4HACB 3CCLN 3GV8B 3CJCA 5CZ2A 3OYLA 1Q81O 4EFAC 4CTAA 4Y2KA 1TMMA 5F8IA 3UI3A 4CK2A 3M2UB 5FD1A 2QLXA 4LFCK 3ZFVA 2JWKA 3ETMA 2FZCB 4CM2A 3RRKA 4QYZJ 3U8XA 1IVZA 1HYVA 3JB9k 1UVKA 1S1XB 2I7NA 5FROA 5HAOA 1BO5O 1S22A 1MWQA 1HD1A 2VHGA 2UUAJ 3O9UA 2AF6A 1OY6A 2BJ1A 2FZKB 3WUHA 5IV4A 2O4IA 2G0IA 2CQBA 1EARA 4G6VB 4JI2K 2DGUA 4YQWA 3RAQA 1HKGA 3OR2A 5EDWA 4OJ1A 3HZEA 4UF4A 2ZITA 3OBYA 2VFSA 5J1EB 1XNQK 3QEPA 5K9FA 4F3QA 4NYNA 4OLOA 1H6KX 2Y1LB 4FLXA 3KG4A 4DQRA 1X3MA 2XLIA 4W5QA 1JB0C 1FKOB 3DLLQ 3BPSP 4GKJF 1FRIA 3DHWC 3W61A 2NQPA 3GDQA 3IGVA 4RWTA 2OPRB 3US5A 2IFXA 1RTHB 2VPWB 2BQ3A 2HS0A 3UKRA 2XSFA 2ASYA 4DV5J 4CHQA 3KJVB 4IOCQ 2MSSA 3Q0AA 4JRPA 3V9SA 1VSHA 4DV4F 1RGIA 1HL6A 1S0NA 2BV3A 2GTDA 1U7LA 4AL6A 4B9NA 4RJVA 2V67A 3W8GA 1QQCA 2UUBF 3C3LA 4ETXA 3ZT0A 4EI2A 2MGZB 2UXBJ 3R6LB 4JI5J 2E2NA 3M1VA 4CO1A 1YITN 2AMCB 4NEYA 3L9ZA 4RW9A 4X62K 2PMZD 4KV8A 4W92B 3WXLA 4F0MA 2ZM6F 1YJ7A 4LVNP 2YNIB 3QT8A 2OGUA 4CJPA 4DCHA 1O13A 2VUGA 4EP4A 3MTJA 1KD1O 3UN3A 2K1RB 2CWKA 1F2GA 2N7YA 5HMZA 3IXQA 4BWMA 2P9UB 3TAPA 3NBPB 2FJWA 2HQGA 4LR9A 4CLPA 3HVAA 3OFEA 2ZH2A 3ITHA 4PUOA 1BG3A 3AV9A 2O8EB 2OTJN 2EBEA 2GVDA 1S7IA 2PFFB 1NMDA 2NLXA 1RJJA 3P49B 2C28A 2IDEA 4ECYA 2D0AA 1EJ7L 4OLBA 4DUTA 1VOMA 3KJNB 1BE4A 3VEVA 2X1FA 2GGPA 2R8HA 4JNEA 5D0RA 1CJUB 2GQ2A 1K8AO 4UQGA 4M8LA 1NGIA 1BHLA 2GWJA 2F65A 4EEYA 5LSOA 3DLHA 2BW7A 1NK7A 1NB7A 2HYIB 1MG7A 5I42B 2QWNA 4DSLA 2I9SA 3HHEA 3LZIA 3DLKB 3FZMA 4I7FB 1QVGM 3CO0P 2BH1A 3R5AA 2NR0A 2D0BA 2WOMA 3V81B 1KDNA 2DEJA 2CAJA 2ITGA 2YKAA 1RKJA 2KM8C 4ZLNA 4YY3K 3NH0A 3HO1A 2V8DA 3TTCA 2HSEB 3R7BB 4KYZA 1LWXA 2QZ8A 1N33K 2LEAA 4I6MA 3THWB 1C0UB 4WK1A 2HFSA 4RNFA 2AWZA 2ACMA 4Z37A 2P9IB 3KNAA 2LA4A 3AO5A 3IAM9 3CXCM 4LF2A 2W7OA 2JVRA 4DWIA 5KT5A 3EGWB 3NH2A 4GVBA 3IAYA 4C23A 4I1TA 4KRWA 4LFCJ 4ECUA 2ZJPL 3CFRA 4YOUA 2YY3A 1UFLA 2CJQA 1U24A 5JLFA 3DM2B 3VQEA 3MZIA 3FQLA 4QAGA 3QB0A 2J5AA 5KFIA 3TAFA 2DIVA 1YBAA 3DOLB 5M2PA 4TU8A 2C2ZB 3J7ZO 3A3OB 5F2RA 1N8RT 2AQ4A 3O3GA 2DHGA 2ZWOA 3ZSQA 4HACA 1TL3A 3OBWA 5ITHA 1U4BA 2ZKUA 4JS5A 5LL6Z 4DQ8A 3RTVA 1VQMS 3VENA 4YOWA 5HATA 2J6UA 2CG8A 3CMAS 4BR0A 3ULHA 3DMJB 1XNQJ 2XMMA 1TR0A 1L5UA 5HLFB 2GVZB 2DH8A 1K8KB 1M1KO 3ICLA 1YTAA 4JKGA 1UAXA 4JV5F 5HI7A 4O5FA 4USTA 1EQYA 4OJRA 4I69A 3MEEB 1TKDA 1LW0A 2ZH9A 4AF1A 3KOAA 1D9FA 4K2JA 5ADXH 3OYAA 2QMUB 4PXEA 4FK4A 1KQGB 3ULEB 1W2IA 3M32A 3PZPA 3PYFA 1ICEB 5K14B 1SKUB 2FHJD 1XMOF 4GV6A 4QR2A 4FLYA 1C2PA 4FJGA 4BC5A 1FTCA 4U8VA 2QMWA 2XY8A 1DT9A 1BU6O 4USWA 3PDNA 2WTFA 4FLTA 3KLGB 2GBZA 4F3MA 3OFGA 5C25B 4F26A 4LSNB 2CPFA 3MMBB 3TZWA 1FJEB 1BWVA 1LNQA 4QS9A 2ZZMA 4C11B 1XN9A 4X62J 3J7A1 3KLEB 3PFOA 2MY8A 3NGIA 1ZZNA 3AD9C 4DB3A 4NMXA 2Z1IA 2YKOA 1CJVB 4B1ZA 3SFGA 2K06A 2PBDA 4JK7A 3KMSA 4F50A 3PYGA 1U1KA 1N36K 2G2ZA 2DHHA 2HGLA 2DPIA 3DU5A 2GAHC 3X3UA 4ZIVA 3ZSOA 1JJ2M 1R8PA 2KXFA 4Y28C 1YJVA 2COLA 2KW4A 3PX0A 1SAZA 2PI4A 4P71A 2PC6A 3NGSA 4N77A 