3DM2A

Crystal structure of hiv-1 k103n mutant reverse transcriptase in complex with gw564511.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
539
structure length
531
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 146
structure length 531
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dm2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dm2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dm2A05
4IG0B 4HYKA 2KW4A 1FKPA 4ZPCA 2IS3A 3ISNC 3U3GA 3HSTB 4MKBA 4K4WA 4NLSA 1RT7B 1RT4B 4OKEA 1C0TA 3P83D 3OL6A 3EYZA 5FROA 5T14A 3OSPA 5HRSA 4CJ3A 3WNHA 1A5VA 4ECRA 4KKOB 5SWMA 3H08A 1LW0A 3N6NA 3M8SA 5KT7A 4KFBA 4PUOA 2G8KA 1TKZB 3QETA 2HHSA 4CHOA 3IRXA 2YNIA 1DLOA 3HVTB 1RA7A 3Q8PB 3VA3A 3V6DB 2ETJA 1VSJA 1RTHB 1JL1A 1WLJA 4BDZA 3VQQA 3VQ7A 1VK0A 4K8XA 1RTJB 3K57A 4RG8A 1RDBA 5HRNA 3GILA 4CF0A 3OYCA 2IM0A 1HNVA 3LP2A 3DI6A 2R2RA 2UVVA 4B9NA 2FBXA 1S1TB 4FCYA 4OVLA 3BSNA 4QWCA 3GV5B 3FRZA 4FJGA 4DTUA 4M3TA 4ECZA 4CJ4A 5D3GA 4ED6A 5KTQA 1NJZA 3G6VA 4ZVGA 3H5YA 3BJYA 3RWUA 2R8JA 2FJWA 4CERA 3WNEA 2Y1IA 2P5GA 1SV5A 2IGIA 5KG3A 5KFYA 5KFZA 1W25A 3SV4A 3QGGA 3QYYA 3TAFA 5KFPA 3V9XA 4IFYA 3IGVA 2HHUA 3KHGA 5J2MB 4IDKB 4URQU 1TKTA 3Q8RB 1SL1A 1G15A 5HP1B 4ED7A 2IOCA 4U7CA 3RBDA 4JS4A 1UWBA 2E4LA 1S9GB 4DFMA 4Q8FA 4ZMMA 3IGNA 1NK4A 3O4QA 1WAJA 2RN2A 4RUCA 1HNIB 2D3UA 3HYFA 4BDYA 3NMAA 4PA1A 1KSPA 3FDSA 3E01A 1XR6A 4CGGA 4JRQA 1EKEA 3PZPA 4DLEA 3ZT2A 3GIJA 4WXOA 1JL2A 2D41A 3H4DA 4LD0A 4I9QA 1UAXA 4M3RA 1BQMB 3N6LA 3TAEA 4GMJB 3LPTA 3RR8A 3VQ6A 2YKMB 3L3UA 4KBIA 1L3SA 3CYMA 1X9SA 3MR5A 2XWYA 4F2SA 2FLNA 1IKWA 1U04A 3PW2A 4CF9A 3NBPB 3TABA 2G8IA 2YNGA 4AHRA 4H4OB 4J2AA 3SYZA 5KFMA 1LWFA 1TKXB 3VQPA 4F3TA 4CJVA 3C6TA 5CZ1A 3SZ2A 4FBUA 4RW6A 1SUQA 1N6QB 4CHPA 4HKQA 4NCAA 1LAVA 2HVIA 3GIMA 3ULDA 3KD5E 1LW2A 4B08A 3MR2A 4XO0A 4WFZA 3HVWA 4BE1A 1NJYA 2VG5B 3TARA 3DRSA 3ALYA 5HROA 1TKTB 1JLAA 4TY8A 3KK1B 4DG1A 3NAHA 3MR6A 5F8HA 4XPCA 2OH2A 4OPJA 3PUFA 4YP3A 5HRRA 4NCGB 4KAIA 1RT3B 4ZPBA 1ASVA 4HHTA 4DFKA 4NZ0A 2VG7B 4DTNA 3QIOA 1S6QA 3QIPB 1RT7A 4M41A 2RKIB 2I5JA 1X9MA 3IN5A 4ICLB 4KHNA 2XI2A 3NCIA 4PWDB 3OYIA 3OYJA 3EPGA 4EBCA 2JC0A 1SL2A 4CJKA 4ECQA 1VSKA 3I5CA 1CSJA 4EZ6A 3S3NA 4KTZA 3HP6A 1S0NA 4M45A 3HM9A 4C8LA 4E7KA 4J9OA 3KHLA 4YFUA 3AVHA 2BQRA 1VSLA 1WNSA 2IC3B 3K5OA 1IH7A 2F8TA 3PW4A 1U49A 4ECYA 1SKWA 2PY5A 2BE2B 5KFSA 5J2NB 3OLAA 2Z1GA 1D0EA 4ID1A 2IM1A 4F2RA 4ELTA 2XGPA 1TKXA 3CIZA 4CIGA 4KAZA 2XY7A 1LV5A 4QWDA 2HB5A 4E3SA 3ASMA 3KK1A 5KFGA 3GYNA 5FDLA 3PY8A 1KVBA 4EZ9A 4KHQA 3VQAA 3CM6A 3T5KA 2YKMA 3QO9B 3LP0B 2HHTA 4EO8A 1Q9XA 4AHCA 4JUZA 5DG8A 4C8MA 1JXLA 5KT4A 3DYAA 1FXXA 4G1QA 1ZBFA 4RW6B 1JLQB 3V6JA 4NLVA 2YHAA 3M8QA 4R0EA 3L2QA 3FFIA 1S9EA 3DOKB 3ZCMA 2HHVA 1TAQA 2BGGA 3TAMA 2JEFA 4QCLA 4B3OB 4F4ZA 3K5LA 4Q45A 1KRPA 4ED1A 1S0OA 2J6TA 4R8UA 4O44B 5J2MA 5L1JA 1TP7A 2O5DA 2FC0A 4CJSA 3UQSA 3RB0A 4DU1A 1GX5A 3RAQA 3OYDA 4Y3CA 2QKKA 4RW7A 3I5AA 4G1QB 3SNNA 1JLQA 2Q3SA 3KLIB 3H2LA 4CK2A 2W9BB 3IG1A 4Y1DA 3ZT1A 2DFEA 4FJNA 2IJFA 4ECSA 2X6SA 1C1CA 1JLFB 1ZTWA 1QTMA 2G8HA 2XO7A 3LZJA 4FK2A 3AO4A 1N48A 3DI6B 3LP2B 1XC9A 3V81A 2IDOA 4M3WA 5I3UA 3WNFA 3CJ0A 3OLBA 4DL4A 4N41A 3SUQA 1RTIA 4ZP9A 2IC3A 2IBKA 3AO3A 1EETA 2YKNB 5KFRA 3FQLA 1BI4B 1HPZA 2OPRB 1HQEB 3SUOA 4IKFA 4JRPA 2ZKUA 3V6DA 4NCGA 3JSMB 1WNEA 1WAFA 1KLMA 4CEOA 1VRTB 3OYMA 4CHQA 4ZPDA 2X6NA 1EP4A 2IJNA 3AVJA 3OJSA 4M42A 5I42A 5CYQB 3EPIA 4FS1A 1RBRA 1RAJA 2I1RA 4NLPA 4BWJA 1S0MA 3V4IB 4TQRA 5KFVA 4EP5A 3TR8A 1WSFA 1VSEA 3LAMA 2OPSB 4H8KA 1IO2A 3OL8A 4DS5A 4OGEA 3DLEB 4ED3A 4RW7B 1GOAA 3NH1A 1S6PB 1TGOA 2VG6A 4Y2CA 1RT3A 3KLHA 1KHWA 1VSIA 1WSIA 2Z1HA 3DLKA 3HO1A 4Q44A 4B9TA 3MECB 2HMIB 4B3OA 3KKRA 2ILZA 2XY5A 5T7BA 4O4GA 1VSDA 3K59A 4QW8A 5C24A 3AVKA 4H4MB 4YNQA 3S3OA 3HVAA 4FZZA 4NLYA 1NJXA 2ZD1A 3QEVA 3H5SA 3SPZA 2FVPA 3T5JA 2O4GA 4F4KA 4MK8A 4DMNA 2F8EX 1HYSA 2GIQA 1UOCA 1S1WB 3I0RB 1QUVA 1QQCA 4W5TA 3L2VA 4BE0A 1TV6B 3OL7A 2AWZA 4JV1A 1S1VA 1BGXT 1YT3A 4FJIA 2Z1JA 3BQ1A 1S97A 1MMLA 1RT1B 3AA3A 2AX1A 4FLZA 3V9SA 3VQ9A 1BQNB 1MU2B 1WN7A 5KFXA 4RUAA 1TL3A 3DYAB 4DL2A 2IM2A 3OYNA 4R5PA 1U4BA 4ZHRA 2ILYA 1XHZA 2EX3A 2HNDB 3HPOA 4AHSA 2G8FA 5KT3A 4IH7A 3NDKA 5KGWA 3AA2A 4BACA 3KLGB 1I3AA 5FDLB 2GBZA 3RR7A 1ZBIA 5KT6A 3PO5A 3MEEA 3HT3A 3RMDA 4CIFA 3NE6A 3KKSA 4WZQA 4HUEA 1F21A 3DLRA 1HPZB 1HNIA 3NL0A 4I9LA 4PQUB 4KB0A 3ISND 5D3GB 4FJHA 3SFGA 2B43A 2JEIA 1VRUA 3SQ2A 1S1TA 4KO0B 4F8RA 4KI4A 4IG3A 4CJEA 3OYLA 4Z4CA 3KLEA 1ZTTA 1IM4A 3D5MA 3I5BA 3KHHA 3V9ZA 2XCPA 3HP9A 2W8LA 2AGOA 1RNHA 1RTDB 3G0ZA 1RTJA 2YNIB 3HVTA 5KFWA 2UVRA 4K50A 2GV9A 4O0JA 5I42B 4BDPA 2E9ZA 3DLHA 1RT5A 2QE5A 4CF8A 5HLFB 4EBDA 3PV8A 4QWEA 4NLQA 1K1SA 2OPRA 4N56A 2GIRA 2WHOA 1WSEA 1Q9YA 4GC7A 3SPYA 1BI4A 3NHGA 3O3HA 4XIUA 1L3TA 1LWEA 1N6QA 5DGAA 2JEGA 4YMEA 3QGIA 1LW2B 4ZVFA 3V81B 2ITGA 4Q8EA 3QEPA 4CJTA 4FW2A 3BQ2A 1DLOB 1Z4UA 4MIAA 4EO6A 3CFOA 3IG1B 3CJ5A 1IKWB 3QERA 4FJ5A 4FJKA 4O3RA 3DMJB 2BRLA 2CJQA 1NK5A 3D28A 4ZHRB 4KHWA 1BIUA 2GC8A 3TQ1A 4WZMA 4NLRA 1YTUA 2V0NA 