3DMDA

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
318
structure length
310
Chain Sequence
MFGKLREKLKSFVKRVEEEVEKEEEEVELTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle receptor
publication title Structures of the Signal Recognition Particle Receptor from the Archaeon Pyrococcus furiosus: Implications for the Targeting Step at the Membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transport protein
total genus 116
structure length 310
sequence length 318
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dmdA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dmdA02
1R2QA 1H8HD 2N42A 1E2DA 5H70A 1EG7A 8OHMA 2ZPTX 5LDDC 3U61B 1TUIA 2BMDA 2QTHA 1KDTA 4TTQA 5DIFA 1P9WA 5EP1A 3U7EB 1SKQA 2FGKA 4B3FX 1E1QA 3IKJA 4HDCA 5E4FA 4OI1A 3PCRB 1JXMA 1AZSC 1EFCA 4I1OA 4CEHB 2ZRGA 2QP4A 5AJYA 5EXPA 421PA 3SQXA 2QP9X 2DY1A 3KQHA 1Q57A 2JA1A 5FBWB 5JWRA 4LJ8A 3L2OB 4B74A 2YKGA 4Q4JB 4DC9A 2JCSA 3BFKA 1G3MA 3L0SA 3U3JA 4AC9A 4PQRA 5C4GB 1S9HA 4V0OA 3IQXA 2EW1A 3RSLA 3AVXA 3QKSB 1U9IA 4Q01A 3QSYA 1JR3D 4D4MA 3SHWA 1DTSA 4HAWA 2R2AA 3UK6A 1H8HA 4URUR 3KXLA 4IDHA 2GEUA 4PC2A 1XJCA 1KTVA 1YR7A 3EIQA 4ACBA 4YMVA 2VP0A 3WHKA 2I1VB 3CRRA 1Z0DA 2NPFA 2QPTA 4O2LA 2I3BA 5B30A 5CITA 2CCKA 1T8TA 1KKMA 2JLYA 2ZJOA 4I81A 2OBMA 5EZ5A 3VU9A 2E9SA 1XEWY 2CK3D 4IDQA 2QSYA 4D4LA 2PH1A 3VHLB 4MYHA 5EP4A 1R5NA 2BWJA 1R8QA 4AKIA 1E2PA 2DR3A 4MYUA 2FN4A 4IEEA 2RGEA 1L2TA 3NH6A 3B1WA 4E07A 1RZ3A 1HT2E 2YWGA 1T9HA 2RGAA 3CM0A 4D26A 1Z8FA 1EFTA 4NYJQ 1TMKA 5FPSA 2ZEJA 1COWD 3B5JA 4TN1A 1F2TA 1T5IA 5CK5A 3TK1A 2X2FA 1JR3A 4EJSA 4GZLA 1FQJA 2HJVA 2IEYA 4CDGA 2QROA 4WW0A 4ZDKA 2IEZA 3GLIE 1GKUB 3QF4A 1JR3E 3NC0C 3ZQ6A 2IS4A 4JLNA 4M9XA 1SXJD 4QXAA 2XOKD 2NO9A 3I72A 4QFMA 1XZQA 2CK3A 2FSGA 4ZPXA 1GOTA 4B2LA 1AKYA 4Q1DA 4U5XA 4ZI2A 3KXIA 4PSAA 2HXSA 3OESA 1AS0A 4IOLA 1YR6A 1W36B 3KXKA 2GXQA 5HCNA 4M1TA 1AN0A 2G1KA 4XH9B 3BXZA 2V55B 3HU3A 4QG7A 4WVFA 1N6HA 3NVAA 4R2HA 1FUKA 4DEYA 4LPSA 1COWA 3REFA 3EPKA 4NZYA 4PSVA 1GILA 3OE7D 3P1JA 5KPJA 2NG1A 2GJAA 4BQSA 1Q1ZA 4FWIB 4GOXA 1BO6A 1NMZA 3KB1A 3T5DA 1K8RA 1MRSA 1G8GA 4PHFA 4B2IA 4BFYA 4HB4A 5J40A 2VYFA 3PXGA 1SXJA 1FTNA 1VKJA 2XOKA 4DJTA 5FL7D 4UXHA 1S9DA 1KMQA 2C77A 4W7SA 1X3SA 4NHOA 3VU9B 1SVOA 2D2FA 4QBGB 1KNQA 2ZI4A 1M8PA 1VG9B 4AURA 1SXJE 3K70D 3AVYA 2VP6A 3I92A 4H1VA 5BQ5A 1M7GA 1ZM2A 2IXEA 4KHZA 4RD4A 2H57A 1T3SA 3TUJC 5HTKA 3OEED 2XAUA 2WKRA 1D6JA 5F2EA 2AXNA 4BRWA 2EYQA 2GRJA 3QOFA 1U8ZA 3RLFA 2GESA 5EXTA 2ZYWX 4RFSB 3TMKA 1HH4A 5EE9A 5P21A 3OE7A 4F92B 2ORIA 4JBYA 1F2TB 2AKAB 2XJ4A 1C9KA 4V0ME 4EJSB 4ZCIA 1F6BA 1L4YA 4LC0A 3B1VA 2WOJA 1A2BA 4TL9A 2KBFA 1DOAA 4U00A 3BD9A 3QF4B 1GZSA 1M7HA 2UZ3A 1CP2A 3IIKA 2YWHA 4XWKA 5FL7A 2QQ0A 3CZPA 4C0HA 3VKGA 5JS8A 3RS5A 2ATVA 1NLFA 1TF2A 3B1ZA 4K46A 4FMCB 4KAXA 3DVLA 4DT1A 3O8DA 3QI2A 1MO3A 1IN6A 4WAUA 5FPKA 3CR8A 3B8HA 1NJFA 3OEEA 3TH5A 4Z1MD 2C96A 3RRMA 3RS7A 2YC2C 4KITB 4UNNA 3E5HA 3LWNA 1XEXA 1XMSA 3PJRA 3RAPR 4XVUA 3I62A 1VG1A 2X77A 2O8CA 2PL3A 4DKXA 4GL2A 1EESA 1P2UA 4EKDA 1E96A 3D8BA 2JLZA 2CNWD 1E6CA 2WICA 2ZRLA 4NYJR 1Z6YA 3P26A 3AH8A 1RYFA 2OAP1 4HB0A 1F2UA 1SVKA 5J47A 1YHNA 1SXJB 1ZC4A 3EZ2A 3SI7A 3LLMA 2WJJA 5AUPB 1GRRA 3O8RA 1XB2A 1KZ7B 2IC5A 5CB8A 1KNXA 1MV5A 1G3UA 1YZKA 1SVWA 4OI4A 2G77B 3THYA 4PHTA 1QBKC 3QPVA 4JL8A 2ONKA 3FTQA 2GJ9A 4Z1MA 5SZHB 4NCNA 2JDID 4KODA 1W49A 2BM1A 1YR9A 3X1WA 2QPAA 2ZJAA 1CRPA 1OHHD 1XMJA 4JSTA 2IK8A 1XWIA 1K6MA 2EFCB 2VHQA 1OJLA 1M74A 2FEMA 2CNWA 3SS8A 1FTSA 1S1CA 5DE3A 3LLUA 3JVVA 4OHVA 4Q9LA 5HZHA 1WXQA 2WSSD 3NBZC 3AVTA 1OIVA 3GLGE 1T6NA 2ERYA 2X19A 2BMEA 4MITA 3PITA 4M9ZA 5FUWA 2XZOA 3AVOA 1U2RA 2QG6A 4ZO4A 1ZUHA 1G41A 1KO4A 2G0NA 3C16C 4G5RA 4HATA 3U7HB 4JLDA 4DT1B 3M1IA 3RSOA 4DIDA 1MH1A 1OFUX 3HR7A 1OW3B 5FPHA 4DLWA 3K70B 1U94A 2PZGA 3IBGA 3NBFA 4YMTA 3K0SA 1P5ZB 2JDIA 4UKDA 2JLQA 1OV4A 2C95A 2GILA 2RMKA 4MGIR 1Q21A 1Z63A 3ZYCA 1SGWA 1BIFA 3SDZA 3DMDA 1OHHA 3RNLA 2A78A 2YV5A 1XEXB 1KI2A 1E2QA 2F7SA 4OQNA 121PA 4A92A 2WIBA 1GAJA 1T0HB 4MKFA 1EX6A 4PR0A 2O8CB 1P6XA 2VF7A 4HI0E 3SBEA 4B44A 4HUQA 2GJ8A 3PUWA 1NI3A 4BWYA 1OXUA 2WSSA 6Q21A 2JAQA 5KSOA 3PVSA 3OIUA 3U6BA 2FU5C 3C15C 2ZYTX 2ZYUX 4X8LA 2QRZA 1G4UR 5DYGA 1AS2A 3NHBA 3I8XA 2YINC 4PC3A 4D82A 1A1VA 2UVQA 1W0JD 1N5LA 1Q1QA 2OCBA 2QM8A 3L0IB 4EFNA 5IF9A 3THYB 1M7BA 1W47A 2Q0HA 4TYYA 2VF8A 1MRNA 3IPXA 4IOKA 1XPRA 4JS0A 4AKHA 1KDRA 2P3SA 3TRFA 1O3YA 4Q7KA 4H1UA 2IYYA 1OB2A 4LK2A 1VHTA 2ZIAA 3ZLJA 1AQUA 1TF5A 4LBZA 3TUZC 1KO5A 2ZE6A 5FH9A 2A7QA 3BOSA 1UBFA 1QHNA 3O47A 1SKYB 1CJVC 2I1QA 4RCYA 1KI6A 1Q1EA 1N6KA 3AKYA 1U8AA 3KTAA 3SQWA 2CMKA 2QAGB 1HE8B 4QGGA 1Q20A 3GLGB 1CULC 5LBIA 3W6PA 2EFHB 4GT1A 5CB6A 1E2LA 3NKVA 4A9AA 3WYAA 2FFQA 4HZIA 2D74A 3KKQA 1MO6A 4I99A 4KFTA 1K5GA 3SFVA 5JCPA 5IT5A 2FPKA 2QU8A 1IXSB 1S8FA 1IBRA 4LC1A 2BIFA 4PPGA 2XITA 4FD2A 1FQKA 1W0JA 2F55A 4A1FA 4KSCA 1ZNXA 4MYTA 1WE2A 2ZXUA 5DI9A 1UEJA 3KDSE 4PPFA 5FOUA 3VHXA 5H8WA 4CT5A 1GDDA 4G3XA 4ZI3A 1PVOA 5CM8B 1C1YA 1DE0A 3QPWA 3R9IA 3TVTA 3TW8B 1AJEA 1D8TA 1NBME 3UWKA 5KNDA 2C2HA 1ZMXA 