3DMDA

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
318
structure length
310
Chain Sequence
MFGKLREKLKSFVKRVEEEVEKEEEEVELTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Signal Recognition Particle Receptor from the Archaeon Pyrococcus furiosus: Implications for the Targeting Step at the Membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transport protein
molecule keywords Signal recognition particle receptor
total genus 116
structure length 310
sequence length 318
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dmdA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dmdA02
3BXZA 4RFSA 1GRQA 3CPHA 1ONBA 3S1AA 5LPNA 4QHYA 2FSHA 4L8GA 4A6XA 2ORIA 4DXAA 3U4QA 2QSYA 5B58C 2EFDB 2J7PA 4GOKA 3AV0B 1RRFA 2YKGA 1ZVQA 3WP1B 4EQ6A 1TUEA 5CLQA 3WP0A 5IRCD 1JXOA 3ZD6A 4I81A 4NCNA 3TAUA 1G3IA 3KKNA 1HY3A 1VCMA 3FHTA 4N0EA 1ZUNB 4ZKDA 2YJTD 1Z28A 2ZREA 1AKYA 1G5TA 3BH7A 4K81B 3SJAA 1IBRA 3T35A 1BMFD 5DYGA 2DB3A 1II8B 4Q4HA 3HPQA 2BDTA 2Q9AA 1OFUX 2FH5B 4CEHB 4URVR 4RKFA 2VP9A 2HCBA 3BE4A 3LVQE 3CNNA 3L2OB 1NMXA 3BERA 2NG1A 4NMMA 3EPLA 2PCJA 1SULA 1SVLA 2FN4A 4M9SA 3B1VA 4UJ3A 2VEDA 2BCJQ 1W2HA 2AK2A 4Z1MA 3U3JA 4FIDA 1NNEA 4I1SA 1GOTA 2CMKA 2QI9C 3Q7PA 4QNMA 1YVDA 3QKSB 3ADCA 2WVJA 4DWJA 2A5YB 3QKSA 5DSZA 121PA 5B2ZA 1SGWA 3KFXA 1ZM9A 4B43A 2ZRAA 1QDEA 4L9WA 1YRBA 1QRAA 1QHHB 4P4SA 3CRRA 4PZLA 4ZIRA 2GZAA 2RHMA 1NVVQ 4CVNA 2CK3D 5FTNA 4TYWA 1W7AA 1M7BA 1II8A 1UBEA 2AHOA 4Q4HB 3MWKA 4G5SA 1KAGA 2DCUA 3GJ5A 4MRVA 5FL3A 3DEFA 2FDCA 2EVWX 1R2QA 3LVRE 4AD8A 1U9IA 3NBFA 4RZXA 4XSHA 5L3QB 3W3AA 1PUIA 4JKYA 3FOZA 2Z4RA 2GILA 5CB6A 1RKBA 1G1MA 2DFNA 5J40A 1D2NA 1UDXA 5FUYA 2ZRMA 3CRMA 1J70A 2ASEA 1JAHA 4HI0E 2B8WA 3SHWA 5KO2A 5AJYA 2C9CA 4Q9JA 3UXMA 1MRNA 4JSYA 5JI3E 2PMKA 3IPYA 4S2EA 3CX6A 2E87A 5JCZA 3MCAA 5BN5A 1UFQA 1TQDA 1W4RA 2XTZA 5E7MA 1JXMA 4Y0AA 5H68A 2ZROA 5P21A 2V54A 5TY0A 1KNXA 3ZQJA 3QQ5A 1M74A 1FNMA 4KLNA 4DLTA 3LXXA 4UNRA 2ZETA 2XSZD 4N3NA 4M1MA 3THWA 3QENA 1Z0IA 5EE3A 1VG8A 2YC4C 3THOA 1VMAA 4DEXA 4B74A 4ACBA 1L7VC 1KMHB 3UIEA 2HDNB 4D26A 3QEOA 1CF4A 3IHWA 2EYUA 3QKRA 1JPNA 2IBMA 2RGXA 4LPSA 1SVOA 2EFEB 4Q1CA 4FXPA 1VCOA 2VP5A 2IYWA 5D3MB 3ZD7A 1XTKA 5IF9A 2VH5R 2RGNC 3GEHA 1AS3A 3WNDA 421PA 4I1VA 4POAA 3KJIA 2C9OA 4DCSA 1OH7A 4X8HA 3SJBA 4QJ3A 5L3QA 4UNQA 3NEYA 1DE0A 2C8VA 3FGNA 4M21A 4HLCA 3P20A 4IOMA 1A5TA 3PUYA 1NJFA 4IHQA 3AVTA 4MYUA 4QHTA 1GTVA 2ZUCA 2ATXA 1G7RA 4W5JA 4AKGA 4JVMA 2CE2X 1DG3A 1W5SA 2PT5A 5DI9A 4LJAA 2QQEA 2V7QD 2CHGA 1WRBA 3SJZA 5JSZB 4NYIQ 3BH0A 3U6BA 4EFLA 2GCOB 4B6EA 3TVDA 5FBRB 1JPJA 4A8JA 5G41A 1UAAA 1CTQA 1XZQA 4MDEA 2C2HA 3UPUA 4XJXA 1EFHA 3CH4B 3ECCA 1XXHB 4XD7D 2AKYA 2RGBA 1GSIA 1XEWY 3B82A 1G3UA 4YMUA 4YMWA 1U99A 4ZIRB 5JMTA 1YQTA 2GA8A 3PEVA 3TSOA 3GPLA 5TMPA 4Q48A 1U90A 2BOVA 3BB4A 5FUXA 1XU4A 2GHIA 1FQJA 1OH8A 3VR2A 2HXYA 3B8HA 5EP4A 5KSPA 1E99A 1R8SA 1JI0A 2RKOA 5SZKB 3AF0A 1XNJA 2XITA 4DDVA 2P65A 2V1XA 1C9KA 4JLAA 3NTUA 4X8MA 4M53A 2WJYA 4Q4AB 3RAPR 4C0LA 2Q3HA 1FTSA 1QVAA 1SZPA 5E95A 1DAGA 3PITA 3CLVA 2D2FA 4YXWD 2H57A 3GMTA 4W7SA 1PUJA 5D3QA 4MGKR 1E3MA 2B6HA 2YNMA 3SS8A 4EPWA 3TIFA 5F3WB 4Q9HA 1ZUHA 2JIZA 3LH5A 3CRW1 1XEWX 1N6PA 1I4LD 4QOSA 4AKIA 4TMZA 2F6RA 5C2JB 1HE8B 1K5DA 1HE1C 3I73A 3C7KA 1KNQA 3K0FB 3H0KA 4Q4JA 3JZAA 4YMTA 5JSZA 1OKKA 2XZLA 1KTVA 1RYHA 3BAFA 4QGHA 4QNRA 4ARZA 3U4QB 4UXJA 4QKQA 3DM5A 4HAXA 1JR6A 1YKSA 5DYIA 1Q1BA 3K8YA 2A7QA 2ZS8A 4UXHA 3ZIAD 2ZJAA 4BGDA 2FEOA 3K0SA 2O52A 4DVGA 1IONA 3UK6A 5KOYA 1NIJA 1IY1A 2GF9A 3NBZC 2QPTA 2WSMA 1KI1A 2ODWA 4PAOA 4TSFD 1R7RA 3IIMA 3QNUA 5UKDA 1NBMD 3IUYA 2KBEA 2QMHA 4Q21A 3THXB 3CNLA 4LWZA 1AA9A 3RHFA 1NN5A 4B2LA 4LYFA 2ZVPX 4V0MA 4ABYA 1KJWA 2VBCA 4MQBA 3ZVRA 1S4QA 3KKMA 5DH9A 1P72A 3QBTA 1UBFA 1FMLA 4KBGA 2ZR0A 2GRJA 4TSFA 5J5CA 3FMIA 1YZQA 2AN9A 4GNKA 1NSFA 1A82A 1J7KA 4GFDA 3I61A 1AJEA 1OXUA 4TMKA 3MLEA 5AWFC 1E79D 4LC1A 3FTQA 2Z5FA 3O8DA 5JI2E 4Z1MD 1N6NA 4A0FA 4U7DA 3K0FA 2RGDA 4BLQA 2JJ8A 1N25A 3T15A 1O87A 1Y3AA 2Y8EA 4IDPA 1G9XA 3NEJA 4E09A 1DO2A 4D6PA 3N2IA 2W2XA 3TK1A 2ZM5A 4NYJR 5J4YA 2VO1A 2WZQA 4BEBA 2IS2A 4EKDA 4ACAA 3DHWC 1QVRA 3NH9A 2BIFA 1E98A 3EIEA 3GJ8A 4R2HA 2JCSA 2W2VA 5KHOC 3I72A 5BWMA 1JEDA 1WQ1R 2FPKA 4MDFA 2P6UA 1TQ2A 1XXHE 2L0XA 4RCZA 4A82A 1UADA 1OXVA 5EZ6B 3RABA 2W58A 3KKOA 5JS8A 2PZFA 2GEVA 2ZJ2A 3T61A 4OHWA 2A2ZA 1IXSB 3QSYA 1HURA 2V8OA 4ZDWA 5J4KA 3TGPA 5L3SA 2EU8A 2ZRHA 4HAZA 4IDHA 3EPKA 1NSTA 1FL9A 1TF5A 2KBFA 5ELXA 4B2PA 1GL9B 1QHSA 1ZAKA 1FNNA 5IDVA 3KX2A 3PIRA 3HR8A 1JEEA 1XMJA 2W6JD 1P62B 4WAUA 1P61B 4MRPA 1E1RA 3CR7A 1OYWA 1MO3A 2IHYA 2OO7A 5GJCA 4A0RA 1E2MA 4JL5A 2D7DA 2V9PA 4V0ME 1VPLA 3RWOA 2D4HA 4JL6A 1XJCA 3P27A 4LJ6A 2C9YA 3UKDA 4IRUB 2EW1A 2QY9A 4Q47A 3L0PA 4ITRC 5BYKA 2BVNA 2ZYUX 2ZSFA 4JBXA 2A78A 1VHTA 3TNFA 1OLOA 4IDQA 5JWRA 3GP8A 3BB3A 1OH6A 4CEIA 2VPPA 5FTJA 2RGNA 3WRYC 3CB4A 3MUFA 2ONKA 3KL4A 1E1RD 3VMFA 4ZI2A 821PA 1XCPA 1FUKA 1GNRA 2IEZA 2W6JA 4DDUA 4CEJB 5CJ2A 1FOEB 1NL3A 3UWKA 4ZI3A 2PLRA 3IEVA 1NY5A 2IHBA 2RAPA 4I1UA 1VECA 2HCJB 1N0UA 3SFZA 3R7WB 3PEUA 2D7CA 