1S4FA 1PAEX 4DTUA 3TI0A 4LF1A 5H9EK 4KC5A 2QWPA 3W9HA 4YHHF 2P6SA 2XMVA 4DV0K 1Q78A 2MQQA 5FDLB 4DQIA 1LK7A 3EDRB 2FTRA 5ETSA 3GLJA 1U1QA 1XHXA 2MEWA 2GZOA 4LF8F 3E66A 1JNZB 2WB4A 3MDQA 4BRMA 2K1RA 1YQHA 2HWTA 2BJ7A 2JSXA 2HFVA 4M95A 3AVMA 2ASJA 3HPOA 1S6PA 2DR7A 4HUGA 1RFQA 1B3TA 1O1WA 1G7CB 5CY4A 1FXXA 1UW9A 2O8EA 1GNKA 3U02A 1RTZA 1XR5A 4OGCA 4TU7A 1NDLA 4HTUA 2IVOA 3QESA 4QOZB 2F9DA 1LW2A 4DPOA 4YY3J 5KFYA 3RW7A 2RE2A 5B0FA 2QA4N 3SEOA 1UVMA 4IEEA 4CEFA 1WC4A 2A1SA 3AXMA 1N33J 3GJQB 3LOUA 1OWXA 1FJGJ 2XS2A 2E1YA 5A76A 2A6MA 4FJNA 4MFBB 1BI4B 1OS5A 3K7RA 4D3GA 2KU7A 1I94K 4DLEA 1JLBB 4DR2F 3W63A 3V81A 5LMUK 2KHDA 2BUPA 1FXRA 2R7TA 2AJ1A 5J2NB 4P6QA 4EFHA 4BRHA 4ED2A 3DRRA 1NEEA 2DGQA 2R2RA 3R2DJ 4IRCA 1Z1ZA 3P38A 5T41A 2DITA 3IN5A 4L3QA 4CF8A 2HBMA 3WNFA 2L3MA 5K20B 2AP1A 4CGJA 3IBCB 3DOKB 2ZH1A 4Y0FA 2APOA 2P9IA 3HVTB 4FWNA 3VTIA 5EVZA 3OYGA 3VEZA 4CFDA 2WUSA 2ABYA 4C8KA 1NKBA 2BJ3A 5J2MB 2O3DA 2JX2A 2U1AA 4GW6A 4TYAA 5F0XA 2OTLS 3OL7A 1A7GE 3K5OA 4DR5K 5GVQA 4CYUA 2XI3A 1W0HA 2ZJPQ 2F8TA 1LQ9A 3DOMB 3G4SN 3NGTA 3LGHA 4NX9A 2NRXA 4KIAA 4Z4IA 3QETA 1JLFB 2X1GA 4CLWA 4DX8H 1KAZA 5HMWA 4CHOA 2UV8G 1SC3B 4ZTJA 4J9UE 2HNDB 4WYBA 5I3UB 1GOCA 3U1LA 2J6SA 1RBOB 3F2KA 4I2PA 3NDKA 1Q8BA 5KFAA 2DGWA 4C97A 1CC7A 1V4SA 4YOXA 4HH0A 4QIWD 1H74A 3RR7A 3LTOA 3A3NB 1QSSA 2QL9B 3IR6B 4GC7A 4CJVA 4B9TA 1NCLA 3O3HA 2E5IA 2VQEK 4M3ZA 4U9RA 2ZBQA 4EP5A 3HZ6A 4AHRA 4JUZA 3VCDA 3CJ8A 3G4SS 2GV1A 3PO5A 2E6LA 4NO7A 3DDIA 1FK9B 5HP1A 1OYDA 2F9JA 2Y1IA 3N4QA 3SBMA 4MLEA 1RA7A 3AA8A 3TUPA 3PCOB 4MT1A 4X64F 3AJ1A 1V4TA 4CJQA 5IC6B 4DSIA 1N36J 1I1GA 1RHRB 3EMTA 3G71N 3E1YA 1Y4ZB 1VC6A 1HR0F 4CGHA 2XS7A 4LF7K 5H9EJ 1HHQA 2FJDB 4QWDA 2DRDA 2X1AA 3IA0A 4BRKA 3KFWX 2OPSA 4DV0J 3QEWA 2M88A 1KP6A 4JI1K 2JL9A 3U3GA 2R8KA 3CB4A 5CCMA 1F21A 1SIZA 1IBCB 2QA4G 5MLCV 2G4BA 2C2NA 2MB0B 1OQ6A 2YWWA 2OYQA 5D77A 4JKAA 1ZZFA 3OXGA 4DDFA 1HNWK 2HWIA 4KHPF 1T9WA 1WOQA 2XB2D 1FXLA 3OYDA 1KBRA 5M1NA 4F67A 4HTJA 3EN9A 5CABA 2NNWA 3HSCA 4CT8A 5B0GA 2OEJA 4BRLA 2JEFA 5L1JA 3GSDA 2E1AA 1N54B 1PG5B 4X4OA 3CPEA 2GS8A 4DV3J 5FDLA 4IG3B 1IBMF 1C0FA 4WE1B 2YHWA 3LWMA 2RNEA 3WIVA 3EY1A 1YJNN 1TL1A 2V8HA 4TKTA 3TVZA 1SUQB 4H54A 2CGKA 3PR4A 3CPWR 1U2CA 2JFDA 4Q43A 3EPIA 4RBVA 4BGAA 1N48A 2AHOB 4WFYA 2VG7B 2CRLA 1JX4A 1I94J 1YVNA 2X74A 3SCLE 2OZSA 1RAJA 4J37A 2Z0GA 5GIOA 3TWZA 2N3OA 5LMUJ 2DYAA 4K50A 3TO8A 2MKCA 1GMVA 5DRKA 1WEXA 2MLYA 3KVGA 2AX0A 1WUUA 4M63C 1BQXA 2YVSA 4C98A 2IPOB 4MTPA 1OH8A 5JMVA 1KTVA 1HNZK 1FRKA 2HVHA 1YJNS 5GMEA 4OI3A 4OYOA 5FLXU 3SMSA 4ISEA 3BO4A 1MROA 3J7YU 1FKPB 4BRPA 3ZT3A 1MN9A 3BGUA 4HWIA 2OD4A 4I9QA 1JLBA 1LWFB 5FPDA 4DR5J 4O0IA 3C16A 1WHWA 1PKUA 5J2NA 3TJAA 3OYBA 1B9DA 2CDQA 3G8QA 3QFPA 1T9VA 2C2OB 4DL0C 2RIJA 3H5UA 4TVAB 4IO9L 3ZETB 1AROP 1GMWD 4IG0A 4MK9A 1G3OA 3HVTA 5L8RC 3PM9A 2QM1A 2OANA 1TMJA 3NOCA 2AYEA 3C6UA 2LEPA 3CG7A 3VA0A 3ENWA 3S01A 1IQTA 3WNEA 4CJSA 2XMUA 3RZAA 