3DMDA

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
318
structure length
310
Chain Sequence
MFGKLREKLKSFVKRVEEEVEKEEEEVELTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle receptor
publication title Structures of the Signal Recognition Particle Receptor from the Archaeon Pyrococcus furiosus: Implications for the Targeting Step at the Membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transport protein
total genus 116
structure length 310
sequence length 318
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dmdA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dmdA02
1GZSA 1WXQA 1EFRA 1DG3A 4FN5A 2Z0MA 4KFUA 4KXFB 4OHVA 4B47A 1GUAA 5KSOA 4NCIA 2HLDA 2ZRKA 1YU9A 3U2QA 4PAOA 1U2RA 2ZJBA 1RC8A 2A5DA 4EKDA 4NZYA 2V6IA 4UNRA 1Z5ZA 3C16C 3ZQJA 3TSOA 2NQ2C 3BB3A 2YKGA 5F2EA 4MGIR 1SXJA 1OE0A 4CF7A 2GAAA 2RGXA 5EP3A 3VAAA 5IHPA 1U94A 2FSIA 3ADBA 3SU8A 2ONJA 4LBZA 2VTKA 3PUXA 5AUNB 2V4ZA 2HCJB 3F5FA 821PA 4MKFA 5EUQB 4TQ9A 4W5HA 3B1WA 3WRXC 2ONKA 2XZOA 5M04A 1FPMA 4R7ZA 2YOGA 1E9EA 1HQCA 1LF0A 2YVUA 3RS0A 5DN6A 4A0FA 1IXZA 3WYAA 3LVRE 5KSPA 5FR2A 3R9XA 3C5HA 1PVOA 1ZBDA 2I1QA 3Q85A 3GLHB 3B13B 4KCGA 3N2EA 3I32A 4Q1EA 5FOUA 2QMEA 3AB3A 5K8IA 4RD0A 5H68A 1H8HA 1SVLA 1E96A 1Q21A 2PLFA 4GNKA 4I1SA 3RHFA 3CRVA 2QP9X 4I1UA 3T12A 4QFMA 4H1UA 2NPIA 3PUWA 3QF4A 3BC1A 4B76A 3A1WA 3TNFA 1DOAA 1KJZA 1H65A 1ZD1A 2V3CC 4OJKA 2FFBA 2J0UA 3BAFA 2WBLC 3LX5A 4M4SA 2FPMA 4FWIB 4DB4A 1ZYUA 1WP9A 3BORA 4NYIQ 2QRNA 4LX0A 1VHLA 4Q4LA 2ZEJA 2QAGB 1E98A 4LC0A 4Z1MD 1MKYA 2BMFA 1XEFA 4P33A 3S1AB 3SHWA 2OE2A 3EC1A 2WICA 1ZUHA 3RSLA 1S3GA 5GJVC 1U90A 5FPKA 4MRNA 5GJWC 3UXMA 1OYYA 1RFLA 3K9HA 4RD6A 4RCYA 1NN3A 1RW4A 4KO8A 3BE4A 1N6OA 2IYRA 1OFIA 1VTKA 3LBNA 4HLCA 5L3SB 4B6FA 5HPYB 3QBTA 4EAQA 2J1LA 2G9NA 4QM7A 3ZIAA 2XXAB 4B75A 1FX0B 3V9PA 3U60B 3LH5A 2ZS9A 4WVFA 2VSOA 4EQ6B 1Y63A 3NH9A 3K70B 2NO1A 1I2MA 2ZI5A 5CDFA 5JZVA 4LYAA 1V43A 5TV2A 4TWZA 1FUUA 1W2GA 4DUGA 4IXNA 1UBFA 2OESA 4JLKA 2IEYA 3QXXA 4PC3A 1N6IA 3CNLA 3VR5A 4YMTA 4PZYA 3GLHA 3AP2A 3TR0A 4QGAA 2IL1A 1G20E 4YC7A 5FR1A 5TMPA 1E9DA 1W48A 2OFOA 3KUCA 2FMXA 2YINC 4BEJA 3CX7A 3GJ7A 4EPXA 3ASZA 2R65A 1DTSA 1R7RA 2RHMA 3ADKA 3PEYA 1Q0UA 3T5DA 3AF4A 5LB2A 3K70C 3AVVA 221PA 4UNPA 2R6GA 3THWB 2GWHA 2J45A 4TMWA 4D82A 3ADDA 1E3MA 2G77B 3RC8A 4XVUA 3ETLA 1OT3A 2EW1A 4DCNA 4DT1A 4LPSA 2JGNA 3QKSB 1O87A 1KI7A 3CB4A 1AS2A 2QTVB 2EYQA 4HAZA 3G0HA 2QAGA 1UPTA 4WW0A 2WAYA 4DLSA 2QY9A 3W3ZB 2QRZA 3S1AA 1PUIA 1EGAA 2PX0A 5CLLA 4M1MA 2JAQA 1X86B 3QXJA 2IYZA 1MO6A 2GBLA 2I4IA 2IYTA 4H1VA 3PCRB 1OHHA 1ZD8A 2QPAA 1JNYA 4QG7A 4B3BA 4Q4AB 4IVRA 2H16A 2B6HA 4AD8A 5L3SA 1R6BX 5FPHA 3N5CA 4URWR 4GFDA 4A9AA 2XXAA 1FX0A 4O2LA 1T6NA 4EQ6A 3X2SA 1SXJE 3PEUA 2L0XA 1YZNA 2ANBA 4Y0VA 5CJ2A 3FPAA 4GOKA 4Q4JB 4YXWA 2XB4A 5E7MA 3Q9LA 4PQFA 4B33A 1G291 1XXHB 1GTVA 3FKQA 3BIFA 3ZLJA 1OXXK 4MA4A 2RKOA 2QPTA 2OXRA 2F1HA 2F3RA 1TF5A 1OFHA 2ZRGA 3RRNA 2BCGY 1N6RA 2GVDC 1YR8A 5CB6A 1NSFA 2QSZA 1KI1A 2FU5C 1I4LD 5KU1A 3WNCA 4S2EA 1G4UR 1N3BA 3PENA 1I2DA 1Z06A 3IQXA 2GRJA 5H8WA 2IUUA 1Z0DA 3GLFA 2IA5A 1UAAA 3ZS8A 3IDQA 2GVZC 4EIWA 3EIQA 4CGZA 1KGDA 3SN6A 3QKSA 4LBVA 4MRRA 1NIJA 4A6XA 4Q4HA 4HLUC 2HCBA 5L3RA 4AG6A 2ZQ5A 2CK3D 2QI9C 2RGCA 4GMXA 4MGZR 3ZH9B 3IILA 4PHGA 4BZQA 2P67A 4TSFD 1EFRD 1DPFA 2BEJA 2Q9BA 2FPLA 3A1SA 1QHGA 1FTSA 1T4GA 4HDCA 1DO2A 4Q4AA 1E2IA 4C0BA 1MH1A 5D3QA 4AWXA 3RS7A 1TEVA 3ZJYA 4DLRA 5JEEA 1MT0A 5DO9A 2HJVA 2GZHA 4LJ7A 4NCKA 1A7JA 1NL3A 1SXJD 4OI1A 2WKQA 5B57C 5HE8A 2F55A 4BFSA 4NU0A 3K0EA 4Q4JA 1LV7A 4A4DA 1HA3A 2O52A 4F4JA 4TN1A 5BN5A 3I5YA 1XXHA 3AP1A 4DLZA 1JAIA 2KE5A 2ZETA 1D5CA 4MUAA 1UDWA 2H5EA 4M9SA 3A1VA 5DN6D 4TTRA 4MQBA 2J7PA 2FZ4A 1P73A 5CDFE 1G7TA 5KSYA 1NVVR 1KO1A 4KVAA 1DAFA 5LB4A 2EVWX 3SEAA 5KPDA 1E9FA 3B8HA 3MUFA 3I61A 1T8UA 2WWFA 3LO5A 2FFHA 1G3IA 4TYYA 2BBSA 1CS4C 4IDQA 2H1LA 3GLHE 3QSYA 1NLZA 5AK0A 3QNUA 5FUXA 3VR1A 1JEEA 1M2OB 1H8HD 4C30A 1D2EA 5HR5A 3OFNA 1OKKA 4KFTA 1G8HA 3OIYA 1NN1A 4MUBA 3OEED 4AG5A 1NG1A 4XVQA 1HY3A 2BMJA 2TMKA 2IYXA 4OYHA 4BEBA 2IW3A 1MOZA 4Y0AA 5JHGB 3M0EA 3TQFA 2PJZA 5DHAA 4ZV4A 1ONBA 2EFDB 3P1JA 1OYWA 2HUPA 1X8JA 3HPQA 3NHBA 4TYWA 1Z07A 1XB2A 5DIFA 1OLOA 4UXHA 2WMNB 4Z54A 4HLDA 4LV6A 4JLDA 3T1TA 1GDDA 4EPRA 1ZM4A 1GL7A 4RSGA 4UQOA 3DM9B 1N5LA 3MRSA 2FEOA 1UKZA 1DAIA 1E79A 2FF7A 4L4UA 4IDPA 1G18A 2XJ9A 1OFUX 1MR3F 4A92A 3H2YA 1ZRHA 2ZYTX 1W2HA 2ZYVX 1DO0A 4Q1AA 2D74A 1QHSA 4DSTA 4U5XA 2QP4A 4QM6A 2WPDA 4JVLA 2C04A 4WXRA 1P2TA 1TU4A 2OLKA 2CL0X 1LY1A 3ZIAD 3IIKA 4DEXA 4QBFA 2JJ2A 4JBYA 1FFHA 4W7SA 1RKBA 4DDWA 4BRUA 4YMWA 4LI0A 2FX3A 5CK4A 4DUGD 1SVIA 1CU1A 1YRAA 4JBXA 4LYHA 1W0JD 2XSZA 1S2MA 3DHWC 1KDRA 3B85A 4JSYA 1W4AA 1N5JA 5FTKA 1RYHA 1GP2A 1IAQA 2GETA 3E1SA 2IT1A 3CUEF 1G8PA 1SHZA 1PLJA 5JSZB 4LUCA 3QQ5A 3EWSA 4LHWA 2C5LA 1NVVQ 2FSGA 4QNMA 4OHZA 3U7GA 4ACAA 1XF9A 4AURA 4RZUA 3WYGA 2ERYA 4LJ8A 4D4KA 3LBHA 4XSHA 2B8WA 2XTNA 3EA0A 4LDJA 2PBRA 1CR1A 3ICQB 4JLOA 2FJUA 1BYUA 1U9IC 2WJHA 1JQLB 2B92A 4JL5A 4XJXA 4BLRA 5TARA 3KTAB 2WSMA 3L0PA 1SVWA 3UK6A 4LPKA 