3NDPA 1TL7C 2BWJA 2J9RA 4HZUA 4V0OA 2QBYB 1Q1EA 1T4GA 3EPJA 4OK6A 3F5FA 1DARA 1WP9A 3ADKA 1ETUA 3ONWA 4MITA 1LF0A 4PSAA 1ZBDA 4BFZA 1BS1A 4Q5IA 2F9LA 2HLDA 2IYTA 2ZRGA 3WYAA 4AI6A 4HAYA 4DDTA 1S2MA 3GCGA 1N6OA 1ZC4A 2ZJOA 4IEEA 1XD2B 3RS5A 5FL7A 3VKWA 2R6CA 1G16A 3Q8XB 4DSOA 1E96A 1G8FA 2XOKA 2ZANA 4TL7A 4D81A 3EZ2A 3GLHA 4NKRA 1GKYA 1TU4A 2C77A 3WMGA 3A1TA 3NKVA 4HB3A 3PVSA 2ZE8A 4PQYA 4BLSA 1RRCA 4LBZA 5EXSA 3PXGA 3Q72A 2GTPA 2YWFA 4MKIA 4PO9A 2ZRFA 5H1YA 4URXR 2FSIA 1ZM3A 1QBKC 1FTNA 2P5SA 1DBSA 3FDIA 3O47A 4IXNA 3ADBA 1GNQA 3OAAA 1GITA 1DPFA 1NY6A 2JEOA 2NO1A 3FKSA 1ZYUA 3SHFA 5FOTA 1Q3HA 1KZ7B 3A37A 4TLEA 1VTKA 2VIIA 4AKEA 2HYDA 2ZI9A 3EW9A 4ASUA 4LRWA 4B3XA 3HU1A 1ZRHA 4BUJA 2DWPA 5CITA 5AJWA 1SVMA 1D6JA 1RJ9B 4DIEA 4FWTA 1F2TB 4JIMA 4DLSA 2IWRA 2CHQA 2JLVA 2Q6TA 5CIWA 1C4OA 1DTSA 2O0HA 3CZPA 3KXKA 2GJ8A 4BLTA 4CEIB 3IIJA 4R9UC 1IN4A 3QKUA 1SVSA 2G0NA 3BFXA 4C0SA 2HYIC 4Q01A 4F92B 1ANKA 5K8LA 3AH8A 2FFAA 1QHHA 4F91B 3TE6A 1HT1E 3TVTA 1KKLA 4LJ9A 3ASZA 1I4TD 1LY1A 5J4HA 3OE7D 4D25A 1YHNA 4HATA 3X1ZA 1BO6A 4C3ZA 1ZW6A 2N1BA 3KQUA 1CJMA 4XTRA 2OT3B 1SXJC 2NO6A 2R6FA 2ZRBA 3MJHA 4XIGS 5DN6A 1W44A 3M1IA 4BECA 4DLZA 4E22A 4JLBA 5BW8A 4MRNA 5DGXA 2QEQA 1DELA 4B3GA 2J7KA 1FX0A 4EFMA 1D5CA 3VR1A 2QRNA 4FCVA 2RB4A 3BFVA 3B1XA 1XTSA 3PEYA 2ZS7A 1OXTA 3TQCA 4NYMR 3VR6A 5HKKA 2ZIAA 2CXXA 1T3SA 3BGWA 1XBTA 4RD2A 4GL2A 4GMDA 5L3VA 4GOXA 3A1WA 1DOAA 3AUXA 4R2IA 1OHHA 4US0R 3LWNA 3W8NA 1SKYB 4M1OA 5FBWB 4ZCIA 4FW9A 2PCLA 3REGA 3O8CA 3O8BA 5JZVA 3MFYA 1T0JB 1NLFA 2W6IA 3BK7A 1L8QA 5KPDA 3OIUA 3A4NA 2REOA 4V02A 4OQFA 2IA5A 4CRWB 3ASYA 4C0BA 3ICQB 4NHOA 4KVAA 3TSWA 4PPGA 2FG5A 3CPJB 3LRPA 4DB4A 4IOJA 3P26A 4RFVA 2H8KA 2RGGA 1WGWA 2JJ1D 4PC1A 3OESA 5JRJA 1Z22A 4OQXA 2MSEB 1GL7A 2WICA 3EZ9A 3UWOA 2YOHA 2Z6VA 1KAOA 3VAAA 4WZBE 1E94E 3C41J 2MSCB 2HF9A 2FSGA 3EC2A 1AZSC 4HYYA 5DI3B 4DUGA 4DLXA 1GDDA 1MABA 1B23P 2X19A 4AG6A 4RZ3A 4A1FA 4KBFA 3A6PC 4BFXA 5F9FA 1S8FA 2CL6X 3NHBA 3PJRA 1D2MA 4ZCLA 4AC9A 1EFTA 2FMXA 3HDTA 3U7HB 2R2AA 1Z2CA 5C4GB 3IHLA 3U44A 2QA5A 3GJXC 2WMOB 3PUXA 1UKZA 2D06A 1F60A 4YLGA 4ZPXA 4DKXA 1T91A 2JDID 4KSBA 1COWA 2DFLA 3Q3JB 4HB2A 2GVZC 4GZMA 5LD2B 2OAP1 2ZSAA 4EIWA 2OE2A 2CDNA 8OHMA 2O8FA 2ZJ8A 3QVVA 1U0LA 1KIMA 4JYBA 4BFWA 3FVQA 1P2SA 1ZM4A 2V6JA 4KVGA 1GAJA 4Z51A 2AWOA 2FZLA 3TUJC 1Z0KA 2K5UA 2FEMA 2V6IA 5JEEA 2EWWA 4XD7A 4MYTA 1XMSA 3OEHD 1AS0A 1N3BA 4C2UA 2B92A 4YC7A 4QBIA 1XF9A 2WOJA 2ZITA 5JRZA 2ZTSA 3CR8A 2BMDA 1U9IC 1N6IA 1FPMA 2JLUA 3BIFA 3K09A 3RVBA 4M1YA 3A1SA 2I4IA 3CF6R 2GJAA 4GP6A 2A30A 2QM8A 1P73A 2DYKA 2RMKA 2AKAB 3BOSA 3GLFA 3FFAA 3EARA 3LA6A 4TL9A 2QPAA 3D6TB 3FFBA 3J81k 3TLXA 2VHJA 1E2JA 1FX0B 1WF3A 1GVNB 1COWD 1OFIA 2WWHA 1OT3A 2FGJA 1CBUA 3E1SA 3K53A 3HYRA 1Z6GA 2QPOA 2YOGA 2IYVA 3I5XA 3B2EA 2WOOA 3QXXA 1IOZA 4IOKA 1HV8A 1NN3A 1TADA 4RVCA 1JR3D 4YONB 2QROA 3EZFA 2ZSDA 1ESNA 2R8RA 2GCOA 3KTAA 1ELOA 4I4LA 3QG1A 2W00A 2ZI6A 2V7QA 1YZLA 2C5LA 1VIYA 2ZRIA 3RNLA 5EXPA 1XRJA 4ON9A 4LV8B 1XPOA 4OBEA 4LUCA 1NRJB 3ZGXA 4BPBA 1F2TA 2OHFA 2ERYA 5F9HA 4HB4A 1L2TA 1VYVA 2CJWB 4PO8A 3ND8A 4CDGA 1KO4A 2OBNA 3GJ6A 3W3ZB 3QBVA 1GWNA 2ZJBA 1I2MA 3AP3A 5TV2A 1EFUA 5EUMA 4D4JA 2WHXA 4C0JA 4F4IA 5GJWC 2QGNA 5JFGA 2NO7A 4QBFA 2A9KA 4PC2A 2JLRA 1J8YF 2Z83A 1KSGA 3B85A 3RS0A 1EFCA 1JNYA 2WIBA 1GNPA 3T34A 3M4YA 3VNUA 1C1YA 3CF2A 2X77A 2UZ3A 4EFNA 1S9DA 4M8NE 2AFIE 3CNOA 1N5LA 2XJ9A 4A8JC 4DZZA 2HT1A 4QC2A 2OXCA 5KNDA 4MH0R 1CU1A 2YYZA 1GKUB 3B9PA 4QM6A 1KMHA 3FMPB 4G1UC 4JJKA 4OYHA 2IUSA 4C0KA 3AEZA 3GLHB 4TL8A 4C4PA 4D82A 1UDWA 4XVRA 4JVSB 1KJYA 2GWHA 1MO6A 3PG5A 1NLZA 1RFLA 3L8YA 4RZUA 2ZRLA 1AKEA 3G0HA 1ZIPA 1Z3IX 4KU4A 4A0HA 2XJ4A 4A4DA 1Q44A 1IY0A 4NONA 1XCGB 3K9LA 2ANCA 3U7EB 3U2QA 2NIPA 4DCTA 5FBLB 2P2LA 3OEED 1DAFA 2GXUA 2JLQA 1ZCAA 4U02A 2GKSA 1E2FA 2WWXA 2QZ4A 1CRQA 4P32A 5BXQC 1PZNA 1XTIA 5LB2A 3W6OA 2WSSA 1KI7A 1LV7A 3TBKA 1Z2AA 4MGYR 2IF2A 5KNBA 1N6RA 1H65A 4B2IA 2G3YA 5FPSA 2ZSEA 1QHXA 1WXQA 4Z54A 4LGMA 3ZH9B 2CCJA 2WWIA 3ZJYA 1SXJB 1OB2A 1XX6A 1M8PA 5G40A 2NMVA 4NL4H 5LDDC 2BJWA 2YWHA 1N0WA 1Q12A 1ZD1A 1N6LA 4Q4LA 1JR3A 4RJLA 2LKCA 2Z43A 4JT4A 4W5WA 1BMFA 5AJXA 4DUGD 2V1UA 4ILEA 4IXMA 4PHFA 1IXZA 5EE9A 2EFCB 2PBRA 1YJ5A 3VR5A 2F3TA 1KDPA 5CYPA 4NDZA 3UATA 3X1DA 4E07A 1KGDA 1KK2A 2PMDA 2VYFA 1RC8A 1KMQA 3BH6A 4FD2A 1OF1A 5FOUA 1CEEA 2WM9B 2QGZA 1FUUA 1TMKA 1HA3A 3OE7A 5AJZA 4J0QA 1NKSA 1AN0A 2O8EA 4GPTA 2QP3A 2LWIA 3H1TA 4W5HA 3RDPA 3V00A 3RRZA 5GJBA 3AVQA 1E9BA 5FOWA 4HAUA 4A2QA 3U3RA 3B1ZA 1RRGA 4F93B 3D8BA 3LW8A 3K9HA 2GAOA 4P3YA 3EASA 3I62A 3QOFA 2GEDA 1A4RA 2NZ8A 5JJKA 4A8JB 3BD9A 1NMZA 3K1JA 3VKGA 4LHWA 2A5FA 2WKRA 4OHYA 3UMSA 1JB1A 5FH9A 1W0KD 3L43A 3P32A 3GLGA 4QGFA 4TL6A 2AL7A 4JVNA 4DRZA 3WY9A 4DEYA 3A1UA 2CL7X 5DE3A 4JS0A 5EE0A 1G8PA 3FYHA 4FMCB 2XX3A 2F43A 4QBHA 2IXGA 3SZRA 4HLQB 1NBME 2J87A 4N0DA 3PR1A 1TQ6A 1CJVC 4HUQB 4TYNA 1E2GA 3MWLA 2XB2A 1M2OB 4YMSA 1Z0JA 2ZJZA 4MKFA 4BASA 4LX0A 2WMNB 5C4MA 2D62A 2OZEA 2XOKD 1XD8A 2H92A 3DZ8A 5IK2D 3PQCA 4PHHA 4US2R 2JLXA 3H4MA 2FSFA 5FL7D 4DLYA 3SBDA 4HLDA 4JLOA 3F0TA 