3QIDA 3DRRB 3RBEA 5J2QB 1TK5A 4ED0A 1VRUB 2YHBA 3MXJA 2ALZA 3H98A 2B6AB 4J9NA 3LANA 4LH5A 2VWJA 1TV6A 4FM2A 2HNYA 3KJVB 3H4BA 3OYHA 5C25B 4FLVA 3IS9A 2JEJA 3PO4A 3KMSA 1NKBA 4HUFA 3P1GA 5HRPA 3CDUA 3G86A 2W42A 4WFYA 4UQGA 1L5UA 1L3UA 4YR0A 2ZE2B 3NH2A 2RF2B 3CJ2A 5J1EB 5FRMA 5F9NA 4MH8A 4CE9A 3UDLA 3MXIA 3IS9B 2DY4A 2D0BA 3SUNA 1JKHA 2BR0A 4FJLA 2W7OA 4NRUA 1QAIA 4WXWA 5KFKA 3GIKA 2G8UA 4NLWA 3NH0A 2ATQA 3DOLB 3QGHA 3QNOA 5KT5A 3H5UA 3T1AA 4I7FA 3GIIA 4LSNB 4RW9A 3SJJA 1D5AA 3ZT4A 2HWHA 3T5HA 4KTWA 3C6UA 2UUTA 4C8NA 3AO1A 3OHAA 1B9FA 4CK3A 4RNFA 4IRKA 1HJRA 3G6YA 4RNHA 1S9FA 3TANA 3LPUA 4K4YA 4HTUA 2DFFA 4AHUA 3VQDA 1A5WA 2YKNA 3D0PA 1RTDA 4CEEA 2KQ2A 2W9CB 3KMQA 1LWCB 1HQEA 3KLEB 4MIBA 5DMRA 3DM2B 2RDIA 3QESA 4Y1CA 3BDPA 4KO0A 1SUQB 4I2QA 4PWDA 3QEIA 3THVA 3SUPA 4M3ZA 2R8HA 1LAWA 4FJ8A 3MF5A 4DSLA 5C5JA 4W5RA 4Y2AA 4DSKA 4LSLB 1JLEA 3AVNA 2P51A 5J2PA 1RILA 3RB3A 1NK9A 2EHGA 4RW4B 3BQ0A 3RMBA 3OS2A 4FVMA 1C1CB 1JLFA 3AO2A 4CJ5A 4DG1B 3ZSWA 2XC9A 3MEDA 4J9QA 4ZPAA 3RAXA 3QNNA 3BGRB 2ASJA 2W7PA 2J6SA 4KHYA 1BIZA 5HBMA 4YR2A 4FZXC 5EU7A 3OYAA 4C8KA 1IKVB 3PHEA 4DL7A 4K4ZA 3AVGA 3NF7A 4DTXA 3PW7A 3NF8A 1BISA 4Z4FA 1RT4A 4URSA 4N47A 2V4RA 4CIEA 2HNZA 1YVFA 1HMVA 4CEQA 1X1PA 4E7JA 1UA1A 4IQXA 4ZTFA 2F96A 2W9AA 2FLLA 4QAGA 4KRFA 3O3FA 1XR7A 3CWJA 2EC0A 1IKVA 1QS4A 3B6PA 3VN5A 3IAYA 2RF2A 3TVKA 2IAJA 2HWIA 1IKYB 5KFHA 2C22A 4IH5A 1NHUA 4O4RA 4CJQA 1S49A 2UUWA 5SZTA 2D3ZA 5DGBA 3PJWA 1S1VB 5C25A 3AA4A 4ID5B 4E89A 1HRHA 3NGZA 3TAMB 4I2PA 1FK9A 2HHXA 3LWLA 1C0MA 5KFUA 1S9GA 4M3XA 1SL0A 5J2QA 2FBYA 4RW8B 3SQ1A 3PW0A 2FJVA 4DWIA 1HQUB 3C95A 3G10A 4O3PA 3V4IA 1KFSA 2R8IA 4TXSA 4DQSA 2E6LA 2RDJA 4CGFA 3I8DA 4O3OA 5EDWA 3OSNA 2E9TA 2BQUA 4CGIA 1RDAA 3T3FA 4NLUA 1KVCA 4Y34A 4CEDA 2XHBA 3H5XA 3LZIA 4N5SA 3SI6A 4OGCA 2VG6B 3ZSXA 3AVIA 3NF6A 1RT6A 4I2QB 4IBNA 3HPGA 3OYEA 4RW9B 4OKJA 1WSHA 5I3UB 1S6PA 5CYMB 4EP4A 4C8OA 3ICLA 2AQ4A 3PW5A 4MQ3A 2XY8A 1IKXB 1U48A 4OLBA 3M8PB 5KFOA 1BHLA 1NK7A 1JKHB 3CVKA 3MTKA 3IRXB 1RYSA 5L9XA 3NBPA 2JLEA 3T5LA 2ASDA 3L3VA 4ID5A 4WYWA 1W0HA 3OYFA 3V9UA 1TQLA 4U6PA 2J6UA 4FLUA 1VSHA 5KFIA 2C28A 4FJJA 2G8WA 2OPQA 2XI3A 1GOCA 1S48A 1ZBHA 3DLBA 2HAIA 4O44A 1HYZA 5JS1A 1XHXA 4KV8B 4DTOA 4NLOA 1C0UA 3MXMA 4CEFA 4I2PB 5F8NA 5KFDA 3GQCA 4BE2A 3OY9A 1VSFA 1D8YA 2YNFA 4J2DA 4AILC 3KOAA 4IFVB 3LP1A 2A1RA 1EX4A 2HNDA 2OPPA 2JGUA 3SI8A 2XRIA 4RNNA 2NUBA 3TAQA 4KSEB 3NFAA 4B9VA 1ZBUA 4O5BA 5L1LA 2OZSA 3CDEA 3AVAA 3K5MA 4DTSA 2KFZA 4DS4A 5F8GA 2XCAA 1C6VA 3DRPB 1L3VA 4J2EA 4FK0A 3C6TB 2AX0A 2W8KA 2IAJB 3BR9A 1VSMA 1JX4A 4KI6A 3D45A 3V9WA 2AJQA 1REVB 4KHMA 4Q0BA 3ITHB 2BE2A 4E0DA 4K8ZA 2A1SA 1RT2B 3AVMA 3TAPA 3ZSZA 4KB1A 1D9FA 2Z1IA 1ASUA 3N6MA 1C1BA 4ZTJA 3QZ7A 3T19A 2PYJA 3RTVA 4CF2A 5EUHA 4E7HA 4CEAA 4KPYA 3QEXA 1RDCA 4IFYB 2R2TA 3BREA 1ZYQA 4FK4A 4JV0A 4NLDA 4ECTA 4MFBB 4IH6A 1JLGA 1TAUA 2E9RX 1T3NA 3KNAA 4X2BA 3S9HA 4DSEA 4CJPA 3KK3A 3QINA 4IG3B 5F9LA 3CFRA 5DQGA 4ICLA 3KIOA 5KG5A 1B92A 3CM5A 1HNVB 1HQUA 4E19A 4DL6A 4QOZB 2BANB 5C42A 5DQHA 4EYIB 4DSJA 3KHRA 1U47A 3F9KA 1CXQA 3V1OA 5HLFA 3V6HA 4TY8B 3MR3A 4MK9A 4EBEA 4CHYA 2QKBA 1KLMB 1LWCA 4J9PA 2FVCA 2QV6A 4FXDA 1JLAB 4E1NA 4QW9A 3B6OA 3V1RA 3V1QA 3KLGA 3G6XA 5JS2A 4FZYA 5DG9A 3Q8SB 2BDPA 3KD1E 4KKOA 3WNGA 4NYFA 1DTTB 5E41A 3KLVA 4PUOB 2VG5A 1JLEB 4BWMA 3EZUA 4NLXA 2FBVA 4DEZA 4DQPA 3ZSOA 1UA0A 3NGDA 4OLAA 4URGA 4IFVA 1EETB 5KG7A 4TSXA 1RDRA 1RT1A 3ZSYA 1RTIB 2D7SA 1FKPB 4CHNA 1NK6A 4GC6A 2UVUA 3BSAA 3FFIB 3KLFA 4NCBA 1REVA 1SKRA 5KFCA 2X78A 1RYRA 4ED2A 2LSNA 4CF1A 2B6AA 1S4FA 2W9BA 3ZT0A 4FLXA 4K4XA 2OPQB 3OVNA 1CLQA 3I0SB 2BRKA 1NHVA 4DL5A 1QSYA 1TKDA 4GW6A 1KHVA 3OYGA 1RT2A 1I39A 4CECA 2D0CA 4DTRA 2B4JA 5L1KA 2KZMA 5KG4A 4KHRA 4QWBA 2IA6A 4KV8A 3LP1B 1A5XA 3KK2B 1SKSA 5CZ2A 1ZBLA 1JLCA 2R8GA 3HK2A 3E51A 4DF8A 3SFUA 4DSFA 4QPXA 1IG9A 4MKAA 3AV9A 3DMJA 1FKOA 3PJXA 1TL1A 4MK7A 3M9NB 2XY6A 1S10A 5L1IA 3BGRA 2AU0A 4W5NA 1ASWA 4GVMA 1EP4B 5EWEA 3FSIA 4O4GB 1EXQA 5C24B 1NKCA 4CFBA 2YNHB 4NLTA 4O0IA 2RPIA 1SH3A 4W5QA 5DG7A 4RW4A 3JYTA 5C42B 4B9MA 3KLFB 3NF9A 1I6JA 5EWGA 2DPJA 3K58A 1K6YA 2F8SA 1RTHA 3PR5B 4IDKA 4K4TA 1GX6A 1DTQB 2PYLA 4M3YA 3SQ4A 4ECUA 2W9CA 3L2RA 2G8VA 3AVCA 4O55A 2BQ3A 1WSJA 4IG0A 1NKEA 4OKKA 4Z4HA 2P5OA 3NGIA 4O3QA 3HHKA 3OS1A 1LW0B 4Z4IA 4MFBA 1C0TB 2KFNA 1U09A 4NRTA 1C1AA 3PVXA 4FW1A 4F4WA 4M3UA 5J2PB 1SH0A 4Z4GA 2HHQA 1S5JA 4CFDA 4FJ9A 1T03A 3UR0A 4IR9A 3K2PA 5KT2A 3C6UB 4EEYA 2WONA 1TL3B 1QSSA 4LSNA 3QZ8A 1T94A 4R8UB 3LWMA 5KFJA 4CJUA 1Z26A 5F8MA 1KFDA 3NAEA 2VA3A 3KK3B 3VQEA 1NK8A 3I0RA 3AO5A 4DF4A 2V4QA 1N56A 1JLGB 4ZVEA 1Z25A 4J9RA 3RB4A 4TLRA 4FBTA 2GUIA 4KE5A 1D1UA 1NOYA 4E7LA 1ITGA 3DRSB 5KG6A 3DRPA 1TL1B 1B9DA 1KTQA 5HROB 1N5YB 5K14B 1R0AB 4CHZA 4E1MA 5KG1A 3QLHA 1JLBA 1RBVA 1RDDA 3VQ4A 3SCXA 2HVHA 1BCOA 4JLHA 3E01B 4CJWA 5KG2A 1QE1A 4RZRA 2YNFB 3AA5X 3KK2A 2KTQA 4IRDA 5EWFA 4RW8A 4CJFA 3DLKB 2HHWA 3LP3A 2C2RA 3UPFA 2XGQA 5F8LA 4FLWA 2Y1JA 3HXMA 4FYDA 4DLGA 4B8CA 5KI6A 3TI0A 4RU9A 1S1UB 1HYSB 2P1JA 3BSCA 4H4OA 4AH9A 2R2UA 