2AN9A 4UJ3A 2AK2A 1GL9B 4JLBA 1W2GA 1E2FA 1ZP6A 3PIRA 2ECKA 2FSFA 1YRBA 4HSEA 721PA 1VCNA 5G53C 5KSYA 1AGPA 1YZUA 1TQ4A 3MCAA 2OFOA 4HUQB 2DWQA 4OHXA 3THXA 3R9XA 1Z6AA 5LPNA 4B73A 5L3SA 1IN7A 1OT3A 4DSOA 1N0UA 3R9WA 2IF2A 3C5CA 1ZNZA 1E2JA 2ZAOA 3TSZA 2V8OA 1KSFX 5DYIA 2KE5A 2PJZA 1TEXA 1FL9A 4Z8XA 3V4RA 4OQXA 3N70A 3PR1A 4BLPA 2V4ZA 3DZDA 1CXZA 3I32A 4DCNA 1ODFA 4F91B 3T1TA 1Q12A 4MRNA 2FDCA 1CJTC 3B9QA 3OZXA 4UXJA 2QMOA 1XTRA 3Q72A 3UATA 1CF4A 4BLOA 1S3GA 5TV2A 3SYNA 4QHTA 1OFIA 2O0JA 4Q1BA 3T15A 4IDOA 1KI6B 1VCIA 1OIWA 4US0R 4GBMA 5C46F 3KTAB 4NCJA 3CRW1 3F8TA 3BGWA 3KJIA 3FGNA 1P9NA 2A9KA 4ARZA 1T91A 2ZM5A 2ZI9A 3Q7PA 1Y3AA 1AQYA 1E9CA 2BMJA 1ZBDA 5KTYA 1SULA 3CH5A 1OB5A 4JLVA 5K8UA 1VDZA 3BFVA 2ZRBA 1KI3A 3NDBB 1GTVA 2CBZA 4AY2A 1NN5A 2F9LA 4P4TA 1ZYUA 4LJ6A 4P3YA 4RZXA 3W34A 2WJHA 2P5TB 4HDQB 2F43A 1EWRA 3OEHD 1EXMA 4ILEA 3PEUA 2JIZD 2FF7A 3RDPA 4ABYA 3Q5EA 4DEXA 5JSZA 4LV6A 5BWMA 5HE8A 3IQWA 4YMWA 5BXQC 3K0AA 4Q18A 3GLHE 4QJ4A 3LDAA 1BYUA 3K70C 4Q1FA 2H8KA 1W5TA 2GBLA 5B57C 3AKCA 3U3RA 2ZI3A 2CVHA 1OXVA 5AUOB 3QXJA 1XCMA 4LYJA 3THXB 1CR4A 2ZAMA 1N3BA 3MMPA 5L3SB 2XTNA 4NYMQ 1X1SA 2J59A 2QMHA 4CVNA 3LFUA 4FMBB 2DPXA 1XFAA 5KNBA 4PTLA 3VNUA 4CF7A 3LX5A 5AK0A 3VX4A 2QT1A 4LGMA 1M6NA 1G3QA 1R0XA 2ZJYA 2RB4A 1D2MA 1TUEA 2VO1A 2PMKA 4D4JA 4E03A 2CDNA 3SZRA 1G1MA 4C30A 1W2HA 1G5TA 2NGRA 2OZEA 3OEHA 3PEVA 4ITRC 1QDEA 2JIZA 4R71A 2Q9CA 3T35A 3GJ3A 4HYYA 1U0JA 4M1WA 4JBWA 1XCGB 2ZRIA 2VHCA 2ZS9A 3CRQA 4TYPA 2IYLD 1ETUA 3AVUA 3HR8A 2DFLA 3T1QA 1OE0A 4DBLC 2QE7D 2AFIE 1ONBA 4MKGA 2GVZC 4L15A 1JAIA 1UKVY 1NSFA 2ZRJA 3I4LA 4LX0A 4PAOA 4ARZB 4RVCA 3ONWA 4B47A 1GM5A 4KSBA 3RRZA 1Z06A 4K8OA 1GWNA 2ZSAA 3H4MA 2V1UA 4AI6A 1XXHA 3IGFA 5GVSA 1PLLA 5JWHA 3NDPA 1OXSC 4GP6A 2XNSA 1QZXA 3VR1A 3QXHA 4QC2A 1UKZA 2AX4A 2E1RA 1R10A 2CEAA 3LA6A 1KDPA 2F43B 1M1YE 1X8JA 3GLHB 2YHSA 2R8RA 4ZIRB 5JSZB 2G0TA 2GTPA 1Q3HA 4K81B 4AIIA 4TLEA 1OFTA 1QG2A 2QE7A 1Z6XA 2PCJA 5J4VA 5HZKA 3K0FA 3QIAA 2WWHA 1G21E 3SR0A 4YXWD 5GJCA 2CCJA 4LOAA 3BIFA 1D2EA 1S3SA 4Y0VA 5BYKA 2BMFA 4OJKA 3TR0A 1G17A 4KBFA 1T3HA 3LVRE 3BFXA 1I2MA 1V5WA 1E3MA 3LRPA 1NVWQ 1UKEA 2FX3A 4KLNA 2PCLA 1OKKD 3FB4A 1XJ0A 4JVLA 4EFLA 3HPQA 2Z43A 5CJPA 3D6TB 3ND8A 4PANA 2JGNA 2PX3A 2P65A 4HAXA 5TMPA 1Z28A 3MUFA 4Q4JA 1QG4A 4XIGS 2MMGA 5DH9A 2XTMA 4C0LA 3CF6R 4EFMA 4YMSA 2CE7A 2NO6A 5G41A 2ZRFA 3TBKA 4UQOA 3GFPA 1UJ2A 2R6FA 4JYBA 4PZZA 4ASUD 1VIAA 1YJ5A 2NOAA 5EXSA 4YXWA 2AL7A 4QNRA 1Q22A 4D0LB 2FWRA 4ZKEA 2D7DA 3V4FA 1XXHB 1JPJA 4A2QA 2WHXA 5E7JA 2OUKA 2CL0X 2PT5A 1I4LD 1E0JA 5IDVA 3U4QA 3H2YA 5JWOA 1QHXA 2G6BA 2C5LA 4DSNA 2EQBA 3CR7A 3NEYA 4NYMR 4CGZA 3KJEA 1VPLA 2YWFA 1OKKA 4AKEA 3NTUA 4FI3C 3C5HA 4N3NA 3AF4A 2OEPA 4S35A 2IW3A 3G82C 5KSPA 3BB3A 5FBLB 2QORA 3QKUA 4GDFA 2ODNA 4TTPA 3K09A 1ZIPA 2HXYA 1P60A 1KO8A 1HQYE 3EZFA 5C4MA 4DRZA 3IILA 1V43A 3I5XA 3ADDA 2WSMA 1PUJA 5EE5B 4M9SA 1DVRA 4RD1A 4BFZA 3M4YA 3REGA 5DISB 5J4HA 2UZIR 4KCGA 3IBYA 3DEFA 2XSZD 221PA 4ASUA 4XSHA 1NSTA 1X6VA 3K0FB 2ZRKA 4OK5A 2O0HA 3ZZUA 2ZUDA 3OAAD 5KPDA 1VYVA 3HU2A 2GXSA 4JIMA 2O8DB 2D3WA 1G8YA 3QXCA 4RZ3A 1KJZA 3N2IA 4DLRA 2J5XA 5JBQA 4FWTA 3LW7A 3BH7A 2QEQA 1N6NA 1NY6A 4Z51A 2Q9AA 4DB4A 4FW9A 2RGNA 2GK6A 3P27A 2GA8A 1NNEA 2ZUCA 3ZD7A 1Z0FA 3FKSD 5DO9A 4BLSA 2VQSA 1NN3A 1X1RA 1U0HC 2VP2A 3RC8A 4IKEA 2Z4SA 3B1YA 1G8FA 1GSIA 2C99A 3BB1A 4M8NE 4ZDIA 4HUTA 3X1XA 1N0VC 1CR2A 1WMSA 2OXCA 2XSZA 3ZJYA 3RS2A 2H1LA 1TQ2A 4U02A 4MGYR 3PEWA 4B3DA 5J4YA 2A5DA 3OAAA 2JLVA 1E2EA 2OCAA 3WNBA 1UBCA 1W0KD 4W5JA 1AIPA 4N0EA 3D7MA 4RZUA 2J87A 4YC7A 3U4QB 5IK2D 2GJKA 2JASA 3AQ4A 2NMVA 4HB3A 1ZD8A 2WKPA 4QKQA 3EASA 1P62B 1U0LA 1E2HA 1N5JA 1G19A 3FKSA 1EX7A 4DLVA 4URVR 1XNJA 4LRWA 2B6HA 5IRCD 4QHYA 3X1ZA 4DXAA 3J81k 4RFSA 1DAGA 2VTKA 1S4QA 1P72A 3QQ5A 1RE0A 2F1HA 3AUXA 4M1YA 3GFOA 3GLIA 5EXXA 4PXAA 4W5HA 2QQEA 3BAFA 4M21A 4Q7LA 2XXAA 3NWJA 2IHBA 3ETLA 4AG6A 2ZQ5A 4HLCA 2VSFA 4N0DA 1W0KA 1G8PA 2X1VA 3Q7QA 4O2RA 4M1OA 1IAQA 1I4TD 3IPYA 1RVDA 2WV9A 4NP6A 3BORA 1G7SA 2YYZA 4PX9A 5IK2A 2ZSBA 3IDQA 2CXXA 1WRBA 4BE7B 1XD2B 2ZANA 5B58C 3AF3A 1QHYA 2GBLC 2HF8A 3KKMA 5FUYA 2IYZA 1RC8A 1D5CA 3P4XA 4BZXA 3I5YA 1GL7A 2R6AA 3B6EA 1GNQA 2WVJA 4LHXA 2AWOA 3BE4A 4ZV4A 4US1R 1VIYA 4DVGA 3ADBA 1AS3A 3A1VA 5TARA 2OILA 3ZVRA 4PAQA 1SVLA 1G6OA 2GCOA 3SJAA 3EPJA 3QNUA 2FOLA 1H8ED 2EFGA 4P4UA 5JEDA 2ZJ8A 4AYTA 3GFTA 3A6PC 1E99A 3VR2A 4IVPA 2WAYA 3MWLA 3NHAA 5A4JA 4OKSA 1G5RA 2GHIA 3NXSA 4RJLA 4LUCA 5TB5A 1E79D 4XOIA 4BLTA 4TQ9A 1F3OA 3EAQA 1H65A 2MSCB 3A36A 3GMTA 2R6CA 1ELOA 3LBIA 4DCSA 4D6PA 4YDHB 2RGXA 4A0HA 5FBVB 2WJGA 2GDJA 1XF9A 4CRWB 3K0CC 3CWQA 1KSGA 3IEUA 2VH5R 2ONJA 5SZJA 4TLBA 3ASYA 5D3MA 3VR6A 2X2EA 1DBSA 2ZROA 2PJRA 1S2MA 1N6IA 1TADA 1P75A 4JBXA 3VTKA 5KHOC 4QM7A 1BKDR 3T06B 4A15A 4KU4A 4HLQB 2QTVB 4UNQA 2HJGA 1F60A 2PZEA 4V0MA 4BFVA 3DOEA 4EUNA 4ZKDA 3P20A 4HLUC 3I73A 4NMMA 2Z0MA 2AHOA 4JMPA 4LSGA 2LKCA 4NPHA 4HAZA 4TL8A 3GLIB 1ESNA 1R7RA 2NO7A 2J45A 4C0BA 2WWFA 4Z54A 2EFEB 1E79A 3LQQA 4URXR 2XXAB 1IQPA 3K1JA 5M04A 5FTJA 2HT6A 5GJBA 1NMXA 2XX3A 3GJ0A 2AK3A 