3U3KA 1G64A 1W5TA 3MD0A 3UMRA 1E9AA 2H1LA 5BN3A 2DFTA 3C5CA 2G77B 4TZ0A 3SYNA 5DN6D 5JLJA 3TMKA 3T5DA 1Q1QA 2VP2A 3B1WA 1XPUA 5DISB 2BM0A 1KI2A 2AD1A 2ZQ5A 4EPRA 2VSXA 1IN7A 1KSJA 2ZAMA 5FOXA 2EFHB 2A5JA 2BC9A 4M9XA 1OYYA 1QHNA 1KKMA 2BBOA 2V4ZA 2CCKA 3QIAA 1KY3A 1SQ5A 3WNCA 3AF1A 3R9WA 4H9GA 3WYFA 1JQJC 5B57C 5FBVB 1LS6A 1X3SA 1UJ2A 2WJJA 2C78A 2YWEA 3EIHA 1VCIA 1Z6XA 3X1WA 1U98A 4TT3A 3RRMA 4PANA 2CNWA 3WMFA 3GLFE 4PZZA 2OILA 2QENA 1K5GA 4RY2A 1BOFA 1SVWA 1X8JA 2G1KA 3W6NA 4B35A 1P9NA 5E7JA 3SYKA 1UEIA 3CO5A 1U0JA 5TDHA 1KY2A 2CLCX 3L0OA 3PV0A 2HT6A 3WRXC 2OFOA 3GFTA 2JLYA 3VR3A 1YE8A 1E0SA 1SXJE 2IS6A 3SR0A 3WMEA 2GF0A 3FWYA 3WNBA 4BFVA 1D8TA 1WDTA 4OJKA 3M0EA 1N6KA 1RVDA 3CX7A 1FP6A 5HCNA 3TR0A 2QAJA 4TLDA 3CRQA 1MT0A 1VKJA 1UPTA 4QXAA 2G9NA 2XTMA 3GEIA 4NCJA 1E2EA 4PTLA 1G8HA 5C46F 3W34A 5HZHA 3ZS8A 1OE0A 2WJHA 2TMKA 1YZNA 5JS7A 3PUZA 4G5RA 4ZKEA 2GXQA 1EGAA 4LJYA 4Q00A 3TJZA 1Z6AA 2GJSA 4HAVA 1E2QA 1NVUQ 3AGQA 3QF4A 1UKVY 3I32A 4XWAA 4DLVA 1OH5A 4JLJA 3KKQA 1RYFA 2W0MA 3PUWA 4JLNA 4LYJA 3K0EA 5GVRA 5HPYB 4JSTA 1KSFX 2FGKA 2O0KA 3EA5A 4BE7B 4O3MA 2WV9A 3GJ7A 5CYOA 1JJVA 1OB5A 1KHTA 2G6BA 2WWGA 2FF7A 3JVVA 2V55B 2O8EB 2ONJA 4ASUD 2BV3A 4OI2A 4L16A 3V4RA 3HP1A 2IWHA 3K70C 3NDBB 4CEHA 4XTCS 1TNDA 4YXWA 4G01B 5K8TA 2N46A 5EZ5A 2CNWD 3EIQA 2XNDA 3AVUA 3FB4A 2ODBA 2J0UA 1CS4C 3ZZUA 3KDSE 3VNVA 1CKEA 1UEJA 1GILA 3QY0A 2VHUA 2GDJA 3KJGA 4B73A 1R0WA 2QE7A 3IDQA 3THYA 2QTHA 3R20A 4C0QC 2BM1A 1QHGA 2GNOA 1X1SA 5KPJA 5TB5A 1PJRA 3IBYA 3R8FA 3ZIAA 3KQKA 4C2TA 4FN5A 5JCPA 1II0A 1P5ZB 2OV2A 2OCAA 1LB1B 2OCPA 1OHHD 1T9HA 4G0NA 3U5ZB 2IXFA 1KK3A 1X8LA 3D3QA 1E69A 3SFVA 1XMIA 1SXJA 2VP0A 2C04A 3B9QA 3P1JA 2AXPA 2YINC 1YR7A 3KB1A 1YRAA 4IDNA 4B76A 4B3BA 4WZ6A 3I8XA 3LY5A 2W6ID 4JLVA 3OF5A 3KXLA 3A4LA 1GUAA 2P5TB 1XTRA 3EX7C 2DFKB 5FI0B 5FOSA 4IKEA 3SE0A 2IW3A 4XH9B 3ZVNA 2AXNA 1R0XA 3D31A 4LHVA 5B64A 5JECA 3QE0A 3IBGA 1F2UA 1CR0A 1E0JA 1A1VA 4LY6A 4UNPA 3MWYW 1EFRD 2JA1A 3T1VA 4BLOA 5HKKD 1VHLA 2IYQA 2ZI7A 4FMBB 4M1TA 4H1VA 1NVXQ 5IHPA 1EX7A 4YMVA 4BFSA 4BFUA 1P9RA 3PENA 4OKSA 3THWB 4LI0A 3KB2A 2Z4SA 3Q5EA 1H8HD 1LTQA 1ZIOA 3T5GA 1UM8A 2FV8A 4M9QA 1Z83A 1LS1A 2FPMA 3SI7A 1Z08A 4MKGA 1VG0B 2ORWA 1W48A 3B78A 4URWR 4O2RA 1IN5A 2Q21A 4C9BA 4MUBA 4WOPA 4DSUA 4D2IA 3K70B 4PPFA 3IO5A 2CLDX 5J4LA 3I1FA 1OFTA 4LYHA 4ZDKA 1CR1A 4MKHA 4JJZA 3F3YA 4N1AA 5CK4A 3R7WA 5HZKA 4NYJQ 2HUPA 3QXCA 3B60A 2JGNA 5AUOB 5F2EA 2NGRA 1XEXB 4Z8XA 5JHGB 1Z47A 1IY2A 1FMJA 4JKIA 2QTFA 3OEEA 4O0MA 3FMFA 2A3RA 2IT1A 3VR4A 2QORA 2ZXUA 1H8EA 2JLZA 3B1YA 4XWKA 1SXJD 4RD4A 1TUIA 2CVFA 1PV4A 3FKSD 2BMFA 1CLUA 2EFGA 3RC3A 2VF7A 3GLIB 1E2KA 1KI8A 3RRNA 4M1SA 1OIWA 3RSOA 1W4AA 2OSBA 2BCGY 3CRVA 5AUQA 4WVFA 4XSGA 4B3FX 1PVOA 4FWIB 4OHVA 3IEUA 2GBLA 3TR5A 1CP2A 4MYCA 1YZGA 2KB0A 1J99A 5FPTA 4UQOA 4UKDA 4MRSA 3FHCB 1EESA 1W1WA 1VG9B 4GMXA 3RS2A 4LK2A 2C99A 2XNDD 4LSGA 5FUWA 5HR5A 2ZI4A 1HQYE 3DDCA 1ZD8A 3LD9A 5JWHA 3W5JA 4DCVA 2ZRNA 4ZO4A 4ERNA 3K0AA 1U81A 1V5WA 2CVHA 4EUNA 1CR4A 1DS6A 1G3QA 1E2DA 4K8OA 4PSKA 4JZKA 2LCFA 3AQ4A 3EAQA 4KFSA 3DO6A 2MMCA 2FFHA 1HH4A 1J90A 1XTJA 3I92A 3LQRA 3BBPA 2CCGA 4RD6A 5JHHB 1TF7A 5CB8A 1KO8A 2YC2C 3RLFA 2O8DB 2ZAOA 3QF7A 1H8ED 1ZU5A 1QHYA 1US8B 2XAUA 3I4LA 2IXEA 2YV5A 1I2DA 2P6NA 3AB3A 1DADA 3CZQA 3VFDA 1P4SA 3NH6A 3Q85A 4AWXA 3BS4A 5K8IA 1DVRA 2DWOA 4MA4A 5G3ZA 4G3XA 5JJLA 1RZ3A 2FOLA 2KJQA 2O8FB 1JECA 4RSGA 2OBMA 2KWIA 3AF3A 3K9GA 2BEJA 1FW6A 2WWFA 4KLZA 2OM2A 1DAEA 2X8AA 2Q3MA 2IX3A 5EJEA 5FR2A 4M22A 5IT5A 3VKHA 4U00A 2QT0A 4IOLA 4Q1FA 4Q7MB 2O8BB 3QI2A 2PZEA 5DO9A 3U7GA 4PFSA 4ZDIA 1FZQA 1KOFA 2A5GA 3SJCA 2JJ1A 2UZIR 4PHGA 2OESA 1NG1A 4NYMQ 3UMFA 2GETA 2F7SA 2ZRJA 2H18A 5KDDA 2XZPA 1ZJ6A 4QG7A 2ZI3A 4IW3B 1KYIA 1HTWA 4Q18A 2NQ2C 4LJ5A 4EPVA 1P7CA 4HLUC 1XPRA 4DLWA 3X1XA 2W0SA 1F5NA 1SVIA 2P0EA 3CBQA 4XWOA 2RH5A 1F2UB 2AFHE 2OXRA 2PT7A 2X2FA 3AM1A 3AKYA 5AR1A 3U7FB 3OFND 3V4FA 3NWJA 5H8WA 4XVUA 4JLMA 4L5BA 4WA7A 1UKYA 2BKUA 3KZ1E 4PQRA 4R98A 5LB4A 4MGZR 1P60A 4KAXA 1QHIA 2ZJ5A 2ZR9A 1KO7A 4LDJA 3RRYA 3ZZ0A 2B7BA 1AK2A 2XSZA 2NOAA 3NHAA 4PSVA 1ZMXA 3NBYC 4HZUB 5KSOA 1UBCA 1XZPA 1YZUA 3IKJA 4X8LA 4UNNA 2E1RA 1WCV1 2C98A 1ZU4A 4KI0A 2OCBA 2CHVA 3VHLB 1IHUA 2IYUA 4I99A 3FPAA 5BQ5A 4G5GA 1DAKA 1E2PA 2SHKA 4F4CA 2UKDA 4BEJA 1XB2A 4V0LA 4TMXA 3CIOA 4B44A 4TLAA 3EXAA 4QRHA 2GZHA 2ECKA 4FI3C 4BZQA 1OXSC 2ODEA 1ZCBA 1US8A 4KHZA 1PLJA 4TLCA 1CRPA 1P2TA 1AS2A 1G17A 3FMOB 1KI6B 1XTQA 2IYRA 2DR3A 2R6DA 1G20E 1NBMA 4BFTA 4A9AA 2J3EA 4DBLC 2J0UB 5ANRB 3EZ7A 2RCNA 1Z29A 1G6OA 3CWZA 3KJEA 4RD0A 4TYYA 2OUKA 1KZGB 1XJQA 3QF4B 3WBKA 3KUCA 2PX0A 4IFEA 4BRWA 3D7MA 1W0KA 4C0AC 5JJIA 4GT1A 3LX8A 4NP6A 3K0CC 4Q7KA 3JVUA 3LW7A 1F48A 4TZ6A 2J0QA 1KI6A 1KK1A 4DIDA 3JZMA 2ZRDA 4Z8YA 3BC1A 3PUVA 5KNCA 3NBXX 3QEJA 1VG1A 1H8HA 2ATVA 5DIFA 1KI9A 1T8UA 3NIBA 2ZS9A 3N2EA 4BWYA 3B5JA 4TQAA 2JJ2A 1QG2A 2VF8A 2KI5A 1P2VA 3WHLA 1G8YA 4LJ7A 1I4DD 2WAYA 5FTLA 5EQTA 1S1CA 5FTKA 1TEVA 1T3HA 4EJSC 1QZXA 3H2YA 1EFRA 5CDFE 3EPHA 4DLRA 2F9MA 1HEIA 3GJ4A 3DOFA 5FTMA 3MRSA 1SHZA 2PH1A 3OFNA 1KDOA 