4IR1A 1RT6B 1JLEB 2Y8WA 3PUFA 4H0XB 1XR7A 3MAQA 2V0NA 1KOHA 3GSIA 3VQ7A 5DQGA 4FF4A 1RDWX 2CJBA 4M3WA 3EE9A 1C1BA 1JJHA 2XHWA 4IRKA 3VGMA 4M63A 2Z1GA 1HLUA 2VQEJ 4RTFD 3P4IA 2FBVA 3OTEA 1L3SA 1S5ZA 2XY5A 1IUJA 4AUKA 5IQQA 3SBTA 1FWPA 1CQNA 4MKVA 3MM6B 2XYPB 8AT1B 2DXDA 2HNDA 4JI7F 3GIKA 1M1GA 2OSQA 1YJUA 4JI6K 3HLUA 3T1HF 2DISA 1E3MA 1ZA2B 2AP6A 3SK3A 3UDLA 3HJVA 5IM0A 4QZVB 2IIRA 1VDHA 2P5GA 4NYPA 3DLEB 3VQ5A 3V1QA 3SJJA 3P45B 1FD8A 1OYEA 3V1RA 2PYJA 2OPQB 5F8MA 4LF7J 4N41A 2VOPA 1UEVA 5L1KA 4CDIA 5KFEA 4EIAA 2UUCF 5D4OA 1VLOA 2D69A 1TZ0A 4JI1J 2VBWA 2RQKA 1EAYC 2N3LA 4O4RA 1JJ4A 3SUNA 4DG1B 1B4SA 3BH7B 1WD6A 1KVIA 2DNGA 3BQ0A 5AQGA 2ZD1A 4DQQA 5E41A 1HA1A 3IM9A 2VFRA 4YR0A 3D1HA 1HNWJ 4PYDA 5KFXA 4C3KA 2FJEB 2GFFA 2PFDA 1G2EA 3O1BA 4QBUA 3D0IE 2DGOA 4PG5A 2M2BA 3O9TA 2W9CA 4KI6A 3QIOA 2CA9A 3CC7S 1Q5VA 3HSZA 2WVBA 4IDKA 1EWQA 3KWMA 3W2WA 5E3AA 4NXMK 5I4MA 2PE8A 4BR9A 1RABB 3CJ0A 4DLGA 1B0TA 3D9BA 2ZOGA 3RYLA 5EX3A 4OV1A 2VASA 1FERA 4LH4A 1VGYA 1W7AA 2RUSA 3EXCX 4N56A 2BDPA 1VQ7N 4ER8A 1WBBA 3IBFB 3FNNA 3R9PA 2MKSA 3M9MB 5DZ7A 4PQUB 4EWTA 4B3TF 1H73A 2OKQA 3NMRA 2MKJA 1U8WA 3AO3A 3M9OB 4ZJLA 4Z4CA 3M8WA 5HRNA 3BS9A 4MQ3A 3L2WA 2I7PA 2W9AA 1NK8A 1HNZJ 3DCAA 4G1IA 2DPNA 2V52B 2QEXN 5CD4H 4Q8FA 4CEQA 5B0CA 2GX9A 1DKGD 3OPKA 2QWLA 2HIQA 2YNFB 4QWBA 1OY9A 4QWCA 3LP2A 3D1OA 2HNZA 5E3PA 1D9DA 2FY1A 4QS7A 4KGVB 5CZXA 3LDLA 1G6BA 1HJRA 4HEA9 3GIMA 3WNGA 3L7OA 3FMWA 5KFRA 5GAGP 3BYRA 4Q2MA 4W5NA 4I68A 2DH9A 2V6AA 2BBEA 3PIOL 4QU6A 5D0HA 1JXBA 3GOIA 3RWUA 3VTHA 1F2HA 2O8CB 3CQYA 2QEXS 2Q43A 4BC9A 3WX4A 3MEDB 2YPYA 3H20A 5IS2A 4RU9A 3NNCA 2CZ9A 5JLHA 3PYEA 5ETOA 5CR4A 4UOFA 4RBTA 1DLOB 3K5NA 4IOXA 4YB1P 3TR8A 4JI4K 2YKQA 3OYCA 2CWXA 3M6VA 2FGCA 2I38A 4E19A 3KLHA 1UZHA 3LAKA 3ZTOA 4IO9Q 4J9NA 1RYSA 2HMIB 2OP5A 3D2EA 4MLHA 2J9DE 4DUZK 3W65A 3PY8A 1ZBIA 4JI6J 3CSKA 1B0PA 2RUGA 1TAUA 4ZA1A 2F96A 4KGMA 3ZO7A 1R6YA 3TSQA 1B92A 2BJDA 4TN2A 3KK1B 4HUEA 4CHZA 3T1YK 1ZM2A 3CCQN 3A5MC 3FK4A 3M8QB 3SJHA 2G8IA 4WCEL 1KEKA 1BIUA 2O01C 4ZVHA 2CQ0A 2CQ3A 4PHTX 1VQSA 3QEVA 3RSEA 4EBEA 2F8HA 4ED5A 2GWKA 4CK3A 1WC5A 4O4GA 3VZIA 4W5OA 3MMAB 2CH5A 2XYHB 4IH6A 2P5VA 1KQKA 3LGMA 4DHVA 3ASMA 3CD6S 3S7RA 1E6YA 2QRRA 3TAGA 1NK4A 2KKHA 4E7LA 3W8PA 2OPPB 3MX2A 4K0KK 2EWSA 4USVA 2RAQA 2W7PA 3BREA 1FDBA 4ZHRB 3FZLA 1JCEA 2KT3A 5KFPA 3TYTA 4B3OA 3VF6A 3AFGA 4X4QA 4U7BA 1SL1A 2XSJB 2BE2B 4CZJA 4ANDA 2VQFF 2GJFA 4MKYA 2RSQA 5AQYA 1DQAA 4KKOB 3FE1A 2I5JB 1F6TA 3QRRA 4CZEA 3NAEA 2QMXA 1Z26A 2P9KB 3OD2A 1RCOB 3D6MB 3JAMY 2ILZA 1LFPA 4OYIA 2HGNA 3MPVA 3P39A 1OJ4A 3UDCA 1WF1A 1QSYA 5DM7L 2NZ4A 1P9QC 1NGJA 1YKWA 4AXJA 5JS1A 3DRXA 4HHTA 2RJZA 4ED0A 1XUPO 4OPJA 4JI8K 1C0TA 1HQEB 3NGYA 2FVQA 4AQYK 5GADI 3THXB 2IMWP 5A6PA 3TAMB 3JQMA 4KRFA 3O9SA 1HBNB 2MQPA 1N6QB 4OKKA 3SQGB 4ZP7A 4FXVA 2FZGB 1T44A 4H5RA 4B9LA 5EWFA 3LPUA 1VHXA 1UJ6A 3A5OC 3MD1A 1VK3A 3NOGA 4EU0A 3BSOA 4HYKA 3LO3A 4JYAF 4E8UA 1L3UA 