5L3RA 1II8A 4P4SA 2IBMA 5AJXA 4HZUA 3CX7A 4TQUS 3A1UA 3HDTA 1IONA 3I3SR 1MT0A 2X8AA 4TLAA 5EZ6B 1UAAA 1QF9A 3AKDA 3I61A 2EFDB 3DDCA 1OXXK 4KFSA 2O52A 3Q9LA 5CJ2A 3QY0A 1ZD1A 5E95A 4AWXA 3FDIA 4OHYA 1II9A 3ASZA 4EQ6A 3B7GA 4B32A 5CDFE 1CKEA 4BLQA 2WWWA 2GCOB 1P2SA 1PV4A 4JLAA 3A37A 2QMEA 4I1UA 4PO1A 1US8B 3OIWA 3O8CA 3TR5A 1ZM9A 2GF9A 3E2IA 4V0KA 2OCYC 3N5CA 3L0OA 1R6BX 2F1IA 2REXB 1NN1A 3EARA 4DZZA 1XEFA 4C7OA 5FTKA 4B34A 1JEDA 3GLFE 2XGJA 2WKQA 1DAIA 1OH6A 1NIJA 3B1XA 4GOJA 3SJBA 5JCZA 3A4LA 4M1MA 1LFDB 4IVRA 4XWOA 1LTQA 4QBIA 1GITA 4KFRA 4TQAA 4HAYA 1ESMA 4ZDWA 5D3MB 4TTRA 4TSFD 3GJXC 3L82B 4TMKA 1HEIA 5FOSA 3H1TA 4DCTA 5JI2E 4N1AA 2GXUA 1G7RA 2IYRA 2A5YB 4GRAA 4L9WA 4V0NA 2QGNA 4EPYA 3IIMA 1T8UA 2FH5B 4WZ6A 1MO5A 4JLPA 3C4JA 4OI2A 4TLCA 3H0KA 2GEDA 3VX3A 1G18A 1KJWA 2QAGA 4IOJA 2RH5A 1L4UA 3U3MA 1U98A 3GLGA 2A3RA 4NL4H 1JALA 1XEWX 4WXPA 1G7TA 5EE1A 3W90A 3PUVA 5FR1A 4A0RA 4FMDF 2ZRMA 3K9GA 4KYIB 4A2PA 2ZREA 5C2JB 2CHVA 2K5UA 4EIWA 4YMUA 5FTLA 1BH2A 1II8B 2IT1A 1XCPA 1YVDA 4P4SB 3NH9A 4B35A 4HZUB 4EPXA 4GP7A 3ICEA 1GP2A 4UNSA 5J4KA 5SZIA 3EIHA 4TSFA 2C9OA 2WIAA 4A8JA 1SVSA 3Q3JB 2ZSDA 2LCFA 3VKWA 4RCZA 4GOKA 3GEHA 4GMDA 3VKHA 3P32A 1P3JA 2OHFA 5FOTA 1LF5A 4EQ6B 4F4CA 2HT1A 4MGZR 4PFSA 5F3WB 3AF1A 3IHLA 3U7FB 1NN0A 1YQTA 3GLFB 3M0EA 2ZRHA 3MAAC 4W5WA 3MRSA 2N46A 1EFRD 2VHJA 4PO9A 3U44B 1W36C 1NLZA 1BOFA 2RGNC 2Z5FA 3WNCA 3HPRA 1CR1A 4GNKA 4C7OB 3FFBA 4G1UC 1KI1A 4JSYA 4OYHA 2IYWA 3TSOA 5EUQB 3CB4A 4HEJA 1CLUA 5EP2A 1Y63A 1IXRC 1KI8A 3QEJA 4BPBA 3RS0A 3NBXX 1NBMD 5GJVC 4QHSA 1U9IC 4V02A 4MGKR 4HLDA 2IS2A 3DOFA 4LYAA 2IWHA 3ZH9B 3SC3A 2VSOA 4RD0A 1B0UA 5D3QA 2Q6TA 2NZ8A 1G7CA 1R0ZA 4NYIQ 4RD3A 4ZCLA 2ZUBA 1WCV1 3A8TA 3LO5A 2BDTA 3E1SA 3LBNA 3PFIA 1OFHA 4WZAE 2BHRA 2WBLC 4UNRA 5LD2B 4QJ3A 4JLJA 1XMIA 4JZKA 3QUSA 1JXOA 5KOYA 5EE0A 4Q00A 4CW7A 3SJCA 3N2EA 3W6OA 1OYYA 4BZQA 821PA 3X1DA 1EFRA 4XTCS 5GJWC 3RABA 5DNYB 1VCOA 4XTRA 1NKSA 2J1LA 1KSHA 4Q03A 4QL3A 3EWAA 3PENA 4B71A 3MWKA 3E70C 2B8WA 3KB2A 4DUGD 5BW8A 2IUUA 4IOMA 4Q66C 2FSIA 1UM8A 4C0AC 4R9UC 1NBMA 1TPZA 1A82A 2H92A 2Q3FA 2YOFA 3T34A 4Q02A 3TKLA 3LW8A 4EJSC 2Y8EA 1E4VA 1U8YA 4GSYA 4L9SA 3W9YA 5DHAA 3G0HA 5LB4A 1HQCA 4A8JB 4EPTA 4OHWA 4G0NA 2C78A 2R9VA 3FHCB 3T61A 1KY3A 1Z22A 4NU0A 1Z08A 2AR7A 4DSTA 3BK7A 4BFWA 2VHUA 3FWYA 1IJFA 4P33A 2ZI6A 2BBOA 1GFIA 3SNHA 3UMSA 4A6PA 4D0GA 2ZRDA 1KK0A 1M34E 2ZS7A 4LJ4A 5SZKB 3W6NA 1ZM4A 2BBTA 3MD0A 4M9QA 3A4MA 5KNCA 1FP6A 2P6NA 1FFHA 3K9LA 2Q21A 4MDEA 1VYUA 5KU1A 2HEIA 3DMNA 4DDTA 1T5LA 2IYUA 5TVKA 2ZE7A 4IHQA 5BN4A 2ZVPX 1RFLA 1NMYA 3FVQA 2R6GA 4DUGA 2W6JD 2P0EA 2ZJ2A 3JVUA 2ZJBA 5FL3A 3D31A 1IY1A 1ZVQA 2BKEA 2FE4A 5FUVA 4A36A 1JJVA 2ANBA 1IN8A 3MG9A 3RYTC 2WMOB 2IYTA 3CF0A 2FJUA 2PZFA 2IL1A 4L4UA 3TJZA 1WA5A 1LNZA 2FSHA 1E9RA 4F7WA 3KFVA 1J99A 3KJGA 1SXJC 1JNYA 1S96A 3TQCA 1N5KA 2IYSA 2HLDD 4KV9A 1UDXA 1JEEA 1TU4A 1ZC3A 4Q48A 1J8MF 4WXRA 2V9PA 1MO4A 1N6OA 4Q19A 4LJYA 5HR5A 2IWRA 2NO1A 1JBKA 1WDTA 4JJKA 1TTTA 2W6JA 1G6HA 1VTKA 1G20E 1ZUIA 2G1JA 1J8YF 2J0SA 1IY0A 2IUSA 5JJLA 2BVNA 4Y0AA 3QEOA 2QN6A 3PUYA 1VHLA 1R5BA 2J0UA 2REOA 2OAQ1 3EZ9A 5FTMA 3W3ZB 4E5UA 1TNDA 4QNMA 5C18A 1W46A 3QXXA 4DDUA 1G9XA 4TYWA 3GLHA 1E9SA 4LDJA 3KX2A 2MSDB 5GADl 4ZIRA 3RS4A 3WMEA 1DG1G 3AF0A 3SEAA 1N6PA 1VG0B 3KKOA 2HLDA 1TX4B 1BYIA 4PHGA 4Q9HA 3P4YA 2UKDA 1NG9A 1KO1A 3SYKA 4AYWA 2VL7A 2XB2A 4URZR 2G88A 1T4GA 4YQFA 1HURA 1DAKA 4LBWA 1ZINA 2BJVA 4BGDA 5FBQB 3MJRA 4NE2A 2ZI7A 1RYHA 5JECA 2QPOA 1NF3A 5KDDA 1E4YA 3RWOA 2GJSA 4DDWA 4G5QA 1LS1A 4NCIA 2CLSA 1GNRA 4TL7A 4RY2A 3GP8A 1KSJA 1ZJ6A 1XTJA 3OIYA 3MLEA 1AK2A 2C04A 4OQFA 3CNLA 1RIFA 2NIPA 2J7PD 3U2QA 2Q3HA 3WP1B 1SHZA 1ZCAA 1K5DA 1R0YA 2CJWA 4OK3A 4C0SA 3DZ8A 1HV8A 2YNMA 1SZPA 3JZAA 1WBBA 1G8HA 3TE6A 1TQ6A 2D2EA 3BRWD 5FPTA 4Q7JB 3LBHA 4MRVA 2ZR0A 3CF2A 3EX7C 3UPUA 3K9NA 2FFBA 1FOEB 1QRAA 2KB0A 5K8LA 2A2ZA 2ORVA 4JYCA 2QAGC 1TQDA 4NBSA 2CL6X 2ANCA 3X1YA 4XVQA 2AD5A 4JKYA 3BC1A 1SQ5A 1Q3TA 2J0UB 3HYTA 3EC2A 3DO6A 3RRNA 2BBSA 1FUUA 1G3RA 4FXPA 3CRMA 5L3QA 1E32A 2WTUA 2KI5A 1QHGA 1VG8A 1Z0IA 1CJMA 3FMIA 4BUJA 2KBEA 2EYUA 3K8YA 4MYCA 1XD8A 2YOGA 2G9NA 2DB3A 1NVVQ 3TGPA 3UMRA 1VECA 1WGWA 3ZD6A 1OPXA 4B75A 5EP3A 4CEIA 2YC4C 4PC6A 5F98A 1Z2AA 2DHRA 1RPZA 1MKYA 2PMDA 4D25A 4M0LA 3KL4A 2Z4RA 4PSKA 2C03A 4Q5IA 4MH0R 1Z6TA 3MWJA 3QG1A 4PC1A 2CHQA 5IHPA 2Q9BA 4TL6A 1DAFA 4FMDB 2O8DA 1UDWA 4TZ6A 5C1BA 3PUZA 1RJ9A 2OCPA 5GVRA 3HU1A 4TMWA 4BASA 5JJIA 4EPWA 5JMTA 2J7KA 4WIAA 4H9GA 1E69A 1J7KA 4LYHA 3KFXA 2ATXA 2W2VA 1NVUQ 2MMCA 1YZLA 4DIEA 3V9PA 1X8KA 1AA9A 1N2CE 2DYKA 2L0XA 1N6RA 4C0JA 2RGBA 4LPKA 4KVAA 5A5GA 1TF7A 5ELXA 4B43A 3GQBA 3V00A 3ZQJA 3R7WB 1NRJB 4Q1CA 2R6DA 2CJWB 1R0WA 1DELA 2RHMA 1AGRA 4DLUA 3FE2A 1II0A 4AYXA 2O8BA 2D4HA 2GCPA 5AJVB 2CCGA 4LJ7A 4RSGA 4DLTA 2W6ID 3W8NA 5DN6D 4TWZA 2FV8A 1DAHA 1TAGA 4PO8A 2GWHA 1E2IA 2W00A 3LY5A 3U3OA 2GAAA 1Z5ZA 4QM6A 5K8IA 1A2KC 2GK7A 3Q85A 4B6FA 1KK2A 4TYNA 2C9CA 3OFND 3TUIC 3KUDA 3WXMA 2GNOA 3HWSA 5CLQA 5K8TA 1VCMA 3CWZA 3OHMA 5L3QB 1NY5A 2ZU0C 3DKVA 2PT7A 2KWIA 3QBTA 3CNNA 4I1SA 