5E4FA 4LC0A 3MAAC 3N70A 2OG2A 2B7CA 2JAQA 1KDRA 3N5CA 2IK8A 1G291 2ODNA 3QPUA 3T12A 4US1R 4P31A 1P6XA 2GVDC 4NCHA 2DY1A 4A6PA 2G88A 5GADl 3B6EA 4HSEA 1E0KA 3QPWA 4NZYA 4U5XA 1HUQA 1SKYE 2VA8A 2HJGA 2REXB 5KTYA 3M6AA 3GD7A 4PHTA 2OBLA 5E3HA 2RGCA 6Q21A 3UG6A 2ZUBA 3AUYA 2WWYA 4M2LA 1NJGA 1R5BA 2WJVA 3ZYCA 2QAGA 2P3SA 4B6FA 2NPFA 1RE0A 4OHZA 2C96A 1U2RA 2YHSA 3AKDA 2IS1A 3AF4A 4C7OA 3AP2A 3GFPA 3QKRB 1NMYA 4IJMA 4HB0A 1KSHA 3GLHE 5SZIA 3G5UA 4BFYA 1Z63A 3W9YA 2FA9A 2FJUA 1KDTA 2WKQA 4X8OA 5F98A 5L3RA 4PR0A 1JR3E 4LBWA 4PC3A 4HUTA 2VLIA 4NH0A 4OQLA 1TU3A 4EDHA 5KSZA 3RS3A 4QHSA 1N6HA 5KSYA 1W36C 4FMDB 3C14C 5BN4A 3THXA 3EG5A 1Q20A 2J41A 4ARZB 2GJ9A 3ZLJA 3RC8A 4YDHB 4URYR 5TARA 3OEHA 4Q7LA 2WPDA 3W8RA 4E5UA 1VYUA 4TTQA 2WWWA 4Q4JB 1YR6A 5HCIA 2ZYWX 3T1OA 1ESMA 1NIPA 2IYXA 1L4UA 3NVAA 3SYLA 2ZE5A 3LBHA 2PJZA 5EP1A 1LVGA 4IFBA 4KO8A 4RKEA 2F1JA 3U61B 1RRPA 3LV8A 1X1RA 3E5HA 1IM2A 2ZYTX 3W90A 2J5XA 2CE7A 621PA 4DCUA 3NC0C 2R65A 3ZZTA 4PX9A 3THYB 2NO9A 1DAHA 1G19A 1GFIA 2QP4A 1Z0AA 4MRRA 1OPXA 2CL0X 1CJUC 4Q4AA 2WJGA 1DO0A 1TQ4A 5CK5A 1LW7A 4LCBA 2XZOA 4K46A 3NG1A 1Q22A 4O2LA 1W36B 1NG9A 5JWOA 2OFWA 4TYQA 3L82B 4V0NA 1LFDB 4Y0VA 3OIWA 1ZC3A 2BBSA 4Q9KA 4D4LA 1IXRC 3HU2A 1EX6A 4B48A 4WIAA 4FCWA 3F8TA 2G0TA 4WW0A 2DBYA 3K0AB 2ZU0C 4IVQA 3CWQA 2IC5A 1NLYA 2PX3A 2R44A 2XXAB 2JIZD 1DAMA 2F1IA 2RGAA 1CULC 3K9NA 2MSDB 4QL3A 2VQSA 2AR7A 2WPDD 2QL6A 3BRWD 2BJVA 4WZAE 4OQMA 3DM9B 4AK9A 2G1JA 3O8RA 4JLKA 1XEFA 3B7GA 3LBNA 3MWJA 4V03A 5DHFA 4BZXA 3AVWA 4NTZA 3CF0A 4V0KA 3W5IA 1WB9A 4QM7A 4DSTA 1G6HA 2IYSA 1ZINA 4G5OA 5DLQC 4TYPA 4DJTA 4A36A 4C0HA 3ND9A 5EP3A 4EJSB 1L4YA 3E2IA 1SKQA 3CPEA 5KU1A 4KFTA 5FFMA 1XMVA 1OIVA 4A0GA 1HT2E 4E03A 3SU8A 2PL3A 2RHDA 4RD1A 3BORA 4RCYA 5HE8A 1ZP6A 2QTVB 3HPRA 3TRFA 1E9RA 2FE4A 2XB4A 3EZ6A 1IJFA 2QMEA 3CUEF 2VHQA 1R10A 4LJ8A 1XDBA 1PLKA 3V9PA 4M0LA 4OL0A 1T5IA 2DHRA 4AY2A 4TMWA 4LJ4A 2AK3A 5EXXA 1WBDA 3PEWA 1KK0A 4L15A 1TTTA 3S1AB 1KI4A 2VRWA 3FHOA 3HJNA 3HYTA 4NE2A 4TTPA 4PXAA 3U3MA 1NN1A 1R4AA 3MJRA 1TPZA 5D3MA 5FBQB 5IK2A 5EP2A 1YR9A 3QKTA 3OZXA 1P75A 1N5JA 1OJLA 2WIAA 1W36D 1G7SA 2V3CC 3HR7A 3SDZA 4DDWA 2OLKA 3NXSA 3VX4A 4OK3A 4B3DA 4O25A 1ZNZA 1OFHA 1IQPA 3U3OA 1AZTA 2YVUA 1R5NA 2RGEA 1U8YA 3AVXA 4IVPA 3E70C 1OKKD 1X86B 4KFRA 4MUAA 4F4JA 4KFUA 2UVQA 4Q02A 3U60B 2GAAA 5G53C 2PJRA 2QM7A 1S96A 3NC1C 4ZDJA 1KO1A 3I3SR 4C7OB 5G3YA 3QXHA 1NKTA 4TQUS 4S35A 4JYCA 1W4CA 2QN6A 2R6GA 2KSQA 3BJIC 3LBIA 4XOIA 1G3MA 1GRNA 1K8RA 3GJ0A 3ZS9A 3ZVMA 2YWGA 3T1TA 2GXSA 3IGFA 4EPYA 1P3JA 1W49A 1AQYA 2GZDA 1MRSA 1TF2A 1ZM2A 4D4KA 1S3SA 4M4SA 4JLDA 1F6BA 2DPXA 2VSOA 4LZZA 1G18A 3X1YA 4DLUA 3RANA 5JEDA 2Q0HA 2HF8A 3CKLA 4IDOA 5SZHB 5JBQA 5J47A 1E2NA 5LBIA 2IEYA 4EJSA 1GZSA 1IAQA 3ZDQA 5LD2C 1MR3F 4TQ9A 4B33A 1Q1ZA 1ZNWA 3QVUA 2C95A 2CJWA 2FFQA 1IN8A 3LQQA 1EG7A 4CZ2A 3ZVLA 3A4MA 2EQBA 2O5VA 2QMUA 1GKIA 4JLPA 4B34A 2IUTA 4Q1EA 1W2GA 4NU0A 5TXGA 2HV8A 2ZJYA 4TN1A 5EE5B 5C18A 1E4VA 2YOFA 4P4SB 5CDFA 3ADDA 3KTAB 2VSFA 3FKQA 4CW7A 1E0AA 1IN6A 3A58B 4KV9A 4A15A 3FE2A 1AGRA 5CLLA 4D0NA 2PLFA 3GLFB 1J2JA 2JATA 4KSCA 2GJKA 4G5QA 3PCRB 3WYGA 1FQKA 4LHZA 2JASA 1EK0A 2H7VA 3C16C 4M9ZA 2JLWA 3KQHA 4LV5B 1TX4B 4TTRA 2IF0A 5EE1A 4A2PA 4CT4B 1G4AE 4Q9LA 2VTKA 4GZLA 3I5YA 4OK5A 2XXAA 3IIKA 4FCTA 2JDIA 4LOAA 1X6VA 4A92A 2GK7A 3MSXA 1KJZA 1OSNA 2H17A 2XNSA 1E2LA 2N42A 3OIYA 4HAWA 5FOVA 5AK0A 4MGIR 2OEPA 1MO4A 1MO5A 1R8QA 2IYYA 3CM0A 4WBSA 1XXHA 4DCNA 3QXSA 4PQFA 3TW4A 1CJTC 5GVSA 3OHMA 3H84A 4BZPA 4EPXA 2I1QA 3BB1A 1G7CA 2B21A 3DMNA 4URZR 1KO5A 2ERXA 2O0JA 3QG5A 4TMTA 1BH2A 1U8ZA 3K70D 3LO5A 5FPHA 4QJ5A 4EQ6B 3VU9B 2GXAA 4QJ4A 2FFBA 2I1VB 4KITB 1NI3A 3VQTA 4GBMA 1A2KC 1E9EA 1ODFA 3C4JA 4HDCA 2Z0MA 2BHRA 4C30A 1LNZA 2QP9X 2F55A 2CBZA 3DVLA 2O8CA 3AKCA 1MV5A 2ZSBA 4FINA 4D0LB 1W0JD 2F3RA 4KJZA 3AVPA 3RWMB 1BYUA 4OHXA 4P33A 1XWIA 1YZTA 4QGAA 2X2EA 5E7IA 4DC9A 1T5LA 2I3BA 2QE7D 3SBEA 3SC3A 2EWVA 3A8TA 3W6PA 3LLUA 4B3CA 1SHKA 4RZ2A 3R9IA 3BWDD 4B75A 1YZKA 2AX4A 3ETLA 3P4YA 2R6AA 1FP7A 1S0UA 3QXJA 3TUIC 4A2WA 2J0SA 4DT1B 1O3YA 1GG2A 1NVWQ 3K09C 3BFKA 4CGZA 2ZE7A 4ZCMA 1JQLB 3VX3A 1MOZA 4BRUA 3C8UA 1RW4A 5M04A 3KUDA 1U94A 1UKEA 4LPKA 2WKPA 4PC7A 1R5OA 1E6CA 4JL8A 5GJVC 4M1KA 1J8MF 1GRRA 3AVOA 721PA 1BYIA 3R8CA 3H86A 3RS7A 1FFHA 3GJ3A 4ESVA 1DAIA 1R6BX 4HUQA 1T8TA 4KYUA 4URUR 4D80A 4F7WA 3TUZC 2PEYA 4GP7A 3Q9LA 4JT2A 4AIIA 3QJYA 1LF5A 4WXPA 5FR1A 4QGGA 1T3LA 3EWAA 2GEUA 4AYWA 2F43B 5K8UA 2J46A 4W9MC 2W83A 2P6RA 3ICEA 3SOPA 2IYZA 4PAMA 3GLGB 4LYAA 3EWSA 5CM9C 4AYTA 5L8VA 4D4MA 1G21E 3AGPA 4GDFA 2FPLA 2NZJA 3MG9A 4DB2A 2WBLC 1ZD9A 2H5EA 3CX8A 2F1RA 2EYQA 1IJEA 1G7TA 1VYTA 2QSZA 3WXMA 2W2TA 1A2BA 3HWSA 4R7ZA 4PPNA 2OLJA 3IQWA 1GIAA 4UNSA 4LV6A 1ZNYA 2WAXA 1OV4A 5CM8B 1W4BA 2A5DA 4XVQA 1X8KA 2J7PD 3DMDA 5AJVB 1XP8A 2QAGC 1WBBA 4MYHA 4HDQB 1VIAA 3LDAA 3CONA 1YU9A 1EWQA 4FMCF 4ZV4A 1W46A 1GM5A 1E2IA 1E1QA 3Q7QA 4EPTA 1EWRA 4NYIR 3TKLA 3SQXA 3DKVA 4HLUA 3TQFA 3QPVA 4IVRA 4BQSA 4LHXA 2HJVA 2ZU6A 2J59A 2R9VA 1N5KA 1E9CA 5HTKA 3MGCA 1OIXA 2B8TA 2ZI5A 3GFOA 4JVLA 4II7A 