2RGNA 3NDBB 1SGWA 1UF9A 3CZQA 4B71A 3EPLA 2OLJA 3B9QA 4GBMA 1E9BA 1T3SA 4G3XA 4B44A 1AM4D 2BEKA 2ZIAA 4ZDKA 3CF6R 1U0JA 3TAHA 1RVDA 3D7MA 2OV2A 3U3RA 3AF0A 4JT2A 1HYQA 2DR3A 3X1YA 4E03A 4NL4H 1XJCA 3VU9B 2D62A 1TF7A 3FDIA 1O3YA 4D0GA 3EZFA 2H92A 2CDNA 5EUMA 3RS4A 5DH9A 1ZIPA 1E2QA 4IDOA 1YR9A 3EWAA 3SFVA 5C2JB 1C9KA 4O2RA 4YXWD 3A8TA 5KHOC 2O8CB 3T5GA 1JPJA 1P2SA 3L8YA 1OF1A 4LV8B 1XXHE 4PPGA 3SFZA 421PA 2ZITA 5J4HA 2ZR9A 1H8EA 4BE7B 2XZLA 2ZAOA 2OXCA 2HYDA 5JSZA 4QBGB 1XTQA 4IDNA 4C0QC 1ZNYA 1KO5A 2AK3A 4M8NE 4A1FA 2GJ8A 1LB1B 4QHSA 4TQUS 1E1QA 3SE0A 1WQ1R 3NEYA 1FL9A 2QTFA 1F6BA 3RWOA 1XMVA 4OK5A 4HEJA 2GXAA 2O5VA 4XOIA 1EK0A 4W5WA 2ZUBA 2EFHB 1G64A 3O8BA 1S1CA 4HAXA 4BFWA 3FKSA 2X2EA 2KWIA 3KTAA 1QHIA 2I1VB 4POAA 2R44A 2YC2C 4Q47A 5LPNA 1G41A 5DYGA 1VYTA 2B7CA 2P65A 1G3RA 2O8FA 2AWNA 4II7A 5BYKA 2WJIA 3A37A 1ZAKA 3SS8A 2QQEA 3SDZA 2BVNA 1KY2A 2QNRA 1YZQA 5K8UA 4S35A 3PJRA 4DLYA 3MG9A 3L2OB 2PZEA 2QL6A 1M34E 3U4QA 5JS7A 2WHXA 4HDQB 1DELA 5FPTA 3DZDA 1G3MA 3Q7PA 1NG9A 2I3BA 3JZAA 1KNQA 3PG5A 5DGXA 3X1XA 3VU9A 3VMFA 3CNNA 2BM0A 2CE7A 1WCV1 3SJAA 1V5WA 3C7KA 2IWHA 2PMDA 4PSKA 1S0UA 3KKNA 5JFGA 3CF2A 2P5TB 4AK9A 2VHJA 2Z4SA 3TLXA 2CXXA 2D7CA 4AI6A 1PLLA 4US2R 5DI9A 2JLWA 4MH0R 2O8CA 4BRWA 1KK0A 1ANKA 1AGRA 1KMQA 3GCGA 5FBWB 3TMKA 4ZI3A 5CIQA 3W6PA 1G8FA 3JVUA 1R0YA 1N6LA 1S8FA 4CEHB 5CM8B 1XMSA 2P5SA 4PPQA 1FNMA 4RFVA 5FBVB 5B58C 4TTPA 2D4HA 2WWIA 2J7PD 1YZUA 1M7GA 1Q3TA 3LDAA 3WP0A 1ZJ6A 2H17A 1ETUA 2ZSDA 4ACBA 3EA5A 5HE9A 3B60A 1LS6A 4B34A 5ELXA 1FUKA 3QI2A 2CMKA 1DAHA 4F92B 2KJQA 4NH0A 3REFA 4V0KA 3V4RA 2DCUA 3Q5DA 2Q6TA 3OFND 1B0UA 5KTYA 4GL2A 2ASEA 2BBOA 3GMTA 4NBSA 4TL9A 5AJYA 1P9NA 2GK6A 1YKSA 3AVXA 5JECA 3EPJA 4LSGA 1L2TA 1P2UA 2ZE5A 4ZI2A 2FFQA 1FP6A 1AS3A 1G4AE 1G9XA 3GJ5A 3PUZA 2GEDA 2QE7D 2XOKD 4FIDA 4P0TA 3IGFA 2BHRA 5CLQA 3MCAA 2G1JA 4OJQA 3OIVA 2ZJYA 5JWOA 3CO5A 1XPOA 3BRWD 2XTMA 2OHFA 4Q9JA 3N2IA 3TR5A 4Q03A 4EPYA 2FZLA 3WNDA 4CW7A 4D4LA 2XITA 1WMSA 4LOAA 1FMJA 5KPJA 3HU3A 2AD5A 1E79D 1W44A 2FOLA 3W34A 2BCJQ 4PR0A 2ZRNA 3WMEA 1S96A 1EX6A 2A3RA 4URZR 2JLVA 2F9MA 2ANCA 1J8MF 2CHGA 4DDUA 4BFYA 3GEHA 1TUIA 4Q1DA 1T3HA 3KQNA 1CULC 2VP5A 4B6EA 2E87A 3UG6A 1LW7A 1P5ZB 2VQSA 5SZJA 3CM0A 2JJ2D 1JEDA 1VYUA 1Z6TA 1CJUC 1NMZA 3ONWA 4ARZB 1TPZA 1MRSA 2AD1A 3X1ZA 4A2PA 1KI6A 3MFYA 1BOFA 1P6XA 1GL6A 3U5ZB 1LS1A 2NG1A 2V9PA 3NDPA 3TVTA 4N0EA 3I3SR 3L43A 1CJTC 1M7HA 4BZXA 3QE0A 2XSZD 1DADA 1W4BA 4B2PA 4PO8A 2JLXA 4F4CA 3E70C 1W1WA 1J70A 2Q0HA 3THOA 4TLAA 1QG4A 2ZROA 5J40A 1VPLA 3TBKA 1RPZA 2UVQA 1OH5A 3CBQA 3ZD6A 2BKUA 4M1OA 4O0MA 5JRZA 4XSGA 3QKRB 3DZ8A 4K46A 1GNPA 1NNEA 3IIMA 2ZS7A 3IEUA 1SXJC 1DVRA 3TUJC 4B3GA 3BD9A 4GI7A 2JEOA 3K8YA 3SHFA 4CEJA 1A1VA 2PZGA 1HT2E 4HATA 2IUTA 3GJ6A 1AZTA 4YMUA 3TH5A 1VCMA 4OHXA 1GRRA 2MMGA 1VG8A 2VYFA 3DEFA 1P2VA 4G5RA 3ZDQA 4L15A 1K5DA 4IW3B 2FGKA 4OK6A 3R9WA 2HXSA 4DLVA 2XAUA 4RFSB 5G40A 2CNWA 4M1WA 2EFCB 3QVUA 2J0VA 1F48A 2ODBA 2IF2A 5KDOA 1M7BA 2WOOA 5TY0A 3KXIA 4BFTA 1JBKA 4DIEA 2H7VA 3WXMA 1ELOA 4QKQA 1US8B 2J0UB 4TZ0A 1W5TA 1EFCA 1XZPA 2JLZA 3LA6A 2REOA 1YZTA 1LNZA 4LWZA 2NO6A 2DFLA 2RGEA 3BOSA 3KB1A 4B2IA 2HV8A 1CXZA 2XNSA 3TUIC 4TT3A 4EPVA 4G0NA 4ARZA 3PXGA 2GDJA 3KKPA 3VKWA 5FUWA 4EPWA 3ICEA 1XPUA 2A5YB 1Q22A 4JL8A 4QHTA 1CRQA 1Z0KA 4CRWB 4KV9A 4M21A 3E2IA 1H8ED 2QP3A 3T35A 3TW8B 4ZCMA 3UMRA 3WYFA 4FMCF 3V4FA 3HWSA 3TSZA 3CPHA 2W0SA 3QPWA 4FMCB 4A8JB 1JR6A 1E1QD 2GJAA 3RWMB 1X8LA 3OZXA 3QKRA 4RZ2A 4C0KA 2IX3A 2W6IA 4EFLA 5C4MA 4B2LA 3EG5A 3RRMA 3GJXC 1VIAA 2WIBA 2QT1A 4BLTA 4F93B 3LLMA 4PAQA 4AKIA 1MV5A 3FE2A 4US1R 1Z2AA 3CZPA 1WRBA 3FKSD 1CBUA 3JVVA 4BQSA 5AUPB 3THXA 2IYVA 3W5IA 1XMIA 1CEEA 4A2QA 1KOFA 2GCPA 4P4UA 1VYVA 3ND9A 2KB0A 4ESHA 5EXTA 2WAXA 5CJPA 4A8JC 5KYKA 2PMKA 621PA 4RFSA 1VCOA 1M74A 1QZXA 1T5IA 1KHTA 1W47A 2J87A 3BB1A 3OEEA 4R98A 2ZI7A 5KUTA 3VQTA 3CKLA 5AUQA 4DLXA 4GP6A 4F7WA 1TEXA 1RZ3A 3UWKA 1US8A 2VHQA 4TQAA 2PEYA 4EFNA 4URVR 2C96A 2FSHA 1GWNA 3I8SA 3K09A 4DT1B 2D7DA 2VSXA 4Q21A 3B82A 3OE7D 1WBDA 2C95A 5BW8A 2ZE7A 1U8YA 1RJ9A 1SKQA 4TMZA 3RS5A 3GFOA 2IS6A 2GA8A 1DAMA 3K0FB 4PC6A 1BIFA 2CLCX 5J47A 3CONA 3AVQA 1XD2B 4PSAA 2RCNA 4DDTA 3FHOA 1QRAA 4RD2A 5D3MB 1GL9B 1XBTA 3K9LA 3K9GA 2HEIA 5L3QB 3THYA 1NF3A 2WSSA 3UG7A 2JLUA 4R9UC 4XIGS 4R2HA 3NVAA 3VHXA 3ZD7A 4A8JA 1FOEB 3WMFA 3AKYA 1RE0A 2QAGC 1F5NA 1NLYA 4FINA 4HB2A 3AF1A 1ZUNB 3NHAA 1JI0A 1P75A 1W0JA 4MDFA 3TIFA 1G5RA 3LXXA 4Q9KA 4FCWA 2GBLC 2ZYWX 4JLAA 4NPHA 2C2HA 1GOTA 2AN9A 3A1TA 3A4MA 4RY2A 5HTKA 3BFKA 3AGQA 4IJMA 3VTKA 4I81A 4OI2A 5G3YA 2IYUA 2G3YA 2QM7A 1U98A 3B1VA 4PC7A 4B32A 1S9HA 4ZCIA 3IIJA 1R0WA 1XEWX 4TTQA 4CT4B 1BYIA 1LVGA 3FMFA 2QU8A 1OB5A 1F2TB 3GLFB 2ZJAA 3DDCA 4D2IA 3GLIB 5E95A 1MO5A 4C0AC 5C1BA 2YWEA 8OHMA 3AF2A 2V6JA 3OF5A 1KKMA 4Q4HB 1XX6A 1XFAA 2R62A 3EZ7A 3GPLA 3NBZC 2WWHA 3K0FA 3I72A 3O8RA 5F9FA 3VX3A 4BWYA 5E7JA 4DRZA 1XD2A 1Z0FA 2WOJA 4FWTA 5D3MA 2Z5FA 2X8AA 2QG6A 3IO5A 1FNNA 5SZKB 5L3QA 4CVNA 5DHFA 4X8MA 3G5UA 1PJRA 1GVNB 3JZMA 2W6JD 1LTQA 1ZM7A 3B1ZA 1CLUA 4LK2A 3FFAA 5AJWA 4A0GA 1ZUIA 2PT5A 