1PUIA 4QOSA 5CM9C 1FNNA 1NJGA 1JQJC 4MA4A 4D4KA 1Z07A 3QBVA 4DLZA 1RRPA 1JPNA 4JT4A 2BOVA 1GKYA 3WMGA 1C4OA 2VP9A 2A5FA 3NC1C 4QGFA 4PPQA 3BBPA 1E1QD 4LHWA 4CEIB 3CH4B 3B82A 2EWWA 5HKKD 1XZPA 2V1XA 2W6IA 2V6IA 3MGCA 5DN6A 4A82A 5HE9A 4WA7A 3A1WA 3RANA 2B92A 3LH5A 3SU8A 4AK9A 1W7AA 5CYPA 1VYTA 4XWAA 2B8TA 2HCBA 4PAMA 4GMXA 1PJRA 1XD2A 1RJ9B 2FPMA 2FNAA 4RD6A 3GEIA 4QRHA 4D81A 2JLUA 4Q9KA 2C9YA 2LKDA 3OFNA 5FBRB 3WYFA 1ZM7A 5EJEA 4US2R 1OH8A 2OM2A 3DPUA 1GVNB 1P73A 2HCJB 3ZIAD 1EK0A 2V7QD 4HAUA 1G3IA 3CW2A 4URWR 4C0QC 3EC1A 4NTZA 1JI0A 3AKEA 1G4AE 5FUXA 3VQTA 3DHWC 4A4DA 5FFMA 3Q8XB 2JEOA 1CU1A 3BS4A 3C14C 3FMPB 4Q7MB 4DLXA 3U60B 3QKRA 5HKKA 4OJQA 3GEEA 1P61B 3ZS8A 4A0FA 1NVVR 2XEXA 2O8BB 3VR4A 3ZVLA 2ZVQX 3ADKA 1J90A 3F0TA 4DHEA 1YKSA 4G5GA 3SYLA 1ZU4A 3RHFA 4LJ5A 1KK3A 3UMFA 2XJ9A 1ZU5A 2QY9A 3CO5A 2WWGA 3FMOB 4BZPA 4DLYA 1F48A 3A58B 4LJAA 2ODEA 2FFHA 1T3LA 2VP5A 2DWOA 3KQUA 2V6JA 1XRJA 2FFAA 3ZIAA 2RGCA 1SVIA 1UPTA 2HF9A 2V7QA 4M22A 4KXFB 4EPVA 3F5FA 1BMFD 3F3YA 1CRQA 2HYDA 4V03A 2GEVA 4KVGA 521PA 1KI4A 1EFHA 1LV7A 4Q4LA 4IDPA 1N0WA 4JL5A 1DAEA 2OO7A 3CX6A 4NCHA 2P5SA 1X8LA 2AFHE 3CKLA 1ZD9A 5AR1A 3SOPA 1HYQA 1E1RD 1XJQA 2J41A 4J0QA 4BFSA 3ZZ0A 1KI9A 3EG5A 4ERNA 2VHTA 1FPMA 2GZDA 3QVUA 3CPEA 3R8CA 3RC3A 1FMLA 5FOVA 2P67A 4JVSB 3B13B 3UWOA 3QKTA 1CEEA 1OF1A 2WWYA 2QBYB 1KAGA 3VR5A 1E2NA 4B48A 4CYMA 1W5SA 5TY0A 1XBTA 4FIDA 4LHYA 3LAWA 5EQTA 4JVNA 2VSXA 2FEOA 2QP3A 1BMFA 2H5EA 4YLGA 4P0TA 1SVMA 4TMVA 4ESVA 2O5VA 2F1RA 4DSUA 1XX6A 3CZQA 4HAVA 1US8A 3CONA 3FKQA 1XD9A 4DB2A 1S0UA 4AKGA 4DWJA 1CBUA 1Z0JA 2QI9C 5JEEA 1CTQA 2BC9A 1E2MA 3QKRB 1E1RA 4JT2A 1EGAA 4M1SA 3QG5A 3AVQA 1RRGA 5JS7A 2AWNA 1I4DD 1IM2A 3FHTA 2OLJA 4JLMA 4LV5B 4G5OA 4PQFA 1R5OA 1WB9A 3EZ7A 4U7DA 3AB3A 3EA5A 3CPHA 2B7CA 4C2UA 2LWIA 3AGQA 2I4IA 2G3YA 4GPTA 3TVDA 4IXNA 4R98A 4M4SA 3AEZA 4E09A 1M2OB 1Q0UA 5BN5A 1ZM3A 4CT4B 5BYJA 2DFTA 2C98A 3PG5A 2OBLA 5FTNA 4EPRA 4BRUA 3SN6A 1H8EA 3O8BA 2P6RA 1IOZA 1KKLA 4EDHA 5AUQA 4L5BA 3T12A 5AUNB 2DWPA 5HCIA 1DS6A 1NVXQ 1NKTA 3NEJA 3AM1A 3ZDQA 3TLXA 3PUXA 4NCKA 3FMFA 2VPPA 3SE0A 2V54A 4KBGA 3NBYC 3MJHA 2QBYA 2QT0A 4DDVA 4MQBA 2R62A 1KO7A 4I4LA 4Q47A 5CK4A 5DHFA 1O87A 4TMTA 5J5CA 3WYGA 3C8UA 3B85A 1RW4A 2EVWX 1NIPA 1KGDA 4FCTA 1W44A 3CUEF 5CDFA 3HJNA 5H68A 1DPFA 2F3RA 2WPDD 2EWVA 3BJIC 5EE3A 5FOXA 1XTKA 4Z8YA 2OG2A 1PZNA 2F9MA 3GD7A 1XPUA 3EXAA 1OSNA 1L7VC 3ZVMA 3RS3A 2PLRA 3FHOA 2JLWA 1Z47A 1G64A 1OH5A 4IRUB 5B2ZA 3THOA 3B2EA 2WM9B 3CLVA 3GLFA 4JKIA 1E98A 2AKYA 2QENA 3GJ7A 3U44A 2ZSEA 3R20A 1Z2CA 1QVRA 3UG6A 5AWFC 2O8FA 2WJYA 2GKSA 3GJ8A 3IO5A 4NONA 4QGHA 4UNPA 4B3XA 3LD9A 1E0KA 2NZJA 4WBSA 5G3YA 1P7CA 3U3KA 3CIOA 3TIFA 2WOOA 3VAAA 3AGPA 3EWSA 1OYWA 4YONB 4Q4HA 4S2EA 3UKDA 1P9RA 2BJWA 3WNDA 4NDZA 1B23P 3LXRA 4LBVA 4X8HA 3WHLA 4LI0A 5L8VA 2ZRAA 4IDNA 3K9HA 2WPDA 1KOFA 2EU8A 1IY2A 2PBRA 2IF0A 3PQCA 4LYFA 2HV8A 4Q9IA 4PZLA 2WAXA 1UBGA 4PQYA 5KYKA 2FZ4A 1CJUC 2RGGA 1W4CA 2WWIA 4BFTA 2ASEA 2HUPA 1W4RA 3QF7A 1Z83A 2GF0A 2VP4A 2AXPA 2W2TA 4JVMA 4Q1EA 2JLSA 2QM7A 1GRNA 3WY9A 3KQKA 4XVRA 2ODWA 4RD2A 1UADA 3NIBA 2V3CC 2BEKA 4Q1AA 1N6LA 2BKUA 4I1VA 4LBYA 1GRQA 3B9PA 2W58A 4LCBA 4MRPA 1U90A 4NKRA 5G3ZA 3K09C 4LHVA 3GJ5A 1ZNWA 4CIDA 3B60A 1KJYA 2ZU6A 3H86A 2IUTA 2FGJA 2PEYA 3CBQA 2W0SA 2H17A 2JJ1D 1SKYE 1YRAA 3LVQE 4OBEA 1RKBA 4W9MC 2CLDX 1IN5A 1U81A 1W48A 1UKYA 1XDBA 3A1SA 4QBFA 1QHIA 3KJHA 4BFXA 2W83A 2ORWA 2D06A 4RZ2A 1RRCA 3KZ1E 2FPLA 5G40A 1BS1A 3L0PA 1E9BA 3BERA 1GG2A 1G291 4MRSA 4OQMA 5TDHA 3W5IA 2QMUA 5H1YA 1HA3A 3QPUA 4AG5A 2J0QA 3EZ6A 3PEYA 2B7BA 1E0AA 1GNPA 1Z0AA 5A0FA 2OT3B 3LQRA 1FMJA 1NG1A 2O8EA 1ZW6A 3Q5DA 4OK6A 1YZTA 4Q9JA 1Z3IX 1E2KA 1DAMA 3WRYC 2IX3A 2O8FB 4GFDA 4XJXA 2MSEB 3DKPA 3AUYA 5J4LA 3WMFA 3EA0A 3KKPA 4GI7A 1R8SA 3BB4A 2CE2X 3A1TA 3VR3A 4Q21A 1QHHA 2RCNA 2AD1A 4B33A 4Q4HB 1IXZA 4B76A 2JJ1A 1T0JB 2G83A 3ZVNA 1A4RA 5CLLA 3DM9B 4TT3D 2D62A 1DEKA 2NQ2C 3K0EA 2GXAA 4B3CA 5BN3A 1GL6A 1F2UB 2J9RA 1Z6GA 2NPIA 2W0MA 2QNRA 2ZE5A 1W1WA 4PPNA 3LNCA 4P31A 4O0MA 4P32A 1MOZA 2OBNA 2HDNB 4XD7D 5LB2A 4FCWA 1ZRHA 4BECA 1VMAA 3WRXC 3ZZTA 4C0KA 3TQFA 2JLXA 3D3QA 5EUMA 4D80A 4KJZA 2JLRA 2B21A 1RRFA 4JLOA 1XP8A 2YVUA 1J70A 1NLYA 4A0GA 4LZZA 5KUTA 2F6RA 4OL0A 2OSBA 3ECCA 2O0KA 2XZPA 2XNDD 5ANRB 5CIQA 4POAA 5JRJA 2BM0A 1E9FA 4TT3A 2A5JA 2QUZA 1JB1A 1LVGA 5KDLA 3CPJB 5CYOA 1ZIOA 2J46A 2KJQA 2KSQA 5JFGA 2WJVA 3SJZA 2HYIC 4C2TA 1DO2A 4XD7A 4V0LA 4RKEA 1EWQA 1KMHA 5FOWA 3RVBA 4ACAA 4ON9A 1CR0A 3W8RA 1TL7C 3AVWA 4NH0A 3TW4A 2O8EB 1P4SA 4A6XA 4XSGA 1R4AA 2FZLA 2XB4A 3H84A 3R8FA 4L8GA 5UKDA 4CZ2A 3KQNA 1TU3A 3T1OA 3W3AA 1HE1C 1W4BA 3B78A 4BEJA 4C4PA 2QL6A 2XNDA 3PV0A 4KFUA 1QHHB 2WJIA 4LY6A 4IFBA 4BLRA 1E94E 2A30A 2ODBA 3LX8A 1HT1E 3BH0A 4MRRA 2H7VA 2BBWA 4R7ZA 1GUAA 4WZBE 1YE8A 5JHGB 3AV0B 3TNFA 2YOHA 5E7IA 4LWZA 2GCNA 3S1AA 3FYHA 2GVDC 2OE2A 2VBCA 1LS6A 1KIMA 5F9HA 4Q4AA 1EFUA 1AZTA 1CS4C 2PLFA 2BCJQ 1PLKA 3BH6A 1XU4A 2VLIA 1ZCBA 1DG3A 1XMVA 4QBHA 3UANA 4AD8A 4IW3B 4C3ZA 1KI7A 2BCGY 2H16A 3U5ZB 2OXRA 1JR6A 3UXMA 2ZETA 5JRZA 2N1BA 4MUAA 4O25A 3AP1A 2VIIA 