4KCGA 5KYKA 2IUUA 4Q03A 1CIPA 3LAWA 4OJQA 1VCNA 4PO1A 3KQNA 1N2CE 4H1UA 1M34E 3AP1A 2WSSD 3Q5DA 4CIDA 4L9SA 4P4TA 1E1QD 1KI3A 1M1YE 3IQXA 4RFSB 4TWZA 5CJPA 1XFAA 3A36A 4AG5A 4OI0A 1T0HB 1OW3B 1W0JA 3TH5A 5FI1B 1Z06A 1PLLA 5A5GA 3L0IB 2IL1A 1T6NA 1WMSA 3PFIA 3GEEA 1WA5A 4BLPA 1M7HA 5DNYB 5DHAA 1Z5ZA 1JALA 4Q7JB 5C1BA 1R0ZA 1XCMA 1SVKA 3IILA 1XJ0A 4Q19A 4F38A 3SN6A 4KYIB 2ZEJA 4CYMA 5CIQA 1XD2A 2JJ2D 1WE2A 4YQFA 1CXZA 4TLBA 2QT1A 4IEIA 2OFXA 2ZR7A 2QNRA 1OXXK 2ZRKA 4HDOB 5FPYA 2GK6A 4PC6A 2R62A 1RIFA 4Q1AA 2O8BA 2GBLC 2QMOA 1MABB 1K6MA 2E9SA 2QUZA 4GRAA 3KXIA 2JLSA 2G83A 2QAGB 4BLRA 1ZM7A 1Z8FA 1NN0A 4P4UA 1JBKA 3DKPA 1GP2A 2O8CB 5B30A 4RD3A 1ZNXA 1CR2A 1BKDR 4HZIA 2BKEA 1VDZA 1QF9A 1U8AA 1ZUIA 4NBSA 2GCNA 3GLIE 1TEXA 4CEJA 3RSLA 2NPIA 5EXTA 1CJKC 4PPQA 5KDOA 3CW2A 2XEXA 5DI3A 1Z6TA 4KXFB 2AWNA 1UBGA 5FUVA 2GCPA 4UXIA 2Q3FA 2QBYA 2GESA 1G5PA 1JAIA 2J45A 2LKDA 2ORVA 3EC1A 3ZQ6A 2O8DA 3KQLA 4Q9IA 2ZVQX 4ESHA 5AUNB 1M7GA 1B0UA 4DHEA 2X1VA 3DOEA 2ZPTX 3QUSA 4LBYA 3KFVA 4PAQA 3TSZA 3KJHA 3P4XA 4I1OA 1UF9A 1E9SA 4B32A 1G8GA 2QRZA 4TMVA 3LLMA 1NF3A 1D9ZA 2Q9CA 2BMJA 3MMPA 4QBGB 4YDSA 1Q21A 5BYJA 3GLGE 1M6NA 2KE5A 4OQNA 4Q1BA 3GQBA 3LFUA 3HU3A 5A4JA 2CLSA 2WTUA 4FMDF 3UANA 4UJ5A 2OAQ1 3UG7A 2ZYVX 1JJ7A 2WJIA 5KDLA 5J4VA 3T1QA 1Z0FA 5L3SB 1MH1A 2ANBA 1AGPA 1RPZA 1TAGA 2HXSA 2NTYC 5TVKA 1AQUA 1AM4D 2FX3A 4Q66C 1NP6A 3X2SA 4TT3D 3KKPA 1BIFA 2AD5A 3C5HA 3REFA 1HYQA 2FWRA 3EA0A 3VTKA 3U6KA 4JBWA 1G4UR 1E79A 3SEAA 4OI4A 521PA 3A1VA 1S9HA 2HEIA 2ZRPA 1R0YA 1NVVR 2D74A 5SZJA 3RYTC 4P0TA 5FPKA 5KUTA 2PEZA 1YR8A 2C03A 2REBA 3AF2A 5EUQB 4LBVA 3TW8B 2YZ2A 2H16A 3B13B 2FU5C 4LHYA 2ZE6A 1MKYA 2BBTA 4JMPA 1U0HC 3SNHA 1W47A 1RJ9A 2MMGA 1E9FA 3VHXA 4D0GA 2BBWA 1Z07A 2J0VA 3RS4A 3GLIA 4GI7A 1E9DA 1P9WA 2XTNA 3L0SA 2CK3A 3DL0A 3G82C 3R9XA 1Q3TA 2XGJA 2PZGA 1D9XA 5HE9A 2ZUDA 3C15C 1HQCA 4NCIA 4PZYA 4EAQA 1GL6A 2QQ0A 3LNCA 4GSYA 1V43A 2HLDD 3CH5A 2VHCA 4JBYA 1N0VC 3I8SA 2BMEA 1G5RA 1G3RA 4L4UA 3AVVA 1A7JA 1Z0DA 2IYLD 2D3WA 3WHKA 1Q57A 1XEXA 3WBJA 1N5IA 1DG1G 3DZDA 4M1WA 3OIVA 2BEKA 1E32A 2P67A 4CF7A 2QU8A 4NPHA 4AYXA 1G41A 4GOJA 4B71A 2ZRCA 1S3GA 2D2EA 5H70A 3LXRA 1F3OA 1Q0UA 2FNAA 4QFMA 5A0FA 3SQWA 1EXMA 2FZ4A 4B47A 3U44B 3LX5A 2F1HA 4OI1A 3AVYA 2QG6A 1D2EA 2VL7A 221PA 4DT1A 3DPUA 4R71A 4NCKA 2OCYC 4KODA 4WXRA 1QG4A 3AKEA 5AUPB 3IO3A 2CEAA 4AURA 4AKHA 4DSNA 2DWQA 2VP4A 2VP6A 1E2HA 3TAHA 1AIPA 1S1MA 4HEJA 2J1LA 3OAAD 4CT5A 2Q9BA 1DEKA 1Z6YA 3VU9A 2IS4A 1E4YA 1XD9A 1II9A 1Y63A 3T06B 2VHTA 3L8ZA 2NO0A 1P2UA 3IPXA 3K0CA 4Q1DA
chains in the Genus database with same CATH superfamily
1E2UA 1GRQA 2VHEA 5C3UA 1TVKB 1WIWA 5DNCA 5A6BD 5FX2A 1SBZA 3U3XA 2XI4A 3G49A 4GWLA 1TIKA 2FSHA 4QHYA 4E31A 4X6LA 4PRYA 1HTBA 3BX1A 3SVZA 1A27A 5K7SA 5B58C 2C0CA 5T6MA 3M3PA 5KYYA 3GUZA 2ZATA 3Q10A 5B36A 2BEVA 4GOKA 2ZP1A 4D56A 1QH8B 2GJ4A 3CSKA 1ZVQA 2A1TS 3WP1B 4E2ZA 5TS3A 1TUEA 1PKEA 5CLQA 4CTJA 4EQ6A 1JXOA 3DHVA 5EFZA 2BFEB 4P4GA 3VR6D 4YJWA 1HY3A 1VCMA 2PTHA 4RH3A 4W8HA 3HUFA 4I3GA 1ZUNB 1D4AA 1VSBA 2YJTD 4MP6A 4N0EA 3C7DB 4OMDA 1C7JA 3E5NA 3GAAA 3GQVA 3L7CA 1GLNA 3BH7A 3UT5B 1OWPA 2FCAA 3EVNA 3IJRA 5DYGA 5K3SA 2HQRA 1ENOA 1T9BA 3RWBA 2DB3A 1Y3BE 3EFHA 3HE3A 4KR0A 1JZTA 2QZSA 4UUPA 4URVR 4CEHB 1BR4A 5E9JA 3T3OA 3W79A 1A9ZA 2HCBA 2VP9A 5HGXA 4GRIA 3O74A 5D01A 3ZHYA 3BERA 4D8WA 2OSVA 3NHMA 2PRKA 4S0ZA 5HQJA 4UZSA 1SG6A 2F1KA 1QQ5A 1IUKA 2ONYA 2WHPA 4GAEA 3UJBA 3V9AA 2C2MA 3W77A 2ZIZA 1KAEA 4M9SA 4UJ3A 4Z1MA 3U3JA 3FVYA 4ND3A 4OB6A 3TMAA 4QNMA 5LWQA 4UD2A 2XUQA 3BILA 3IPAA 1BDMA 5TMDA 3QKSA 4CMIB 4CKYA 2FPRA 5T3YA 3QUTA 1XA0A 3KVVA 1J00A 1QZ3A 2HU8A 7AT1A 1MA0A 4OREX 1ZM9A 3W78A 2IZ7A 5AVUA 1P81A 2ATEA 1MAUA 4WK6A 1MVOA 1FF9A 2DTEA 3EEFA 1SQ0A 2FRVA 1U2EA 2R03A 1QHHB 1GFSA 1GPDG 1K8QA 2NUBA 3DWEX 5DN9A 3W7BA 3T1HB 6YASA 3ZHCA 5CLHA 4ZIRA 4GI1A 1NVVQ 1SCIA 2CK3D 5FWXB 1RWQA 2J67A 2X5JO 1M7BA 1II8A 2AHOA 3KLOA 1QIFA 4Q4HB 4JR2A 4X94A 4AQDA 2PSFA 4MJ7A 3B3GA 2WJZB 1K5PA 1EGHA 4LFAB 2Q50A 4MRVA 3DEFA 1IU9A 1KMMA 4RE6A 4EA7A 5E6RA 5GINE 1ZR4A 1V95A 1MQSA 3EXG2 5DEOA 5C8VA 3NBFA 3IB6A 5DLYA 1P0CA 1RWXA 2J5RA 3KQOA 2PU7A 2YLIA 4IYJA 1LDMA 4YQEA 4BWVA 1R4ZA 3LF1A 3QH4A 3FOZA 3AO0B 3I53A 2Z4RA 3QBEA 4WOKA 4AVYA 4B83A 2HV7A 1RKBA 1TOAA 1WUIS 4QXQA 1D2NA 5CB6A 5LMUB 1XWWA 2VDLB 2ZRMA 1VKZA 1YSCA 2ASEA 4P2GA 3RVQA 3SR4A 3JPWA 4B8WA 1XFDA 1MQAA 2GLXA 3QW2A 4OX9Y 4MP8A 1K9VF 2C9CA 4Q9JA 1IDN1 5F1OA 1DOHA 5JI3E 4WGFA 3TZEA 3IPYA 5LJIA 4YUVA 1UFQA 1I1OA 4PTZA 5M5BA 2XRFA 3OOJA 1NVTA 3NKFA 1H1DA 1ODTC 1XDSA 1YRWA 3HKCB 4HMQA 3RUAA 4AMBA 4L8VA 5CH8A 1YTUA 4K88A 4YV7A 4JITA 4L0CA 3G5LA 4RYLA 1U9JA 2ZETA 3H04A 4N3NA 3C6ZA 3UKOA 3QENA 1FTWA 3MILA 1TJ3A 3CE9A 3OOHA 1M6EX 2E1PA 2ONZA 2YNMD 3IKLA 2CUZA 4YAOA 2P6VA 2QVXX 1EMDA 1QMPA 1A9TA 1M0TA 2HDNB 2RIRA 3JQ9C 4D8UA 5BR8B 3RSCA 2VF4X 5C51B 3QEOA 2PUEA 5DYTA 5C8XA 3GROA 4MW9A 3C3JA 2EFEB 1CY2A 4Q1CA 1QQ3A 2O2XA 4UAVA 3OE4A 4ZLDA 1SHJA 7REQA 3GEHA 1ZS9A 3C6YA 2NM0A 3N2GA 3PJDA 1DKUA 3GELA 3CUUA 4TS9A 1TM2A 2Q3CA 4I1VA 3KJIA 4NECA 4POAA 5AH0A 4LERA 2X22A 4MVJA 4AP6A 