4JLVA 1WB9A 2JLYA 1YRBA 3NTUA 2FH5B 3ZZ0A 4C0HA 3LQRA 1KI2A 4YONB 5JCPA 1OXSC 5EE0A 3AVPA 2VF7A 2BIFA 5DISB 1OIXA 4B3DA 2QMHA 4Q19A 2O0KA 4HLQB 5GADl 2VSFA 3WBJA 3EARA 5BXQC 1K5GA 2XJ4A 3SR0A 3UWOA 2P3SA 4LY6A 2CVFA 4NYMR 4U00A 1W7AA 2VIIA 3KJEA 5EP4A 2GTPA 3GD7A 4PQRA 1EXMA 2YWFA 2R9VA 1IBRA 3AKEA 4HSEA 3AGPA 1J2JA 2JCSA 5CITA 2JJ1A 4LGMA 3X1WA 1F2TA 2IBMA 5FTJA 3TW4A 4DLWA 2GXUA 3GLIA 1CRPA 1T0HB 4MYCA 4Q7JB 4BASA 4TYNA 1ZNXA 2ZU0C 3EAQA 4ZPXA 2WKRA 4PZLA 5BQ5A 2WJJA 1W4RA 4Q9HA 4C4PA 3CNOA 3CPJB 2CNWD 2GESA 1L7VC 4WXPA 3TK1A 1U8AA 1Z0AA 3BWDD 3VHLB 4CYMA 3KQKA 2NO0A 4C2TA 1CP2A 2DBYA 1J7KA 2BMDA 3KJHA 5JWHA 4R71A 2V55B 2F9LA 1Q1ZA 1DAKA 1E2JA 3T1QA 3AVWA 1NLFA 3H4MA 3DOEA 4TT3D 1T0JB 4QJ3A 4W5JA 4QBIA 1GIAA 3LNCA 1EX7A 1L4YA 1K8RA 1VKJA 4Z8XA 3GFPA 4BLPA 3K9NA 4IEIA 2R2AA 3K53A 5CK5A 5DSZA 4DJTA 4MDEA 2WWYA 3DMNA 2GNOA 4UNQA 4B74A 5CYOA 5HCIA 1NMXA 1IXRC 3V00A 2EWWA 2E9SA 3OAAA 4G5OA 4UXJA 2MMCA 1KSHA 3CRMA 2W6ID 3ZYCA 2C9CA 2GF9A 2IK8A 1KDOA 4WIAA 4B43A 1ZC4A 3PUVA 3J81k 1SKYB 2JDIA 2V7QD 2NPFA 1UKYA 4PO9A 1L8QA 2GZAA 4BECA 1XWIA 2JATA 5JJKA 3U7EB 3DPUA 2VF8A 4P32A 4PX9A 3WHLA 5JI3E 1N0WA 3BERA 3QPVA 4LHYA 1IN8A 4NYMQ 1AQUA 3I5XA 2QEQA 3O8CA 4LJ4A 5IT5A 2IYWA 1R2QA 1TF2A 3R20A 2AL7A 3AKDA 1XEWY 3Q7QA 3TVDA 5EXPA 2ZRBA 3AVUA 4CDGA 4DSUA 3H84A 2DWOA 4G5SA 1Q1QA 2VHTA 1RYFA 4GZLA 4M9XA 3M6AA 2O8EA 4OQLA 1KYIA 3CR8A 3C15C 4JYBA 4XWAA 3P4XA 5C4GB 2QE7A 1WF3A 2XOKA 4DCTA 3QXCA 1E2NA 5HKKA 1KI3A 2H8KA 5FBLB 1UM8A 1FW6A 1ZNWA 2NIPA 4AYTA 4DCUA 3TUZC 1J99A 1T3LA 1E2KA 4KSBA 4CEIB 4DCVA 4P31A 2YZ2A 1X1SA 2QSYA 1C4OA 4BLSA 1CIPA 3QUSA 2OO7A 2F1JA 1S4QA 3BS4A 1G7RA 1OPXA 2VH5R 1GRQA 2C78A 4MRSA 2NZJA 2WSSD 3BFVA 1IY0A 3EZ2A 2RGNC 5FUVA 4QGFA 4DVGA 1DAEA 3NEJA 1EFUA 1DBSA 2FGJA 3C14C 1GKIA 3U6BA 3AQ4A 3CH5A 5JBQA 2B21A 2IUSA 3QEJA 3DOFA 2BJVA 3U3MA 2OCPA 3NBYC 3KJGA 5EQTA 5A4JA 4RKFA 4MYHA 2A7QA 1KSJA 1VG0B 5JS8A 2WTUA 1ZMXA 4LJAA 3QXSA 5JJIA 4AKHA 3QBVA 2QORA 3W90A 3FOZA 4MYUA 1KI9A 1G3QA 1RRPA 3NIBA 2OG2A 4QOSA 3A1UA 1R0ZA 2AR7A 4LYJA 1F2UB 1SVOA 3CWQA 1EWQA 4B73A 2BBWA 2D2EA 2F1RA 2CJWB 3GLFE 4X8OA 1GFIA 1Z6XA 4BLOA 1E0SA 3GLIE 3NH6A 2VPPA 4XVRA 1N5IA 1DS6A 1Z0JA 2AHOA 1DEKA 2ZAMA 4I1OA 3CIOA 2IXFA 4D4JA 5FH9A 4C7OA 1IJFA 4LZZA 1NVWQ 1L4UA 5E4FA 2O8FB 1N6PA 1ZC3A 3BK7A 4CEIA 2IS4A 2IS2A 5EZ6B 4LHXA 3VFDA 4D4MA 2HF9A 4JT4A 4KFSA 1OXTA 4HAUA 3KXLA 1GRNA 2XGJA 1MRNA 4TYPA 4A15A 3L0IB 4MRPA 1E0JA 3U4QB 5CM9C 2SHKA 2WKPA 5FOTA 5LD2B 2WWWA 4Q48A 1HQYE 2E1RA 3CF0A 3T06B 2PL3A 1NRJB 3HDTA 4MRVA 1Q3HA 1JECA 4DC9A 1KO7A 1AN0A 3IKJA 3L82B 4IFEA 5K8LA 4OHWA 4UKDA 3FHTA 1D9ZA 1Q12A 2BJWA 2ODEA 3IBGA 4LBYA 4ZO4A 1PV4A 4H9GA 2H57A 2K5UA 3SOPA 1Z29A 2WVJA 4OI4A 1P3JA 3E5HA 1E99A 2LKDA 3T34A 3A4LA 1DE0A 4KBFA 4Q9LA 3TAUA 1Z2CA 2W0MA 2VLIA 4BFVA 2CHQA 4LHVA 3PIRA 1YZLA 2BWJA 3OEHA 3QVVA 3W8NA 4M2LA 3KKQA 1IJEA 3QG1A 3PV0A 4L8GA 2ZXUA 1YQTA 2ZSBA 3BFXA 5FL3A 4M0LA 2W2TA 2JJ1D 1F2UA 2WM9B 2KBFA 2YJTD 3KQLA 1KAOA 4F4IA 2X77A 2CJWA 3KL4A 4EFMA 2ZI4A 4J0QA 1Z8FA 5JEDA 3IEVA 2QN6A 3VX4A 5FPYA 2V1UA 5F98A 1IHUA 4QRHA 4TMKA 1Z83A 2F3TA 2QA5A 4ZKDA 1J90A 2GXSA 4FI3C 3U7FB 3C8UA 2C77A 5DYIA 1R0XA 2R6DA 4BFXA 2X2FA 4HAWA 4WA7A 4URUR 2G88A 4LRWA 4PPNA 4JLMA 1G16A 1AGPA 1AZSC 2EWVA 2P0EA 4NHOA 1TAGA 4IOJA 2RH5A 2ZANA 5JLJA 4DIDA 4B3CA 3AV0B 5KSZA 2C9OA 3AP3A 3P32A 5H1YA 3PEVA 1WE2A 1TQDA 2ZSEA 3OE7A 5UKDA 1J8YF 1P9WA 2QPOA 4Z51A 1Y3AA 4HDOB 3EPHA 3CW2A 4LBWA 1NBMA 3BB4A 2F6RA 3QY0A 3NG1A 2P6UA 1A4RA 3OHMA 4UXIA 5C18A 2ZUDA 4M9ZA 1OH8A 1D8TA 4HB3A 3BBPA 3L8ZA 5E7IA 1IY2A 1NKTA 5IF9A 1II8A 2ATXA 1SZPA 2WWGA 2EFGA 3SYKA 3P26A 3OAAD 3PITA 3VKHA 4Q02A 3RRYA 1VDZA 2ZR7A 2CL7X 2CL6X 4ZDIA 3RVBA 4IXMA 1KI6B 1SKYE 1KK3A 2JDID 3RS3A 3BXZA 1CR4A 1XP8A 4TLDA 3RC3A 4IKEA 2ZJ8A 1E2HA 1ZW6A 2A5GA 3MMPA 1SVMA 3NWJA 4M22A 3LY5A 2J59A 4DLUA 1ZU4A 1ZNZA 3VR2A 1E1RA 4KAXA 2ZRLA 2Q9AA 1KZGB 3ADCA 1Z22A 1E9SA 4DB2A 2VEDA 1G5PA 4OQFA 1ZVQA 3EW9A 2YOFA 3MGCA 4Q01A 2EFEB 2D2FA 3KJIA 3QIAA 4IFBA 721PA 2JIZD 1KDPA 5FOVA 3CX8A 2ECKA 4FW9A 1AIPA 3IHWA 2YC4C 1KMHB 1U0LA 2ODNA 2G6BA 3SJZA 3HR8A 4CEJB 1U81A 4M1SA 1CR2A 2VBCA 4KLZA 2XTZA 4HUQB 5HKKD 2G1KA 2ZJ2A 3QXHA 4PC2A 3EPKA 3KKOA 5TB5A 4OHYA 2AFIE 1TX4B 4LC1A 1CJVC 1GNRA 3LW7A 1Z47A 5AUOB 4WAUA 2MSDB 4KITB 4RZ3A 2LKCA 5J4KA 1A82A 1N6KA 3A58B 4C0JA 1G3UA 1G6OA 3EZ6A 3FHCB 4DWJA 5BN3A 1NP6A 3M4YA 4L9SA 4KVGA 4OQMA 4EJSB 1XTSA 1W4CA 3RRZA 2Q3HA 2XEXA 2Q3FA 3KXKA 2W6JA 5HZHA 1VCNA 4K8OA 4RD4A 2Q9CA 3D3QA 3KB2A 4JIMA 4O25A 2EQBA 1AKYA 3TQCA 2ZE8A 2DPXA 4G5GA 3WHKA 1UEIA 2AFHE 2XB2A 1YJ5A 1E4VA 2YOHA 2DY1A 4JL6A 4NDZA 3HP1A 1XZQA 5J5CA 1JALA 1NIPA 2GKSA 2RB4A 2DYKA 3KUDA 3LD9A 5FUYA 3UMSA 2NOAA 5J4LA 4C3ZA 4ESVA 3PFIA 4BPBA 3FMPB 4EJSC 4IEEA 5F3WB 2ZRDA 3DMDA 4HB0A 3O47A 4MGYR 4AKEA 2VL7A 3W8RA 2ORVA 4HZIA 3TE6A 1GITA 5FOSA 3RAPR 2NO7A 1KSFX 2B8TA 2GJKA 2QGZA 3KKMA 4UNNA 1KMHA 1SVSA 3NKVA 2GF0A 4KU4A 1MABB 1Z6GA 3QJYA 3KQHA 5AJVB 4G5QA 4HUQA 4HZUB 1XTRA 4AY2A 3THXB 5EXXA 2W83A 4E22A 1FQKA 3MJRA 4ON9A 1WBBA 1BH2A 2A9KA 2RGGA 2ZRMA 2O0JA 4R2IA 5IK2A 