2WMNB 3C7KA 3K53A 3WBJA 4ZCMA 3GCGA 4FN5A 3SBDA 2ERXA 3KUCA 2PX0A 3IO3A 3NG1A 4G5SA 1Z0KA 3ND9A 5KO2A 3ICQB 1MABA 2BEJA 2JJ2D 4TZ0A 2IS6A 1CJKC 3IIJA 1G16A 1TEVA 3L8YA 2RHDA 3GPLA 2DFNA 2ZRNA 3M6AA 2IYVA 4D0NA 4TMXA 4HB2A 1X86B 2ZITA 4B2PA 2ZE8A 1E9DA 2QAJA 4NYIR 4QGAA 3SFZA 2OFWA 1MR3F 2CVFA 4WOPA 3W5JA 3X2SA 3U7GA 1KMHB 2P6UA 4E22A 3ZGXA 4ESHA 1JQLB 1Q1BA 2J0VA 5JLJA 1WQ1R 1AKEA 4IJMA 2JATA 1ZUNB 2CL7X 2FMXA 2RGDA 2ZTSA 1WF3A 2WWXA 2QSZA 1KDOA 2QZ4A 1FX0A 5KDOA 2GETA 1JJ7A 2E87A 2D7CA 3AVVA 2DBYA 4KYUA 4ZDJA 3AP3A 3CX8A 1FW6A 3QENA 2VA8A 5JI3E 2DCUA 4BFUA 1G5PA 3I1FA 1GKIA 3OF5A 1IHUA 1E2GA 2ZJ5A 4KO8A 3VFDA 4M53A 4G01B 3ZS9A 2IS1A 1LB1B 2GZHA 2JJ2A 3S1AB 4HDOB 2R44A 2CLCX 3DL0A 4UJ5A 1IJEA 1E9EA 1LF0A 2FA9A 4Q4AB 5DLQC 3DM5A 1YR8A 2Z83A 3R7WA 1KY2A 5JZVA 4L16A 3TSWA 3EPHA 3SHFA 4B6EA 1UFQA 3C41J 1HY3A 3QJYA 5B64A 2XTZA 3L43A 3IEVA 4F38A 1OH7A 4IFEA 4UXIA 2ZJZA 5DI3A 5FR2A 1GIAA 1OIXA 621PA 2F3TA 2OESA 3U6KA 4TYQA 1P2VA 4B3GA 4B3BA 4X8OA 4F4IA 3K0CA 1XTSA 2GAOA 5L3VA 1AM4D 2GZAA 2YJTD 4D2IA 5HPYB 5LD2C 2W2XA 1WBDA 2H18A 3AF2A 4KI0A 4RFVA 3VNVA 4TMZA 3JZMA 4PZYA 1QHSA 2CHGA 2QRNA 5FPYA 2F1JA 1XTIA 1UBEA 2Z6VA 2QA5A 1CIPA 4X8MA 1IN4A 1J2JA 5AJWA 3GJ4A 1MABB 3GJ6A 4IXMA 3T5GA 1PLJA 1SHKA 3TAUA 1LW7A 2J7PA 4FMCF 4HLUA 4CEJA 1UEIA 2REBA 4M2LA 4II7A 1DARA 4URYR 3MWYW 4R2IA 3CRVA 4M1KA 1KYIA 1XXHE 4A8JC 4O3MA 2ZR7A 3BWDD 1NP6A 1A5TA 2YWEA 2ZRPA 1L8QA 1Z29A 1E0SA 2ZS8A 2IYQA 1D9XA 2NTYC 3I8SA 1QVAA 4RKFA 3FFAA 1FX0B 2OLKA 5TXGA 1KZGB 4OHZA 2RKOA 3THWA 3K0AB 1HTWA 1A7JA 2C8VA 1YU9A 4EAQA 1JECA 2OFXA 4A2WA 4DCUA 3HYRA 4F4JA 3WP0A 3UG7A 5CIWA 3RWMB 3CNOA 2RAPA 4JJZA 1KHTA 4PHHA 4DCVA 4MKHA 1F5NA 1KAOA 1NL3A 5JJKA 3AP2A 3ADCA 1E9AA 3QE0A 3G5UA 1Q44A 5FI1B 3KQLA 2A5GA 2Q3MA 2QGZA 3EW9A 2QTFA 1D9ZA 3KKNA 4CEHA 3MSXA 3RRYA 5AJZA 4F93B 2FG5A 2VEDA 3LXXA 1DO0A 4JLKA 5DI3B 2YZ2A 3WBKA 2ZRCA 1N25A 3OIVA 2IYXA 1XTQA 1D2NA 1YZNA 5DSZA 1LY1A 2J3EA 2NO0A 2SHKA 4PC7A 3T1VA 1FP7A 2ZYVX 2IXFA 3QKSA 2XZLA 3QVVA 2DFKB 1W4AA 2OV2A 4C9BA 5JHHB 2IA5A 3EPLA 2ZI5A 4BEBA 1HUQA 1OXTA 3IHWA 3MFYA 2PEZA 5FI0B 1YZQA 1S1MA 1ZAKA 4IVQA 2BV3A 5E7MA 1P2TA 4LV8B 1KK1A 3UIEA 2IHYA 2IXGA 4FCVA 3LV8A 4MDFA 4CEJB 4JL6A 2VRWA 3HP1A 3TAHA 1DADA 1ANKA 3VMFA 4OQLA 4YDSA 5DGXA 4GZMA 5KSZA 2JJ8A 3EIEA 1N5IA 2TMKA 1U99A 1ZNYA 4MKIA 3A4NA 5E3HA 1W36D 4FINA 1UF9A 1OLOA 2R65A 1XPOA 3FPAA 4TLDA 4OI0A 3L8ZA 2ZSFA 4QJ5A 1I2DA 3FOZA 1YZGA 2WZQA 4LHZA 5F9FA 3QXSA 4MUBA 1FNMA 2P2LA 3AVPA 1WP9A 1JAHA 3IUYA 3THWB 4LJ9A 2ZR9A 1FZQA 4DLSA 4IEIA 4KLZA
chains in the Genus database with same CATH superfamily
2VEOA 1A7VA 2HCRA 1TUIA 2BMDA 1DFIA 4TTQA 3DVRX 3DEIA 1P9WA 3T38A 4RCVA 4CEHB 1JXMA 1ZK4A 2VJDA 4J94A 3AVXA 4D4MA 1JPUA 2PKEA 3QEMA 5I9MA 1H9BA 4ACBA 5FFNA 4DY6A 2NPFA 5CITA 4O2LA 1ZPDA 3R7SA 2GAFA 4EX6A 4I81A 4WOCA 2GCGA 2YFKA 1JZSA 5EP4A 4ZOBA 1X74A 3EVBA 4E94A 5H59A 1P3Y1 2JGEA 3RVOA 1DC8A 3CVWA 3ZY3A 1CX9B 4OX9B 1RXSA 2DCMA 1B16A 2GUGA 4OFWA 5JSUA 3KT8A 1JR3A 3LT5A 3U09A 1J2TA 4RVOA 2ZK7A 2BEWA 3GM2A 3IBSA 2EDAA 4B8ZA 4HDMA 4B2LA 3OESA 4Z9BA 2HEGA 3M34A 2GXQA 5HCNA 4PG7A 3ND7A 1AN0A 4YRGA 1QNFA 3HU3A 1JR8A 4R2HA 4RTPA 3R3VA 3VM6A 2HRBA 4HNTA 4B8WA 3K1HA 4C14A 1DIHA 2X7XA 1F6DA 4XEUA 1VKJA 1GNLA 3DKKA 2OD7A 5AMXA 1LSSA 3G68A 2XUAA 2BTOA 3OEED 1PFYA 2FVXA 3HNIA 2AXNA 5KOIA 1C9KA 1D0IA 4NJMB 1FFCA 3LU1A 1P7PA 2OGTA 5H02A 1NLFA 5JSHA 4RF3A 3FVYA 1YZYA 2LVBA 2RK6A 1NX9A 1ZH2A 5F9MA 4OATA 2YL1A 4KITB 3DZFA 4XVUA 3KT0A 3BEHA 1NJ6A 1G8XA 4FDUA 4O1HA 1TM4E 4UBOA 4F2GA 3DMGA 1F2UA 3RH0A 1GRRA 3PDIB 1SVWA 1GLVA 2GJ9A 3VR5H 3HK2A 4DV6B 3D0RA 1KZYC 3Q3CA 1XWIA 3BRQA 1OJLA 2Z9DA 4AXXA 5LYJF 2AOTA 3CEJA 3NBZC 1VJDA 2V26A 3GLGE 4MITA 3BMQA 4GVPA 1QPBA 1EKXA 5DGIA 3UC5A 1Y1PA 3D1LA 3RSOA 3HR7A 1A8QA 4WBXC 4DUPA 4GICA 3V6MA 5EMJA 3NTRA 3SF0A 1WWKA 3RNLA 4DPMA 4KXQA 1E2QA 2H2AA 2QXYA 4A92A 2B94A 1DU4A 4CS9C 1T0PA 4EKYA 2DQKA 3L5KA 3WSWA 4IFTA 2OYCA 1E18A 3TCXB 4IJ5A 1UMBB 4R1PA 1N5LA 5KYUA 4TYYA 2ZJ0A 5G4LA 2ZE6A 3H7AA 3X0DA 3SFTA 5IZ4A 3KTAA 3MUEA 3GLGB 4R8VA 2Z2ZA 5AOAA 5LBIA 1DWOA 5CB6A 1ZESA 3A06A 4P82A 3D6JA 1ZIXA 1ODJA 4LKOA 5IYZA 2XGGA 1BX3A 4FD2A 5F2KA 1ECPA 2ZB4A 3VHXA 5GOTA 4QXPA 4K26A 2Q99A 4FZ5A 2RHWA 3RIPA 5SYNA 4NOMA 5JQGF 3QW2A 1VCNA 1YZUA 1TQ4A 1HWYA 3PLRA 1OT3A 1E2JA 3DTVD 2P0AA 3NYWA 2NZYA 1EVKA 4HS4A 3UJ3X 3LKBA 1BXRA 4QEZA 4AJ4A 5CVEA 3STYA 4GLOA 4Y2GA 3P0JA 2XA1A 3UCXA 3F8TA 4JYPA 1OGYA 2PMFA 1OB5A 1WZIA 1WLSA 4F9GA 2ZRBA 4JSRA 2O3JA 5LQUA 2F43A 4ILEA 1G8MA 2P4SA 4JK3A 3RDPA 3IP7A 3V1MA 4G24A 3HCDA 1JLMA 5IP5A 1V4VA 3KNZA 1NXOA 1YV9A 1QRRA 5L3SB 3EQZA 1YR1A 3BFPA 3G2NA 3VNUA 3LX5A 4N7RA 2QV0A 2VO1A 3HZOA 5I7VA 4E03A 3LBFA 3RASA 5ELMA 5CXQA 2NGRA 4PAGA 3D3KA 4M7WA 3CH6A 4HYYA 1C17M 1ECGA 3PICA 4EHNA 2QDXA 5EWLA 1QCDA 3MRXA 4R3UC 3H99A 3BYZA 2P69A 2GTIA 4JA2A 2R03A 1QR2A 4F4UA 4IJVA 4BQOA 3NUGA 2PMWB 4MCIA 3F6BX 1K3FA 4Z9FA 1SQGA 1QZXA 3S9OA 1NM5C 5HW0A 2KLHA 1JIIA 3V8QA 4F5DA 5L4LA 1F3LA 3W04A 1GTMA 3WWPA 1NZEA 2WVHA 4R40A 1FA9A 3C5VA 1NQVA 2V6BA 1MGOA 2E4VA 4HN2A 4X9XA 3BFXA 4GBED 