4LY7A 1X9WA 1TK8A 1RA6A 3L2UA 3HVRA 4OPKA 5KFAA 4IOBA 4F50A 3GV8B 5CYQA 4E7IA 1BL3A 3MECA 2HMIA 3F73A 4HCBA 4RNMA 3NGYA 4IKAA 2WK4A 4PY5A 4DTPA 2OYQA 2FLPA 1C0UB 2FVSA 1LWEB 5KFNA 2RKIA 4DQIA 2OPSA 3M8PA 5HP1A 5KG0A 2D0AA 3H59A 1TVRB 1J54A 3OYBA 1HARA 5KFEA 3SQ0A 2HW3A 1Y97A 2WONB 1BCMA 2I5JB 2WOMA 3FQKA 2O4IA 3S3MA 1KCFA 1T05A 3CFPA 4XPEA 3O3GA 4CK1A 3Q8QB 4KB7A 1S1XA 3MEDB 4ECVA 4LQ3A 3O4NA 1DTTA 3MFIA 1VRTA 3C94A 3JYTB 3OHBA 1T03B 3CJ4A 3LALA 3UIQA 3LAKA 3OYKA 3VQ8A 4ZP6A 4DSIA 1W9HA 4OJRA 4CGDA 1RT5B 1OS5A 5DK5A 3H40A 3VA0A 4ZP8A 4ELUA 3ZSRA 4DL3A 1CZ9A 4PQUA 2WB4A 4H54A 2VG7A 3VQCA 3OJUA 2FBTA 4CCHA 1RT6B 1HYVA 3QIPA 1S6QB 4B9UA 1DTQA 4M94A 1LWFB 2CKWA 1SH2A 3QEWA 4F3OA 2ASLA 3L8BA 2QXFA 4AHTA 5KRSA 5F8IA 4CEZA 3ZSVA 1K1QA 3RB6A 2IMWP 3CJ3A 5KFTA 1QE1B 1XWLA 4FJ7A 5JUMA 5JXSA 4K4VA 5J1EA 1J9AA 4WFXA 3RRHA 2ZD1B 2YNHA 3CO9A 4G3IA 4Z4EA 3MEGA 1RCHA 2WOMB 4WE1A 3MFHA 4DTMA 4O3NA 2JC1A 4EYHB 4HCCA 1TVRA 4Q0BB 1JLCB 1C1BB 3HL8A 3ZSQA 2R7YA 2PZSA 1NOZA 2AGPA 5FRNA 4KHUA 3MAQA 3OL9A 4KTQA 3ITHA 1XR5A 1GOBA 3PX4A 2FVRA 3NAIA 5KFFA 4B9SA 3M8QB 3MEGB 1CXUA 1RBUA 2YNGB 2HNYB 4FM1A 5J2NA 1JXBA 2WTFA 2B5JA 2UVWA 1JLBB 3PX6A 1JIHA 3PX0A 5F8JA 1WSGA 1N5YA 5K14A 1R0AA 4KREA 2IM3A 3QO9A 1T8EA 3QLHB 5HBMB 1O1WA 4QWAA 4FLTA 4DFPA 3M9MB 2E6MA 3AVBA 4CESA 4DU4A 4JS5A 4NYZA 1S1UA 3HJFA 3LP0A 4ZVHA 4FS2A 3HPHA 1Q8IA 2X74A 1S9EB 3DOKA 3V6KA 1J53A 1S1XB 3LDSA 2QK9A 3KJVA 1TK0A 1XI1A 1HMVB 4J9SA 2C2DA 5KFBA 3DRRA 4WYLA 2OZMA 5DLFA 4LSLA 4ECWA 3DM2A 4WE1B 4CGHA 3SV3A 1QSLA 4HVJA 4CFAA 1J5OB 3DLEA 4Q5VA 5KRTA 4KHSA 1QAJA 1U45A 4DQRA 3RMAA 1YVUA 3KTQA 4TQSA 3U6FA 2OA8A 3GV7B 1SV5B 2VA2A 3JSMA 2BANA 2DFHA 1D9DA 4CGJA 4J2BA 4FM0A 1NK0A 4CJRA 1NJWA 3K5NA 1C2PA 4DTJA 4TYBA 3NKYA 1QHTA 2R8KA 4N76A 4B9LA 3U3YA 5KFQA 5DQIA 5CYMA 4M95A 4FJMA 3OS0A 4FJXA 4J9LA 2KZZA 4K4UA 1ZETA 3M9OB 4DQQA 3PR4A 4AHVA 1YTAA 4ECXA 3DLGB 1KLNA 4IR1A 1RBTA 3M8RA 4KFBB 4L8RB 3DOLA 1RBSA 1TKZA 4YQWA 3DDKA 3L2WA 4HUGA 3RMCA 5KGXA 3VQBA 4CFCA 2AGQA 4FLYA 4JV2A 3KLIA 4DU3A 1T7PA 4CJLA 3BSOA 2ZE2A 1BQNA 1MU2A 4RNOA 2FVQA 4K4SA 2ZQBA 3TWHA 3CG7A 2YV0X 5CY4A 1IKYA 1J5OA 4ED8A 4NLGA 1T05B 4O3SA 3P5JA 5DLGA 2ATLA 4ELVA 4F4XA 1FK9B 4J9MA 4I7FB 3HKWA 1FKOB 1NNDA 3TAGA 3AVLA 1S1WA 4ZP7A 3MEEB 1UWBB 2HNZB 2DTUA 3KLHB 2C2EA 2V9WA 1KVAA 1N4LA 4TYAA 1JXEA 4CEBA 3CQ8A 4Q43A 4YR3A 4IRCA 4LH4A 4J9KA 2DPIA 3RRGA 3AVFA 4LQ9A 2WCXA 4TY9A 3I0SA 4TN2A 3ZT3A 3EY1A 4F4YA 2OPPB 3CDWA 2FJXA 4W5OA 4R5PB 4OL8A 2VWKA 4Z0UA 3VQSA 2WRMA 3A2FA 4NYNA 2R2SA 5KFLA 4B8AB 3EZ5A 2B5JB 4H4MA 3DLGA 2D5RA 4DFJA 1BQMA 1CZBA 3VQ5A 1IKXA
chains in the Genus database with same CATH superfamily
3H20A 1U6BA 2M5YA 4HYKA 3QRQA 2ZBIA 3HMJG 2DB1A 3O1WA 1F60B 3U3GA 3HSTB 1AA1B 1CJTB 4P6QA 2C42A 1RT7B 3BM7A 2UXDJ 4YDDB 5FROA 1YTYA 4PL8A 3OSPA 2VOPA 5HRSA 4CJ3A 3WNHA 2EXUA 1A5VA 4KKOB 2ZH1A 3H08A 4A61A 5KT7A 2KDOA 2WZ1A 2G8KA 2HLUA 1TKZB 3PM9A 4BS2A 2LXFA 3I4HX 4OHVA 2HIQA 3Q8PB 4BBYA 3VA3A 3V6DB 1X7VA 1MW7A 1VSJA 1RTHB 4KGKA 1JL1A 1WLJA 2GHVC 2XNQA 4NZ7A 1RTJB 2H3EB 1WB9A 4ZN3A 5HRNA 3UR3C 3LP2A 4CBUA 3D0HE 3O9RA 4LRAA 2R2RA 1VC0A 2XYGB 3ADAC 3JQMA 4FCYA 2W41A 4RLEA 1SC1B 2VBZA 4QWCA 4CJ4A 1BDGA 1NJZA 5IT0A 3BJYA 4MYTA 4RBVA 2R8JA 1QHAA 2FJWA 4CERA 5EN1A 3WNEA 4CO3A 1SV5A 3ENWA 2IGIA 5KFYA 1OMSA 4UY8T 1Q5VA 3SV4A 3QGGA 1RJJA 3TAFA 5KFPA 2ZC4A 2PIIA 5JLFA 5BXIA 3VQTA 4URQU 1TKTA 3Q8RB 3TJAA 1UPMB 2AP6A 1G15A 2XS2A 1K9MT 2B4PA 1AB8A 3RBXA 2FSJA 2MJUA 3GB0A 2IOCA 4U7CA 4JS4A 3N79A 3WXMB 2GMJA 4DFMA 4ZMMA 1SKUB 4YHHF 2Z8QA 4QJVA 1S72N 1PYSB 2D3UA 4OYPA 4JI2J 3K2YA 1RB0A 2JSXA 4FF3A 4U67Q 2P9NB 4R0JA 4I9QA 3ZEUB 4M3RA 1BQMB 3TAEA 5EHHA 4MO5A 2RIJA 1RGVA 3CYMA 3JS6A 2XWYA 1NGEA 2CQ3A 1IKWA 3FGUA 3PW2A 1SJFA 3FBFA 2C2NA 4F3TA 2YX7A 5CHIA 2CGKA 3TA1A 4CJVA 3C6TA 3SZ2A 3CETA 2J8AA 2ZH8A 4FBUA 4OYXA 4A48A 4NCAA 1LAVA 5FPDA 2AW0A 3ONQA 4B08A 1UJ5A 2NRWA 2E8AA 3A8IA 2QX0A 3ALYA 1KONA 2AEMA 3J80Y 4DX7A 4USTA 5DRKA 3MR6A 4XPCA 4PCQA 3NOCA 2OH2A 4OPJA 2DHXA 1HNWF 2G9OA 4NCGB 1S7HA 5B0DA 1RT3B 1NG9A 4ZPBA 3UDEA 1WC6A 1NDLA 1HBUA 4LREA 2F65A 1UFKA 4H0VB 3UD3P 3CJCA 4L3NA 4O5FA 5E2QA 3C6AA 1P1LA 3BGFA 2QJ3A 1TUYA 2UV8G 1ZA2B 1KQGB 4JI6J 4ZCMA 4RKUC 4M5JA 4CJKA 1VSKA 2GTDA 1OH6A 1CSJA 2XZWA 4EZ6A 1GK8A 5DZ6A 1S0NA 3SCKE 5EY4A 5GAEP 2DISA 3FBBA 4NMLA 3ZX2A 3M2VA 3KHLA 1VRQC 2BQRA 1VSLA 4DV3J 3ZZYA 2PI5A 2EFVA 4OZ2A 1TL5A 2V8HA 3D7SB 1HD1A 2KXFA 4C1NI 1SKWA 2NRXA 1DQAA 1BA1A 1NGIA 5IC6B 1TL7A 2VASA 4J8FA 5KFSA 5J2NB 1XQSC 1D0EA 3IC1A 4ID1A 1LV5A 2AYMA 2M2BA 2HB5A 3VESA 3NMRA 2W1BA 3CC7N 3QGPA 4ZN1A 4AFFA 4I6YA 2XO6A 2AJ2A 3CM6A 4QU6A 3ELHA 2R7OA 5IM0B 4DV6F 4U8YA 1VK3A 4RW6B 3FK4A 4NXNF 1S4EA 4ILLA 1OPZA 1XBWA 1TAQA 1PC4A 2JEFA 3K5LA 4Q45A 1VHXA 3G6ES 4JKGB 3CMAS 3AQOA 2GO9A 3DFEA 4L3KA 5KPZA 2O5DA 4CJSA 3MM7B 3UQSA 5BR9A 2C3YA 1GX5A 4FWOA 3HULA 3KJFB 4Y3CA 3I5AA 4G1QB 2VIHA 1XNQJ 4CK2A 3IG1A 4GV9A 4Y1DA 3ZT1A 3CD5A 2EW9A 2KO1A 4FJNA 4M5IA 3NMUA 5AQUA 1NSAA 2P5VA 1VC5A 1JLFB 1CJKA 2LLZA 1ZTWA 2X6SA 2H5JB 4FSVA 3J7YI 1N32K 