2K7JA 2ZBIA 1BWEA 3IS9B 3BZCA 4KPYA 3EXYA 2YV0X 2YWGA 2VOOA 5AQFA 4CGFA 2VC1A 5HVHA 1BY9A 3RMCA 1DGKN 3AVLA 4R79A 1M0SA 2FUG9 3HFZB 1UKUA 4G9ZA 1ZA1B 2OO4A 4NCBA 4GO7X 2R3VA 4GVMA 2DCUB 4GV9A 3PSFA 4QIVA 2MZSA 2MZTA 4FWPA 3M30A 4YOEA 1T9XA 2A3JA 4OZJA 1NHKL 3ILJA 4PPDA 3OYJA 4IEIA 4M42A 3S41A 1MN7A 3M5RA 2X1BA 2WSEC 4LFBK 4M3RA 3MAAA 1MDUB 2X3GA 4OX9K 1HPZB 1C1CB 2B3TB 5KQDA 2M7SA 3UW1A 1UJ5A 2X3DA 1RHJB 1IG9A 2J7UA 2HS3A 2IVPA 2KXHA 4JI4J 4WFZA 3K5PA 5MLCQ 4K4UA 4YB5A 1U09A 4K4VA 3OBIA 4H0OA 1TK5A 2XNRA 2CPXA 2H3EB 1O8BA 4DUZJ 1DTQA 1BLUA 1PC4A 1TUGB 2ZH3A 2IM0A 5BN8A 4J7CA 3PIOQ 3IR7B 4HR2A 4DZ6A 3HT0A 2UUAF 1TGOA 4DXLA 3MEGB 1ITPA 3Q2SC 4CIFA 1CLQA 4BG8A 4A8WA 3D6RA 3E01B 5D3GA 3MPUB 1QAIA 4Q8EA 2E5LJ 2RS2A 3T1YJ 4KE5A 3HCXA 2YKNB 2V69A 3JXUA 4Z7YA 4KREA 4MK7A 1OH7A 2FLOA 4FLZA 1RAHB 2P9EA 1LCUA 2EK6A 2YI1A 3AA2A 3FZ2A 3Q89A 4QPXA 3D67A 2RB7A 1H1VA 1N5TA 3U6FA 5B0DA 3OS2A 1WELA 2ZVIA 4MKAA 3G6EN 4OLAA 4M5KA 5ADZA 2ZJQL 1RYRA 1KRPA 4Q0BB 4NB4A 1RWVB 3ULDA 3WDOA 3GPAA 2ADCA 2HIYA 1R43A 1F9HA 2ADBA 1KQSM 4DV5F 4A47A 1NKEA 2QT7A 4K0KJ 2CQHA 2DT9A 2DGVA 4WBFA 2DRAA 3J8AA 1WC0A 1VQPN 3AH6A 5M1OA 4U67L 4TQSA 4KHMA 4PWWA 1MMNA 4WCEQ 3HHLC 1F0XA 2FLNA 5AXKA 1TKZB 2YKMA 3ENOA 2GO8A 3KD1E 2UXBF 4USUA 4M7YA 2EG2A 5AZIA 1VQ9N 4JI5F 1WSIA 4A59A 2Z1JA 1S97A 1YVUA 4WFAL 2KT2A 4PKDB 4NL5A 3ET6B 2LEBA 1XEZA 3ZTPA 2V8GA 4X4NA 1RXOB 5KFDA 2V4RA 3SQ2A 1NHVA 1RWPB 2RDDA 2E7XA 5J2PA 4UUXA 2R8IA 3CMQA 2O8FA 1RE1B 4DTMA 4WZMA 1P1LA 4BQLA 2YBVA 4JI8J 5DLGA 4OPAA 1T3VA 4OFZA 5CYQA 1VQPS 3LPTA 4AQYJ 4JLHA 3NG8A 2ASPA 2QKKA 2XWYA 2MY7A 4FM1A 4KKOA 3NL0A 3OXLA 2UU9K 3FMBA 3THYA 3N79A 3TX8A 3MR5A 3UE2A 1S48A 4LBIA 4M5IA 2XEXA 3P8BB 1NK5A 4M5DA 3Q7BA 3AVNA 4HL9A 5IT4A 2ZH4A 5K8OA 4BC2A 3RB4A 1IKYB 2ZDOA 4O8UA 5BPLA 2WCXA 5F8GA 3PRVA 3HHLA 2HHPA 3TR5A 3A8YA 2N4DA 3TU5A 2AEJA 5DM7Q 1QQOA 1WG1A 1CZAN 3C6HA 1UJ4A 1SPBP 1HQEA 1WNEA 1MWMA 2LQ9A 3TABA 1WJ9A 3F9MA 3W66A 2AGOA 1G15A 1NGBA 2OELA 4A2AA 1YI2N 3UWTA 3CCJN 2UXDK 3ZNJ1 2LFVA 1RBSA 4LFBJ 3DHXA 1M5HA 3A4TA 4CO2A 4OX9J 5I3QA 3DRPB 4DCPB 1YWXA 1XNRK 3ILIA 1RWKB 4KQZA 4LQ3A 3C14B 4FJKA 4NYZA 3HL8A 4LFCF 4KGZB 2ZOFA 4H5VA 2IM2A 1WTFA 2H4WB 5KGWA 2QSFA 5C7PA 3VQ9A 4TNOA 3BZKA 3ETOA 1ZBSA 3GU0A 4J8FA 1KN6A 1NSKL 3FKBA 3CIZA 2W9BA 4ZCKA 4CI6A 2CVIA 4Y2CA 1S5JA 1X1PA 3HZGA 1RT7B 3QBWA 5FPEA 3MM8B 1S9EA 4IFVB 1FT8A 4I64A 3G8SA 2CFXA 3PEJA 5LSRA 5KPRA 3FRZA 4G1QB 3SQ0A 3U4LA 2F40A 1XNQF 2CJXB 2HSTA 4NMLA 4GV3A 2B8QA 2LP4A 3D6TB 3NGUA 4RUAA 5L9NA 3WC2A 2WSFC 1WDDA 4ZCLA 2AX1A 2W4DA 2ITMA 2NRVA 4ID5B 1BQNA 1NGAA 3M9NB 2GIRA 3VF4A 2ZUAA 1FD2A 1N32J 3MFIA 3H3NO 5GINA 4FJXA 3E01A 3V4IA 1TAQA 2JLGA 4CJ3A 1D9AA 4ZPVR 2C1EB 5HJYA 4RW6A 1RISA 2ATCB 3VOVA 3ILOA 5BR8K 2VGMA 4NE9C 1M5OC 1RCXB 1TK0A 1VAZA 1RZMA 4DR1K 5KT3A 3ENVA 3T5JA 1VBKA 4PG6A 4Q7AA 2B8PA 4LRAA 2OD6A 4Q0BA 3L4BC 5C24A 2F8EX 3RMBA 4X62F 1AFJA 3CM5A 1X4GA 2ZJQQ 2FPHX 2JLEA 1WF2A 