4D6PA 1YHNA 4DKXA 4IOMA 2J9RA 2RGBA 4X8LA 5JJLA 3VR6A 1F3OA 3QPUA 3ZZTA 4V02A 4FCVA 4TL6A 4PANA 4PQYA 2Q21A 1JB1A 1KJWA 2ZVPX 2Z83A 4Q1BA 2IHBA 3U61B 3UMFA 4X8HA 3B9PA 4DBLC 4YDSA 2QZ4A 1D2MA 3OIWA 3LAWA 2ORWA 1COWA 3SYNA 4ASUD 3UIEA 4C0LA 3IPXA 4EJSA 2ZRAA 1W36D 1GM5A 1SULA 3GJ8A 3NC1C 1IOZA 5C46F 5FTMA 4P4TA 3C41J 3FYHA 1RJ9B 4A0HA 4LYFA 4B3XA 1XTJA 2HF8A 1X3SA 1Q1EA 3D31A 3ECCA 5GJCA 4TMTA 2HJGA 1TMKA 3DO6A 2AXNA 5CIWA 5EZ5A 1EESA 4B35A 4A82A 1ODFA 2DFKB 3C4JA 3AVOA 2GHIA 2QQ0A 2DWQA 3MWJA 4PSVA 3THYB 2ZJ5A 1OW3B 4JBWA 4AC9A 4P3YA 2IXEA 2ATVA 2QT0A 2VP4A 3K09C 1GG2A 3AKCA 4GSYA 4NONA 3U44B 1B23P 2A2ZA 3OEHD 5FPSA 2DWPA 1NY6A 4GRAA 1XJ0A 4BGDA 3Q8XB 1G7CA 1M6NA 2GZDA 2AXPA 3Q5EA 4FXPA 4OQXA 2V7QA 1IXSB 1DG1G 1MABA 4ZDJA 4O3MA 4D80A 3P4YA 1JJ7A 3LLUA 4HZUA 1KSGA 2IF0A 2OSBA 1Q44A 3EXAA 4TMVA 2VO1A 4V0NA 1ZP6A 1N5KA 1W46A 4Q5IA 4JLBA 3HJNA 4Q1FA 3MLEA 4D81A 1VG1A 1NN0A 5JI2E 1E2LA 1KDTA 4MKGA 1QG2A 2UKDA 1G8GA 1HE1C 2O8BB 2ZPTX 3RNLA 4YLGA 4RVCA 3GLGB 2Z6VA 2IYLD 2MSEB 3WNBA 4KLNA 3R7WB 4F38A 5EJEA 2P6RA 2RGAA 2R8RA 5CYPA 2FFAA 3RDPA 4E09A 3TKLA 4UNSA 1AK2A 1E2GA 3B6EA 4KSCA 3L0OA 3QOFA 3SC3A 1W49A 1IN7A 4XD7A 2C8VA 4XTRA 3OIUA 2WZQA 2ZJZA 3AUXA 3FWYA 3A36A 1NBMD 5JHHB 4LJ6A 4AIIA 4YDHB 1AQYA 3HYRA 4W9MC 5BN4A 2J7KA 1E2MA 5JCZA 4JJKA 5BYJA 1I4TD 3HU1A 1DARA 3BH0A 4PXAA 1E2FA 1N6NA 1NY5A 3T1VA 5P21A 2JA1A 1UJ2A 2WJVA 2FSFA 4JLPA 3U44A 1YVDA 5EE9A 4TL7A 1TU3A 2IYYA 2ZE6A 4GZMA 3SI7A 1U0HC 3SJCA 3D6TB 5L3VA 2W58A 1E94E 2KSQA 1YZGA 4RCZA 3PQCA 1R5BA 5HCNA 1OIWA 2PEZA 2ZJOA 1E1RD 3DKPA 3GP8A 1D2NA 1IN5A 1AA9A 1HTWA 1OXUA 2PCJA 4JLNA 3HPRA 2YWGA 1F60A 2VA8A 2ZRPA 4ERNA 2OBLA 1Q57A 5CB8A 2ZS8A 4OBEA 4HB4A 1VIYA 1SQ5A 1ZU5A 1PLKA 4A2WA 4L5BA 5G3ZA 3PR1A 2O8BA 3IUYA 5FFMA 3I4LA 3GLGA 1ZM9A 3CH4B 4V0MA 3TSWA 4DEYA 1Z6YA 1YZKA 4PHFA 2A5JA 4M9QA 3R7WA 1NMYA 1GKUB 3W6NA 1UADA 4WZAE 5LBIA 1R5OA 2AKYA 1AJEA 4Q7LA 5FL7A 3QF7A 4MGKR 2QMUA 2OT3B 4G01B 2PH1A 4KYUA 1GSIA 2EU8A 1HUQA 4TLEA 4LJYA 5KOYA 3B1XA 3IPYA 2RAPA 5DNYB 1WDTA 3KDSE 1K6MA 2G0NA 1EFTA 2JLQA 3QG5A 4D0LB 4L9WA 5DLQC 2YWHA 4B3FX 1KIMA 5KNCA 4Q7KA 4IOKA 4YMVA 1BKDR 3EC2A 4JJZA 3R8CA 4JVMA 1A2KC 2BV3A 4V0LA 2ZRIA 3SYLA 2FPKA 2QGNA 3DVLA 5LDDC 2J3EA 1XNJA 3H1TA 1KO4A 1NVUQ 3RS2A 1X1RA 1X6VA 1D9XA 1QHXA 4F91B 5FTLA 1UBEA 1JQJC 1GAJA 4QL3A 2GXQA 1X8KA 2EYUA 2IYQA 1UEJA 2QROA 3MJHA 3CR7A 3CRQA 2O8DB 3WMGA 1CJMA 4OKSA 1TL7C 5HZKA 1HE8B 4KBGA 3SBDA 1WA5A 3WP1B 3FB4A 1KY3A 4TLCA 4B48A 3SJBA 3ZVLA 3D8BA 4N0DA 4I99A 5JWRA 5TVKA 4RD1A 1GILA 1XCGB 1KZ7B 3LV8A 4NTZA 4TMXA 2WV9A 5DE3A 5KDDA 1YE8A 2KI5A 3M1IA 4M1YA 2BC9A 1XCPA 2FV8A 2ZRCA 3B5JA 4JVNA 4RD3A 4D25A 2N1BA 3NC0C 4LJ9A 2Y8EA 3QKTA 1TQ2A 4FMBB 4KODA 3UPUA 2J41A 4TYQA 4KJZA 3OESA 4JYCA 2BMEA 3F3YA 5IK2D 3ZVMA 2IWRA 2W00A 4JMPA 4URXR 4ZIRB 1R8SA 2D3WA 2VHCA 1IN6A 1P9RA 1KNXA 1BMFA 3UATA 5JMTA 1FZQA 3FGNA 1ESMA 4GDFA 5ANRB 3HR7A 1NJFA 1TNDA 2IC5A 2QTHA 3PVSA 4KFRA 1W0KD 5FI0B 5GVRA 3SQXA 2WMOB 3GEIA 4PHTA 4DDVA 2O8EB 4Q18A 1QHYA 4LCBA 3R9IA 4DCSA 3THWA 2OEPA 2AWOA 3NBFA 1E2DA 4XH9B 2XZPA 1COWD 3IO3A 1XRJA 4CZ2A 4M53A 2ODWA 4DLTA 1QVRA 2OBNA 1XJQA 4QXAA 4RZXA 4MITA 3K1JA 4IVPA 3WY9A 3GJ4A 2R6CA 2IYSA 2CVHA 2GEVA 2ZI3A 5FOWA 1E6CA 3PEWA 1NN5A 1G6HA 2O8DA 2HXYA 2FDCA 1IQPA 1JXOA 2FN4A 3W9YA 2NO9A 1N0VC 4EUNA 3LX8A 5K8TA 4JLJA 3AM1A 2NZ8A 2ZVQX 1UBCA 2HLDD 4LJ5A 3EZ9A 3HYTA 4QNRA 3BH7A 4PZZA 2OCBA 1TTTA 3P27A 4ZCLA 1II0A 1JR3A 4NCHA 5AR1A 3KZ1E 3CLVA 4Z8YA 2J0SA 5AWFC 1R8QA 3SNHA 4IDHA 5JRJA 1KKLA 3LW8A 1P60A 4JZKA 3RABA 2NMVA 2ZRJA 3RSOA 1T91A 4HAVA 5DI3B 3NXSA 4JSTA 4FCTA 3KFXA 1KAGA 4MKIA 1G17A 1NI3A 1U8ZA 4ZIRA 3F8TA 4NP6A 4HLUA 1RRCA 4QBHA 2V8OA 2W2VA 1HV8A 2WJYA 3LQQA 1MO4A 2JIZA 3AEZA 2FWRA 3U3OA 4FMDF 2UZ3A 4PPFA 1E9AA 3GLGE 4V0ME 2J46A 4FMDB 4PO1A 4BFZA 4V03A 3GFTA 1ESNA 3W3AA 1G8YA 4UJ5A 3LWNA 3Q72A 1Z3IX 1GKYA 3B78A 1RRFA 2PZFA 5EP1A 5G53C 4IVQA 1HT1E 3QENA 4AKGA 3DL0A 1KK2A 5F9HA 3UKDA 4C7OB 2V54A 3U6KA 4L16A 4XD7D 4JKIA 3ZS9A 4NCJA 4QGGA 3BGWA 4RJLA 3DM5A 1VECA 2CCKA 1E2PA 2OILA 1S9DA 2PLRA 2HYIC 1LFDB 1E0AA 5A5GA 2OBMA 2GILA 3I92A 3BH6A 5B2ZA 1E4YA 1W36B 4WOPA 1UKEA 1U99A 2RMKA 3T1OA 1M8PA 3MWKA 5KDLA 4IHQA 4N3NA 1EG7A 3C5CA 1OH6A 2FG5A 2ZSFA 3K0SA 3B7GA 3O8DA 1UFQA 1QDEA 2D06A 1OB2A 1GNQA 3U3JA 3SZRA 5DI3A 2C03A 4ITRC 3F0TA 1LF5A 2YNMA 2REBA 4C9BA 1WGWA 1W36C 2GCOB 4GOJA 1SHKA 1G21E 2RHDA 5KNDA 5A0FA 4A0RA 2VHUA 1ZM3A 2FEMA 3BJIC 1AS0A 1QHNA 4US0R 3LBIA 3MSXA 4QJ4A 4BUJA 2OAP1 1XD8A 1I4DD 2KBEA 3AH8A 4KI0A 2Z4RA 4E07A 1EWRA 2JLRA 3K0CC 3FFBA 1R10A 1E9CA 3A4NA 4IOLA 1NKSA 1XTKA 2CLDX 3ZVNA 3CX6A 3W5JA 1IM2A 4D0NA 4GP7A 1UBGA 3Q3JB 5FL7D 3K0AB 2DB3A 2DFTA 3W6OA 1FTNA 2HT1A 4U7DA 3GQBA 3ASYA 2HT6A 1A2BA 2X1VA 1AKEA 2ZU6A 2AKAB 4PFSA 4PC1A 1Q20A 1IN4A 4BZPA 3LXRA 1KTVA 2XNDA 2PX3A 1SVKA 1ZCAA 2JASA 5GJBA 2HDNB 2G83A 1KI4A 2ZUCA 3CRRA 4KHZA 1HH4A 4RKEA 3REGA 4ASUA 3EX7C 2P6NA 1II9A 2Q3MA 3IHLA 2A78A 2BM1A 1OFTA 1UDXA 4I4LA 3RYTC 4Q7MB 2BBTA 1OIVA 3MWLA 3ZGXA 1Z28A 2YYZA 1JXMA 1E69A 2QBYB 1XDBA 3K0CA 4OQNA 2ZI6A 2J5XA 4HAYA 4I1VA 4ZDWA 4ABYA 