3G82B 3DI6B 1XC9A 2IDOA 4M3WA 3CJ0A 3SUQA 3Q7CA 4CO5A 5HMWA 1RTIA 1MROA 4B3TF 2E1CA 4BR5A 5LMUF 2NXNA 4I0WA 2IC3A 2IBKA 4IO9Q 1VIXA 3I55N 2AJ0A 4L6V3 4JKDA 4DHYA 4HVZA 2FUG9 5FLXU 4F4AA 2UUAJ 1H38A 1HPZA 5IFMA 2OPRB 5LL6Z 4A8WA 3SUOA 4IKFA 3R97A 4H5WA 3B8HA 2ZKUA 3V6DA 2Y0BB 1WNEA 5B09A 1KKHA 4CEOA 4ETZA 3QPIA 3FEXB 4CHQA 4DKWA 4M42A 3AHPA 4ZVOB 1RAJA 5AQQA 3NS7B 1YITS 2HWTA 2I1RA 4BWJA 3V4IB 1PJ6A 5IXUA 5KFVA 2QWNA 4EP5A 5G4DA 1W97L 1VSEA 4OJHA 3ENVA 3AOAA 3CCMN 4RW7B 3NH1A 1FERA 1HI8A 1FRKA 2MY7A 1FF2A 2PDAA 3OFEA 1JCFA 4BRPA 2ACYA 3DLKA 4Q44A 1HI1A 2HHHJ 2QW9A 3QT6A 4U9RA 3MN9A 1UVMA 4K0KJ 1HJOA 5FIIA 2YVSA 2OTJS 4DI6A 3IAM9 4O4GA 4QW8A 1Y7PA 4MLHA 1MWYA 4FZZA 1HNWJ 3SPZA 1ZZNA 2FVPA 5DDOC 1RHQB 3VAFA 1FDDA 4KY3A 3KFWX 8RUCA 4MK8A 3DGVA 5THWA 2P9KB 3LDLA 4DMNA 4AL5A 3IM8A 1P9YA 4P52A 1U1NA 4OYAA 1UOCA 3ATUA 1K47A 2BM0A 4CP5A 1G3OA 5CZVA 5GMEA 4BE0A 1TV6B 2CVEA 1S1VA 1LKZA 4FJIA 1N32J 1MMDA 5BPMA 3B54A 1RT1B 1S97A 2QLXA 1MU2B 2ZH7A 1WN7A 1A7GE 1RZMA 3JSBA 4RUAA 4OX9K 1PBUA 2EX3A 2HNDB 3A8EA 2GHWA 5KT3A 5D0RA 1N36K 4U7BA 2G2ZA 3O1LA 2GBZA 4JAXA 3Q7BA 2P8IA 3RMDA 2ASMA 1WF2A 3NE6A 3T1HK 3NS6A 3POTA 3DLRA 1LQ9A 3DAWA 3L95X 4PQUB 4F0KA 4FJHA 4ZITA 2JEIA 1VRUA 4QIEA 4ZCIA 4KO0B 2XMVA 4KI4A 2Z30B 4KGZB 5D77A 4FWMA 2YWEA 2MGZB 4Z4CA 1LNQA 5BN8A 3I5BA 2AV5A 3HTVA 2E5HA 2I7PA 2PFDA 1X5SA 5KFWA 4I6MB 3B78A 4O0JA 4BDPA 5H9FJ 2E9ZA 3LF0A 4BRMA 2W6KA 1FRJA 3EVMA 2GIRA 4L74A 2E2QA 2CPJA 1WSEA 1Q9YA 1HWIA 2YWGA 1QQNA 2HQGA 4WQ5C 1XUPO 1N6QA 1SVDA 3WQTA 2XS7A 2A6AA 2GIFA 1GTEA 2HFZA 3W9HA 2X3DA 3BBCA 3W63A 1JB0C 2V2ZA 2O8BB 1Q7YT 3BKTA 4Q8EA 3QEPA 4CJTA 5AQIA 1RWNB 4BHQA 2ZOFA 5AE1A 2G0JA 5KOXA 2ZH9A 4C11A 4JI6F 1IUJA 2GMHA 4KJIA 1ITPA 2H5IB 4FJKA 1B7YB 2CJQA 2DNGA 3T1YF 3D28A 1F9FA 2GJIA 3KJQB 4M5KA 3J7ZO 2IVPA 2GC8A 4DCHA 4HI2A 3QIDA 3RBEA 3DRRB 2RNEA 2V94A 4LF8F 3MXJA 2CQ1A 2ALZA 3H98A 5M2UA 3KG1A 4C3KA 5AXLA 3W2WB 5AXKA 4A8XA 1WELA 3E2EA 1REGX 4LBIA 3M2UB 3QT5A 3QRPA 4FLVA 3KMSA 5HK4A 3GJQB 4MLEA 1IBLK 3D2FA 4ZJOA 1F5CA 4ZS6A 3G86A 3B82A 3S1TA 2ZE2B 3CCUN 1YZ7A 3FNNA 3J81O 4MH8A 3WIVA 5LJ3Y 4CE9A 1YJNS 3PSIA 3MXIA 1PG5B 2K3KA 5M2RA 2YPZA 1BU6O 3J80U 5KFKA 3GIKA 4ISGA 4NLWA 4OFZA 2BZ2A 2ATQA 4USWA 3DOLB 4PEOA 2W2QP 3QNOA 3X3UA 5AZIB 3AQPA 2XLJA 3CJBA 1VQPN 3GIIA 4ISEA 4RW9A 3SJJA 3HI0A 3ZT4A 2HWHA 5A8WB 1KVKA 5AZJB 2FYXA 2DXFA 2QRRA 3AAWB 3OHAA 3AO1A 2O8EA 4H0OA 2WW4A 3C15A 4IRKA 2XTJP 1RAGB 3G6YA 4K4YA 2Q2RA 2FQQB 1S79A 3S41A 4GV6A 3VMFB 4NL5A 5CH7B 1FJ7A 5C2FA 3MCOA 4L76A 4JI8J 4MIBA 1J27A 3CJAA 2KRBA 1BWFO 2LQBA 1UZHA 2EC2A 4M3ZA 5CA5A 3MF5A 4EMDA 1SIWB 4DSKA 2MQLA 5J2PA 5HQLA 1RLCL 1ZS6A 4KHPF 3G2XA 3V2UC 2VODA 5J1NA 1A0OB 4FVMA 1DAXA 3AO2A 2CXEA 4V19J 1X3NA 2E5GA 3ZSWA 3EN9A 4LF5F 1VJWA 5A0YA 2ASJA 4DV5K 1VCTA 4KHYA 2Q97A 3PHEA 3NF7A 2E7WA 4DTXA 3PW7A 4Z4FA 3T9NA 4N47A 5HL7L 1ZH5A 2DHHA 3R8YA 2FJEB 1UA1A 4ZTFA 3PCOB 4KRFA 2DNLA 1OYEA 2OMLA 3CERA 1IKVA 3B6PA 4NXNJ 2RF2A 1NCLA 3PFOA 3TVKA 4EHTA 1W2BR 5FLXO 4DPUA 4YEAA 2CJXB 4B02A 5C2GA 5KFHA 2DRBA 4IH5A 1KR4A 4O4RA 2MKKA 5SZTA 1Y10A 3UKUA 3M2UA 4E89A 5IWAF 1YJVA 1IBMK 3GZ7A 2RRAA 2HRTA 3LWLA 3T7ZA 3LTOA 1W7AA 3PXGa 3SQ1A 1FFWB 2B8PA 5LJVA 2JRSA 1KFSA 3DNCA 3VGVA 3C14A 4Q7AA 3I8DA 4IEEA 3K7RA 3HX9A 3BO4A 3OSNA 4CZHA 1NGHA 4CGIA 3LL3A 4GKKJ 5AQZA 2KB2A 4CEDA 2XHBA 4CLTA 1HBNA 4IOCL 3LZIA 4N5SA 3SI6A 3MMAA 3AVIA 2ZH3A 3H6EA 3OYEA 5B0EA 3AAPA 2F7VA 3PEJA 5I3UB 1S6PA 4EP4A 4C8OA 3HBTA 4BQLA 2C2MB 3ICLA 1Y11A 4WKYA 3NS5A 1U48A 4OLBA 3G9CA 2HG4A 3WXIA 3CVKA 3MTKA 4I6AA 1RYSA 4LR8A 2ASDA 4ID5A 2PBDA 4CLSA 2QWOA 2NZ4A 4E8UA 4JHDB 4DR7J 4U6PA 1X0PA 1VYAA 4FLUA 5KFIA 3E66A 2N3LA 2H51B 3FSXA 1GOCA 3FMWA 2MHNA 1ZBHA 4DV3K 3KVGA 1Q0NA 2P9SB 1RAIB 2ZJRQ 2HAIA 3U9DA 4LIRA 5C2CA 5CR4A 2P9IA 2IA0A 4BQZA 5JS1A 5KFDA 4DCPB 3GQCA 3OY9A 1D8YA 1VQ9N 4J2DA 4AILC 2OIHA 1NU0A 2NZTA 3LP1A 3J7A1 2FHKA 4CH1A 3F2KA 1EX4A 4W4MA 1HLWA 2HNDA 2OPPA 1H0HB 3QBXA 2QWRA 4A47A 1AZSB 3TWZA 1U0HA 4ANDA 1ZBUA 2GA7A 5L1LA 2FSKA 5BPLA 4DTSA 3H45C 3CW2C 2OP5A 5GAHI 4J2EA 2ADBA 2F40A 3VEVA 2J0XA 4DV0K 2JWKA 2N4CA 4I64A 3A0IX 3V9WA 2ZUGA 1REVB 3ITHB 2GGPA 2A1SA 3IWXA 3O1BA 2V9KA 4KB1A 5A0YB 1C1BA 4ZTJA 1FI4A 4C0HA 1AUSL 2RUGA 1BY9A 2YJFA 4DR4J 2PYJA 4CF2A 4CEAA 2N7YA 3BO3A 3RGIA 2VUGA 2R2TA 1ZYQA 3PTWA 5JVHQ 4JV0A 4DXLA 4MFBB 2MDAA 4YB6A 4X64K 2EFNA 2NRTA 4M5HA 3S9HA 4Y00A 4CJPA 3QINA 5EX5A 4IG3B 5F3ZA 3QBWA 3KIOA 3QATA 1B92A 2CIMA 1HNVB 2IYGA 5IQQA 1R0BG 4NEYA 4DL6A 4NXNK 1NPPA 2BANB 5DQHA 1UVKA 2XZDB 5A2QU 4DSJA 1YG0A 3KHRA 3V1OA 1CXQA 5HLFA 3V6HA 4N8OA 2XMKA 4CHYA 1LWCA 1ZM9A 1VQ6N 1JLAB 4E1NA 1WEYA 3B6OA 3FC9A 3V1QA 3G6XA 4TVAB 5JS2A 4FZYA 1IVZA 2BDPA 3KLVA 2GX9A 4PUOB 2HLTA 4BWMA 3EZUA 4GVBB 4NLXA 3VF2A 3NWRA 3EUNA 1FNOA 2CWXA 3BH7B 1EETB 3Q23A 2XB2D 3QFUA 3MM6A 1FKPB 1T9UA 2UVUA 1S59A 5AQKA 3BSAA 3KLFA 2WBNA 4JK7A 2J9DA 1F2HA 2ZH6A 5EXWA 3W9IA 2DNMA 1SIZA 3TA0A 4DV5J 4DOZA 2WVBA 3ZT0A 4FLXA 4YN3B 2W2OP 2KH9A 3OVNA 1P8GA 3I0SB 1V6HA 3QBCA 1QSYA 4GW6A 4X84A 2X3GA 2DR5A 1RT2A 4FWQA 1RABB 4GO7X 5AJ3F 