2CLIB 2CUTA 3BA1A 4UHFA 1EP2B 4EUFA 4KWTA 3P2OA 1QG4A 4LY0A 4C0LA 3AT1A 3AI1A 2QZPA 1Z56C 2AL7A 3P4UA 1SPBS 3Q7RA 2DG2A 1LLFA 2QVZX 1P9OA 2YWFA 4O4HB 2TECE 1OKKA 2SKEA 4EHPA 2OEPA 5JD6A 2QORA 4RXMA 4GR4A 4ZMBA 1XAJA 3EZFA 4NESA 5DCLA 1JTFA 2H51A 4M9SA 3HM2A 3GJTA 3SY8A 3T5PA 1SKUA 4WLEA 2C4UA 4DLRA 3L7KA 2ASRA 1VL5A 3H97A 4Z51A 4O08A 4HG2A 3PQDA 1FFXA 2WY2D 4EY5A 1G8FA 1GSIA 1CR2A 5CVVA 2GPSA 2NUTA 2O3UA 2JLVA 1D0YA 1W0KD 4B85A 4GQHA 3TOSA 2QTCA 2AXEA 2D5BA 3FMVA 3MJEA 3WLLA 5BQIA 3LRTA 5I7SA 1N5JA 2QTVA 4BX9A 2ZIXB 4ODIA 3DXYA 2QY6A 1QPGA 5KYWA 4X1OA 2X8JB 4TN5A 3ZV7A 3BXPA 4W8KA 1H1LB 3P8ZA 3RQGA 4M1OA 5AYVA 3BORA 4YRZA 2G7ZA 5M34A 2H31A 4L78A 1JAXA 4CKZA 2DHDA 2J0WA 3KYCB 2JFYA 1U4SA 3B6EA 1B73A 4US1R 3W5CA 4DADA 3UMGA 4AYTA 3GFTA 4CL2A 2P1AA 4OKSA 4CIHA 1ZZEA 3V5NA 4CX9A 4JI8B 2VI5A 5PNTA 1R3DA 1NTRA 3U0VA 4QM7A 1MA0A 1BKDR 3H19A 4KU4A 2JGJA 3I73A 2HSQA 5JJCA 5E6UB 1ESNA 3AWIA 3VNQA 5JD5A 1I24A 1UMCB 1KFCB 4N18A 3V2IA 2WIFA 1ORIA 3WHNA 4QVKA 3PZBA 3UAGA 3AR9A 4MV3A 3EDQA 4N6HA 2WFAA 5DRTA 3WB2A 4W7HA 2W2LA 1THGA 8ABPA 4GSLA 4I1UA 3G0IA 3O8CA 3VOAA 5AM2A 3ET5A 3O38A 1JV2B 3SJBA 2XYHA 4QBIA 3RS9A 3VHQA 3NTLA 4P4LA 4CMGA 2B1RA 4MVWA 5EHNA 3ZZ1A 3C7DB 1XEWX 4A0RA 4ES6A 4LWPA 4KUHA 2J9GA 1ACMA 3JVIA 4AU1A 1L3IA 4XQEA 1CUFA 1NP3A 3VKWA 4U2EA 4RCZA 4GPAA 4KOEC 1D3AA 3F6YA 3DXXA 3MAAC 1T9DA 1HMDA 1P74A 3L8IA 4QPJC 3SZMA 4QTYA 4Z7NB 1D4AA 3H05A 4I46A 3SBOA 2X5JO 4HLDA 2JPDA 4AAYA 4ECAA 5D3QA 2WSYB 2O0LA 2A6HF 3WKAA 2WBLC 1YOVB 3HB1A 4TROA 4BNGA 3CLKA 4Q00A 5CURA 4BZQA 3EXG1 4Y9RA 2XT6A 4GVXA 1UXJA 4B71A 2YW9A 5C81A 3MVEA 2FSIA 3AYZB 2NX2A 3RIMA 1HQCA 4ER7A 5LL6P 2GWRA 4LRQA 4D0GA 2HMWA 1UM9A 2DM6A 3LPMA 1UR5A 3A4MA 5THQA 4DTIA 3TIXB 5DK4A 5DYTA 3FMGA 1YUNA 1FP2A 2C88A 4JGGA 3FVQA 1WABA 3T4UA 3DE4X 3D31A 4MUMA 1OILA 2LSEA 3C45A 3O26A 4ZTBA 4XJTA 4C5BA 2EATA 5TRTA 4EA9A 5TQ2A 5E3CA 2JIDA 1Z26A 2HLDD 1KVSA 4D9JA 1OR2A 2GWWA 4D43A 1F7VA 5JJLA 3FB1A 3P2EA 3LUTB 2DBVO 2OP0A 2REOA 4AO7A 4UEWA 3K9WA 1N1GA 3NIDB 5GADl 3RIYA 1BYIA 3P4YA 4Q3LA 4FFMA 4FGLA 1Z4NA 1JQ5A 2YNMD 5L7WA 4URZR 1QO7A 5JISA 4QDOA 3TQRA 3M6WA 4OKNA 2I3AA 4MQLA 2LD6A 3IPLA 1G66A 1JX6A 2A57A 5CHEA 4LOLA 4Y30A 3QWBA 1ZCAA 1K5DA 4F85A 4WUVA 2EFJA 3OFSA 4KPYA 2DUMA 3LBHA 4KYVA 2JLCA 3CF2A 1PHPA 4UMFA 2AQIA 4JH0A 2CL5A 3T8YA 4B79A 4EFDA 1N7JA 2QUIA 4FXPA 2QR2A 3DW3X 3GB9A 2KBEA 2L6HA 1TFOB 3KIPA 3I9V1 2YUTA 5L95A 5A5EA 4H1HA 1PFQA 4J9UE 4FSHA 3DBRB 1T4MA 4BASA 4EPWA 2IZZA 4GPD1 1VB5A 5K0JA 1DZIA 1EH5A 5DF1A 3BWCA 3MGGA 3W2FA 2GLXA 3PQEA 2XMBA 1R0WA 2BONA 1LA2A 1II0A 4AYXA 2O8BA 2GCPA 5F77A 3C7CB 2FV8A 1L7BA 1SC4A 3GANA 4PO8A 3OA1A 1PUXA 1QUEA 3LY5A 2BFPA 4OMUA 1QQ6A 4IKPA 1KHHA 4OQ4A 4AZVA 4HL6A 3ANYB 3RSGA 2D0OB 4S0XA 5MN5A 4O2BF 1P2DA 3NRCA 4GEKA 4XR4A 4CEIB 4NBVA 2EWWA 3RQEA 3LH5A 2PD3A 4GMXA 3TXAA 1PJRA 1K04A 4RD6A 4DXDA 2C9YA 4KW7A 4BNMA 3KHUA 1OH8A 6ADHA 2HCJB 4YRKA 2FR8C 3T0GA 2PFKA 5TLSA 3M5WA 2YDYA 1AKTA 4HV4A 2JJQA 4XSVA 1Y42X 5JXIA 3DD7A 3H1GA 3A58B 4LJAA 2LW7A 1UPTA 3FPEA 5A7HA 5JPCA 4KXFB 5A6BA 4DCJA 1U28C 3OZIA 4W5TA 2PRKA 4IDPA 5AKYA 1ZD9A 2X5NA 3EIXA 3OTOB 1Z39A 5KC8A 2HU2A 2PLWA 1XHFA 3KR1A 3R8CA 3RVZA 4JVSB 2A9JA 1XUOA 1YVIA 3A1EA 3D7KA 1XDZA 4HUJA 4RENA 4BKUA 4A8HA 5EMHA 3BIWA 4DUYB 1FUIA 2O4UX 4L3VA 4AKGA 2CSUA 3A7DA 1QRDA 1BNCA 3H8SA 1TFRA 4QNNA 1GFWA 1GUYA 2LIPA 3EZ7A 4GNRA 2JI7A 3HGMA 2YNMC 3FA2A 2GX6A 5B37A 3ICWA 1W25A 5JAQA 4CT4B 4OLJA 1YASA 4EDHA 5AUQA 1GSOA 1NKTA 3NEJA 1NAHA 1VBKA 1VE1A 3MJHA 2R4UA 5J5CA 3M9WA 2A1TS 5D00A 3RJ9A 4LRSB 3IERA 2C1XA 3WSTA 2WYIA 2R8PA 1U5BA 2F59A 3KEFA 3FHOA 1Z47A 4I55F 2EZTA 3RSSA 2IP1A 3GLFA 1M6WA 4PNPA 3GJ7A 5F7OA 3AUJB 5AWFC 5MHTA 3TQQA 1E0KA 5SY4A 3ENKA 1M66A 1NLMA 2JEYA 3PDUA 2NSLA 4LBVA 1SCKA 2HNBA 1KOFA 1UBGA 2J9BA 2QTGA 1CJUC 1C03A 2MYNA 3LZ6A 4YRBA 2QM7A 4BO8A 1VL8A 2BYTA 3CN9A 2ZATA 1NC1A 4DMHA 2UXCB 4NFSA 4RGBA 3NATA 1GS9A 3LVQE 1RKBA 2H0AA 1T2UA 1E59A 4CCYB 1G291 2JD2A 4YRIA 1OXKA 3UTCA 4OTZA 2C3YA 9LDBA 1ZW6A 4Q9JA 3FOWA 1PQPA 4BMSA 4HVCA 3DKPA 5J4LA 4J7TA 3MUNA 3VR3A 5A9SA 4HT3B 5JRAA 1OY1A 2RKBA 1A4RA 4DBRA 5EZYA 3SZ3A 1YQQA 2E6KA 4MLZA 1OX4B 3VPBA 4CMCA 1Z6GA 3EXIB 3CLRC 2G3VA 1QCZA 1GPMA 2X8LA 5IEBA 4D80A 2XQGA 4I4NA 4DLAA 1FFAA 3D3NA 3F9IA 3EVAA 4U5GA 2O0KA 5IJAA 4CMAA 1QC5A 2BFNA 4AO6A 4GRIA 4AP6A 3CPJB 1PEKE 3LQFA 2OQMA 9ABPA 2G5PA 3G5AA 3QK7A 3G2HA 4RKEA 4EKEA 5ESWA 1R4AA 2PA3A 4L8GA 3RAGA 5EIBD 3B78A 2VR1A 1UJ6A 3UMJA 4PW0A 4E08A 1QVXA 3AK4A 3TD7A 4COKA 4MVQA 2CFRA 2Q5OA 3NBKA 4KQ9A 3PE4A 1FVHA 2RIPA 3AI7A 1VIDA 4HOYA 3SE7A 2R0QC 4LSWA 3MB5A 3P9NA 4K7JA 4XCVA 4D1YA 2VIIA 3DE6X 3C7KA 4XWJA 4AMVA 4CQMB 4TTIA 3WGMA 3U9MA 5TQJA 1ZXXA 4NTAA 3MJ4A 2RHDA 3GPLA 3OQIB 2IYVA 3AFMA 1QV9A 4TUYA 3W5JA 2XDQB 1SU8A 4CU5A 3AEKA 3B9BA 1OR8A 2ZTSA 3CZAA 4X20A 3S70A 4DL9A 3WLMA 1J25A 4LMRA 4ZAGA 3L07A 3I1FA 1DT3A 5LXTF 3U4CA 1C0IA 4IINA 3MX3A 3S1AB 5J5AA 1IJEA 5KREA 5I9NA 2B20A 3SHFA 4KPGA 3C41J 5T3UA 2M6RA 2FK7A 1DIGA 1Z3CA 3U6KA 1J09A 2XCUA 1AHPA 4JFRA 3AKZA 3D8SA 3AF2A 3VNVA 3TD9A 3PWKA 3DNFA 3Q5GA 3X1OA 4KQ1A 3U80A 4FMCF 