4PTLA 4LHZA 5FOXA 2VP2A 1N6HA 4QC2A 1OHHD 2QMOA 5FTNA 5LD2C 1II8B 2IXGA 3ND8A 3UANA 1XMJA 2GCOA 2F7SA 3TJZA 2P2LA 3I1FA 1CR0A 1JR3E 1A5TA 1CKEA 1OV4A 1XTIA 1G1MA 4K81B 4U02A 4CT5A 4Q1CA 1Z63A 1QBKC 2R6AA 2AX4A 3K70D 4OL0A 2VP6A 2N42A 1OH7A 1T8TA 1M1YE 2QUZA 2YHSA 2DHRA 1NVXQ 3VNUA 3RANA 2GJ9A 1U9IA 2H18A 1P62B 2ZTSA 3AUYA 4NMMA 1G19A 2B7BA 2X19A 2ZRFA 4NYJR 3KFVA 1P61B 2ZSAA 2VP0A 5EE1A 3K0AA 1HEIA 2BDTA 2G0TA 4DSNA 3U3KA 5TXGA 2OCAA 2OFXA 2C9YA 4PHHA 5SZHB 1BMFD 2REXB 4GPTA 2J0QA 3KQUA 2ZYUX 4CIDA 2OCYC 3G82C 1DAGA 4GOXA 2ZR0A 2IHYA 2BKEA 2OAQ1 2XX3A 4WZBE 3MAAC 2WJGA 4LV5B 1NSTA 521PA 2GJSA 2CLSA 4G1UC 4Q00A 5BWMA 4MYTA 2CCGA 1TADA 4WZ6A 4TZ6A 1QF9A 3KX2A 1KK1A 2F43B 4Q66C 4A36A 2GCNA 1RIFA 1FQJA 3WRYC 4QGHA 4JS0A 2QBYA 2GAOA 1JJVA 3FVQA 4URYR 6Q21A 4HI0E 4OI0A 3H0KA 4YMSA 4P4SB 4NKRA 1W5SA 5G41A 2FE4A 4JVSB 3LRPA 4KYIB 5L8VA 3EIEA 3I62A 2LWIA 3AVTA 2OZEA 1ZIOA 5AJZA 1E32A 1XPRA 1TUEA 1JR3D 2CE2X 121PA 2YV5A 3FMOB 2N46A 1JPNA 1QHHB 2ZREA 4Z1MA 4XWOA 5FBQB 3EASA 4HYYA 1R4AA 2QAJA 3IBYA 1VG9B 1IY1A 1G7SA 3I8XA 1TQ6A 1ZM2A 2ZI9A 4YQFA 2JLSA 1G5TA 1MO3A 2A5FA 4EPTA 3CWZA 1QVAA 4BLQA 3T15A 4C2UA 4QJ5A 4V0OA 2MSCB 2FA9A 2PT7A 1VHTA 2O0HA 1T5LA 5EE3A 1N25A 1KJYA 3CPEA 2IS1A 2F1IA 1IONA 3I73A 1HURA 4XWKA 4NYJQ 5J4VA 2ERXA 3R8FA 1YR7A 3QKUA 2A30A 2AK2A 4XTCS 5FBRB 5IDVA 3ZZUA 3P20A 2FNAA 2ORIA 2OM2A 2ZM5A 3VR4A 1T9HA 1OKKD 1XD9A 2V1XA 2IEZA 3WBKA 4IRUB 3RLFA 2F43A 1ZD9A 1JAHA 2GK7A 4AYWA 4PAMA 1Q1BA 2GEUA 3U7HB 1CF4A 2CHVA 1FP7A 4P4SA 3GEEA 5SZIA 1PZNA 1TQ4A 2C99A 1YR6A 2CEAA 2JJ8A 2QM8A 2VP9A 5EE5B 1ZINA 4M1KA 5EXSA 1N0UA 5H70A 3GJ3A 3B1YA 3TGPA 4FD2A 4MKHA 1KO8A 1OXVA 2BOVA 2C98A 4D26A 1P72A 1XEXB 3TRFA 1D6JA 1QHHA 2PCLA 1XCMA 4EDHA 1E9RA 4WBSA 5AJXA 1S3SA 3IQWA 3FMIA 3AF3A 4AYXA 1BS1A 4CEHA 2WPDD 1VMAA 2RGDA 1Z6AA 3N70A 4E5UA 3EIHA 4HUTA 1P4SA 4GT1A 5J4YA 1OSNA 2UZIR 4Q9IA 1SXJB 5KO2A 1BO6A 4M1TA 3VR3A 3L0SA 2CBZA 4ILEA 1Z08A 1S1MA 3DKVA 4TLBA 4DHEA 2OFWA 5B30A 3AVYA 3LVQE 2WWXA 4GMDA 1E2EA 5IRCD 1CJKC 1UKVY 2ZRHA 1P7CA 4TL8A 5FI1B 4DSOA 2R6FA 2NTYC 5GVSA 3LFUA 3MWYW 1CTQA 4QHYA 1XU4A 3QEOA 2NGRA 2WIAA 3B2EA 4ZKEA 4A6PA 1FMLA 4NE2A 2W2XA 1W0KA 3GJ0A 3ZQ6A 2XNDD 4NCNA 1ZCBA 2VRWA 2QENA 1Z0IA 5E3HA 4OK3A 4DXAA 3SQWA 3VNVA 3NBXX 3PUYA 5KNBA 2CCJA 3A6PC 1OJLA 1EFHA 2Z43A 5B64A 1PUJA 4N1AA 3ZVRA 1RRGA 3H86A 1R5NA 3CRW1 1E0KA 5EP2A 3MD0A 2LCFA 3X1DA 1XEXA 4DZZA 3VKGA 1NBME 2DFNA 1VCIA 4NYIR 3SBEA 3HU2A 4BFUA 2PJRA 2CK3A 3T61A 4UJ3A 3FTQA 3QF4B 2OUKA 4C0SA 1KI8A 1C1YA 1N2CE 1NJGA 5TDHA 4JKYA 4TSFA
chains in the Genus database with same CATH superfamily
2XDYA 1WXQA 4HNAA 3VGPA 4HQ0A 1K05A 3GANA 1T2DA 3VF0A 821PA 2QLBA 2OPHA 1KU0A 1AUQA 1C17M 3DZKA 3LS0A 3V1LA 4ONEA 5FULA 3L34A 2ISQA 2O1WA 2GD6A 4XUGB 3GLHB 4HWGA 2DXIA 3IIEA 4UOQA 4CN9A 4QFMA 2H2IA 3G2KA 3BDIA 1VJ5A 1JBQA 2PNOA 2V3CC 2M64A 3PD0A 1WP9A 4H17A 2O7VA 4EARA 1RPTA 2ZIZA 3FBGA 1Q50A 5GV8A 4TUYA 1S3GA 3UXMA 1OYYA 5CFLA 3QTLA 1U6JA 4TV8A 3AEUA 4DTCA 4HGYA 1R6TA 1TVMA 3LBNA 5L3SB 3E23A 3QBTA 4J0JA 1D4AA 2ZJ3A 5IKEA 1RWBA 2JFBA 2A0UA 5FJJA 1N6IA 5LOVF 4RF5A 3H2ZA 4J91A 1Z0UA 1XTPA 1VXRA 1NW6A 3ASZA 2AG6A 2AOTB 2VH2A 1C03A 4UE2A 3ZV6A 1EFVB 1BCSA 3HY4A 3IC5A 2H07A 1L1EA 4AY3A 2R1ZA 2IYTA 4H1VA 1EVIA 1QIDA 1RKEA 5EWJA 1YULA 3HKCB 1FX0A 5A6BA 1RI1A 3IB3A 3BCUA 4PYQA 3D8TA 3KR1A 5HXAA 3DFUA 1YBHA 4PQFA 4IV0A 1CWUA 1OFGA 2CF5A 2BCGY 1ZMTA 5BWOA 1RYMA 3BT7A 1KI1A 1JFRA 1UK8A 4QO8A 3PENA 4DQVA 3GLFA 3H9EO 3JAWA 1RBZA 3SN6A 2PDAA 2QI9C 2C5HA 4MGZR 1I4WA 1JT9A 4E5DA 3WC4A 1DO2A 1SXIA 2I6SA 3M89A 4Q4AA 2Y27A 1FDOA 1T9GS 2NTJA 3LT5A 1O3UA 1PW5A 2IITA 3NGMA 4AJNA 1NBEA 1QO9A 2HOQA 4NMLA 1Z4IA 5COBA 4EK9A 3FLEA 1TYCA 3BXFA 2P69A 5C4IA 1FA9A 2EVWX 1KY4A 2FFHA 2J0EA 2EIJC 2QD4A 2WVQA 5FUXA 3KC2A 1VL2A 3MERA 2Q1SA 2WM2A 2RKBA 3H11A 3HCRA 2DHDA 1LBSA 3RW9A 4A2NB 3P1JA 2HUPA 1U04A 3NHBA 3PDCA 3OM9A 5KYXB 1NRIA 4EPRA 1TW3A 3EWNA 2D8MA 4UFNA 4EVIA 1UKZA 1DAIA 1ZJWA 2I4NA 4HHEA 3UHPA 4IQ4A 4JURI 4ZQCB 2HJRA 2JJ2A 1KE1A 4DOMA 4ZOLA 4MW7A 3LIIA 5JAZA 3SHQA 3V1NA 2UYQA 4S0ZA 4YL1A 4RZUA 2B6NA 5IM4F 1YONA 1ECJA 4BEMJ 1SY7A 4GKAA 4AO8A 3VYSB 4BMSA 1JQLB 2F59A 3KTAB 4FOLA 3A1CA 3R3XA 1SHTX 1WULS 1VHJA 4F6RA 2FG7C 3HKDA 2BEKA 3WLLA 1RVDA 4RU1A 1PGOA 1DLJA 4REOA 2O3RA 3H2HA 3S2ZA 1E3LA 5DH9A 1H6CA 2UYHA 3CUYA 2PGXA 4W4TA 5IJ0A 1HQDA 4NJMA 3ESBA 2WYWA 2XZLA 1JF8A 4I8DA 1XTQA 3DZAA 5HOQA 1GGJA 3E18A 4BFWA 1XZFA 4I4CA 4E6EA 2X2OA 2WJIA 2QYOA 3HN6A 1GT91 4S35A 1V8BA 4DLYA 3Q7PA 4QAJA 5DM0A 3E82A 4FS3A 1SHJA 3ZSUA 3ZQUA 3KKNA 1JDZA 4AK9A 2CXXA 4J3FA 4BQOA 5GGYA 1TCCA 3QFFA 4ZI3A 3JQAB 4DIKA 1DKLA 1FNMA 3GLSA 4XWJA 4W8HA 3TOMA 3AEQB 2BFCB 3QTHA 2H17A 5T1DB 3ANYB 3H8VA 5KJFA 2QV7A 2A7XA 5KTMA 3QTBA 4GR5A 4F92B 1M2VB 4XI9A 4V0KA 2YKZA 2DRIA 5KTYA 4Y7DA 1D7OA 3NANA 3GJ5A 3R3VA 4DARA 4NFLA 3AHJA 3P0JA 2O20A 3LQ4A 4V0QA 3B5IA 3ZWXA 2HKVA 4KXNA 1C7FA 2E18A 3F46A 2Q1XA 2HWYA 3WWCA 4DDUA 3UTDA 4R1LA 1LW7A 2XUFA 2V8BA 5A4MS 4PZUA 1ODJA 4YRNA 2GZMA 1BX3A 4QJIA 4XDGA 3I3SR 2FSPA 1Z23A 4J0KA 3RCBA 3NRCA 2ZROA 4ZAZA 3HB0A 2QM3A 