2DNOA 4UT4A 3IAS9 2OMLA 1VC5A 2CADA 2RF2A 4RX6A 4OMFG 3W60A 5IXUA 4CZFA 6FD1A 4DZDA 2Q3PA 3BP8A 4FWLA 5GADU 3NCQA 1FRLA 5D4PA 2QO3A 3CNQP 4B1VA 1V3SA 3WBZA 4Y2AA 2NYHA 4U67Q 3EGZA 4AHUA 2P9NA 2MYFA 1HFEL 2H51B 2VG5B 3IWXA 4PWDA 4ED8A 5IWAK 2UU9J 3DN9A 3NWGA 2M8HA 3CJ4A 2DNHA 3ZEUB 5K8MA 1GTHA 1HBUA 3BDPA 5A2QY 1WUAA 4JBCA 1T02A 3MM9B 2V9KA 4JHDA 1G4CA 3HSGA 4OZ5A 4WFAQ 4LRBA 1NG9A 3DLGB 5SUHA 5BXIA 1AFIA 4OKJA 2HW3A 3U7JA 2G13A 3CI5A 3LM2A 4NOHA 4DTJA 4JKCA 1XQIA 1RTJA 3LALA 3OA9A 1C4AA 1GXUA 3OW2M 3TX0A 2J0WA 3AY0A 2GQQA 2WFBA 1YX2A 4YY3F 2O8BB 3JAMO 3E9OA 3O9RA 3HK2A 2B9WA 4K4XA 5HOOA 1N33F 3NCRA 4KH6A 2UXDJ 3IP0A 5LT5A 1U45A 1FJGF 2FLLA 4PQAA 4FZVA 1PGZA 2ZF5O 1DY3A 2QLJB 1IKVB 1SJQA 1XNRJ 3GONA 3UR3C 3VGKA 1ASVA 2ZHOA 3O08A 2GIQA 1QZ6A 2IGIA 3VF2A 1K8AT 1VQLS 2DHSA 2UVRA 4J9KA 1N0UA 2Z2ZA 3I33A 4HDGA 3LGNA 2HWHA 5A8KB 3CFPA 2J0XA 2FVSA 2XMAA 4M94A 1ZBHA 1S72N 4BRNA 5T7LB 3TW0A 4BRGA 3HD2A 2DTUA 2VC0A 4K42A 3NF8A 3NVMA 3LDSA 2HHHK 3IG1A 1Q18A 3MM5A 2CYYA 1S6QB 4MO4A 2NRRA 2F4VK 4XAKA 1TUUA 4R8UB 1NUEA 1MNEA 5G0RB 4N8OA 4MKBA 4BE0A 5DG8A 2XRIA 5AZJB 4DPWA 1D8YA 1S0MA 3QSIA 3ISND 3IFRA 3CCES 1JLGB 3AVBA 2E1ZA 3CFOA 5GAGI 1Y97A 3NFAA 4K4WA 4DL6A 2AKWB 3LP3A 5E26A 3VQ8A 3QAEA 2WVDA 4JI3J 3WXIA 3ZTSA 3EO3A 3UD4P 3RVCA 2RDIA 4F0HA 4K5SA 2W2NP 4O3QA 4OZLA 2VPYB 2ZE2A 4O23A 4G1QA 5ETQA 2IC3B 2B9EA 1N5SA 3TARA 3AB4B 4QIEA 1WOPA 2QL7B 5BR8J 3V6DA 2BYCA 5KFNA 3JSBA 1NGEA 1YF5L 2AU0A 2YXLA 2V4JB 2I2YA 1LWEA 4DR1J 2YX1A 4PL8A 4BRDA 2HQDA 4CLTA 1TKTA 4B1UB 3SNNA 3EGNA 2LQJA 3AGRA 3KLVA 4H4MA 3MR7A 1IKWA 5AQOA 1CJKB 3VR1A 1GLLO 4TQRA 4FCYA 1H98A 5IZHA 5AQLA 1U0HB 5D8HB 3WQUA 3J7Z5 4UY8T 2A0FB 1N5VA 1HBMB 1PJ5A 4EUVA 1N36F 3MPWA 1RDAA 4A8QA 3BKFA 3TSPA 1X4EA 1SQKA 2J8AA 1Q4RA 4ZLJA 4YOTA 3MUVP 1TP7A 2E2PA 1KFDA 2HG4A 1U49A 4F02A 2D3O1 4GY2B 5JJBA 4PABA 4L3NA 4K8ZA 4IJNA 2RHKA 1QAJA 3CCMN 3VQDA 5IWAJ 2ZOMA 4DV0F 3CWJA 4HI2A 2WVCA 2VWJA 1RTIA 2IJRA 5HK4A 3OHBA 1ZM9A 2WBNA 4OYBA 2OCEA 4PEOA 1LXNA 4ZVPB 2ZNZA 1S6OA 2MQOA 4FYXB 2HFUA 3BB5A 1JLQB 1IH7A 1N88A 5F8HA 3KTQA 4KTWA 2V9WA 3UB5A 1U1RA 2C22A 3TVKA 4BR5A 3CQ8A 4ILHA 3TEHB 1X9JA 3CJ9A 3FVYA 4FLUA 2VG5A 2ZUGA 1ZAXA 4YDXA 1T3OA 3RBZA 4BE1A 2IAJA 4DV3F 1S49A 3CCMS 3JSMA 1U6BA 2YQ0A 2EW9A 4JKBA 3L09A 2N7CA 1NJXA 2NXJA 3DRYA 2IM3A 2R2TA 2Q66A 2YWEA 1OKJA 3U1MA 4F2RA 2DXFA 1TELA 4QW8A 3CJKB 2BACA 1I94F 1IJFB 3KIOA 3RRHA 3MCNA 5KFFA 1YIJN 2UYTA 4NRTA 1CULA 3D28A 2AJFE 2BXJA 5LMUF 3HHDA 4FLVA 3D0HE 1ATRA 4H4KC 2FXUA 4RPFA 1KNZA 2O8BA 4W4MA 5T14A 4ES2A 4NLGA 4FWQA 4W90B 4EO6A 2XY7A 1OVQA 4FWMA 3LP1A 4Y00A 3C65A 1S77D 1OSCA 2HHHJ 2XHBA 2K2PA 4UTGA 2R7QA 2N82B 2FC0A 2PAVA 4A62A 4JK9A 2F4VJ 3F0NA 2NREA 2GV9A 1OMSA 2MKIA 4GNIA 1WOSA 2ZM6K 2HRYA 1RAEB 4K59A 2JGUA 1WKKA 3TTFA 4DR5F 3KWIA 5KRSA 2HK2A 3FCHA 4ZVSB 2CZ4A 4WTYA 4P74A 3NRBA 1NAQA 1N52B 3LWLA 3WXMB 3CW2C 3O44A 3CTRA 5M1QA 4WIQA 4CJLA 1XWLA 2EFNA 2V7YA 4FBTA 1W97L 