4HLUA 3UWSA 3STUA 3IDZA 2EERA 2IYAA 2P62A 1NP6A 5KOJA 2ACKA 2ZS8A 2PPLA 3M7IA 2BMWA 1RWNA 5LKAA 1FX0B 1O6GA 1E6MA 5EZQA 5AP9A 2C8VA 5BSTA 3B52X 2NYUA 2CMDA 1KHTA 5FI1B 4CQJA 4PLHA 3CE9A 2XB8A 1S5PA 3EMKA 1H2WA 3O5AA 1ECBA 1XTQA 4PC7A 1W2WB 1JMWA 4PK4A 2VK4A 5FUBA 1W4AA 1A69A 5DFAA 4CF5A 5JARA 1GRVA 3T7RA 3IAHA 1JFFB 1S1MA 2F64A 4IH4A 1BW9A 4LV8B 2D5RB 2IXGA 5CT9A 2CXQA 3HP1A 3MMSA 4Q3NA 1V37A 2OTCA 5KSWB 1OLOA 5I7RA 1U0BB 1ZDMA 2PUCA 3FOZA 4UTNA 2P2DA 4QAQA 5JADA 3KUUA 3DP7A 4IH9A 3BD8A 3GYGA 5HBGA 4XYGA 1DEXA 3U7EB 4PZDA 3F4LA 3MTBA 1AZSC 5AJYA 1X70A 1AMUA 1K7YA 2ZB2A 4B74A 3IQXA 5EJ5A 4Q01A 2XCIA 3QZUA 5DM1A 3SP1A 5JPIA 1YBMA 1T8TA 2JLYA 3VU9A 1JG6A 2CK3D 3DD5A 2Z56A 2IHUA 4KQEA 3ZH2A 3EH1A 3EW7A 1LE4A 4E07A 1RZ3A 4D26A 3QWAA 4U3JA 3SIPA 3EB9A 1HORA 5IX8A 2X2FA 4W8GA 3E9DA 4OXKA 1JDJA 2IEZA 1PX0A 3EVTA 4CG3A 4EHAA 4KIJA 3LESA 4YMGA 4G0VA 2YJ3A 3BL8A 5DX0A 1W36B 4E1BA 1W9MA 2PGXA 4N49A 1T8WA 2VHWA 3BXZA 1Q91A 3D8NA 1U0EA 3V4LA 3CCFA 4EGFA 2I6UA 3KQVA 2P2CA 3PUHA 1O3UA 2PUBA 3RT1A 3TB6A 4LGVA 1AQJA 5EWMA 3AVYA 4H1VA 2NUPA 3TUJC 1UOOA 5F2EA 1IYZA 2FK8A 4OQZA 3SICE 5EXTA 3O3MB 3E5RA 2G0AA 1F6BA 4IO0A 1T1EA 3OH8A 3BD9A 3LLIA 3IIKA 5G0WA 3GWGA 1NR5A 2DP4E 3HUTA 4OA5A 4ZAWA 4ME6A 4MEBA 3EBOA 2CC2A 3RRMA 1WV0A 4BO3A 1Z4KA 1D8AA 2HC9A 1I2BA 3OLYA 3P9CA 1RYFA 4MW7A 2FHSA 3M9LA 4DCCA 2ZUVA 4TOIA 4RS4A 4MUEA 1DTWA 3HSYA 3L0IA 1HY5A 4MUFA 4KODA 2QPAA 1CRPA 2IK8A 1ILWA 1K6MA 3UT0A 2WJ6A 4Y2RA 1S1CA 1A04A 4NQFA 3UFXA 3EOAI 5DNAA 2JKVA 3PITA 1WMAA 3C16C 4JLDA 2RH4A 4HXEB 1ZMBA 2GKOA 5DNDA 1PW5A 4DLNA 4LGYA 1KZ6A 1T0HB 2Z6AA 4DRHB 4R68A 3AILA 1FYWA 3JQCA 4YJ2F 2FPXA 3C15C 1XZLA 1GPDG 3QTLA 4U2DA 4W63A 2ZJFA 2XM0A 5JNTA 2IEDA 4AY5A 1SC9A 2AMJA 3EVGA 3GNLA 2JAPA 2RJ3A 2BT4A 2QSUA 3ZDAA 1TO2E 4DQDA 3QVOA 4QA9A 4NZ9A 2WMDA 4TRMA 3GLVA 3K1YA 1Q20A 1MG5A 1Z4JA 2AH5A 1E2LA 4OINF 5JCPA 3H9JA 4QI0A 3KKZA 2QU8A 3VO9A 3D6MA 1EGHA 3RU9A 2I6QA 1EFDN 3U9LA 4LXHA 4AL0A 3H1PA 4C76A 2YN4A 1N34B 5H9WA 4E21A 1RM5A 1TZJA 4JLBA 2ECKA 1NVEA 5G53C 1RRMA 3R9XA 1EAMA 2DWQA 5IC6A 2VOEA 4EMSA 2IF2A 4NJEB 4MI6A 4QQRA 1AKQA 1CXZA 3GHHA 3Q72A 1CZOA 5J43A 1O5TA 4U5DE 4AKSA 1W6UA 1AB5A 3RC7A 3WLJA 1VSTA 3IV7A 5EJ7A 1W5EA 3R6TA 2V8BA 1ZBDA 4ZJYA 2WJ4A 1VDZA 2DQSA 1TK2A 3W34A 3COWA 3FFTA 2WHRA 2XVZA 3PVCA 4I1PA 4HGQA 3M6FA 4Q37A 3IQ6A 1J1UA 3FGPA 3ABOB 2DULA 4DA0A 3D3EA 2BKLA 3VYVA 4CVNA 2H2DA 3IDSA 5I7FA 3WISA 5E0OA 5AHWA 5GV7A 1WY7A 2QX8A 3I1IA 1M0TA 5G0VA 4DC0A 4CKBA 3PDHA 1Z2OX 4EUHA 4FBGA 4C01A 3T35A 1N3IA 1BS9A 1U0JA 4EJMA 4ONSA 4IAOA 2DFLA 1JQ3A 1GN8A 5C53B 2AFIE 3UQYS 2GVZC 2X2OA 1N57A 1D1QA 2V1UA 1W88A 3B6JA 2AUTA 1DOWA 3MRTA 5F52A 3Q12A 4HZGA 2AX4A 1N3LA 1TQGA 2UZAA 1N78A 3DDWA 3O8QA 1Z6PA 3A1CA 1Y89A 3FNIA 1I32A 4RHCA 2FSVA 1IC6A 2ETSA 6GPBA 1ECJA 3LRPA 4FX5A 1W85A 1QYCA 5CJPA 2VPXA 1OAOA 3D3WB 1OYVA 1RTKA 1VLSA 3HXMA 3S84A 3PE6A 5F5LA 5E3JA 3DMTA 4YRPA 3G50A 3GFPA 5KMGB 4BMZA 3ABKC 2GD2A 4N8SA 2GBFA 3OMWA 4K9SA 4M9RA 4KO4S 2DSNA 1ZOPA 1QP8A 2ZYHA 3CR7A 4RH0A 4UHEA 3AF4A 2CV2A 2IW3A 3G82C 3K4HA 4EY4A 1L8LA 2GPNA 1HQYE 1V43A 2IXMA 1O8BA 2YV3A 3OAAD 3NC4A 4M98A 3WWEA 1SVUA 4NI5A 4YAFA 4J9VA 3OHPA 4O4IF 4D6XA 4R2WA 4GW3A 1KF0A 2Z4SA 4G4IA 1T9AA 3S7ZA 4MGYR 1IBMB 1UBCA 4RORA 4YC7A 1BCRB 4FQ5A 1L9XA 3GRZA 2L6FA 3FPCA 3GRVA 5IDQA 1M2FA 3X1ZA 3J81k 2IOYA 2F1HA 4WXEA 2PBLA 5JH7B 5JDIC 4ALNA 2GSWA 2WV9A 2VBIA 2ZSBA 3H1BA 1F2VA 2J5BA 4CM4A 4ZRNA 2CXOA 3CY6A 1MTOA 4TM7A 2I33A 3ME5A 1QQBA 5EXDA 4OHUA 1QX3A 1SVLA 1G6OA 1JZQA 1FRVA 1H8ED 4Q3KA 4IVPA 2N1MA 1NBHA 1RYDA 3EAQA 1DKUA 4MLPA 4QODA 1JIJA 1NR7A 5F4ZA 3WLNA 1YRLA 5IF3A 1G60A 4Z3OA 1TADA 3NHYA 1K6EA 4G78A 4HLQB 4PLZA 5K99A 4FKZA 2FXIA 4MR7A 3ORYA 2J45A 1RACA 1LRJA 5IUKC 3N5KA 5FTJA 3WMWA 4FE4A 3P0RA 4PRLA 1XZMA 2IBMA 1IONA 4U63A 3DDCA 4ZYZA 2QVXX 3OTQA 4M86A 4X94A 4AWXA 3QP9A 5AVUA 4HQ6A 5CW1A 1D6MA 5GTDA 1MVLA 1Z82A 2X9NA 2OV1A 4L0DA 4CIYA 3EDOA 3H5OA 2OCLA 1NN1A 4GLJA 4ENPA 1MJGM 4U5BE 3SQNA 3WK6A 4G85A 2OKUA 4AMZA 2R6JA 2P4HX 3CX4A 3DBIA 1EKYA 2AGVA 2KNHA 3G8CA 4EF5A 1DJMA 1L7AA 4IOJA 1UKBA 4I9FA 3LHSA 5C2JB 1JWBB 3D7SA 3OX2A 2R00A 4ONEA 3O4JA 1SVSA 2LCFA 4NF2A 5FV7A 4KPFC 3IHLA 1LXCA 4LLCA 2KX7A 4PO9A 1KVRA 4IHKA 3EGXA 3PSAA 1TCBA 4JZAA 3KM0A 5BVGA 4JVOA 1JT2A 5EP2A 1KI8A 1IOVA 1SNYA 3ZH9B 2RH8A 5EHQA 5HOQA 4CW7A 3KWMA 4RLHA 1T8SA 4XTCS 1WXXA 2R25B 4AJLA 4YT8A 4PAWA 4PTYA 4JI4B 3PENA 2EL7A 1PNQA 2HD4A 4BNWA 1YBAA 5LB4A 1V35A 4A8JB 5DTMA 2F17A 4BWFB 4DSTA 1E0DA 2D1RA 4G41A 3R5HA 4IP0A 1GKKA 1CE8B 3GY0A 3KHSA 4ND8A 2O8NA 1BRMA 3TX6A 2CLLB 2N3ZA 3T4XA 3TZLA 2EPKX 3OE1A 1M5RA 3OJOA 5AW5A 3L7MA 4R8SA 2HFJA 1JEEA 1EA5A 1O0SA 3UUFA 2V9PA 4H4CA 1JKMA 3NCTA 3WGZA 1X7ZB 1J0EA 2DMRA 4DMLA 2Z1NA 2G1JA 1J8YF 5EJ9A 3EIUA 1L6IA 3G88A 4GC9A 2E89A 3U4HA 1TNDA 1IZ8A 4TYWA 3GLHA 2C1EA 2MSDB 3A05A 1ZK0A 1P1HA 3GCXA 5F1YA 3UA3A 2J9ZB 1RLJA 4UZSA 3ROXA 1WDWB 4C43A 4NE2A 2IPOA 3CLUC 3RW9A 2EKZA 1K8ZB 1NQAO 7REQA 3E81A 4C87A 2PL1A 3L8MA 1ZHYA 4EB8A 2LFFA 4YJ3F 3WB1A 2C04A 3NIFB 3IUPA 3U2QA 2Q3HA 1N4DA 1WCYA 1R0YA 2CJWA 3F97A 2XKAA 3I2KA 2HLHA 