1OA1A 2FZGA 2JEOA 3SHFA 4CEJA 5ALYA 1JHMA 4QVGA 1HT2E 1F8YA 2IUTA 3GJ6A 2REQB 4IKPA 1GAWA 4D43A 1YBVA 1HDZA 3DBRA 1CE8B 1LBTA 3GYBA 3PVZA 2ODBA 3WL8A 3CEPB 1EE9A 3IMGA 1M7BA 4H15A 1RXSA 4KNYA 1BRMA 1JEYB 2UZAA 1JP7A 2O06A 4MWBA 1RAGA 1MAVA 4Q1VA 4BV9A 2P27A 1E1DA 1E3WB 3UW3A 4AJEA 5CEEA 5EJ4A 3VHXB 2AA3A 1E18A 3VC2A 3EG5A 4GI2A 2OJQA 3I09A 1WTCA 4YRFA 3VZRA 1QPGA 3VNAA 2HFKA 1FIUA 5JZ9A 5J1TB 1NXWA 1W47A 2ZI7A 1G4HA 1RAHA 5KEIA 5EKDA 3L0BA 4FFBB 1B3BA 3K09A 2D7DA 1SBCA 4JJ8A 3WIVA 3RS5A 1VMKA 3C8DA 1DAMA 1FYEA 1RI5A 1THMA 4NEHB 4LCJA 2P5UA 1CUWA 4DDTA 1R0RE 2WSSA 3TLEA 2NQ8A 5JUAA 3HFJA 3Q0IA 1RE0A 1ZOLA 3IOCA 2L17A 1W8DA 4NMHA 5EFZA 4DV0B 3ROFA 2DVMA 3IOBA 5CP8A 4IHJF 3OE1A 1WUJS 4A5OA 3P45A 4MVJI 3O4FA 1MO5A 1GL3A 1NHWA 3AF2A 2HCFA 4KZKA 3R0VA 4ZCSA 2CUNA 4L75A 1XD2A 4O4JA 3RC9A 4ESOA 4OLFA 3DVAB 2V3VA 3B38A 2V26A 4JCZA 5L3QA 1JYSA 1I32A 2FSSA 1PJRA 3B6ZA 4IVNA 3FFAA 4JLVA 2NSYA 3GODA 2FH5B 4X3OA 2IVZA 4FDMA 1MVOA 4B7AA 3TLYA 1EQ2A 4ZLDA 3EZYA 3K0BA 3QUAA 1EXMA 2YWFA 3FF4A 3AGPA 3S5UA 1GGKA 4G78A 2OORA 3PGLA 4RLHA 4FFVA 2OD2A 4C2TA 5C53B 1BHSA 4WJKB 2F9LA 3EHMA 1DQYA 5AW7A 4JYMA 3ZCVA 4QJ3A 4QYMA 3ZC4A 1L4YA 5JCJD 3F3SA 3DMNA 3RFYA 3SDBA 2EWWA 4UXJA 5GONB 3LWBA 1Z4MA 1KDOA 6NULA 1SKYB 2WJPA 4J1QA 2R6JA 5JJKA 3U7EB 1GPAA 4GL4A 4DSZA 2QEQA 3HNIA 4K9DA 1QH8B 1WX1A 1P1IA 5ILQA 5EIFA 4U7HA 1BWSA 2ZBPA 2DWOA 4M9XA 3M6AA 3PHJA 3P4XA 3RTAA 4KYTA 2XOKA 4XPIA 4JYZA 3QXCA 4HQKA 1TLLA 1FW6A 5C1PA 1DMSA 4LE1A 2PXXA 4AYTA 2VJMB 1J99A 2QYHA 1CQIA 4G81A 4Y9UA 4LYGA 3U9LA 4V0RA 1RBQA 1CIPA 5ILGA 3ZGOA 4H18A 2OO5A 1T4DA 3T3PB 2ZPUA 1WP4A 2BEWB 5AKIA 2NM0A 4RTOA 2GDZA 5BPHA 1M67A 3E3LA 2VWPA 2FGJA 4X0EA 3IV7A 4MVMA 2BJVA 3OLQA 1NMSA 1J2RA 2WTMA 1YQXA 2OB2A 4MLCA 4NU8X 3VVMA 4F8JA 4QYWA 4ZI7F 4P36A 1RAIA 1NT4A 3RYCB 2AFIA 4B3HA 4B3MB 4NV0A 4RLSA 4ETWA 4L8YA 3HDHA 1DJOA 1PVVA 3P9IA 3FCXA 3WAJA 4ARAA 1JECA 5HM6A 2ORYA 2JFQA 1E4EA 5K8LA 4PNEA 1Z2OX 2B78A 4OI4A 3D3NA 1BDMA 4YCCA 1BWRA 1PT7A 4Y1RB 3EXHA 1P80A 2D2VA 3BFXA 5FL3A 2CLIB 5TMEA 1AKRA 2IXOA 3U5SA 1Z4LA 2QA5A 4JQZA 2VXBA 5J5VA 4DIOA 4ESEA 5I48A 3HBAA 4X45A 3PPIA 2YCBA 2G08A 3ZI7A 5EERA 1V7QA 4BRSA 1G16A 3LM8A 3HY6A 4EI9A 1TAGA 2ZFUA 4D4GA 4BN4A 3AP3A 2ZVJA 1WE2A 2V7VA 1OYVA 2Q6VA 5J2TF 1V3UA 4BMYA 3NG1A 1XE3A 1ZZPA 5AVJA 1JJFA 2B34A 1LSJA 3VYVA 3H3XA 3LKVA 3JY6A 1FP1D 3P26A 3PITA 3L3BA 4N03A 3QW2A 4QTTB 3HMQA 2AQ8A 6ABPA 3NWJA 3LY5A 3TRDA 2H1OA 3TTWA 5EVCA 2QLNA 1Z7WA 3EW9A 4MYRA 2WF5A 2EFEB 1OLSA 3IHWA 2IBFA 3EZHA 1PV3A 1YBFA 1GUYA 2G1KA 1WNFA 2OQMA 4MIOA 1Z47A 5EJGA 2MYNA 3T7TA 4XW2A 2WTAA 4K3VA 4D3SA 3TL2A 4C0JA 1VGRA 1UBRS 4E3ZA 1T1JA 1U4OA 1NP7A 1W4CA 5IANA 4IINA 4QDJA 3PQ2A 1Y33E 3KD2A 2W2QA 2NACA 2XMQA 1ABBA 2XB2A 1XZQA 5FUYA 5EEHA 3TK0A 2ALJA 4HB0A 2PU7A 4UAUA 1U7PA 2XMRA 1MABB 1FSGA 2O1EA 4HUQA 2VSNA 2CMGA 5JXWA 4E22A 1TWCA 2O0JA 3HCWA 4TL6A 1QMGA 5FF9A 4JHLA 1JB1A 4URHA 3U61B 3QX9A 4CTKA 5A4DA 5K03A 3KYDA 4O2AF 3GJ8A 5C46F 4F5YA 2JAUA 4KQEA 4S05A 1Q1EA 5LU9A 1ODFA 3MQ4A 4JBWA 4AC9A 3TL6A 3I4CA 3C97A 4C1NA 4CQLB 3ITDA 1HLDA 1RACA 3IOEA 1YC2A 4HWRA 3CX4A 4RABA 3QNMA 2Q4DA 3HJNA 1YI8A 1YZ3A 5AC4A 1E2LA 4I6EA 2W98A 1XMOB 1HE1C 1PTJA 1OXBA 2JIBA 2VHYA 1G8KA 5L6MB 5CU7A 4G0XA 4RV4A 1OU0A 4UBKA 4E08A 1LBHA 4LRSB 3RTCA 1WHTB 5JH7A 4IJ5A 1K7YA 3X1OA 2KK1A 3N05A 2XMZA 5CDGA 1YDGA 3DV0A 3G79A 3I2FA 2CXOA 3HJAA 3COSA 4DUZB 5EKXA 2FSFA 4BN0A 5EGNA 3D6TB 5L3VA 3OIFA 1THGA 1N3IA 4PPYA 3PQCA 4KRFA 4FZ3A 3UMJA 2I2BA 3RV3A 2XMGA 1HTWA 2Y1DA 3PCVA 1Q57A 2PRIA 2ZS8A 2HO4A 4S1WA 3AQIA 3GHHA 4A2WA 4PGHA 1RQ7A 3FLMA 3OJ0A 3GLGA 1ZM9A 4IG4A 5K3OA 4GEHA 3FR7A 3W6UA 2JCBA 1AJEA 3CKKA 2QMUA 5CHYA 4LXYA 5COAA 4ZALA 3O5AA 3FNGA 4D0LB 3CTMA 3EODA 5KNCA 3EXFB 3WLTA 3SYLA 5BQOA 2FPKA 3DVLA 4QPDA 1QAOA 1WY7A 4CF3A 4F91B 1QHXA 3O03A 5AI6A 4KXYA 5IAOA 5HZKA 1UMDA 2C8JA 2FP4A 1XCGB 3LV8A 4ZARA 5B4UA 4JVNA 2N1BA 4FMBB 3WLHA 4MWSA 4CJGA 3GWZA 4OA8A 5I4IA 5IK2D 4MTCA 1JZSA 3NOOA 4CSAC 3V1MA 3TEFA 5GVRA 2HBYA 2PS3A 4OSPA 4XH9B 2Z6QA 2HWKA 4RZXA 4C06A 2Y1XA 5IBCA 3GMIA 5I4KA 1P7WA 1ESZA 3CVJA 2XLEA 1L4HA 2D2XA 4HGQA 2IHUA 2E2WA 1K3TA 3II6X 4K5QA 4BU0A 1EB8A 3BTSA 3ZBUA 3S7TA 3NQ41 4OB8A 2Q1TA 1I1QB 1UIMA 3HKEA 1NI4A 2XL4A 2ZBRA 4RH0A 3BXPA 5A03A 3F8TA 1LKZA 4HLUA 4HP8A 5CVCA 2WJYA 1HBJA 4ZN6A 4TQGA 2EPNA 3ED5A 2DP4E 3R5FA 3ZS9A 4P7BA 5MDHA 1UC8A 3DG9A 3DM5A 1VECA 1ODIA 1C1DA 1PD1A 1K8ZB 2DUJA 2RMKA 4KMRA 3ZDXB 5L0CA 1R64A 5CXQA 1LPAB 1OH6A 4OL9A 2JGDA 4P82A 2Y2UA 2OCLA 1IYZA 2BKLA 1VLHA 3UAYA 1FLAA 1IPEA 2LTAA 2VHUA 1G8AA 3HVRA 1MZVA 4KI0A 2PX4A 3HA2A 4V38A 4NQZA 2JLRA 2HSBA 3V48A 1R10A 1RM0A 5FUBA 3Q3JB 1A5BB 4IGKA 5ADHA 3GQBA 4Y6SA 2I15A 1AKEA 4DR4B 2HNKA 1I80A 2TRSB 3K2IA 3IT0A 1M2GA 1KI4A 3CXUA 1LDYA 4GR9A 3KWLA 3WK8A 1V74B 4JODA 1VLJA 3NW9A 3H04A 2EBWA 3MBIA 1C3OB 1M56C 5FOXA 5LD2C 1EU1A 3DONA 2HGZA 1JR3E 5H82A 3L8MA 2R6AA 4ZYXA 5EIBC 3E5RA 1NSGB 3ABRB 3WADA 3RANA 1U9IA 3A2LA 1N0IA 3UKOA 3OJEA 1FP4B 5EE1A 4F2HA 4FXOA 2OCAA 2YHIA 2YIDA 4PHHA 3ZLTA 3TO5A 3MAAC 4LV5B 2IPXA 5BPFA 4LRUA 4MSUA 3LCRA 3KX2A 4U9HS 1GAXA 4OI0A 1H6BA 