4ZA1A 5L1KA 2B4JA 1NGBA 2B0GA 2DGTA 1VQMS 2QN6B 4KV8A 1OQ3A 3O8WA 4ZVSB 3HSCA 1SKSA 1JLCA 2R8GA 2NXCA 4DV0J 4P73A 4GKJF 4WQ5A 2HQDA 3MAAA 3G8SA 3AB2B 3M9NB 1S10A 1N8RT 2IVYA 2MQOA 2K7JA 4K25A 3O9UA 5C24B 1NKCA 4DV2F 4DX6A 3N9UC 2CNOB 3HD2A 2RPIA 1SH3A 4QIGA 2HFOA 1GAOA 1P27B 2OHDA 4WBFA 2V8PA 3D68A 1RXOB 3C14B 2B4OA 2BJ7A 1ATSA 1NH8A 4PYDA 2W40A 2F8SA 3M1VA 1CJUA 3PR5B 4IDKA 3HF5A 5CHCB 4K5RA 5JVGL 1TELA 4JYAF 3SQ4A 5AQVA 4BR4A 1QVFR 1RWXB 2BJ3A 2BQ3A 1HW9A 3HZ6A 5GVQA 3VGMA 2VQFK 3MPUB 4I6MA 3M8ZA 3KUHA 2OKQA 3R27A 3OS1A 4Z4IA 2KFNA 4NRTA 2W4PA 4LF9F 4C1NK 2I0XA 1NM1A 1YRXA 5J2PB 3GBTA 1S5JA 4DUYK 1IR1A 1BD6A 3UR0A 2J8SA 4IR9A 1TUWA 5LJ5Y 4CT9A 4LSNA 2O8EB 4F02A 3LWMA 1HHQA 2CYYA 5KFJA 2H4WB 2GQCA 3VAHA 2MB0B 1ZZFA 2H9ZA 2HBYB 3EKSA 3THWB 4KGMA 1JLGB 2BEFA 1N56A 1MN7A 1Z25A 4FBTA 4QIWD 2AMCB 1ZA1B 2CPFA 4HWIA 1VQON 4ZK7M 4HHJA 1B9DA 2Q31A 5HROB 1N5YB 4O8KA 5T41A 3KKFA 3F0NA 5KG1A 1RDDA 1RBVA 3SCXA 3E01B 1NHKL 1QE1A 4ZPVR 3SBMA 3KK2A 2KTQA 4IRDA 4RW8A 2UU9K 2DNKA 3UWTA 2XG8A 3EGVA 3UPFA 1SB6A 2NXUA 4FYDA 4KGVB 4LBHA 2E2OA 3PIOL 2E1RA 1PCAA 1X9WA 1HNXF 1TK8A 2AJ4A 3SAFA 5AQYA 4K41A 3BKFA 4CZEA 3CPWM 5LT5A 3CCVS 1RFQA 1V4SA 4HCBA 6AT1B 1HUXA 3D7EO 4IKAA 4C8YA 3SBTA 2WK4A 3CIPA 2FZGB 3SQGB 2BW7A 1DEJA 2UUAF 3U02A 5KFNA 3AY0A 2DGQA 2A42A 1UL3A 3WC0A 1YI2N 1J54A 1NZ8A 1SC3B 1Y97A 2MQ8A 2NSBA 5B0CA 2ZM6K 4CO4A 3CSKA 3M6GA 3CFPA 1R8CA 3GYXB 3MEDB 5E26A 2R4FA 1VRTA 2A41A 3ID6A 4MKVA 1R8BA 5MAOA 2HEKA 3RRKA 1YITN 3VQ8A 4DR1J 2ZH2A 4WP9A 4V19X 1AFJA 4W92B 4ELUA 2CFXA 3R5GA 1M1KT 2LEAA 2LQ5A 3VQCA 1HYVA 3QIPA 1S6QB 3BZQA 2CKWA 5A2QY 1HNZK 2ASLA 3THYB 1HWJA 2NSCA 1EB0A 2QXFA 4AHTA 3NNCA 3Q89A 5ADXH 2XMJA 2ZWPA 2V67A 3GP9A 5KFTA 2ZHBA 2GV1A 2BMBA 1XWLA 5JUMA 1IJFB 3RRHA 2A2CA 2VCPA 2YNHA 4WE1A 1GMWD 4K5SA 2JC1A 4ZJQA 4HCCA 3G71S 1JLCB 1RBLA 2PZSA 1NOZA 3MD3A 3O5TB 5E7OB 4JNEA 1N54B 3ITHA 2GGPB 5AZIA 3ATVA 1F0XA 3PX4A 4B9SA 4A8OA 2HNYB 5J2NA 4BROA 1BA0A 2RILA 1YF5L 2UVWA 3H3OB 4NXMK 1K0TA 1RAAB 2OEKA 1CULB 3THPA 3BPSP 5E3RA 2YX1A 2G2OA 2RU9A 3AVBA 4CESA 2OJ3A 4JS5A 4NYZA 3D2EB 3LP0A 1WD6A 4FS2A 4CLUA 3HHLC 4Y65A 1Q8IA 3L09A 3VZIA 3R6LB 3V6KA 1NDPA 1E6YA 2JFDA 3TA2A 1TK0A 3CB4A 2C2DA 2PC6A 4Y6IA 2HRUA 2VPWB 4HACA 1ATRA 4CFAA 3DLEA 4ZVQB 1HBUB 5KRTA 2E44A 4PKHA 1U1LA 1Q79A 4OHWA 1YVUA 4JKHA 2VV5A 3F5TA 4O8UA 2GELA 2BANA 3SQOP 3DXKB 3W2VA 2GMLA 4XEIA 1PYTA 3K5NA 4DTJA 3NKYA 1QHTA 4N76A 4B9LA 2FSNA 4M95A 3VV2B 3OS0A 4FJMA 4J9LA 4Z37A 4K4UA 2R3VA 4DQQA 2EK1A 2IYIA 3DXMB 4HDGA 1MROB 4NASA 1KLNA 4FPAA 4KFBB 4H03B 3DOLA 4CH7A 1ZXOA 1J6ZA 5D4PA 3L2WA 1H73A 4DPYA 4IOAQ 3K9KA 4CFCA 2AEFA 2AGQA 1YGYA 3P5TL 4PXBA 1VQSA 1OVQA 1X31C 4CLPA 4D3GA 4OYIA 1S99A 3CG7A 5CY4A 3KYLA 1IKYA 4ED8A 2IIHA 3HSDA 4BRNA 3Q8VA 1FK9B 1FKOB 2CDQA 2VL1A 4Y0FA 3TAGA 1S1WA 1UWBB 5GAEU 3NNHA 3ENAA 1KVAA 3EX7B 1HBOA 3CQ8A 4CEBA 1RAOA 4LH4A 1VQ5N 2YH1A 3AVFA 4LQ9A 1O13A 4TY9A 3EY1A 3EVOA 2IDEA 4A5BA 1FJCA 4LFAF 2OPPB 2ZITA 3A8YA 4GO5X 4Z0UA 2WRMA 5BREA 4J9UE 2N7CA 5BYRA 3CMQA 2NPIA 2YQ3A 1GLCG 4B8AB 3DLGA 5HO4A 1FDNA 1CBKA 1IKXA 2F8TA 3KDNA 5LY3A 4IG0B 1YJNN 1HHTP 2WBRA 2FLOA 4ENOA 3H2VE 2UYTA 4CRJA 4ZPCA 2H48B 4ISFA 2IS3A 1RSCA 4K4WA 3DOMB 4NLSA 3RU0A 4BRKA 4OKEA 4FL9A 3WX8A 1C0TA 3P83D 2BJ1A 1A6LA 2J0WA 4LF6K 2Z2ZA 3M2VB 5T14A 4CBWA 4GKJJ 1CG2A 4ECRA 3HOSA 5SWMA 3IR5B 1DARA 4KFBA 3W60A 2OGUA 2E1ZA 4CHOA 3IRXA 3HVTB 4LFCF 2M4MA 5D0EA 2ETJA 4ZDNA 4GMKA 4ILRA 3SXLA 3CPWR 1VK0A 5CYJA 3K57A 3I56N 2QA4G 3SSSA 3OYCA 2OEMA 2HBQB 4LVOP 3MMAB 1M5PC 2IM0A 1HNVA 3DI6A 4B1ZA 1YJUA 3BS9A 5AQRA 4DPTA 4B9NA 2OSQA 2MQPA 4DV5F 4ILJA 2CQHA 2PO4A 5LMNF 3EE3A 1IBMF 4Q2MA 4OZLA 4ZVGA 1HWKA 3CJ8A 4PL7A 1NBWA 3RWUA 2C2ZB 2Y1IA 1AFIA 4ZIVA 4Z7CA 3WQUA 5KFZA 1B7FA 4OYBA 3QT8A 2GVDB 2CVIA 3KHYA 4IFYA 4AXJA 3KHGA 4IDKB 5HP1B 3SLCA 3EGWB 3CD0A 4HTIA 2GWJA 3QMLA 5ITHA 3RBDA 5JMNA 4LF7J 2E4LA 1S9GB 4Q8FA 1NK4A 1UFLA 1FT8A 2ABYA 3W2WA 2M0GB 3O4QA 3KDOA 2V8VA 5HMZA 2KN4A 3P6YC 3FZKA 3E01A 1XMOJ 1FTCA 3PZPA 3TJ8A 1FA0A 4WXOA 1JL2A 1U0SA 2D41A 2HQCA 4BRIA 5AT1B 1R3NA 1UAXA 1NDKA 3N6LA 3D1QA 2P6TA 5D0HA 2BA9A 1PIEA 4UT4A 1U2CA 3CCJN 2QWLA 4EUVA 2YKMB 3L3UA 2KXHA 4C3MA 3IR7B 3MR5A 4ES3A 4F2SA 3LH2S 2IVOA 5FPMA 3L7OA 4ANCA 2DGUA 3NBPB 1XK8A 2P9EA 4H4OB 3SYZA 1CS4A 4AD6A 5KFMA 5AQLA 1LWFA 1TKXB 3M2RB 2DGXA 1EKRA 2W2MP 2ERRA 3VQPA 4NOHA 4WQ4A 4JI3J 3HHEA 5CZ1A 1GLFO 4DQ8A 5K9FA 1Q8BA 1SUQA 2H54B 2R7RA 1N6QB 3QDKA 3GIMA 1LW2A 3U9ZA 4ZLJA 4XO0A 4FWPA 2PEBA 2VG5B 3TEHB 1GMWA 4NXMJ 1S76D 2PT0A 4TY8A 3KK1B 3R1XA 3NAHA 2FC8A 5F8HA 3T69A 3D6FB 2YWWA 1SQFA 2IY5B 1N5VA 4MJKA 1ASVA 2CDRB 2RVJA 3PRVA 4DFKA 4C6AA 5KAKA 1H98A 3JTPA 3VEOA 1S6QA 3QIPB 1RWOB 5IWAK 4USHA 2RKIB 1X9MA 4ICLB 2XI2A 4WWSA 1FDBA 1ZAWA 4JI3K 3D6MB 3P31A 4PWDB 2DR6A 3OYIA 3OYJA 1SL2A 4CLZA 2QTWA 4IEIA 4CTAB 4A59A 3G8TA 1VBZA 2GNKA 3HP6A 2J4RA 2ADCA 3HM9A 3PHTA 4E7KA 1SJ1A 2L48A 1K8AT 3JTNA 1RHRB 4YFUA 2IC3B 1MWQA 1QVGR 2UUCJ 2UUBF 2LECA 4B17A 2G0CA 4K0KF 1Z05A 4CQ1A 2BE9B 3TUJC 1RAEB 3R9LA 3A8KA 2OELA 4WIQA 2CJ9A 5IC4B 4F2RA 4ELTA 