1IJJA 4DPXA 4ES1A 5H1SV 1CG2A 1Z4UA 4UOCA 4WU3A 3GE1A 2QL5B 4WP3A 3CJTA 4BHQA 4FP9A 5KG7A 4R5PA 2VONA 3W5XA 3JYTB 2BQRA 4H4KA 3FSXA 1S76D 4BWJA 1KAYA 3QEIA 1U04A 1GH8A 2DNYA 1JK9B 4CK1A 3DXMB 2VQEF 2ZZNA 2MDAA 3V6KA 4CJKA 3KLFB 3VEOA 3D6HB 1RWMB 5JS2A 4FF3A 2E8AA 5IOLA 1SQEA 1NB2A 2OMOA 2O8DA 2FC8A 1YZ6A 2D41A 3RRGA 3W62A 2Y1JA 4QR1A 4K5RA 4GVEA 4BREA 4O3NA 2J76E 2D3ZA 3KD5E 2XNQA 4CJRA 5I9EB 1YJRA 5KFTA 2HBLA 3VGLA 3UPFA 4OJGA 3HSJA 2HLUA 3J81Y 1J2VA 4I2QA 4LF7F 1ASWA 1Q8KA 1PYTA 3RBXA 3K59A 2G8UA 4JI1F 1RBAA 1XJWB 3VEXA 4EO8A 2LXFA 4DCOB 4U7CA 2YQ1A 2HAIA 4CD3A 1NZ8A 1T03B 5SWMA 5J2QA 3CE8A 1R0CB 5LXYA 4XTTA 1HX1A 2IYIA 3T5LA 3FBEA 2XLJA 4CTAB 3OFHA 1HNWF 4F36A 4FZZA 2R4FA 1S1UB 1QQMA 2E2QA 2MKHA 4OYXA 3PLAA 1FFWB 4DV2K 2BTFA 3V6JA 3NF7A 2D1CA 3R7SB 3OTOJ 3H4DA 4IWVA 4ZPBA 2WAQD 1HQ2A 1XK8A 1QSLA 1NHUA 1FNOA 4KH4A 5KTQA 1NBWA 1RHKB 3QINA 4HHUA 3PW4A 1U1OA 4PXBA 2HRTA 2O1PA 4YR3A 4RNMA 3M6UA 4BRCA 3L4QA 2YWHA 3QDKA 3NKYA 1FF2A 3QFUA 4KGKA 1KOOA 1SB6A 4JV5K 3B6BA 3K0JA 4DR6K 3T69A 2XO7A 3AGKA 2G8WA 1YBUA 4ECZA 2WRMA 4IRDA 3MPYA 3CCZA 1U8SA 2C3UA 4FN5A 5KG1A 1XMOK 2D0OA 4DSEA 3C66A 1CS4A 1C4CA 1H7WA 4MIBA 4NLDA 1T8EA 1NOYA 2E1CA 1HNZF 4CBUA 1L3KA 1U1NA 2JFKA 4DTNA 3IBWA 3DLBA 5EX0A 3J80Y 3TZYA 4DUYK 3DI6A 3M8PA 1UVLA 3UKRB 2F8MA 3MGJA 4HTIA 2NXUA 3DRSA 1EX4A 1NO8A 5FIIA 2IVMA 1KFSA 2IDLA 3H08A 4A8YA 4BC4A 2CJKA 3PJ9A 3NF6A 3CDUA 3VV2B 3OVAA 3Q8VA 4AILC 4A8XA 3M1VB 2GEMA 1KWMA 2VWKA 2Z2LA 4LSLA 3GG0A 1T0TV 1GXLA 4RW9B 2CG4A 2HB5A 5B09A 4IFEA 4KV8B 3I5CA 2R7WA 2K3IA 3CMEN 4J2BA 2FQQB 4R0JA 3UNYA 4NLTA 1T9TA 4PZVA 4RLEA 2KQ2A 1FNMA 1DQ9A 2D0PA 4NZ7A 1TYQA 1RBVA 3ZC4A 3ITHB 4PUOB 4DU4A 5CXTA 2DKOB 3JTOA 2GVDB 4UUWA 4XIUA 3MX5A 3I55N 4NLBA 4X84A 1WOOA 1DBDA 2CQCA 1B99A 2P9PA 1PO6A 2GGPB 4WFNL 4FF2A 1R3NA 1U2RA 1Q95G 1YJWS 3DXSX 4L6V3 2DFEA 1Q82T 3FFIA 5HROA 4MYTA 4JI6F 4A61A 5EU7A 4FJJA 4M5MA 5IT0A 1ZAVA 3CMES 4RUHA 3M8RA 3JYTA 2EFPA 4DU1A 1IN0A 1JXVA 1L3VA 1HKAA 5KG0A 4O3SA 2ASOA 4U7UK 2VFUA 1GOBA 3VAJA 1VC0A 1ZETA 2WOMB 4O0JA 3A2FA 4W5TA 3WT0A 5F41A 4P2SA 2DIUA 1VJQA 2WONA 1U02A 4DN9A 3MFHA 4CHNA 1HYZA 3LW5C 3LUYA 3JQJA 1S10A 1FEEA 2ATLA 4N5SA 3TP2A 3EYZA 4OHYA 1S59A 1UFWA 3VMFB 1NJWA 1R6VA 1RWWB 1U2VA 4OJ3A 3VAKA 4GVBB 3G25A 4L73A 3QPIA 4O3OA 3RBDA 3CETA 4XH4A 3VQPA 3AD7C 4DV2J 3CJQA 2FSKA 4C3LA 1X9WA 3CO9A 1ATNA 3QGIA 5D0GA 3L3CA 3R6MA 3H5XA 3PSIA 1URNA 2CGJA 2RN2A 4O3PA 3MCPA 5KFCA 4ECQA 5CZVA 4OIXA 3TWHA 2B0GA 1TL3B 1EB0A 3PKYA 3JSYA 4DR6J 4ICLA 4ECRA 3CULA 5CA5A 4RCHA 1S1UA 3VVTA 2BKNA 3WX8A 3AAPA 4NI2B 5JVGL 2GMLA 4F4AA 2RPIA 4LMZA 3VWSA 1R0BG 3DJCA 3S3NA 4UW2A 5JVHL 1CBKA 2KM8B 2R8GA 4P73A 2Q31A 5EX5A 1XMQK 3ISZA 2EC2A 4JKGB 3OR1A 1FFGB 3SYZA 1LW0B 5DO2A 3QNOA 3N6NA 1ATSA 1SV5A 4ELTA 2ZGYA 3CJRA 4CESA 3DLRA 2DBBA 1FW6A 4ZIWA 3W9IA 2Q2RA 4DUYJ 3CCLS 3M32B 4KHUA 3ZZYA 4CGDA 4HKQA 4M5HA 1VHFA 2XCAA 3NGDA 2KHOA 2HHQA 3DDKA 2LQ8A 2CNLB 3LH2S 4XDDA 