1N2CA 3FPGA 5EZSA 3MTEA 2X8JA 4NBLA 3CR3C 1EUCA 121PA 4G37A 3Q3HA 4G4SP 4RD9A 2VNIA 2PY6A 3UUWA 1QVAA 4I55B 1CUBA 2FA9A 3NT5A 2PT7A 3VPCA 4EG6A 1VHTA 2HIGA 1U2SA 5DASA 2IZ5A 1YL5A 3EE6A 4NCQA 3BKWA 2P6MA 5ADWA 2VNJA 3WBKA 3MWGA 1EKXA 3I2KA 3EVFA 3B1YA 2R9RB 5DQTA 2BOVA 2C59A 3LPDA 4D26A 5J2UF 4HDAA 3WRVA 5AJXA 4GXTA 4AYXA 4D9JA 1GFZA 5EPOA 3UK7A 3QQPA 1Q7EA 3JRMO 1JNXX 2WPDD 4R1NA 2GRUA 5E6SA 1PK7A 2XUPA 2IOFA 3AUSA 1M6HA 5JNWA 4KGVA 2PXAA 4X20B 3UN1A 1MW8X 2HY7A 5B30A 4LE2A 3WK4A 4GWGA 1TJ5A 3WAQA 4EJ0A 3TZBA 1QS0B 2HCTA 2EEPA 2GM3A 1U02A 3LPAA 5FRDA 1QYIA 1CW2B 4WSOA 1ZWLA 1YTLA 1H2AS 5CA1A 2M9MA 5FFFA 3SBEA 2CK3A 3PIDA 2HJHA 4UJ3A 2FWNA 1YIDA 3B5EA 4OHBA 5G4KB 1GUAA 4NCIA 3LJKA 1RC8A 3OOJA 4Q6BA 4TM7A 1UOOA 3EUEA 5JNRA 5EP3A 1YS9A 5BP7A 2O1XA 1H6GA 3ITFA 3G6WA 3KU1A 4GEKA 3LY7A 3B1WA 2D5IA 2XZOA 1TUBA 1E3DA 5M5BA 5FR2A 2IBSA 3WYNA 3UNGC 1KTIA 1PVOA 4L5YA 2OKUA 4E5PA 1ZH0A 4NY3A 1UM9A 3AB3A 1Q21A 3L9WA 1H9AA 3QF4A 2QGFA 5CB4F 2DF8A 4HL6A 5JRAA 1I13A 3QYPA 1RPNA 2XF2A 1Q0QA 3RKOF 3STXA 5HIMA 1KZ6A 1HLGA 2IYRA 3EAGA 4CE6A 2BHSA 7REQA 3EPPA 3ZIAA 4EGSA 3KSDO 3LH5A 4EQ6B 3HH8A 3W8HA 5A9TA 2IEYA 4PC3A 1ULZA 1P9LA 3GLHA 5TF0A 4LJSA 5CTJA 4I44A 5FR1A 3RU3A 3KUCA 2YINC 4MKXA 2ZXPA 1DTSA 3S55A 4IJVA 3W4KA 1S2OA 1S2DA 4DMKA 4XVUA 1JH8A 3B7WA 2O1SA 2VS1A 5AM5A 4DAEA 4B3JA 4BVLA 1EGAA 5EJ5A 2JAQA 1ONPA 2AKEA 3Q8WA 1GTSA 2WT9A 5L3SA 2QZ9A 1Z9BA 4GE3A 3N5CA 1B68A 4UDVA 3VPDA 2QLMA 4B33A 4MYSA 1XXHB 4X66B 3SXUB 4KDEA 3CTPA 4CL0A 3ZNOA 2WSYB 5H8WA 4DJEC 3EIQA 2C8KA 2QWXA 1EFVA 2OP0A 2NWQA 5JSFA 4PS0A 2EBFX 4GMXA 2A8YA 3MPUA 4BZQA 3GF4A 3GYGA 3BG5A 3IEPA 2GGSA 4QUJA 1MT0A 3JR3A 1D6NA 1HA3A 4NI5A 3BMOB 3NXKA 2EIKC 2X3UA 4EHKA 4ULVA 2VYCA 1T6BY 2XECA 4FHZA 3I61A 4E12A 4CKWB 1HNNA 5HM8A 5AKJA 1NLZA 3QNUA 2FMFA 3EGIA 4WKPA 3OFNA 4U4AA 3HO8A 2BMJA 5BQ3A 4CI9A 1I36A 4Q3LA 1K2VN 3M0EA 1KMIY 5CGQB 1U7TA 1N3YA 4PNZA 1GL7A 4UQOA 3DM9B 1N5LA 1UKCA 1HT0A 2A4KA 3T7KA 4AJPA 3RVNA 4JVLA 5ESXA 1NUQA 2C04A 1TU4A 3VYWA 4MA0A 4TX1A 5L40A 1FFHA 4RKYA 2YZGA 4OQPA 1B93A 4EJMA 4AWBA 4DUGD 5ALMA 1SVIA 1L4EA 3UJAA 3T5TA 3FPFA 1P0CA 5AW1A 4LHWA 1AF4A 1OASA 2C5LA 3R6LA 2FSGA 4QNMA 2GWWA 2FE1A 4ACAA 5CTAA 1FYFA 4AURA 1W2WB 1BJKA 1QU2A 4AZWA 4HGOA 4B71A 1KFBB 2Q45A 1PL6A 3U3ZA 2OV2A 3EFEA 1XCOA 2JFPA 2D62A 3GZJA 2ZB7A 3GGSA 1UP4A 4BMOB 4WGYA 3LCJA 1GV1A 5KJ6A 3CEHA 2PZAA 1E8NA 1E1QA 3SE0A 3FNBA 1EK0A 2EFHB 3RSGA 3KTAA 3T99A 4DRIB 3ZV5A 1VYTA 2C7QA 3NZEA 4P3XA 1K8QA 1ZUD1 4EOGA 1KNQA 2AVDA 5LQNA 2GTHA 2QR2A 4WFKA 3I3OA 2IJGX 3IX7A 4OGWA 5BNTA 1XNGA 3RVRA 1JZTA 1UIRA 4BNKA 3JRXA 4CIBA 4I08A 4QT0A 1G8FA 3JVUA 4YJKA 3DULA 1S8FA 1SN7A 2AOUB 2JKVA 3PZBA 1S4MA 3LC7O 2CMKA 4JB0A 2X76A 3ZIDA 2GEFA 1K2WA 1YUBA 2CF6A 3OC6A 5A1JA 4PLWA 2IHZA 2A6HF 4QWMA 3PUZA 3K6BA 2QE7D 2CYDA 1T4CB 3IGFA 2HMUA 3EPRA 2D13A 3H6KA 2PRKA 2PUJA 1DXHA 3K7EA 3EHEA 4D4LA 3DF7A 5BORA 2YW9A 2OZKA 2HDOA 4RMIA 1QIIA 1A9ZA 1ODLA 3JQAA 4TZTA 4MV4A 1JEDA 3IHTA 3AEQA 3Q7RA 4MVCA 1VYIA 1QFZA 2J8ZA 2TECE 1GG8A 4FAPB 3WGIA 1CT9A 5T3UA 5LJIA 2RBKA 2EL9A 4M1OA 3M5WA 4XSGA 5AJHA 2OAEA 1SXJC 3M9LA 2BGJA 3TTTA 1ND6A 4H7DA 2WQ7A 3SZUA 4ITUA 2D59A 4A0SA 3ZDQA 1DEOA 3T1HB 2GZ3A 4DLVA 2EFCB 3JVDA 4BQEA 2XTJA 1RFGE 1AO3A 4Z7JA 3TZHA 3X2EA 1LNZA 2RGEA 5CUQA 4LEIA 1SZJG 3UMVA 3FUUA 2P78A 4FOSA 1CRQA 2VZ9A 5JS1A 3E2IA 4KPYA 5C1IA 4ZT5A 5C5DA 3TOLA 3OZXA 2QRKA 2IX3A 2W6IA 1BU5A 4P92A 1VIAA 3NIGB 4XRRA 3M3DA 1NW3A 2FWJA 4WCFC 1VYVA 2RK4A 4J75A 5DS6A 1VCOA 4BMNA 1CE8A 4EIYA 3OHPA 5HIAA 1TECE 1JEYA 2PEYA 5DYYA 3E5MA 2B3DA 3K0FB 4YP1A 1KGSA 3CONA 1E3WA 3K9LA 3D54D 4BGIA 2HEIA 2G1PA 3QE9Y 4B7UA 2P2CA 3VDQA 3VHXA 1X2BA 4II3A 2I8LA 3R77A 4YA6A 3EZNA 4MW4A 4GECA 4FCWA 4RCVA 2NPOA 3E1KA 3UF0A 5G3YA 4PR3A 4U5FE 3MTIA 5K3EA 5CBPB 3I6MA 2EXXA 3PUHA 1F2TB 1O94A 3WWOA 4FFBA 3T52A 3RNOA 4UM9B 2O57A 1B6GA 4R41A 3B7PA 3ZE6A 1WXIA 1HMDA 4H16A 4P0PB 3KBOA 4DLAA 5T3TA 3G0BA 5AKKA 3ZZ0A 2RB5A 2LP4Y 1Z74A 4C6TA 1OIXA 1GRVA 4CM1A 1CZRA 1EDEA 1EFPB 2H1SA 1ULHA 1W7AA 3KJEA 3LNTA 1E58A 1JE0A 1J2JA 1R50A 1PT6A 4CETA 2H1IA 4MICA 1CRPA 3P2MA 3AESB 4PZLA 3WLQA 3CNOA 1G66A 4CYMA 2NO0A 3DVAA 1SD5A 3AVWA 2OKGA 3DFZA 1MA0A 1XTTA 1OTHA 1MA3A 4QBIA 4LNUB 2AP3A 5KU7A 2B25A 1SKMA 1K8RA 4Z8XA 3H5TA 5C5CA 4FU0A 2WF8A 2V58A 4G5OA 3FMSA 2LQGA 3ZYCA 4XYLA 3Q11A 3J81k 1YDHA 2YXNA 3LT1A 4KAFA 2AMFA 4OQEA 3BERA 2GA9A 1IN8A 4NYMQ 4UTRA 3COWA 1YSCA 3O8CA 4OSEA 2HW8A 4IQFA 3AKDA 1H4QA 5CW2A 4WY5A 5EXPA 4PYNA 3PUJA 4OQLA 1DWPA 1ZOIA 1IWPB 4QQNA 4E94A 1GPYA 1Q16A 2VF2A 1KI3A 2EP5A 1E2KA 4CEIB 4P31A 3K92A 3HP4A 1M0EA 5K2OA 3OU6A 1KMCA 5HIKA 4KN5A 2C5SA 3GU3A 2VH5R 3X0DA 4AJKA 5GONA 2B94A 5SY6A 1MX1A 2B21A 3JQ6A 4QXMA 4K1LA 5JYEA 5F21A 3C5WP 1QH8A 3AR8A 4AKHA 4E1BA 4ZOQI 2GQ0A 2Q5JA 2A68F 1MIHA 2AR7A 2P9EA 4O79A 2CJWB 3G0GA 1ZCJA 4UQLA 3R7DA 1ODCA 3G0DA 2VJMA 1VLTA 2Z98A 4LXIA 4CHTA 3HKKA 1Z7EA 2HMAA 3AUTA 1WZEA 1GRNA 4CT0A 2PL1A 4MUFA 2WABA 2A0XA 4DMUB 3NLLA 1KL7A 3R74A 4HO1X 1KR5A 4WJZA 1H3EA 1Q12A 1T9BA 1JG6A 3E5HA 3R40A 1WQ4A 3GRZA 4IIGA 5I45A 4Y6QA 2QRJA 3KLNA 2CHQA 5ICFA 2AF4C 