2R42A 2XGPA 1VQ9S 1TKXA 2IVMA 4CIGA 4KAZA 1KDNA 3BO2A 2XY7A 2E1MC 1G1XA 4E3SA 3GYNA 3MPDA 2P2CB 3I4PA 4IJAA 1WC0A 4EO8A 1Q9XA 4AQYF 5DM6L 1NJIO 1FXLA 1WEXA 4JUZA 3MM7A 5DG8A 4C8MA 2UXBK 5M1FA 5TKWA 4FN5A 1FXXA 2EI5A 1JLQB 3C7NA 3NY0A 3V6JA 1WG4A 3UN3A 2YHAA 3THYA 4R0EA 4OZ5A 2RHQB 2BGGA 1NGAA 4QCLA 4B3OB 3OR1B 1S0OA 5CAAA 3I9V9 1X60A 1OJ4A 3RAQA 1W2BM 4ED4A 5MLCV 4WYBA 2QKKA 4LF6J 1VBKA 2Q3SA 4OZJA 3H2LA 1C0FA 3AH6A 2XLIA 2G4BA 4C4WA 1NMNA 4ECSA 3NGRA 1QTMA 1NZAA 2DNZA 1ATNA 4JV5J 4ITSA 4YDUC 5ETMA 4G65A 3V81A 5I3UA 3WNFA 4Y28C 3OLBA 2YHXA 1WC3A 4N41A 1SCJB 3MPVA 2HHHF 3UFCX 4ZLPA 2NQPA 1RWKB 5KFRA 1VQ7N 3GFXA 4NCGA 2NXJA 3JSMB 5CABA 1KLMA 3CCQN 1OY6A 3OYMA 4ZPDA 1EP4A 3AVJA 3H8YA 3OJSA 2KVQE 3J80O 3OTDA 4FS1A 2QYCA 1WTFA 4FF1A 2QG9B 4TQRA 2RT3A 4DR2F 5IT9U 2OPSB 4H8KA 3OL8A 3PRBA 1EZZB 3WXKA 4BRGA 4CZLA 2F63A 4ED3A 1FVSA 1GOAA 4KHPK 3M32A 4JI2F 1S6PB 1TGOA 4BCAA 4I6WA 2CQIA 1VSIA 4QIFA 3J7Z5 4B3MJ 3HO1A 3NCRA 1UVJA 2HGMA 3MECB 4B3OA 3G82A 2AP1A 4A8MP 4DV1K 4L75A 3ISZA 2ILZA 4AQYJ 3U1NA 2XY5A 4WFNL 3K59A 4H4MB 1N0VC 3BPDA 5ETQA 4NLYA 1NJXA 3H5SA 5D4LA 3EZOA 2DGWA 4KPCA 2UXDK 4F4KA 1EHWA 1XMQJ 1V3ZA 1FCAA 3OVSA 2OTJN 5A8KA 4UW2A 2GIQA 4X64J 3I0RB 4LSZB 3E8OA 1GLDG 1E4GT 5AFUH 2UUCF 3UKUB 1BGXT 3TRGA 3BQ1A 5FLXY 2AX1A 3VQ9A 1BQNB 5KFXA 1TL3A 4DV2J 1EWQA 4DL2A 2IM2A 1OY9A 4AHSA 3DWLA 3DKDA 2G8FA 4YOUA 5KGWA 1XNRK 3AJDA 1VI7A 1QLNA 2XM3A 4PR6A 4PXEA 4AL7A 3CMEN 1I3AA 3QFWA 3RR7A 1ZBIA 3N5FA 3PO5A 1NEEA 3HT3A 3KKSA 4FOEA 1HPZB 4NXMF 4DN0A 2HVEA 3TX8A 5D3GB 2CPIA 1S1TA 4C98A 3FZLA 4CJEA 3KLEA 1IM4A 3V9ZA 2XCPA 2W8LA 5D78A 4J37A 4H0XB 1P1TA 3MURP 4P7TA 1RTJA 5HATA 2A10A 2GV9A 5I42B 2A40A 4CF8A 3OW2M 1UTAA 3HHLA 2QLBB 4L72B 2GW8A 4N56A 3E9PA 4WP3A 4E2FB 1WOSA 2V69A 5GMDA 2OD6A 2KT3A 3T41A 3MCPA 2OTLS 2VBYA 3SPYA 3O3HA 4XIUA 5ETOA 5DGAA 2JEGA 2HOEA 2YXLA 1U1QA 4HHUA 5E3CA 1LW2B 4DDFA 1RU1A 4OI1A 3C16A 4AQYK 1HR0J 2PMZD 2ITGA 1DZ5A 3BQ2A 3G96A 1Z4UA 3CFOA 3IG1B 3VGLA 1RLDA 2HK2A 2ZBCA 2LCWA 3QERA 1BHNA 4QS9A 4O3RA 3O8MA 3DMJB 2QGFB 1CJVB 1K73O 1M5OC 1BIUA 3TQ1A 5J2QB 1GLLO 2YHBA 4P9SA 2XSJA 1OIAA 2B6AB 5SUHA 4FM2A 2GX8A 1NJIT 3KJVB 3Q86A 5C12A 1Y5NB 3H1QA 3GE9A 2JEJA 1RAFB 3GSIA 1NKBA 2C3MA 5A8KB 3P1GA 2H4YB 2F8MA 1CLFA 2LU2A 4WFYA 1U2FA 1L5UA 2NREA 1OPIA 2VPYB 1Q82O 2BUNA 5F9NA 3PYGA 2RD5C 3UDLA 3IS9B 2YHYA 3C66A 2BR0A 4FJLA 2W7OA 4NRUA 4BREA 1P9QC 4BC3A 2XMWA 1NMDA 1UJ4A 3NH0A 1U8WA 5KT5A 3J7YU 2MEWA 1V9OA 4I7FA 1G6BA 2BW2A 3L7UA 2AHOB 3IA0A 4IOCQ 4KTWA 3C6UA 3DDNA 2UUTA 4C8NA 5BRHA 1Z6RA 2V2VA 2O01C 2JHEA 1PC5A 1B9FA 5M1KA 4RNFA 2K1RB 3CC7S 1HJRA 1RADB 4OJGA 3JXUA 3TANA 3EJMA 3VQDA 1J2VA 4YDXA 2CJAA 1N34J 5ETKA 4J9VA 2G13A 4TU9A 4CEEA 2W9CB 2CNKB 3MOZA 1LWCB 1Y64A 1Q81T 1HQEA 3KLEB 5F0WA 2GQ2A 3DM2B 3SUPA 1IBLF 2R8HA 4FJ8A 3TPQA 2L9NA 1ZPWX 4Y2AA 3PYFA 3AVNA 1QZ5A 1OH7A 3I6PA 2P51A 3SIPB 2WUSA 1RHMB 3B4DA 3K89A 1RILA 3RB3A 1NK9A 1NDCA 4F0HA 4YORA 2EHGA 5BYQA 2XNRA 2VC1A 3OS2A 2ZJRL 3CJ7A 4BR0A 4CJ5A 1QQMA 3D67A 2E5LF 4DG1B 1N88A 3VGSA 2X1FA 4ZPAA 4JKFA 4YOYA 1MA9B 2A2DA 2JLGA 3UDCA 1BIZA 4YR2A 2YI1A 4M8LA 3CCQS 3OYAA 3AVGA 4A62A 4CLKA 2GZOA 4C97A 1YJ7A 4DUYJ 4CIEA 2HNZA 3NG8A 1F5BA 2R7TA 1YVFA 1HMVA 3IBCB 3W5XA 4E7JA 4IYQA 3VCDA 2F96A 4PKIA 4E1JA 3BDEA 3JB9k 1JMTA 1F5AA 5E84A 3VTIA 2YH0A 5DM7Q 2V8GA 3GR1A 4KBOA 1URNA 1C4AA 4UZCA 2N82B 3ETOA 1R43A 4QS7A 2R7VA 1VQ4N 1S49A 1H6KX 1WC4A 3UD5A 3PJWA 3AA4A 5GIOA 1YJWN 3RVCA 2W7AA 1YX2A 3TAMB 1NH7A 1X9JA 4UF4A 1C0MA 5KFUA 3FCHA 3FVYA 4OYWA 2MZRA 3IBWA 4B3RJ 1X4BA 3WT0A 2R8IA 1RCOB 3IR6B 4DQSA 4WKRA 4LF2A 2HBZB 2ROEA 4LRDA 4KC5A 2MQNA 2EEYA 1Q78A 1WHWA 4NLUA 4BRQA 4Y34A 1UEKA 3H5XA 2P6SA 3W66A 3ZSXA 3US5A 1RUSA 3NF6A 2KLAA 3HPGA 4K7QA 4OKJA 1WOOA 4LR9A 2UV8A 3CJ1A 5CYMB 2RMLA 1EKSA 1DKGD 3MTJA 4UY85 1Q4RA 1I5OB 1N32F 4X4SA 4H5RA 4MQ3A 5T7LB 2XY8A 3HHLB 3M8PB 2VBXA 1VQ7S 1NK7A 1M5KC 2RE2A 4DR6F 1XJWB 4HLBA 3DLLQ 5B0BA 5ETVA 3GFYA 2NUUG 1TTHB 2JLEA 2ZF5O 1G2EA 4WYWA 5K8OA 1W0HA 4LF7K 1FJGK 1TQLA 2OMOA 5ELZA 4USVA 4OLPA 1VSHA 2C28A 4KHPJ 3J7ZT 3VALA 2BXJA 3TUZC 2P9LA 2Z0GA 4B3RF 3HSGA 3VAJA 5IOLA 1FJGJ 2ROPA 1XHXA 2F8HA 4DTOA 1SJ3P 4LF4F 3HJVA 4BE2A 3PLAA 2YNFA 3WIUA 1YXQA 2XULA 2RQ4A 4HH1A 4OX8A 2KJWA 3TZWA 3HFZB 4GVLA 2MZJA 4RNNA 2LXIA 5AE3A 2NUBA 2QI2A 4KSEB 1VISA 4O5BA 2OZSA 4JB8B 2KFZA 3O5BA 3MMBA 4DR1F 1FD2A 4HH0A 4LUBA 3DRPB 1C6VA 1L3VA 1LFPA 1NBEB 3CD6N 5HQ8A 1YBUA 2IAJB 2AYEA 4EHUA 3C16B 1PAUB 2CQGA 3TVZA 4NMXA 3NVMA 2BE2A 2QLJB 3GG4A 3TSPA 3AVMA 2KM8C 3GE1A 3OTBA 3IMQJ 3ZSZA 4BRLA 1D9FA 3FEZA 2WVEA 2Z1IA 4A46A 1ASUA 5BN9A 3N6MA 3FE1A 4BC4A 1TR0A 4OYMA 4IDHA 3CCEN 3QZ7A 3T19A 4B3RK 3IRWP 2HS3A 2CRLA 2OUGA 1T6CA 1SAZA 2IRXA 4XH4A 1IBLJ 5IS2A 4ILHA 3IM9A 3BREA 2Y8WA 3NP5A 3KWIA 2CG4A 2F9DA 1JLGA 2E9RX 4I1TA 4X2BA 4H5TA 4DSEA 4P7VA 3M32B 4H4KA 1H3DA 1GLJO 2UXBJ 2EFPA 5GADU 3CCSS 3GLJA 2OFHX 4CLYA 1SBRA 1NGCA 2F4VK 5C42A 2QL9B 3EWGA 2O8CA 1YHQN 4XDDA 1WBDA 5JJBA 1DY3A 5FPEA 2UXBF 3F9KA 3U7JA 4WFBL 3MR3A 1L3KA 4RR5A 3MM9A 4XK8C 1RDWX 1KLMB 2NXEA 1TYQB 4J9PA 