3ZX2A 5CHIA 3OYKA 2P9SA 4N76A 3WXKA 2YHXA 1FX2A 3BKTA 3C6TA 5GAHI 3KHRA 2XGQA 3EEQA 1Y64A 1Z2LA 3RB6A 1VQ5N 3ZCMA 2YX4A 3VQ6A 1ITGA 1W2BM 3M8SA 3I0RA 1RT4A 2NYIA 2M5YA 2G9OA 3R8EA 3BH6B 1UMJA 4CIOA 3LZJA 3SQ4A 1E6VA 2DR5A 4OZ1A 4ZVFA 4C1NK 1RAAB 1X8DA 3FFKB 5AFUA 2LYVA 3GYGA 3HPGA 3SI6A 4CNYA 4KAZA 1GFWB 3NGRA 2JLFA 5EXWA 3MF5A 1NMEB 5AQUA 3SPZA 3EVOA 1RILA 2Y0SD 3J80U 1VSLA 1U1MA 4DX5A 2AYMA 3G96A 3NEKA 3R5DA 4JI4F 3ZXWA 4OI2A 2EFVA 2KN4A 2NPIA 3R9LA 2RRBA 5B0BA 1ZS6A 3G87A 1QLNA 1VQ5S 3GL1A 2QA1A 2W8KA 3Q22A 4DUZF 2Z56B 2QWOA 3H98A 3HTVA 5K5MA 3W5YA 3MMCA 3EGVA 3P6YC 3FCVA 4PAAA 2MKKA 2J0QD 1N5QA 2V8PA 4I6YA 1Q8LA 2Z1HA 3QWPA 3HD1A 3QZ7A 1S6PB 4K25A 2CPEA 4NA2A 2E5LF 4FZYA 1S99A 3T1YF 1SKWA 1VBXA 3MXJA 1U6FA 5BRDA 1BHNA 1R8BA 1V3RA 4K43A 4B9UA 3MN5A 3IWLA 4NZ0A 1OQ3A 1LW2B 1QM9A 2V50A 3AOBA 5H9FJ 1YITS 4FKYA 4WFNQ 3RMAA 1ZTTA 3N5BA 2KFZA 4DCJB 3BDEA 3GWCA 3FUYA 2CJYB 4I6AA 3FDSA 4FM0A 3MCOA 4CH0S 4YOVA 1O0PA 1NSAA 2W1BA 3D54A 4JKDA 1ZTWA 2GJIA 1CLFA 4FXDA 4OL8A 4K0KF 2FJAB 2OTJS 3NGZA 4CP5A 3CC4N 2MZ1A 2AD9A 5AJ3K 3DRRB 1B7FA 1FRJA 2EPIA 5HBMA 3TPQA 3HYFA 3Q8SB 3AOAA 2YHYA 5D4NA 3ATUA 5DZ6A 2AZ1A 3WZ0A 3J81O 2UVWA 2XYGB 2O67A 1V9OA 1IR2A 4PG4A 4DN0A 5KT4A 2XY6A 2G2OA 2HNYB 4KHQA 2VD3A 3KNGA 2BGGA 4ZVGA 4OLPA 4J9RA 2FSNA 1X4DA 1OY8A 1QVFM 1RDRA 3H40A 2PMHA 4WP9A 4B3RK 4BQZA 1S57A 3W5ZA 4CYUB 3N4PA 2QK9A 4NLRA 1XMQJ 3MN9A 2EK1A 5ETPA 3SCKE 4JI8F 3CCWA 3OQ2A 3LF0A 4AQYF 1WSGA 3VEWA 4F0KA 3P96A 4RBUA 1W7WA 2QE5A 3QT7A 1CVJA 3V9WA 3AARA 4ZJOA 1PBUA 4M5NA 4JI2J 3DXKA 2A1RA 1J5OA 2XC9A 2W6LA 3IO1A 3QIPA 3KHGA 2LXIA 4I2PB 4NI2A 1NLVA 1RT5A 2XULA 4G1PA 1NLKL 4WIIA 2RVJA 3J7YI 3QFWA 5JVGQ 4UY8O 2KRRA 1UWAA 4X4VA 3MCMA 4OV6A 1NJZA 1NBEB 3CVKA 5JVHQ 2HHVA 4KH0B 3MXHP 3G82A 2DR6A 2Q36A 1BCMA 2BKOA 3WHIA 1HMVA 1NH7A 4HVJA 2YPZA 4JI0K 4KHWA 2ZC4A 4E7KA 5HP1B 1FESA 4IQMA 1S1TA 4H0VB 1S4EA 5AQJA 3BM7A 3QJPA 3CJ2A 4LF5K 1S0OA 1J5EK 3OYMA 2B4OA 4HHHA 1S9FA 1ZH5A 3BZQA 5IV3A 3HVRA 2K7KA 4CH1A 4LFBF 4EYIB 1VSIA 1K0TA 4PKGA 4OX9F 4AFFA 4A8OA 2HZCA 5C42B 3T6BA 3EVWA 2MZRA 4H4OA 3OJSA 4D3HA 5BPMA 1UVNA 4KHYA 1D0EA 1HWKA 3LQVA 1MMDA 1T6CA 2ETJA 2IA0A 2AT1B 4KB0A 3QGHA 2A5XA 2HF3A 4RZRA 5A6WA 2EKNA 2H5JB 2WVFA 3J80O 2OPSB 4LF6K 1YHQN 1SC4B 3UIQA 1RHQB 3HT3A 1KVJA 3R3LA 2Q0RA 2D4WA 2ALZA 2IVNA 4DFPA 1OPIA 3HXMA 1QHTA 3D66A 1XC9A 1NK9A 3P4UB 4LRCA 1KQFB 2JEIA 1KC8T 2GO9A 4IUFA 4ECVA 3R5CA 5KG6A 1JIHA 4RW4A 1DZ5A 1MWZA 1CPZA 4DV6K 1U1PA 4X65K 5GADP 2YCHA 3FZBA 4CEZA 4A57A 4TSXA 1FDAA 1OSDA 2ZBCA 3HI0A 4ISFA 1NM1A 1BMQB 1Q86T 2MZJA 1U48A 1TL1B 3M2RA 1JMTA 3R1XA 4CEBA 2UZAA 3ZT4A 5AQTA 3ZZ0A 4FWOA 3HX9A 1FFSB 4KR0B 4ZP8A 8ATCB 3AVJA 4C0HA 1JQGA 1N32F 2PSZA 2OIHA 1JLAA 4B9QA 2CQGA 4ENOA 4HDHA 1G99A 3M4XA 2YJFA 1GT8A 5E84A 2DNMA 4GMJB 3IRWP 2NPFA 4WXWA 2V94A 4DU3A 3C15A 4USIA 2MZQA 4CNZA 2JH3A 5AJ3J 4HUFA 3HFVA 2DO0A 3I0SA 1MWKA 1D5AA 2CPIA 3GG4A 1HKBA 4ZVUB 4AL5A 1KS2A 2VKZG 