2I6UA 2JJ1D 2O05A 2X77A 3RYCA 4B83A 2V9ZA 2IH4A 1J90A 2AX3A 3DS8A 4FHEA 1GPLA 4PW0A 5HIIA 3SIWA 4QLAA 3C6ZA 3CKYA 3LCCA 3TVYA 2XT0A 3B1JA 4CR6A 3L7BA 1FZTA 2XLVA 1OWLA 2BSXA 4V3BA 2HI0A 3PDJA 3EPHA 3K1ZA 3UWPA 1ULUA 3QY0A 4EZIA 2AJ8A 5JYDA 5BN3B 2HZBA 1OH8A 1U65A 2IYOA 3CVWA 3RQFA 1L8AA 3AIIA 4HEA6 1VDZA 1Z4KA 1E2BA 2CL7X 4Y1RA 3DW1X 3RVBA 2XKBA 4IKEA 1ZW6A 1K4YA 4BE4A 4DLUA 3VR2A 1Z4PX 1E1CB 4JA2A 1Z4JA 1SUPA 4JB8A 3VPBA 2XCSB 2WJ4A 3QOYA 4IFBA 4DMLA 2DSTA 1H3FA 1U0LA 2ODNA 2Q3BA 5B3KA 1U81A 3AOGA 4JOQA 5K8CA 1SM4A 4WZAB 4PX5A 1TX4B 4EAAA 3RH3A 3UGOA 5C1DA 2L69A 4WAUA 3NR2A 4DNFA 2OBYA 1VLZA 5JDIC 2JVIA 4BWFB 1DFHA 4Y9DA 1KDYA 1RPAA 2V4MA 4OD0A 4XDHA 2DPXA 2Z8XA 3TL3A 2YOHA 2O48X 3MUNA 3IPLA 4ESVA 2B82A 4KXVA 4P53A 3DZGA 1PIWA 1O8CA 2Q6IA 3F1KA 1LNQA 3AJRA 3QJYA 3U1BA 3E84A 5EXXA 1XDUA 2J9VA 2C1XA 2HMYB 1V39A 1IL0A 4EYKA 4YCDA 1KJWA 3FCAA 2G76A 4L8LA 4Q1BA 4HX2A 1NPDA 3SYNA 3T9DA 1M9NA 2H51A 4QDXA 1GJRA 3V7FA 3UHFA 5A7FA 1QGOA 5GJCA 3H17A 3DO6A 5JANA 4KK4A 3D6JA 4NARA 3AVOA 2R8EA 3CINA 3TRJA 4M83A 4YMIA 8ADHA 1U1DA 5FPSA 1XDWA 1I7LA 1XVTA 1XJ0A 4X3CA 3QBDA 4Q6WA 1MABA 4TKVB 3P9XA 3LYLA 4PIPA 1YHZA 1JJ7A 2OO3A 3C63A 3EXAA 1GTG1 2COKA 1NN0A 3LVBA 2HPHA 4MKGA 2NU9B 4MQMA 3RNLA 4CV1A 3HY3A 4A6DA 1I2BA 5DPMA 2P6RA 2P9YA 3W5DA 5CR9A 2H7BA 2RAUA 1DU4A 4RPLA 4JP3A 4O4JF 3SNKA 4CIVA 1LCIA 2ZUSA 1KAMA 2BFWA 4RQBA 5KTKA 2XBLA 5P21A 3WRXA 2IW1A 4CQLA 3E9VA 4TSRA 3AJDA 1W29A 3I2GA 4JEUA 1E1RD 3IKLA 1G21B 1JQAA 3W5AA 4YUVA 1PLKA 4DABA 3GJYA 4G1FA 1AHIA 3U31A 3T6JA 2FHPA 1VB5A 4MGKR 2C42A 3OOWA 1GT6A 2EU8A 1WHTA 4KO4S 1O8BA 1XZIA 5KOYA 1K8YB 2C7GA 2G0NA 3OWTA 1V8ZA 1KIMA 4PN3A 1JLHA 1XYVA 2I3DA 5THQA 5EZYF 3VVBA 1GYQA 4BQFA 4OOFA 2BC9A 4WX2B 2RG1A 2CW5A 3WQBA 3GUHA 5C0OE 3ZX4A 5IWCA 5D86A 1PX2A 5JZOA 1IN6A 3V34A 4R2XA 1QP7A 2O8EB 3LF2A 1YZHA 2IYNA 1UPBA 4EMBA 3EXFA 3HM9A 3SCZA 5BQIA 2RBEA 1TFOB 4BAZA 1YK0A 2IYSA 3QFRA 2CVHA 4U2BA 1YDMA 2DCMA 3ZNQA 1JXOA 3MVEA 3OWXA 5D85A 3LUJA 1SCUB 3TFWA 2AG8A 3M49A 4QNRA 1TTTA 1YS4A 3JQ7B 2Y4OA 4CGYA 1R8QA 4J2HA 4DA8A 1DX4A 4JSTA 3KFXA 4MKIA 2NVBA 1G98A 2EKBA 4ND8B 1RHQA 2W2VA 1T43A 2BCEA 3PKZA 2HTEA 4FMDB 1OLUB 4QYIB 4UJ5A 2BFFB 1KYWA 3L46A 2P2YA 1AUOA 4FT2A 1ZITA 4CI0B 2PBZA 1EIZA 2FUG1 3QSGA 4HNRA 4AQYB 4GQIA 5BSUA 1XLWA 1CIVA 1ORYA 2ZWMA 4J94A 4CFZA 2VXCA 3B7GA 1GNQA 2A9FA 1E2XA 2V74B 6ADHA 3E9CA 3AH8A 2B0HA 4TXMA 1RLIA 4Z4QA 1NKSA 5IAGA 1W581 4AWAA 4PFSA 4H6VA 1JHXA 5ALEA 4R9NA 1A7UA 3VDRA 1KOJA 1SURA 1NU8A 3B52X 2YDYA 5I7VA 3HJCA 3REGA 1J1IA 2BBTA 5IS2A 3ESYA 2L42A 3I05A 3IAUA 2B4KA 1XTBA 4HBGA 4QC2A 3RTGA 1A4UA 2IXGA 3R7CA 2J4FA 5FO0A 3UANA 3DGEC 1V6CA 4EY7A 3RUHA 4K81B 1Z63A 1QBKC 3OWOA 4MYDA 5IUKC 1ORWA 1XA4A 3N59A 2YV4A 2HA2A 3ZWWA 4I36A 2I62A 1Y6ZA 3PNPA 3BXGA 5HG0A 2ISCA 3NKDA 4WZBE 2AE2A 5C34B 3IRVA 3D5QA 2HF2A 3NUGA 2F43B 2GAOA 2AI1A 1SUBA 4HI0E 1C3OA 1WCXA 3M6MD 1GV0A 4O6NA 5KKCA 3AVTA 4OIMA 4J9VA 3IBTA 3UA3A 1TDJA 2YQZA 5DRYA 5FBQB 3EASA 3MYFA 5F1PA 4UCFA 3SEQA 2WFMA 1FP4A 1XVIA 2V7WA 4EH1A 1EB9A 5C7IO 1ZVKA 1UG7A 5EE3A 3Q9SA 5LIRA 4QYXA 3R0IA 2R4UA 3C5EA 3W3AD 2LFDA 5FBRB 2MJLA 3NV7A 2FFRA 1USKA 4NG4A 2OCXA 3SX2A 3VR4A 3QHQA 3RLFA 2H9AA 1EFLA 1UC5B 3SK0A 1F9EA 4R1TA 2VP9A 4HNUA 3EDRA 3ET4A 4JLWA 3TZLA 2JAWA 3IUSA 3EOBI 1T9DA 4TTTS 3T38A 4I1RA 2W6NA 2XADA 3RIPA 5A6AA 4YR7A 4OYRA 5IKOA 1D4OA 5FYQA 1GTL1 2TMGA 4I6JA 3A3NA 5IJ9B 1P4SA 5J4YA 3VBEA 2RHOA 1NXXA 3VPGA 4UHFA 2EWMA 1V54C 4TL8A 3OD5A 4UMDA 5TMDA 3H2UA 1EK2A 2QR3A 3GLQA 3WK9A 4Z4FA 4ZKEA 4OG2A 4X90A 4KH1A 3C4VA 2PO5A 3CHYA 4ZYLA 4NCBA 1J24A 4BN5A 1PT9A 3SQDA 5BR4A 1D4FA 4O6VA 2F67A 1VCIA 1K6EA 1IIRA 2QUIA 2Y0EA 3ROKA 4X5OA 4KO3S 1P74A 3KO8A 4JNKA 4FN5A 5ES4B 5IUNC 3PGXA 1WKCA 4ZYTA 3TSOA 2NQ2C 5F2EA 5CGZA 4IRXA 4X20A 3OTHA 3COZA 3H13A 1JDBB 2NZUG 4C7JA 2MHRA 4EYEA 2YOGA 1JI3A 1AVTA 5KSPA 3V2HA 3ANNA 1R3DA 3RJ5A 2XLCA 2IELA 3MILA 5AW3A 1U2EA 4C3OB 5IKMA 4CMIA 2I80A 3DHYA 3I9KA 5JYBA 4JWTA 3W5VA 4KMSA 5G4KA 1EHCA 1ZL0A 2WUGA 2FPMA 2XDQB 4OO3A 1F14A 5CFNA 2BMFA 4JYAB 4R8KA 4BEWA 4HH0A 3RC1A 3C3MA 2B5VA 2BT4A 4TWZA 1O6GA 2CV2A 3AP2A 3C7DB 4QGAA 3DE5X 5ALXA 3H1GA 4GP9A 5ERGB 3GJ7A 4EKEA 3R0ZA 1LA2A 4XB2A 3THWB 4FE3A 4LDKA 2ZYAA 3FYUC 5T6BA 1PUIA 1MQ9A 1E3EA 4PWYA 3TIIA 1JSZA 3BMXA 2QMZA 5KYWB 2AUNA 2B6HA 2NSDA 1ICIA 4EQ6A 5HQ3B 3RVKA 5E7MA 1HYEA 3ABKC 2J3LA 4AKSA 3D6FA 1OFHA 1UBTS 4RVGA 3NEPX 2VJDA 5FWNA 3GGDA 1KWKA 1I4LD 1PR3A 2UXBB 4KNWA 4LF8B 2IUUA 3HTKC 2UYOA 2R05A 4UBJA 1KGDA 3RKUA 1JA0A 2WNIA 3UB4A 3OEWA 2PYZA 2VDNB 5GP1A 1ZH4A 4L1KA 4PHGA 4MI3A 3PNBA 4AF8A 2F8LA 3KMIA 3J80A 4MWTA 2I6FA 4RULA 1PW7A 3SSOA 2GPSA 4KXUA 4KQWA 4TKLA 1U28A 4DQXA 1Z0SA 1KZ4A 1I30A 4KWCA 1NL3A 1SU4A 1D2AA 3V2UA 2HU5A 1L3CA 4HE8D 4ALNA 1XXHA 1RXQA 1L8XA 3K1IC 5DN6D 4MQBA 4N40A 1G7TA 5LB4A 5GIPE 1EP2B 3WGYA 3DOUA 4GZ6A 3IL2A 3DUFB 1Y48E 4KFTA 3CEMA 3EOZA 3OOEA 2OG1A 4MUBA 4AG5A 4EF4A 1BDIA 1XC7A 1HWYA 1QCYA 1QHEA 1FTWA 4UVIA 5ALLA 4LFBB 1S2IA 2G25A 3TD2A 1XB2A 4PK4A 3RE1A 5IYZF 4TKZA 1WBJB 1VA4A 3BMOA 3K2BA 1VJTA 1ZRHA 1CB7A 5TQVA 2D74A 2OLKA 1LY1A 5CDHA 3DW3X