2L3MA 1F3FA 3RZAA 1JJ4A 2DGOA 4AUKA 1KBRA 4OYZA 3WNGA 5M2PA 2VG5A 3D6RA 2FBVA 3C3LA 2AYBA 3NGDA 1YAGA 3SAGA 3K0JA 4LF4J 4URGA 4RTFD 4IFVA 2J9EA 1M5SA 5KG7A 1RDRA 1RT1A 3ZSYA 2D7SA 4CHNA 3VF4A 3SEOA 1UP1A 1SKRA 2DO0A 2AJFE 3ET6A 2X78A 3LO3A 3TZZA 2B6AA 1YLXA 5H9FK 1UAWA 4GKKK 1S4FA 4K4XA 4H5VA 1TZ0A 4NI2B 4U7UK 2OPQB 1U1RA 3H46O 4JKCA 2BRKA 1HKGA 4DTRA 2HBJA 4EFHA 1EO1A 5HMYA 4KRWA 3LP1B 2HVDA 2ZM6F 1A5XA 3KK2B 2XSJB 5CZ2A 4G9ZA 4M5GA 2BM1A 5LXYA 2W6LA 1AUDA 4ZVUB 4S0MA 4DF8A 4QPXA 2IVFB 2MXYA 5B8HA 4CLFA 3DMJA 1FKOA 4MK7A 3A8JA 3MMBB 2VQEF 3BGRA 1MMNA 5E5NA 2B7BB 1ASWA 1D3WA 2DRDA 3P3DA 1EP4B 4F67A 4O4GB 3MMCA 1FX4A 1IWGA 1C4CA 3H7HB 2AT1B 4W5QA 4OJ3A 5DDQC 3JS9A 3DHXA 2HF4A 1VFJA 2DEIA 1VQ5S 4RW4A 2DXEA 1HNXK 3NF9A 3A5OC 2E5LK 3GOIA 2DPJA 2F4FA 1XMQF 1RTHA 4ER8A 4FYVB 3DXKA 1RWMB 3M6XA 2CPHA 4FNIA 4K4TA 3P39A 3C65A 3GSDA 3NNAA 1NPRA 1DTQB 2PYLA 1RHJB 2YTCA 3L2RA 3CCRN 1R8PA 4O55A 3ILLA 2Q6BA 1YVNA 1VR6A 3ZXWA 2BKPA 4Z4HA 3NGIA 1NGJA 4O3QA 3HHKA 5F3TA 3M6UA 3PVXA 1ZBSA 3DXMA 5L46A 2C3PA 4Z4GA 3L3CA 3N4QA 1U6ZA 4FJ9A 3TU5A 3CJSA 1T03A 3WBZA 4LF5K 5KT2A 2GEMA 2CNNB 2VOOA 2R7XA 1QSSA 1T94A 4R8UB 5DM7L 2CG8A 1TU0B 1Z26A 1J5EJ 5F8MA 2LXUA 1KFDA 3THTA 3NAEA 3KK3B 3W61A 5ETRA 3VQEA 1NK8A 2VDIA 1Q5YA 3AO5A 4YHHK 5C15A 4WU3A 1U24A 4ZVEA 4TLRA 2VBWA 3QWUA 3BGUA 1NOYA 1WKKA 4JI5J 1ITGA 3S7RA 3DRSB 5KG6A 3DRPA 1RI7A 1HQ2A 1TL1B 5AQWA 2VFTA 3ETMA 2I9SA 1X0FA 4CHZA 2P9NA 2BOAA 4I4BA 3AOBA 2LA4A 1O0PA 1BCOA 4CJWA 1QDUB 2PAVA 3M30B 5KG2A 2Q36A 4RZRA 2YNFB 2Y8YA 5EWFA 3DLKB 3QAUA 4I56A 2Y1JA 1X5OA 2Q6CA 4DLGA 4B8CA 4FVUA 3AA9A 5HN0A 4RU9A 3LDQA 2I38A 4X65F 1F6TA 3TEGA 1LFWA 2QLFB 2CQ2A 5AJ3J 1N33F 4LY7A 4BLGA 2CPYA 1RA6A 1UKUA 1M1KO 3L2UA 4JI8K 4M5MA 2DCUB 1GMVA 3N28A 3QQCD 2EG1A 2A0FB 2YWKA 4PKDB 3FZFA 3MECA 1Y5LB 3GU0A 2XLKA 2ALYB 3BV8A 2OYQA 3ZTSA 3B4MA 1SQEA 4NA1A 2ZNZA 3MCNA 1C0UB 1WKLA 2FVSA 3M6WA 4AE5A 2RKIA 1RTZA 4PZVA 3VWSA 3W5ZA 1RWWB 5HP1A 2CZ9A 2DITA 1S5ZA 3OYBA 3SDEB 2WOMA 1KCFA 3O3GA 4CK1A 3KUEA 3Q8QB 4KB7A 3A5LC 1FW6A 4Y2MA 2DT9A 2X51A 4CZMA 2BE7D 1TUUA 4LQ3A 3MFIA 3OHBA 2GVZB 4CZFA 2V68A 3UIQA 3LAKA 4YHHJ 4JI4K 1W9HA 1OS5A 2HQIA 3H40A 1KVJA 2KG0A 4JI1K 4B3MF 1H7XA 2WB4A 2RE1A 3E1YA 4XDCA 1KN6A 3CCSN 1JJCB 5A8WA 4M94A 2F1FA 3KZBA 1LWFB 3M2RA 3HHNB 1SH2A 4F3OA 3HHLD 3I33A 3GFHA 1NNEA 5KRSA 2GQQA 5F8IA 3N4WA 2ZBQA 4OI2A 1LXJA 5ADZA 2E1AA 1QE1B 1KQSR 4FJ7A 2LFVA 2VFRA 5AQTA 4K4VA 2DY1A 4WFXA 5IM0A 4Q2LA 3N4PA 3MR7A 1SJRA 3OBYA 2ZD1B 4G3IA 3CO9A 5C10A 4O3NA 3RSEA 1ZC6A 4Q0BB 3HL8A 4QR1A 3OFFA 1Q86T 5FRNA 4IJNA 1VQLN 1ULRA 3CCLS 1VQ8S 2BV3A 1QAYA 1R8HA 1XR5A 1UWAA 2FVRA 4JD2B 5KFFA 3CJTA 3M8QB 5F41A 3MEGB 4CZKA 1M0SA 1NRKA 1RBUA 1QVFM 2W4CA 1W7WA 4FM1A 1KTVA 1U0HB 3E9LA 3FFKB 2B3TB 1S57A 3KWGA 1JIHA 3PX0A 2VF3A 5AQHA 5K14A 1R0AA 1R6VA 1FEEA 4CVNE 3LGNA 2IM3A 4A5AA 1T8EA 4MIWA 4QWAA 1APSA 2OLWA 4DU4A 4DU8A 4ZPWR 2QEXN 4F26A 2HGNA 2PGCA 3CGIA 3M05A 2D74B 2BKOA 1FVQA 3CMES 4QOTA 2CPZA 1YUWA 4NE9C 1S9EB 1S1XB 4F3QA 2GUPA 4X64F 1RQ0A 3DRRA 5DLFA 2O8DB 3SV3A 4CGHA 1TFWA 3L4QA 5ADXA 4RBTA 4NI2A 1TYQA 3J81j 1GLEG 4X62F 5B0GA 2FB0A 2BBEA 4TQSA 2VGNA 1QUPA 2OA8A 3GV7B 2C3UA 3CEDA 4UUWA 3C15B 4RUBA 2K1RA 2VA2A 1X5PA 2HZCA 3EXYA 4H5NA 2N3OA 4J2BA 3SDEA 1NK0A 2P9PA 1VQKN 4CJRA 3FBCA 8ATCB 1N8RO 1WACA 5GAGI 2IHR1 2P9GA 2FHOB 3G6EN 2UXCF 2R8KA 2E2PA 5CYMA 4J7CA 3AD8C 2KZZA 3HFKA 2OTLN 2QM1A 3BB5A 3AODA 3QRRA 3M8RA 4L8RB 4NO7A 4CZJA 3PYEA 2IBOA 4DR1K 3VQBA 1WSRA 3OQ2A 1DT9A 2ZJQL 3ZEUA 1DQ9A 3A13A 4K4SA 2FDNA 5GAHU 1NSQA 5JMVA 1J5OA 4H0PA 4NLGA 3IKMA 3NGSA 1JQGA 4CO2A 1RU2A 3POTB 3AVLA 5IQ6A 2HNZB 3JSRA 2UXCK 4TYAA 1O5JA 1Y3JA 4ID8A 2V4JA 2F9WA 3ZZTA 2IVNA 1T9XA 3RSEB 1UW9A 2QSWA 2WVFA 3UN2A 3EDRB 3CDWA 4OJ1A 1DRZA 2UUAK 5AQOA 4OL8A 2VWKA 4JOUA 4DUZK 4P2MA 4FNHA 5KFLA 3AARA 3E3XA 1BQMA 7FDRA 2F4VJ 1WI8A 4JEPA 1X4AA 2VD3A 3ILJA 2FY8A 1XQIA 2AF6A 4DR4F 1BUPA 2DO4A 4MKBA 1KXPA 2ZDPA 4OX7A 3AXKA 3MX5A 1XNQK 3EYZA 2FJAB 4UOCA 2Z57B 3M8SA 4PUOA 3CC4N 1JJ2M 3LW5C 4X4VA 2HHSA 2YKAA 2K2PA 2YNIA 4OPHA 5BRFA 1Q18A 2BVZA 3OUYA 3VQQA 3VQ7A 4RG8A 1RDBA 3SJHA 1VS3A 1YSJA 3CJKB 3CULA 2UVVA 3THXB 2FBXA 1Q8KA 1S1TB 4DR3F 4G6VB 1ZM4A 3GV5B 3FRZA 4FJGA 3O44A 5D3GA 4ED6A 5KTQA 3S01A 3MAHA 3H5YA 4JI5F 3OPKA 2P5GA 5KG3A 3SMZA 3AB4B 3W65A 4BG8A 2BTFA 3V9XA 1HWUA 4JI0J 2F5GA 2MKSA 3MN6A 4BG9A 3Q2SC 3ENBA 1OKJA 4WK1A 4ED7A 4B9QA 2DY9A 3GONA 1GT8A 2KKZA 3OTCA 1RCXB 1VBXA 2RN2A 4RUCA 3PKYA 2GHPA 3HYFA 4BDYA 3UD4P 4FXWA 1YI2S 2R9LA 2D0OA 4CGGA 5IT9Y 1EKEA 3ZT2A 3SCIE 3T1YK 4O23A 3H4DA 4LD0A 1H2UX 2RQCA 3N5BA 1B0TA 3CQXA 3LPTA 3RR8A 4JI1J 3VQ6A 2LMIA 4KBIA 1L3SA 2WSCC 2MKCA 1AZSA 1U04A 1KQSM 4ETXA 3PFEA 2G8IA 2YNGA 2APOA 3EM1A 4C11B 4AHRA 4J2AA 4W98A 3VEXA 3GWCA 1WC5A 2GS8A 1QM9A 1WJ9A 4RW6A 3EEQA 4CHPA 2EBGA 4HKQA 5E3PA 2DPNA 2HVIA 3DDIA 1ILYA 3KD5E 1T9TA 3UDVA 3MR2A 4WFZA 3AOCA 1HPMA 4BE1A 3ZTQA 1JCGA 4DZ6A 4DV2K 3R3LA 4PG8A 2VB6A 5HROA 1E6VA 1JLAA 3RW7A 2FF6A 1V4TA 1BOTO 4YP3A 3PUFA 1ZBTA 2QWQA 1WF0A 1AT1B 4KAIA 4P10A 3CCRS 5BR8J 2CQDA 2WBMA 2YPYA 