4Y6IA 4GKKK 3BYPA 3GCXP 3LPEA 4WJBA 1MROB 2BANB 1WSVA 4E2FB 2KJVA 3OSNA 4CO4A 3S1TA 1TUYA 2ZGZA 5ETRA 4FLWA 5B0AA 3EZWA 1XQSC 4B3RJ 1REGX 3JS6A 3C16B 4FSVA 1Z2ZA 4ZLPA 4MH8A 2LQBA 3PJWA 1UEUA 1ZBFA 2UXCK 2KO1A 1T05B 4PG8A 1M5PC 3QO9B 1N34K 2L08A 4FKXA 4NCGA 2L48A 4IG0B 1VRTA 2QA4S 1EO1A 4E1MA 3CT9A 4LIRA 4U6PA 4H03B 2UU9F 1FRHA 4KBIA 3C6UB 2H1YA 3AO4A 3G6XA 4P9SA 3AVAA 3U3YA 3D2WA 5CYMB 4FK0A 2HNYA 5GAHU 4Z7CA 1DTTA 4AD6A 4F25A 2F9WA 4LF9K 4NLPA 4A4JA 4J9SA 3B6OA 3ZSZA 1M90T 1C1BB 2GQCA 5KFGA 3I5BA 3AY9A 5HANA 4ZTFA 5EWEA 2BX6A 4I67A 3NLCA 1VLYA 3O8MA 4F3OA 2RRAA 2XZTB 3ZZRA 4F4ZA 3G2XA 3QLHA 3K0SA 3O5BA 3CIPA 2CNOB 3D2FA 4UOGA 4JI0J 4YB6A 4FS1A 3KKFA 4F9OA 2KH9A 2F7TA 4CEAA 4AL7A 4LF5J 1PIEA 1J5EJ 4B8AB 2UXDF 1GMUA 4BY9C 2CPYA 3KDNA 5KFZA 4MAKA 5IM0B 1XI1A 3A8EA 1MU2A 3OYNA 1XNRF 8RUCA 1NJIT 2AYBA 3K58A 2HVDA 1EP4B 2I1RA 1A5WA 3ZSRA 2B7BB 2CPZA 3C19A 4BLGA 2V2QA 1HYSA 3MECB 3SAHA 5EUHA 1HWIA 2RHSB 3CD0A 1ZXOA 1H72C 1MWYA 4LF6J 1BXNA 1RI7A 4H0YB 1FNXH 1UETA 2A1BA 1QVGR 1APSA 2CUYA 5DJBA 2KFYA 3FBCA 3UCZP 4LR8A 2RQCA 5LOQA 3OUYA 3ZSXA 3L2QA 4P2XA 1WSRA 5TKWA 2ZD1B 3OFFA 1MLAA 2GUIA 2L9WA 4DL4A 5BYQA 3OVBA 3KDOA 5C42A 4CO5A 5HQMA 1VQON 1HBOA 3HSTB 4URQU 4A8SA 2W9CB 1CQMA 2QLWA 4DV6J 3CXCR 4CLLA 4X65J 1YAGA 2KB2A 3MXMA 3I32A 4IDKB 1SJ1A 3W2WB 3SDEA 3WQTA 2VFVA 4DQSA 5FPMA 1TV6B 1QQNA 2JJ4D 2WBMA 2A10A 4M3XA 4IOBA 3P83D 2XWXA 4NXNK 4JI3F 1VSDA 3HOTA 1FEHA 1FCAA 1IBKK 3LDPA 3UN2A 2ZEJA 5E7OB 4FJ9A 2VU5A 1HI8A 4CF9A 2KDOA 4F4YA 1FWKA 4AHTA 2VPZB 1ESVA 3AO2A 4ZLLA 2W41A 2OFHX 3O4WA 1OO0B 1KTQA 2BUNA 2HBQB 1T9YA 3Q8YA 3G71S 2KLAA 1VQOS 3UVJA 2NZTA 1IQZA 4CGIA 1HARA 5BR8F 3KHLA 2AEFA 5FJ4A 3ZLJA 4FWKA 2FHKA 3T5HA 3ZZOA 5AXNA 2BEFA 4DR1F 4H5WA 4JYAK 1B70B 1C0GA 1VIOA 1OH6A 1PYOB 2G1HA 3RUBL 1AB8A 4QCLA 4ED1A 4GKKJ 4DBQA 1B0VA 5KFWA 1TK8A 3EKUA 3LAMA 1YXQA 4QQBA 3AQPA 2M9KA 1Q1KA 3DGPA 2KFNA 4FVMA 2YQ3A 4LH5A 3LP2B 2HNZB 2EC0A 3NNAA 1X4AA 1RGVA 3M6WA 5A8WA 4EZ6A 1YSJA 3GV7B 4NLXA 2UXCJ 4B02A 4PWUA 3PX6A 2GHWA 5AQWA 3OJUA 3NS7B 5IFMA 1N34J 1S1WA 4BVOA 4URSA 4ZVOB 3PW2A 5IWAF 4ZP9A 1U2FA 4CQ1A 3DKDA 2V34A 1BQMA 1KCFA 2IDOA 2BANA 1HNVA 2KZZA 3GIRA 1BUPA 3RJMB 3RAMA 2QKBA 4LF9J 5J1NA 2CVEA 2BOPA 1WHVA 2YH0A 1Q82O 2F4FA 2RRNA 2DTJA 3BR9A 2DD8S 3O3LA 4ZN3A 3PG9A 1T05A 3BEGB 3SAFA 3QO9A 4DFMA 3QQCD 4ERDA 3NMUA 3PO4A 1FJCA 4K8XA 1Y9OA 1JJ2R 5KFVA 3KLHB 2RKIA 3I9ZA 4BR7A 1Q9YA 1NDPA 1ULRA 3D2EB 3KLIA 4NRUA 1ZM4A 4CWBA 1R0AA 1Y5IB 5CYMA 4C8OA 2HHWA 3SSRA 2P5OA 1KVCA 1VYAA 3P5JA 2RHQB 2FBTA 2RU3A 4OO1J 2D9OA 1T7PA 1CXQA 4DR3K 1RCHA 4ZVQB 4ANCA 1EHWA 3M1FA 2IRYA 5C2DA 2ROPA 2HFNA 1YT3A 3CM6A 4LJMA 1HQUA 2Z8QA 2ASLA 3E51A 1QE1A 3AA4A 3RSEB 2ZBRA 3MM7A 4DSFA 3EZ5A 1GX5A 4O4GB 1EETA 3WXJA 1NGDA 1QZ5A 4RUBA 3VGSA 1GXTA 5BYRA 1L3TA 2HHHF 1QHAA 1NXIA 2V5HG 1K0VA 2C2EA 3R6GB 1E6YB 2R7RA 1EP4A 3NS5A 1LWCA 2F4VF 2OEMA 4KO0A 1BGXT 3PXGa 3MECA 4YDUC 1URRA 3EE3A 5KFLA 5HL7L 2XZDB