2WHQA 2D2EA 5FPTA 1H42A 3ZE1B 4RK0A 3UPUA 4N6NA 5CAEB 2RC5A 5AI0A 4EGSA 4GEHA 2BEUA 3OT1A 3RVJA 3AW9A 3H2UA 3HH8A 2J0UB 4OGFA 2B34A 2KLBA 2WTUA 4K9RA 1KEZA 5D8DA 4M36A 2XDWA 1BDIA 1NVDA 3FSRA 1HE5A 2QRHA 1O6FA 3A1NA 1GADO 4PSKA 3ZIDA 1VBFA 5K9ZA 2O0MA 5LA6F 4OHBA 3E84A 2EZ9A 3PUZA 1TTHA 4WIAA 5C1OA 4G9BA 4D3SA 3O1HB 1GTZA 4C0JA 2BSQA 4PGMA 2R6DA 1TT5B 1F6WA 2UUPA 1CUXA 3D2LA 5AJVB 5C5DA 4RSGA 4U5EE 1PR9A 3RYHB 1AV6A 4JEIA 4AN0A 3QOYA 1EE9A 2G9UA 1DV2A 3OFND 5JMOA 2UAGA 5K8TA 3CTPA 5DYNA 3HABA 1F4PA 3QBTA 4RV5A 1I5RA 1NJGA 1KEVA 1E3WA 2FWBA 2XYGA 1EBFA 5A9RA 3VYSB 3ZCSA 1DJNA 3ZVKA 2BUCA 1ZLYA 2BR5A 4FJ2A 3LO8A 4XB6B 4D81A 2LKDA 1P73A 1P1CA 5KJCA 2VXCA 3NWOA 2O2GA 1IU9A 2DEUA 5I4IA 3PFNA 2WVOA 4DHEA 4G5GA 1GZDA 2VPZA 4OU4A 3K31A 4MVJD 4X7PA 1LFAA 4EHBA 4EEKA 2HF9A 1MVNA 4KDEA 3U8VA 4QDLA 3EA4A 4ECEA 5AR1A 4FAPB 1PBTA 2V4MA 3KPUA 1HYQA 3CR3C 4YQZA 2GPTA 1GZ4A 1ONPA 1VJTA 2VK8A 3CPEA 4IJJA 2P67A 5AM4A 5HRAA 4B48A 3AC0A 4JVNA 3N3AC 3WGJA 2JZNA 2F1RA 2G4LA 3CMMA 5E8JA 4DWJA 5AI9A 3TD2A 1KIAA 3QKRB 4WKNA 1PCXA 4K5QA 1YC5A 4G5OA 4YL0A 1WB9A 2I4IA 4GPTA 4MYRA 4BXOA 3SQDA 4FYVA 4DXHA 3O8BA 1IOZA 3M81A 1EFPA 2D4UA 3QKWA 3K5WA 1UBUS 2Q3BA 2VZEA 3ZGYA 5FNZA 4BBAA 5L0GA 3CUYA 5DHFA 4ZOAA 5EC8A 1NU7D 2O06A 2WPDD 4PZ9A 4OQPA 5T1DB 1W35A 2OG2A 2VC9A 3LFTA 1PYDA 3BZWA 4YAIA 3QMWA 4XUDA 2PPVA 1VI6A 1TKRA 1DB3A 4WBSA 1KS2A 3AGPA 3EWSA 4W82A 1OFGA 3WNDA 1C7FA 3DD1A 2H9AA 4EW6A 3EGVA 1QTIA 2OOKA 3LLKA 1F1BA 2RAFA 5EXEA 3FYUB 3I53A 1ML4A 3DEAA 2CNLA 3ORSA 3PJFA 3T3NA 5LU9A 1TKBA 5EQJB 2GF0A 4JVMA 3SXMA 3UB4A 5AXBA 5D7NA 2X8WA 1UADA 4DBLE 4GZ6A 3KQSA 4CV1A 2Z5LA 4AN4A 2QRVB 2I2XB 2WP8J 3PFBA 1XDBA 1RZUA 2O2EA 2GCEA 4J29A 1WAMA 3JD0A 3AIOA 2B7BA 3VR6H 2YS7A 3BSWA 1EUZA 4HXFB 5JZBA 4RPKA 3BE6A 1WETA 3MNFA 4YP5A 3ZJ5A 2G83A 4Z53A 4U5HA 2D62A 1CJBA 3M6LA 1MB3A 1YBHA 5E4JA 1T35A 2QOEA 1DJLA 3DAFA 3E9EA 1JNXX 1Q14A 4O0MA 1Y4DE 2HDNB 5EJGA 4MHSA 4C0KA 4BJ5A 1NW6A 2C9DA 3IAS1 4JLOA 4PZUA 1WXHA 5LDHA 4OL0A 3GAAA 2ODPA 1UXGA 4KV7A 2V45A 4Y2HA 2QL9A 3C8ZA 2PUVA 4KUGA 3ANTA 3KJXA 3A9CA 1HLFA 3VKVA 3QA9A 2PU7A 3I1YA 2UYQA 3EVNA 1FNCA 1OI4A 2FYTA 4UDNA 3LEVA 1YZ3A 2M4EA 2OM6A 4BEJA 3UMBA 1SVNA 3PV0A 3S28A 1T0UA 3LF2A 3ROGA 3TQHA 3V8RA 1HT1E 2H7VA 2ERCA 1Z16A 3A3KA 2DSTA 1BJRE 3NRBA 1EFUA 3HCWA 2PS9A 3WG7C 1ZEJA 5L0IA 2I6TA 2WMNB 2IV3A 3GCGA 1ZD4A 1M34B 4LQLA 5HKOA 3BFJA 2R7AA 4RA9B 2DFNA 3G7NA 2B3TA 1KU2A 4YCAA 1TJYA 1U8TA 2VZ9A 4WOPA 2IVFA 3T3OA 3A1DA 1LD3A 2CL7X 2IXPA 4B6SA 3CPSA 1V7ZA 5KDOA 4JXXA 2R85A 5K8JB 2EBWA 1G5PA 3IQGX 4KO8A 1YRHA 5IDWA 3CUSA 1HEYA 1YONA 4C1NA 2FA9A 5DLQC 5AVRA 4B6EA 1UFQA 1HY3A 2KW3C 3ZLTA 1G20B 4U1RA 2DGJA 5JYEA 1NOIA 1WBDA 5JY6A 1JHPA 1QHSA 3P52A 1FYDA 3ZLVA 1DOVA 3WK9A 3LEOA 2FSPA 3OY2A 1QSPA 1PLJA 3EVCA 2DECA 3AU9A 1R15A 3ITFA 1RTTA 3CRVA 4MNTA 4YYEA 2NTJA 5AVJA 4LC9A 3NYLA 4FB5A 3HKEB 1C5KA 2YWCA 4HWTA 3GOQA 4CHTA 1R3UA 2WVNA 4AJHA 3RHZA 1I0LA 4B1FA 3PWTA 1T2DA 3INYA 3O2QB 3DL7A 3L0YA 1TZKA 5JYDA 2JRLA 4M0UA 4BYGA 1VM6A 4Z7OB 2WB2A 1YZNA 3H2KA 3RE1A 2SHKA 2GS9A 1T8YA 4BEBA 1HUQA 5C32A 3HUDA 5LQCA 1D0VA 4IIJA 2CLKB 2HMSA 3L8JA 5E3HA 4KZKA 5KX5B 3JQ7B 4L73A 4FDAA 1FNBA 5KNLA 2CZGA 4F71A 4LHZA 1FNMA 1FZQA 4BMYA 1W8IA 2VF4X 1X2EA 5LDDC 3HCEA 4WKOA 4B3TB 3IR7A 4KGDA 2QP9X 1Q57A 2YMPA 5JWRA 2QYOA 3RSLA 3T54A 1MAUA 5JYCA 4PC2A 2I1VB 3CRRA 2YKZA 4JT8A 1V9SA 1YFKA 3WHIA 5KVVA 3IELA 1F8UA 2PH1A 4GAEA 3VSBA 3T9CA 2MYUA 2YASA 3JW8A 3ZK8A 4CDMA 2FPSA 3K66A 1HT2E 3TTXA 3QQPA 4C08A 5KU7A 2HWYA 4RHFA 4CDGA 4WW0A 2FCAA 2OCXA 2RHBA 5TT1A 3M6MD 4MQEB 3I72A 2GLTA 2YL2A 3KK0A 3ECAA 3KXIA 1KRXA 4IOLA 3ZI7A 3CEMA 4M1TA 4HFRA 1Z37A 4QG7A 3BILA 4A8TA 3QYAA 3REFA 5HQ3B 4BE9A 1HX7A 2I99A 3A9WA 4BFYA 3KB1A 1WVGA 3W7VA 1YXMA 3KSDO 4FLFA 2LBPA 3ZJUA 1U7XA 2R6HA 3AR7A 4HNRA 3JWEA 2BZGA 3RFVA 3VPCA 4ZYWA 1KPHA 4AX2A 2ZT7A 1MB4A 5IH7A 3ZDDA 2AYXA 2JRCA 3AB7A 1DOAA 3L1IA 1GZSA 3CZPA 5KBYA 3MOSA 4XX0A 2VUUA 2EEZA 1IMOA 5BMVB 2NYAA 2FUG1 2BC5A 2FHPA 3ESCA 5HMLA 3GYBA 4JLSA 1FRZA 3LWNA 1XSEA 5ALWA 5TS3A 5DB4A 4GMHA 4INJA 1Z6YA 2XVMA 5J47A 1ZC4A 1YZKA 4PHCA 1IDN1 1Z88A 2QR3A 1USKA 5FI5A 3STHA 3X1WA 1Q7EA 2AXQA 2VHQA 3M3HA 1Z7BA 2UDPA 1TT7A 3SS8A 1W75A 4WMLA 4AY4A 3HTKC 3D6UA 1Z6ZA 4B6QA 2QW8A 1PR4A 2QG6A 1UCFA 2QI9F 2PZGA 5AK4A 3OTHA 5F12A 4XGRA 2JLQA 2RMKA 3ZYCA 3JQRA 1VBNA 3G1UA 1BWSA 3JZDA 3KWJA 3LZDA 2VCAA 1CUEA 3ERCA 1Q16A 1J8DA 4HI0E 1FMCA 1CQJB 4UTXA 4AICA 2M6SA 5DTEA 4M76B 5DYGA 2YXEA 3SJ7A 3ZQYA 3IMKA 4ENVA 2O19A 3MLGA 3KALA 3ZTWA 1PS9A 4G7OF 4IZIA 4DV1B 1X7HA 3R75A 3T7EA 5CMLA 4UC0A 2XUKA 3AKYA 4MUKA 4AJKA 1BQEA 4Q9AA 3ORHA 2WQZA 2FN9A 1P33A 4Z2YA 4CQLA 2FFQA 4CODB 1H7IA 4YECA 5F5XA 4LGCA 1IXSB 1CFJA 2IHZA 2BIFA 4PPGA 2I3DA 4FFBB 3UHAA 2IDZA 5T8KC 4A1FA 1U6JA 4CL8A 3GT4A 5JCJA 4CT5A 2UUBB 5CM8B 1DE0A 1ZMXA 4UJ3A 3IA2A 4D0RA 2NTVA 1Q92A 1YRYE 2NSGA 3OP1A 3NT2A 5K0BA 1UFBA 1WX1A 1KVUA 1OQAA 3L04A 5B3SC 2QTBA 3K1AB 4I55A 3T94A 1J49A 4OQXA 4XGKA 3P97A 2X4GA 4QHTA 1VCIA 1UT5A 3E6AA 3N6RA 4MDYA 1E9CA 3CH5A 4CL3A 2CBZA 4P3YA 3TKYA 2VPQA 4JOBA 2J07A 4QJ4A 3AOUA 2YXLA