1WXHA 2FR8A 4FEAA 1NJ6A 2V6FA 3SJBA 1B6TA 4MR7A 3UGQA 1PZFA 2V7BA 1DE0A 2WSYB 3FGNA 4IKPA 4YRQA 4DNPA 1D07A 2AF3C 1NU9C 2HCFA 1FNSA 1JZQA 3ENWA 3NHSA 2I3ZA 4O79A 4L8FA 5TJ9A 3RHSA 1LRJA 1GTVA 3G2QA 3IPCA 3GZNA 4JVMA 1QAQA 3SHTA 1T6UA 2CE2X 2DMRA 4UBJA 1XOIA 3WG7C 3JATA 2PT5A 3ZDEA 5BV0A 3LWDA 4NTAA 1HM5A 1IC6A 1W19A 2C7BA 2QQEA 2YVQA 3OIGA 1WRBA 2IUYA 1YC5A 2RCYA 2MYTA 3PDCA 3SJZA 1TCVA 3ZQYA 1QH9A 2HU2A 4MDHA 3K33A 4NYIQ 3MX3A 3KC2A 1DMRA 2WD7B 2GCOB 2QVYX 4B6QA 2DKNA 4EFLA 1H4TA 4EMSA 1LX7A 2IOFK 1E86A 2I33A 4GUAA 3PTZA 4RH1A 2X6QA 1CTQA 3OIFA 2C2HA 2ET6A 3KJFA 4YBZA 4XQEA 2W70A 1ZIDA 3GHHA 2KM1A 2WTAA 1ORWA 1KNYA 2I4TA 1NE2A 3AM4A 3R0ZA 4RJJA 1CFZA 3VI4B 1ZGBA 2RGBA 4FGWA 1GSIA 5G1OA 1EUZA 4O4JA 5JCJA 2NU9A 1GZ5A 3AY0A 5FUBA 3I58A 1R64A 1OWLA 3GN2A 3QPBA 3QFRA 1AC5A 2C59A 1DCKA 3FUCA 4YO8A 3UOWA 3ZXIA 5I51A 3S1LA 5CYGA 4QWMA 1PGJA 5K8VA 1ZGZA 1U90A 2YJ6A 2JFPA 2VTVA 3KAPA 4HGOA 5FUXA 2GHIA 4ALIA 3F6BX 1OH8A 3B3QA 5DCUA 2G5GX 5EP4A 3DMHA 2F4VB 3M1AA 1ZQ1A 4J30B 4OATA 3I4FA 4QEDA 5SZKB 4C7VA 5C4IA 1CZNA 4HZGA 4OSEA 3C7AA 1JHPA 4FDUA 3K1HA 4JLAA 4X8MA 4M53A 1V5IA 2WJYA 3H3XA 4RHYA 4X63A 5FA6A 1SUBA 4OP1A 1VE6A 1NX6A 1B93A 3PL5A 1T6QA 1YI8A 2DSTA 3RKUA 1P91A 1DT3A 5JRAA 3CLVA 3DMGA 1ZDMA 3GD5A 3I52A 2XLOA 3TPZA 3GMTA 3VNRA 4E5DA 2GM5A 4KUEA 3ZEIA 5D3QA 2KYHA 4G0UA 2YNMA 1BMTA 3GMDA 1Y6JA 1H05A 1M2VB 4AKIA 2G8LA 3RQSA 1T1GA 3UAVA 3OQNA 2E3JA 3LEOA 2AS0A 2LP4Y 3I73A 4ARAA 1HZZA 2UAGA 3ZDXB 4EARA 5E1DA 3K0FB 3IB3A 4IDBA 1XAIA 2PUVA 3KVRA 5T57A 5CEEA 1SCKA 1LLCA 4S05A 1OKKA 2H7BA 5EJFA 3QBJA 1W29A 4NC3A 1NW5A 4JKVA 4PYQA 3RAEC 3RSSA 4QKQA 4CIAA 5KX5B 2BUCA 4EMBA 5DYIA 3MJEA 3FZEA 5K99A 1CG6A 2CKDA 3NYLA 3K8YA 3O7MA 3JTEA 3RSQA 4UXHA 1PQWA 3ZIAD 2VCCA 1X80B 1YCDA 2MIIA 3BXGA 4ARIA 5HX7A 3K0SA 3A70A 2Y6UA 5BR4A 5KOYA 1BROA 1NC1A 3YASA 3U0BA 1IY1A 4GOOD 2WSMA 2WTBA 1KI1A 3GP3A 2BFMA 3P9QA 4QDTA 4G4SO 3PYMA 1OI2A 4TSFD 5FNVF 2FOXA 3LNMB 2PGIA 4DG9A 4ID9A 3QNUA 4AJIA 3L1KA 1X13A 3UAXA 3IUYA 5GPBA 4BNUA 1MCZA 2ZSUA 2JBWA 2KBEA 2XGSA 3O1LA 1J2TA 2YUTA 2I4MA 1KE2A 5DDIP 1Z6QA 1QH0A 2FMIA 2P9GA 4JC8A 3UM9A 3MELA 5EMJA 1HLDA 4UHEA 3O91A 2HTFA 3ESCA 1CQZA 4YNBA 3D7NA 2C1EA 4PHCA 4YJGA 1KJWA 1SIWA 3WLQA 1F8UA 2RG1A 1SBTA 1Y98A 2VBCA 4BP1A 3E9RA 3ZVRA 1S4QA 4Y9SA 5DH9A 3BRSA 3MWFA 1E1YA 3QBTA 1ZHYA 4Y6LA 4BX8A 1ZN8A 1MOSA 3MINA 1J33A 1JG7A 1TUGA 1YZQA 1Z36A 4PJLA 2D0DA 4NS4A 1NSFA 2OC9A 2P8JA 2J48A 3GBVA 2I87A 1GQQA 1J7KA 1BGVA 1NUQA 4GFDA 4JEUA 4W1RA 4QGSA 3EN0A 1OXUA 1KS2A 1CZLA 4LDNA 3M82A 3MLEA 3OMWA 4K87A 5AWFC 2ORED 4I5FA 4OF4A 4Z1MD 2JFVA 3HY3A 4A0FA 2O7VA 4RTSA 2I65A 3K0FA 4U7DA 3K8OE 2XSEA 3SLKA 3R3SA 1O87A 4AWAA 4D41A 4IDPA 1G9XA 3PXUA 5MHTA 4PG6A 1WDWB 3RF7A 4ILKA 2WJ6A 3EXHB 3W7AA 2M64A 3BGDA 1DO2A 1K06A 2VHXA 3P0RA 2AI3A 2OYRA 2X0EA 3AR7A 1BC5A 2FF5A 2PSEA 2A6HF 2YL7A 1DJQA 1X7ZB 1JG1A 3KDPA 3A0RB 5D6OA 5B7QA 4ESOA 2V58A 3CLUC 2A1IA 3BTSA 4OHBA 2G0AA 1Q2XA 2Q8QA 2HBRA 1NNLA 1HK7A 1SZJG 3DHWC 4JEMA 4WEQA 1QVRA 5L7YA 4ACAA 5B12A 3K0HA 4H1WA 1IY9A 4K1LA 3C39A 4B6RA 4JP1A 3CXUA 3S7ZA 2AG5A 2Q2QA 3GO4A 1EPUA 3BL5A 4P4NA 3SYRA 3S29A 2VWQA 4IO0A 1WLSA 5EZ6B 5JS8A 1PAUA 3V1LA 1FFGA 3RU2A 3T61A 3QWAA 2Y2UA 4OHWA 3IDFA 1ZL2A 1TU0A 3UMMA 1HO3A 5J4KA 2G9UA 5IAJA 4CR7A 4EUFA 5L3SA 4LY9A 3TGPA 1E63A 1NSTA 1ZGHA 5EXEA 2X9LA 3S2EA 2IJGX 2KBFA 3QLTA 2HGZA 4BNMA 2P61A 4ENSA 4DJFC 1GL9B 1PFWA 3MOSA 1VB5A 4ENRA 3GV0A 3JARB 1EBFA 1JEEA 2W6JD 3HBMA 3HNJA 4CDMA 3CR7A 1MO3A 2IHYA 2OO7A 2DB4A 1FVHA 4R31A 1X7XB 4JL5A 1GT91 1ONSA 1RSZA 3DONA 5HW0A 3K30A 2V9PA 5IU6A 3BWBA 1VPLA 3I6YA 4YR9A 3FHTA 2XQKA 2D4HA 4JL6A 1XJCA 4LJ6A 4ZO7A 4L74A 5CA0A 5BNFA 4E0BA 4YUWA 4YP6A 4ZOQI 1C2YA 3FYDA 4MV5A 4RTOA 3RE1A 1QV9A 4XWJA 2ZSFA 4JBXA 1VHTA 4ZEXA 1WCIA 5FQOA 3GP8A 2YJ5A 1KAMA 3OKAA 3VZBA 4CEIA 1WUTA 3BMNB 2ASVA 3BGVA 3KYDB 4F2PA 3NIDB 3ZTWA 4XWTA 5LUBA 2BTQA 3E3LA 3T5AA 3KL4A 2WV7A 5CA1A 1Q7TA 1GNRA 4QXPA 5ALRA 4AW9A 5A6JA 2PLRA 2FJPA 2I6TA 2X3FA 3ILVA 1NY5A 3W8FA 1QIGA 5K6AA 5LQMA 3KAKA 4OQYA 4X93A 2W11A 3VJLA 1T3GA 1RYBA 3R7WB 4UNIA 5JS2A 4DDHA 2BWJA 4HLNA 3TLBA 2A84A 4HZUA 2PNFA 3DO8A 4HXYA 1O95A 1A8HA 4RMNA 2ID4A 2FWAA 3TZBA 4CI9A 1TK2A 1J0EA 3O8NA 4OK6A 3N8GA 3S2IA 1DARA 1WP9A 3N59A 5B6JA 1UDCA 1LF0A 1C1DA 4MWOA 4YGYA 5D8DA 4A8HA 1XZAA 3D64A 5TF4A 4KXXA 3EVBA 4CFSA 2BEWB 4HAYA 4RTQA 4JCHA 2XTJA 3C8GB 1KIAA 3OT5A 3IR7A 4I6JA 4H7FA 4IEEA 3RS5A 1XD2B 3CLTD 2QB5A 3LEVA 5CB4B 4GX0A 3FGPA 4PLVA 3VNSA 3RV3A 1M8KA 1G8FA 3A2KA 2QE6A 2NU8B 4TL7A 1YZCA 1FFXA 2Y1FA 2G28A 3L3BA 4IJQA 4C4OA 1HE1A 2A8YA 4HFRA 4OLJA 2CFSA 2I62A 1NQTA 1EE2A 1WWKA 3A1TA 3H1EA 1UOOA 3AHEA 1QIIA 5H3HA 4PK4A 5LYJF 2ZE8A 5EXDA 3EUEA 1LWNA 3HFRA 4PZEA 1P7YA 4MJXA 3RYIB 3ZI4A 3ZWPA 4BWGA 4C7JA 1VKNA 1GZ4A 3P9XA 4WESA 3Q72A 2GTPA 1YQEA 4RL6A 3VU1A 4DA4A 5E1MA 4EK9A 2Z15A 3OP1A 1P33A 2J33A 5COBA 2P5SA 1RAEA 3FDIA 4IXNA 4HT3B 1GNQA 1CFJA 3OAAA 2B2XA 2JEOA 4HQ0A 4J7UA 3JZIA 5K6TA 4ZAFA 1PG2A 1BTOA 1AMOA 4LDRA 1CERA 3RTCA 2RDMA 3JVIA 3AGUA 3HVJA 1KZ7B 2I54A 3GEPA 1UPFA 4AKEA 5LQJA 1JHAA 2ZI9A 4LRWA 3F5DA 3PDMP 