4WIIA 4HHTA 2LYVA 4NZ0A 2ZOMA 2CGJA 4JK8A 3NCPA 5FJ4A 3VAGA 2DXDA 1RT7A 1OVYA 4ZOSA 2I5JA 3IN5A 2MKJA 5LOQA 1M5HA 4W90B 4OZ0A 3NCIA 2FGCA 3ZETB 3EPGA 1GEHA 4YY3J 3EICA 1CS4B 3KUGA 4ECQA 1VDHA 3I5CA 3MMCB 2MYFA 3S3NA 2HAFA 2V51B 2J7UA 4M45A 4OX9F 4HHHA 1WNSA 3MD1A 3K5OA 1IH7A 1U49A 3AJ2A 1R89A 3R1LA 2JVOA 2Z1GA 3BKUA 2KHOA 2IM1A 2FC9A 2D9PA 4DUZF 2EPIA 3CIZA 2YKPA 3ASMA 5KFGA 2ZH4A 3BR8A 3BH6B 3ZYYX 4KGXB 1H74A 2MHEA 2FZCB 1HR0F 1KVBA 4EZ9A 1XC3A 3T5KA 3DHWC 2A1BA 2A18A 1O6XA 4YUDA 2ZZNA 4OMFG 1KOHA 1JXLA 2AZ1A 5KT4A 3DYAA 4G1QA 4WFNQ 1ZBFA 1X5TA 3LDPA 2HQ3A 2X1GA 2DH9A 3R6MA 3L2QA 3FFIA 1S9EA 5I9EB 2W01A 4F4ZA 3UO0A 1KRPA 4ED1A 2E7XA 2J7WA 4MAKA 4O44B 5J2MA 5L1JA 1TP7A 3U27A 4PYAA 3TNVA 3RB0A 2CPEA 3OYDA 2ZM6J 5EVZA 4NPOA 4JI7J 3I55S 4RW7A 3EO3A 3SNNA 3M3ZA 1T3OA 3NLCA 1VQMN 2E5LJ 3FEYB 1Y5IB 4CO1A 2DFEA 1PSDA 1HNXJ 3S8SA 3LZJA 2VFSA 2MLZA 2E1YA 2RAQA 1KD1O 5B08A 2O8BA 4ZCLA 1FWPA 4U67L 3PJ9A 4ZP9A 4CYUB 1U2RA 5F0UA 2KJVA 3VETA 3KJNB 3O9TA 3IWLA 3IMXA 1N36F 3DGPB 1HQEB 1CJVA 5M1QA 5HQMA 4M7YA 5K20B 4JRPA 3AD7C 3B6BA 5ETTA 2E66A 1WAFA 2XMUA 1VRTB 3AJ1A 3O4WA 1TMMA 5CYQB 2DIUA 3EPIA 1RBRA 1ZM3A 1FD8A 3R1HA 4WCEQ 1NM2A 3CUNA 1S0MA 3TR8A 4B1UB 3D6TB 3BYRA 4OGEA 4AM7A 2QFIA 3DLEB 2HKEA 4LFAJ 1OSDA 1BE4A 3BN7A 2Z1HA 1KHWA 2HZAA 4B9TA 2HMPA 7FD1A 1GTHA 4WCEL 3GCXP 3KKRA 3MMVA 5F1XA 1Q8LA 5AE2A 5ETSA 1HNZJ 1VSDA 5C24A 3AVKA 1VLOA 3S3OA 1B4SA 2Q79A 2RHKA 2ZD1A 1Y3KA 3MDFA 2VJUA 4YOWA 2ZBPA 2ZWHA 1AROP 1UEUA 2OAUA 1HYSA 4PABA 1QQCA 2J9DE 3CCWA 3L2VA 3OL7A 2AWZA 3QSYB 3EZWA 2CJYB 5E0OA 2Z1JA 3DU5A 4EI2A 4DCOB 2FJBB 1MMLA 4FLZA 2ROGA 3FMBA 3D4JA 4R5PA 1U4BA 2ILYA 3CD7A 1U2VA 3HPOA 2AYGA 1Q95G 3EL2A 4HL9A 4M1KA 1TFYA 4N8NA 3AA2A 3KLGB 4QU7A 2HFNA 5FDLB 3M1FA 5C7PA 2B9XA 4CIFA 4WZQA 4HUEA 2PEHA 1NGGA 5K5MA 2MLYA 3NL0A 2QL7B 3ISND 1FWKA 2DEJA 3SQ2A 4UZBA 2ASOA 5CZXA 4IG3A 4CJ7A 1DBDA 2HHPA 3OYLA 4OI6A 3D5MA 2RUSA 3CTRA 3HP9A 4DV3F 3UKRA 1RTDB 3HVTA 4X4RA 2UVRA 3LUYA 4WFAL 1KEKA 3MM9B 2DR7A 4AXIA 2QE5A 2G2YA 3PV8A 1HIYA 4QWEA 4NLQA 1K1SA 2M70A 3UI3A 4KH1B 1FESA 3DGPA 1BQXA 1J5EF 2GWKA 1L3TA 1LWEA 3ILIA 3OR1A 4OZ3A 2M7SA 3C8YA 3QJJA 4ZVFA 2PE8A 4MMOA 2HURA 1ZAXA 3A4TA 1RDUA 1EJ7L 4CLLA 3FBEA 2Y1LB 4ZVTB 4J5OA 9ATCB 5K8NA 4FVCA 4MIAA 4EO6A 1VQ8N 3CCLN 1IKWB 4HT7A 2KI2A 2KRRA 4M5NA 2OO4A 2BRLA 1NK5A 4BY9C 1F9HA 4ZHRB 2WTUA 4YOTA 4WZMA 1YTUA 4NLRA 4M63C 4KH0B 1VQLS 4ED0A 1VRUB 3SMSA 1NAQA 1GMUA 2JLFA 4J9NA 3LANA 2EVZA 1IBCB 2DK2A 2HS0A 2VWJA 3ZTOA 2YHWA 1FHTA 2IMOA 1WOPA 3H4BA 3OYHA 5C25B 3IS9A 3T6BA 2VDHA 4G1PA 2Z2YB 3PO4A 2NRHA 2CNLB 2OFGX 4HUFA 4LFCK 2XWXA 1WF1A 3CDUA 1T44A 2OSRA 1KQKA 1L3UA 4YR0A 3NH2A 2RF2B 4DPXA 4B3TJ 4CLWA 3VVUA 3IAS9 1UJ6A 4RUHA 2M52A 3SUNA 1B99A 3OTOK 3ZX0A 2VC0A 4IO9L 1T11A 2NUHA 3IBFB 1QAIA 2G8UA 2CWKA 3OXLA 4WJBA 3R6GB 3T1AA 2EWSA 3C19A 2M88A 1K8KA 5IT9O 1X4GA 4OYOA 3T5HA 2BJDA 3MN5A 2JNJA 3TO8A 4IO8A 3ZZPA 5DDPC 3V4MA 3CC4S 4YOXA 3WEEB 3BF4A 4CK3A 5DM6Q 1WBBA 3FJ2A 4XTTA 4A8SA 3CCUS 1O8BA 2E1PA 2I8EA 4AYBD 3LPUA 2QIFA 4HTUA 3O80A 4X4QA 4JKAA 1RTDA 4PPDA 5A6WA 3RJMB 1T6DA 2VQEJ 3CPEA 4DV4K 4CTAA 2RDIA 5DMRA 3QESA 4Y1CA 4DX5A 4KO0A 3WC2A 1SUQB 4PWDA 4BR9A 3QEIA 4HACB 2ZHOA 3FZBA 1IQTA 4DSLA 4W5RA 4LSLB 4DR6K 2CUYA 3ZNUA 4BRAA 3GJRB 4U8VA 1UVIA 3RMBA 4QS8A 4V19S 4DB3A 2MPUA 1EQ0A 3O9SA 1C1CB 3OFHA 5AQXA 1KC8O 2HGLA 2XC9A 2RHSB 2CH6A 4J9QA 1JJHA 3BGRB 5KPTA 2QYGA 5HBMA 3K0SA 5EU7A 4C8KA 1IKVB 2O3DA 4DL7A 3NF8A 1BISA 1RT4A 4URSA 1SZ2A 2V4RA 3W8PA 4HDHA 1FRXA 4CEQA 3M5RA 2UXDF 2FLLA 3EGNA 4HTLA 3H90A 1IM6A 4CBXA 3P5BP 1ROFA 3FRYA 2H3GX 2KYZA 4JI7F 3O3FA 4JBCA 1XIQA 1XR7A 3CWJA 2EC0A 4ERDA 1QS4A 3HZGA 4CNYA 4BR7A 3VN5A 3IAYA 1FRLA 2IAJA 2HWIA 1GFWB 1HW8A 1WC1A 3EE9A 3FZMA 2POKA 2IRUA 2G1DA 2CADA 4LF9J 2ZUAA 1NHUA 3FCWA 2FZKB 4QZVB 5D8HB 5C25A 4BVOA 3UNYA 1K9MO 4ID5B 1N52B 1JJ2R 1RHKB 2E5JA 3NGZA 3MWBA 1K73T 4I2PA 2O66A 1S22A 2HHXA 5M1PA 2J7KA 4DV7K 2KHDA 2VGMA 4M3XA 1SL0A 1HL6A 1NB2A 2FBYA 3OHRA 4OZNA 4RW8B 1VHIA 3QJLA 3PW0A 2FJVA 1HQUB 3C95A 3V4IA 2VONA 2I6WA 1P90A 4O3OA 1I94J 2QSFA 2E9TA 3DC2A 4CNZA 3PKMA 4FPRA 4OO1J 1RDAA 1XMOK 3T3FA 3QJPA 3VERA 3LDNA 2W25A 1I94F 4EFAC 2UXCJ 3CD6S 1AXQA 2MKHA 4OGCA 2VG6B 4QQBA 5BPNA 2O8CB 3AD9C 1RT6A 4I2QB 4GKKF 4RW9B 3UKRB 3OVAA 1SPBP 2AQ4A 5J1PA 5IV3A 3ZZOA 3PW5A 1IKXB 5KFOA 4CW7B 3OA9A 1MDUB 1MLAA 4K0KK 1U1KA 4IWVA 2I7NA 5L9XA 3T5LA 2ZDOA 1YBTA 3L3VA 4WF9Q 1WDDA 2EBEA 3OYFA 3JAMO 1IG8A 3CMAN 1CQNA 1VQ4S 2J6UA 3EDQB 3MWPA 3CF5L 2LQ8A 2YCHA 5I4MA 4A2AA 3TP2A 1S48A 3JSYA 2A5XA 2P9CA 3Q83A 3DLBA 4O44A 1VBYA 1XMOF 4KV8B 4NLOA 1C0UA 4I2PB 3PDNA 4FYYB 5F8NA 3J8AA 1VSFA 2Q1NA 2A1RA 3MPWA 3PNIA 1VQNN 1S0VA 1R7IA 2GJFA 1Y0HA 4ES1A 1CULA 3Q24A 3NFAA 4PPZA 4B9VA 2DRAA 3K5MA 1O51A 4DS4A 3ZNJ1 9RUBA 2XCAA 2V52B 4UY8O 2PI4A 2VH7A 4WK3A 3C6TB 2AX0A 1LWXA 3OR2A 2W8KA 1VSMA 1B70B 2DBBA 3CJRA 4DUYF 3D45A 2VWBA 4KHMA 4Q0BA 4K8ZA 4KH4A 3TUIC 3TAPA 4CZCA 4LF7F 4NZ6A 4P2FA 4JI4F 4OV6A 3U8XA 5HJYA 2MSSA 3BF1A 1DURA 3MCAB 4E7HA 5BRDA 3QEXA 2CQ0A 4LF6F 3BEXA 4M5LA 5G0RB 4Z2XA 2H1YA