4MW5A 1YDIA 1NUPA 1ZRHA 1F5SA 3U5TA 2OGTA 4IJUA 3ZWWA 2GZ3A 1NNUA 4DIEA 3IPLA 3QI7A 4ZJYA 4JI1B 4DBVO 4DIFA 1B8OA 4DANA 3O31A 1IUNA 3K1TA 1Z7BA 3CZPA 4HWGA 3EYWA 3RGWS 1RFGE 1SCDA 4XGNA 2G0NA 4BNWA 4C0SA 4FSDA 2HYIC 4Q01A 1SVUA 4G81A 5K8CA 1ANKA 4NICA 3AH8A 2P78A 5K8LA 2CNBA 5JC8A 4F91B 5LVAA 3GRUA 2JKYA 2RARA 3ASZA 3OE7D 1YHNA 2OD2A 4HATA 4CM4A 5SV2A 5DBOA 4J0GA 1NBWB 5I4BA 1IIRA 1UP7A 4F3NA 4JBHA 3W5BA 3ZCXA 3WWDA 2APJA 4P53A 1SXJC 2NO6A 4EG4A 3GLVA 2J32A 1W44A 2FPGA 4BECA 3LP6A 2IQ5A 5BW8A 5K01A 2QEQA 1DELA 1VE7A 4OGKA 3L7BA 3WQBA 1EJ0A 4RDAA 1Y4CA 1D5CA 1ZK4A 2XUZA 3DYVA 4D92A 4EFMA 2PBLA 5TQ2B 5A69A 1JDUA 2I6GA 4FCVA 4PXYA 4QO8A 2TSYB 3B1XA 1RQPA 3FSGD 4AUEA 4BBAA 4DG5A 2X9VA 3TXXA 2VZLA 2ZCJA 4L4ZA 2O7NA 2ZIAA 2X6TA 2WFLB 4RE5A 1VE5A 1Y89A 2EILC 4D02A 4YYZA 3AL0C 2BFBB 1H85A 2YFYA 4YCSA 4F5WA 4MCAA 3NHUA 3HNRA 2JK0A 2DVMA 4YRCA 2H8AA 2BZGA 5FBWB 3EIXA 1IPFA 3LLKA 3SXZA 2AVDA 2FFJA 2JD1A 3NAZA 5JANA 5K45A 3LHFA 4QOGA 5J2UA 1CUUA 3V1KA 3UBTA 3CPSA 1EYZA 3ZU2A 3OIUA 3A4NA 2XE7A 3HB1A 4OQFA 1I3CA 1G0NA 3ICQB 4IAOA 4EJ2A 3G7SA 4Q3EA 4DILA 4DXDA 4LZJA 4N48A 2EX4A 5FLKA 2B2NA 1KPIA 4U6SA 3C62A 1GGVA 5MN4A 2FP4B 2JBAB 1PCXA 3BJRA 4Q0MA 4RFVA 2H8KA 3DQQA 1UXKA 3AEXA 4L2IB 3OESA 2D4AA 3ABKC 1A4XA 1L5WA 1QOPB 1MNAA 3US6A 4WERA 1JFFA 5K8JB 2IBFA 4JB0A 2LVBA 4OTZA 4XPWA 1SYQA 4H31A 1E66A 3UWOA 2DH6A 2X40A 4KG7A 1JH9A 5C1IA 2ODAA 5B1YA 3HLZA 1AQIA 4JI3B 4ZVQA 1SAYA 3VPFA 4HDSA 3LDHA 1KVSA 2RGYA 3WK4A 3IBTA 1AZSC 5K0SA 2R7UA 1YQ9A 2WUEA 3C7TA 5DI3B 2QZJA 5E6SB 5JD3A 5CIYA 4BLVA 1VHWA 2X19A 3D4OA 4JEAA 4LZOA 2HWXA 1ZCZA 4RIGA 1HYGA 3AXSA 3GK3A 1AOXA 3EF3A 2QVGA 3F71A 1FYFA 3CJQA 4ZCLA 1YZAA 3QYFA 4IKOA 4UDNA 2OXFA 4G56A 4M6WA 1Q7RA 1DC3A 3MUOA 2L9JA 1MH9A 1RKVA 1JHOA 2WMOB 3GAFA 1BH6A 1UKZA 1F60A 2D06A 4ZPJA 5JPCA 1QGOA 2GAJA 3PXEA 4HBGA 5DTMA 5IYZA 4ITVA 3Q3JB 2X8JA 1Y9ZA 3TAXA 5CT8A 2OE2A 3R3YA 2XHZA 4OM7A 5CT9A 1Y6FA 3TLYA 2ZJ8A 2IZ1A 3FVQA 3HC7A 3IQCA 3KRTA 3SF8A 2XODA 4MSUA 2JBAA 2FZLA 3ZHUA 3LUKA 3L79A 3AYXB 3SMVA 1YFZA 1BRTA 4JX9A 4KXWA 3OEHD 5IXYA 1GYRA 2DZDA 4LRTB 1KEZA 2B61A 5EMNA 2C5BA 4B7AA 5L4SA 3H1PA 2B92A 1UT8A 3JD2A 2HK8A 1B2RA 1VJRA 4Q24A 4Y7DA 4YC7A 1WCIB 3S4YA 5A6SA 1XF9A 5ITZA 3DTTA 3TNLA 2OBYA 2XL8A 2ZTSA 3EEYA 5JRZA 1U9IC 3HXTA 3L6OO 1QBGA 1ML3A 2PWBA 2WABA 4UQLA 2QR3A 3K09A 3CKMA 5A71A 1E1CB 4HGNA 2I4IA 1ISPA 5TQVA 2GJAA 1PT5A 1RDFA 3R3JA 3ZDAA 3BRJA 5J59A 2QM8A 5J2TF 2CV0A 2GDZA 2F9FA 2NX2A 1RRMA 3BOSA 2JG3A 1MZPA 1JEQA 3IUNA 4NAHA 2Z30A 2Z8YM 4FP9A 3O3CA 4EKIA 3C3DA 5E9QA 4G7OF 4TL9A 3FFBA 1JMWA 3LQFA 1ST2A 2G71A 3OU6A 3ADPA 3E53A 1GVNB 2NU7A 2Q2VA 5IJWA 2OWDA 3AETA 4IIYA 5JQGB 4P22A 3UJ3X 2IHTA 1E1LA 5AESA 1GTG1 3BKXA 1DXYA 1Z6GA 3O93A 4C7KA 4EKNB 2IYVA 3LPNA 4O4IF 3VH1A 4GU5A 4KUGA 4A0SA 5IT9A 4PJNA 1IOZA 1L8XA 3QNWA 1NN3A 3IBCA 4RQTA 4RVCA 3RODA 2VNSA 3EZFA 4DWVA 3S2ZA 4DJAA 4HSGA 2GCOA 1XRSB 2BZSA 1QE3A 3LS2A 2HZ8A 1YONA 1NUTA 3KTAA 4K9QA 3W04A 2PQ2A 2V7QA 2FEWB 1KVTA 2C5LA 5L3ZA 1VIYA 1EJ6A 2GPYA 1U6KA 1VA5A 3PDUA 3PQ7A 3OCVA 4N7RA 1G2QA 2VHWA 1ZHWA 1UBOS 1P31A 1QSGA 1RJFA 4OBEA 3ZGXA 4DVJA 3VKFA 1IEVA 2CZCA 1OX5A 1XU7A 4OU4A 2ERYA 2FHPA 2YMQA 1JPVA 4N7JA 4OIRF 3HB0A 1L2TA 4IIJF 1H0SA 4PO8A 3DT8A 1VIVA 2CLFB 5JO9A 1JHZA 1HG0A 1KO4A 3GJ6A 1ZWLA 3UTDA 3W3ZB 3QBVA 2QD3A 3B0UX 5EUMA 3GLQA 2WHXA 1IM8A 2H51A 1SQGA 3JWJA 3T0IA 3VOSA 4C0JA 3DT6A 4QBFA 4R1MA 4CKWB 1WQ3A 5B6PA 2K4MA 1D4OA 1XLVA 2HA0A 3CHYA 5DIZA 1Y3CE 1INLA 3I2KA 4B3SB 1CY0A 3QZUA 4UUMA 4F3YA 1WAMA 2P79A 4J7XA 1JNYA 2XUKA 5JCJD 2WIBA 3T34A 1Y8RA 3FNQA 3QNMA 4I19A 4Q6BA 3W5UA 3WLHA 3DBLB 3UFXA 4EFNA 3O3MB 2P1RA 3CNOA 1C41A 1R15A 4GEGA 2FSSA 2WYHA 4MPPA 3OZIA 1OCEA 1L8OA 4KO4S 1DUSA 4RNDB 4XCQA 1TA0A 4P98A 4QM6A 4F5YA 2F64A 3WG9A 4DR4B 4RVGA 4TQGA 2I2XB 1C0EA 5CX4A 3RIMA 4BE9A 5M3BA 4KOEC 3BF8A 1SUFA 4Q5SF 1ZSYA 3PG5A 4KI2A 1DTWA 1HDXA 1NLZA 1RFLA 3L8YA 4MULA 4RIIA 4TS3A 3KPYA 4OJYA 5F51A 1CDEA 2ZRLA 2XWBF 4WKBA 5ETJA 1Z3IX 1ZHTA 1FSGA 3A7DA 3U62A 3WDSA 4CMKA 5H5JA 4A0HA 1EVIA 2XJ4A 2VUIB 2E89A 4X1IB 4A4DA 3IMGA 4FQ7A 1B8UA 2Q4DA 3U7QB 1XCGB 3B6ZA 3K9LA 2BGJA 3REOA 1RJEA 2ANCA 3SJ7A 5FD8A 1JXAA 2NIPA 1YD7A 4DCTA 4ZZ0A 2EP8A 2TMDA 3DP9A 3OEED 4U7HA 2HSWA 4UBMA 2ZYAA 1EP1B 2GXUA 5DM0A 1N2IA 2JPDA 5H16A 1PO7A 1HMYA 2GKSA 1RMVA 3CZ9A 3IEKA 1SUCA 3R0JA 1DEAA 2XUIA 1XTIA 1KBOA 4J6FA 5BXQC 3Q6IA 1N4AA 5KMGB 1YLMA 1NLXA 5F5HA 3VAZA 3ZWNA 3R3ZA 2FPUA 2IF2A 5A7FA 1G2OA 1L5SA 4TMYA 4B2IA 3X1MA 4BHTA 3IL2A 1U80A 1UKAA 1QHXA 1XC7A 2ZSEA 3AEYA 4ROTA 2GK3A 1IWBB 3LUTB 4RS4A 3S90A 4AY6A 1AHIA 4FNGA 5EJ2A 5JBNA 2YS6A 5HUJA 1EUCA 1ORTA 7MHTA 1RIIA 2RHBA 4H4KC 5LDDC 3VNQA 1N0WA 1Q12A 3S55A 1Z38A 4HS4A 4KKXB 1W75A 4Q4LA 2QJTA 2Z43A 2HJWA 3K4QA 4JT4A 2UZAA 5AJXA 4DRXA 4M7WA 4DUGD 4J0JA 5I8PA 2V1UA 3D4BA 1VYIA 3J7TA 5G1NA 5T64A 5I7EA 3FCYA 4O33A 1FX1A 4EG0A 2VC2B 1IXZA 3IQ6A 3VR5A 3DXZA 4Y9TA 2VJLA 3NPAA 4UMDA 5JD6A 1W5FA 3DJNB 4QECA 3V4VB 2VG8A 1Z8NA 4S0XA 1PR1A 5CG2A 1KMQA 5BV7A 5I01A 1PJ3A 2FVYA 2R6JA 1WJGA 2V4UA 2P3QA 3HEBA 2ZVDA 3TM4A 2AQ8A 1PR3A 3WFJA 4DIMA 1FUUA 6REQA 3PFWO 4HQ6A 4O4IB 2PY6A 2JFNA 2WRZA 2XD9A 1MEJA 1EVLA 3HI4A 1PW5A 4AU1A 1SHLA 4O5AA 4BVJA 1EVKA 2GN1A 2J5QA 2R86A 4PZAA 2O8EA 3H1TA 2NNWB 3ORQA 1A4UA 3ULKA 4QE3A 2FPPA 1OYVA 1TM1E 2RFLA 4HAIA 2ZZNA 4MR8B 1JBQA 3GRAA 1V0JA 2H9YA 5GGXA 5C81A 2IKQA 3V00A 1D5WA 1W8DA 3IV7A 4E5YA 2I15A 1EM6A 4EYEA 5GJBA 1E9BA 2ZXOA 2C2GA 5FOWA 3U3RA 3B6IA 1T9CA 4GX1A 4PS0A 2GB4A 3FAKA 1JVNA 4YEDA 4EATA 1Y5RA 1HQKA 5KNCH 1AE1A 1X39A 3NFYA 1VJ1A 1A4RA 1R4NA 5JJKA 3LUBA 4FSHA 3BD9A 4XUDA 5TPWB 3LGSA 1GGFA 4LHWA 4YCBA 1Z18A 1DMSA 1M6TA 1I5NA 1L7DA 1Q0MA 3ZXSA 3AC0A 1XQ6A 1LDEA 2GAIA 1L5MA 5KOJB 3SIWA 4DABA 4RAOA 2X8LA 4DEYA 3A1UA 2FFRA 4IWXA 5EE0A 5DU2A 1HRKA 1QQ7A 5KOHB 1ZONA 4J7TA 5DNVA 4NULA 2Q6VA 4DQ0A 4TV8F 5DM2A 4HLQB 1NBME 5BVGB 2J3MA 1ITZA 2PX5A 2XLHA 3Q2KA 1TM7E 3M1LA 3V5ZA 4TYNA 2XT0A 1IZYA 3KQPA 1NVEA 5TLSA 1QTRA 2I6FA 2YIDA 1JFLA 1IW7F 1JMVA 5TVGA 4FDVA 4KR6A 2ESRA 4BASA 4LX0A 4DYDA 1DSSG 3EZLA 1B8NA 1BHSA 3P9RA 4H3HB 4V0RA 2OZEA 1ADBA 2P4EA 1I3NA 3EULA 2WYIA 1ZIYA 3ITKA 1Z26A 5F7JA 5IK2D 5CVDA 4QU5A 4A8PA 3VF0A 4AQ7A 3ZIBA 1JU9A 4F85A 4G1BA 1SXPA 2BELA 4YALA 5HRUA 5ICSA 1X9IA 3OY2A 5FADA 1LPEA 2H1SA 4ZC1A 3WR5A 3BICA 4MWEA 3TL6A 1NQ5A 1W5TA 3MD0A 1LIHA 1PJ4A 2G17A 2VUTA 1A9PA 4OUDA 3B52X 1E9AA 2QLAA 2IDMA 2H7XA 2P2DA 2QN1A 3E27A 4KH0A 4W9RA 3C5CA 1P3DA 5GWXA 3VR2D 3NT5A 2X8WA 4YJ2A 5BUOA 4KPGA 1SO8A 5A3VA 5JAOA 1SQFA 5AW6A 4UUQA 4UFPA 5DISB 4JI7B 2XT9A 4LJRA 2JAHA 3HXLA 3JD0A 2ZQ5A 4CS9A 2O1XA 3L8CA 4BL5A 1IN7A 1KSJA 3L49A 1AQJA 2M1XA 1U2QA 2HMAA 3DE7X 1Q11A 4DAEA 2NP7A 1KKMA 2BBOA 1X7HA 2BI8A 4C4XA 1SQ5A 3AF1A 5B57C 1RQNA 4X45A 1X3SA 4K6MA 1UJ2A 3NHKA 4EHFA 4L75A 2QLLA 4WWHA 4Y2JA 4CETA 3C6KA 3O10A 2YWCA 4C3DA 1LDNA 3ELDA 4KQGA 1H3EA 2FPOA 2PZJA 4PANA 2Z08A 4CM8A 4TMFA 3GORA 3DAGA 1W34A 2OILA 2Q4OA 1IQ0A 2F17A 3P8ZA 4HDMB 5CHYA 3W6NA 3ZK7A 1BE0A 5B1DA 3UKJA 1N8SA 2JZNA 5E7JA 4W5TA 1L5HB 1WVIA 1Z75A 3CO5A 3K16A 2XHEA 3PV0A 2JIMA 3GFTA 4UVHA 3S2UA 2ZR8A 1YE8A 1NQOA 1SXJE 3A6GA 4WN9B 3VR3A 5BWOA 2WF7A 3RSGA 1H2ZA 2B20A 3ZTTA 2E6UX 2BFFA 4F0JA 4RELA 4YCAA 2IOFA 3QVOA 4GM1A 2Y3IA 3U0VA 3NYQA 2A9PA 2MSKA 5HCNA 1DV2A 1ORVA 4D57A 2WZGA 3CRQA 2ZVJA 1MT0A 2G9NA 2CD7A 2LPMA 3GEIA 1TEZA 1DDOA 4ZU6X 4S1NA 2WJHA 4WK2B 4BIMA 1CLEA 4MV8A 1ULSA 5FEMA 5FORA 3G5MA 3B1JA 4TXMA 3KTFA 2EDCA 3KUKA 4HRYA 3EQ8A 1W0CA 2GXQA 2BFPA 4RGQA 2BGTA 3ZDBA 2VQ6A 4INJA 4WK4B 3QF4A 4PX5A 4QREA 3KKQA 1RYFA 3D4LA 4XR4A 1VGQA 4FEYA 2C00A 4BMOB 3D02A 3NKEA 1L5YA 1MX1A 1H4VB 5GVRA 3V4LA 4CKZA 5HPYB 1UP4A 3LUJA 3IUJA 5KNCA 4O3MA 5A7GA 1Y5LA 2WV9A 4XCXA 1JJVA 3RVOA 1PJCA 5LQSA 2EJBA 1KEKA 3NYIA 2J85A 4RKWA 5LL6P 4K3UA 3Q15C 1D0SA 1R0KA 3HP1A 4L16A 3K70C 3NDBB 4GDMA 4CEHA 2GLUA 3K31A 1GUDA 4YXWA 4FC6A 1ZK3A 3TLGA 4DWOA 3CCFA 4TV9A 3N0XA 5FNVB 2CNWD 3H9QA 3RFUA 1A71A 3VKVA 3FTNA 3AHCA 4DJDC 5F52A 5I8ZA 3D3WA 4EELA 4MKXA 1U9YA 1JSZA 4MMXB 1K6EA 1ZKMA 5EEHA 1FIUA 4AQYB 3QY0A 4UCXA 1JFRA 1OILA 2GDJA 1EAMA 2VHUA 4ZOEA 4AO8A 4YJ2F 2DE0X 3G88A 4L4SA 2EJVA 3ZLTA 1UJ6A 3KDAA 3NB0A 1QHGA 3PDIB 4RZQA 3KOZA 2VYQA 4FYPA 2Q7XA 1PI3A 4WY2A 3R8FA 4YV1A 5ITWA 3KQKA 4C2TA 1M34A 1F1JA 1II0A 1N92A 3AR5A 2R79A 1LB1B 2OCPA 4G0NA 4JBNA 2XCSB 2IXFA 1KK3A 1X8LA 2P35A 3D3QA 4F9EA 4NLLA 3EMVA 2DYRC 1SXJA 2H8GA 3E48A 2VP0A 3M9LA 4R2WA 3V7WA 2EV9A 3EF1A 3JQAD 3B9RA 3LC7O 4H35A 5EOVA 4YCCA 3PIDA 3HCDA 3HKEA 3P52A 4NQFA 4OH1A 4M49A 5ECWA 3A9WA 4MR7B 4N54A 5JT1A 1Z7Qc 3IA2A 5C8DA 3HCCA 4ZOLB 3TOVA 3SXJA 1Q1NA 4WZ6A 3FSGA 3AJMA 2DKOA 4AT1A 1CX9B 5JTUA 2PWYA 4JLVA 1WPXA 2A1UB 3LOUA 1GAQA 3OZAA 2PGLA 2BTOA 4G0QA 2CXPA 4QT0A 4Z9AA 1AUVA 1K86A 4MVMA 1J0DA 2DFKB 3BWMA 1BFUA 1U5AA 2B8EA 5FI0B 4BQFA 1ZHZA 1WKCA 4XH9B 3ZVNA 1U0BB 1R0XA 3VJMA 5B64A 3LT5A 3T99A 3WLMA 4ER5A 1P2BA 4IWBA 3KEMA 5JE8A 4CS8C 1IMOA 3CUYA 5CGZA 3RAJA 2JFOA 4EAAA 2JKZA 5FIUA 2B1IA 1XRRA 2Q5LA 5AI9A 4ND8B 4JJFA 1GPYA 4BLOA 1T6BY 4FMBB 3IODA 3R75A 1NVXQ 5ARCA 1OZGA 2CNNA 1L5OA 1K8YB 4OKSA 4XGQA 3FCXA 4L02A 5IZ4A 2Q4EA 4UMFA 4C2AA 4Z4HA 2XMZA 2A0XA 2DECA 1SFRA 2IYPA 2Z4SA 3M70A 2HJHA 5COGA 3Q5EA 3TW0A 1ZIOA 2OU6A 4ND4A 3QYJA 4M9QA 2PZKA 1GGMA 1Q77A 3PXBA 3K2QA 2MCFA 3S5UA 4FILA 3PC3A 4MKGA 3L4BA 2D2XA 3C5EA 2XZTA 1M2FA 1VG0B 3ZUPA 4UVEA 1W48A 2UYQA 1WXIA 2PD3A 3B29A 3JYLA 3N1UA 3BMQB 2WD9A 1FDTA 4MUBA 4U2FA 3KZKA 1Q92A 3O21A 3HO1A 3AF6A 1ZA1A 3CY6A 4DSZA 1CQXA 2COEA 2O0MA 3K70B 3BULA 2BL2A 1G8MA 5M7EA 5JXHA 2FXIA 1QFMA 3KHKA 3RYFB 1MNEA 1FXUA 3WE7A 4ZDKA 3OCCA 5CCXA 3GVCA 3O7WA 4YGXB 3HKEB 4GBED 1VK5A 1C1XA 1NAIA 2Q0SA 3QXCA 4EB8A 2NLOA 3TTYA 5GTDA 1VRCA 1V8ZA 5F2EA 3EVTA 4YRAA 3F9IA 1AMNA 5CH3A 1ZL0A 4U63A 2G1AA 2CVPA 1U2ZA 3KLMX 2DWCA 1QV6A 2QRUA 1TYDE 1POWA 1Z5PA 4NU6A 2Z8ZA 2VPZA 2FN3A 4UPDA 3U1TA 3V2UA 1J06A 3EMBA 3N2NA 4MW0A 2A9JA 5IPFA 1V26A 2ZXUA 2JLZA 4I4CA 4XWKA 1SXJD 5KTYA 1XELA 1PV4A 1I30A 3QTBA 4W4TA 2BMFA 1KFEB 2WTXA 2WVHA 1U6HA 1PUXA 4U39A 1J9ZA 1E2KA 1Q0SA 3L7AA 1P4RA 2IX9A 4FGZA 3TTXA 5A4AA 3RSOA 2EERA 2OSBA 4KE8A 5TS2A 1K97A 1RC1A 2O48X 1L8LA 2VBIA 5LNK6 4Q9AA 4KNVA 1RI5A 4Z53A 1QZUA 1PVOA 1SBCA 2AOUB 5DMXA 3ZY4A 1YZGA 3H65A 2KB0A 2QZPA 3LU1A