3DMDA

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
318
structure length
310
Chain Sequence
MFGKLREKLKSFVKRVEEEVEKEEEEVELTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Signal Recognition Particle Receptor from the Archaeon Pyrococcus furiosus: Implications for the Targeting Step at the Membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transport protein
molecule keywords Signal recognition particle receptor
total genus 116
structure length 310
sequence length 318
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dmdA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dmdA02
2LKDA 3D6TB 4WIAA 3RYTC 3WP0A 1N6IA 1D6JA 1WRBA 3WYAA 3NBXX 2BMFA 1R5BA 3AVWA 2WICA 1T0JB 4FMDF 1FP7A 3EZ7A 5AUQA 3T34A 4A8JB 4BFVA 1H8ED 1OFUX 1LF5A 2CLDX 4C0QC 5FTJA 3U44B 1MO6A 4AKIA 1AQUA 1DO2A 1U94A 3GJ5A 1YR8A 4FINA 1MV5A 4LJYA 3CH5A 4ZKDA 3QOFA 1L7VC 2ZITA 3HU2A 4TL8A 4UXIA 3TKLA 4DDTA 2H16A 4DXAA 3UWKA 1XXHE 4I1SA 1E9FA 2A5GA 2GXSA 4Q4AB 2FN4A 3ZJYA 4B3CA 1S9HA 1Z06A 4RSGA 1JEEA 1VG8A 4DCUA 1KI3A 1S96A 4RD3A 2R6GA 1FP6A 3DZDA 3ZQ6A 1AK2A 4NYIQ 3I1FA 2BC9A 1P6XA 2BDTA 3MFYA 2C99A 4LV6A 4F4CA 2O8CA 3MWYW 1F2TA 1M6NA 4CT5A 1E0AA 1XD9A 2QAGA 3EXAA 4P4SB 3T5GA 1OB2A 1OH5A 3CW2A 4GMDA 5AWFC 4TTPA 4I1UA 4HAXA 4QFMA 1FMLA 1NY5A 1S1MA 2A30A 4Q4HB 4W9MC 2A5JA 1R0ZA 1RFLA 2BJWA 2VP6A 4PSKA 4C30A 4BZPA 3RWOA 4D81A 2ZRFA 3DM5A 3FKSD 4Q03A 2IA5A 2JLZA 2EFCB 1K8RA 1KI4A 2HT1A 3C15C 5B2ZA 2IWHA 4Q9IA 3WBJA 2R9VA 2V6IA 4PPGA 1BKDR 3W6PA 5C46F 4L8GA 4QNRA 2Q3HA 2ZETA 3FPAA 5BN3A 5CJ2A 4Q48A 5C2JB 1EFTA 2ERXA 1EWQA 4ZIRA 1KMQA 3KUCA 4HYYA 3PV0A 2WAYA 1TQDA 4MGZR 2PX0A 5DI3B 2WWWA 2J0SA 2J59A 3HYTA 2FZLA 4UNQA 3AKYA 3X1XA 1GNPA 5DYIA 1W0KA 1VG9B 2NZJA 3L0IB 5AJVB 3ZZTA 1KI1A 4D6PA 1SXJD 2ODWA 1IY0A 2Q9AA 2MSEB 4LOAA 4NPHA 4URYR 1JR3E 3BGWA 1GAJA 2V9PA 1IOZA 2F6RA 1YR6A 2HEIA 3EIQA 1H8HD 4P32A 5FOTA 5HE8A 1KSHA 5L3QA 1BMFD 3REGA 4B44A 4DUGA 3WRXC 1XEXA 2IYVA 3I32A 3JZAA 4DKXA 1IN8A 3EC1A 5TY0A 1TADA 3LO5A 2V7QA 2WHXA 2PT5A 4JLJA 3P4YA 4JBXA 2BBOA 1JXOA 3S1AB 1VYVA 4OK3A 3K70D 4WVFA 1MABA 1E2HA 1W44A 4JKIA 1P7CA 5CDFA 2ZRDA 2GJKA 1P9NA 3VR2A 1OW3B 3WY9A 4RVCA 3AH8A 2JLUA 4C0JA 1W4CA 4A2PA 1KK1A 4C0KA 2BMEA 1U0LA 4TYPA 1QF9A 4Q9HA 2XEXA 4LDJA 2QRNA 1AS3A 1CJTC 1E79A 5FUYA 2D7DA 2YOGA 3OIWA 2R8RA 4D25A 5LBIA 4MUAA 4TTQA 3T1QA 4AG6A 5E3HA 2HXSA 5KSOA 1EWRA 4MUBA 2FFQA 4RFVA 1Q1EA 2IF2A 3CPEA 3B85A 4LHXA 3OIVA 4LC1A 3L2OB 2XNDD 1JEDA 3UXMA 5JI3E 1RRCA 1K5DA 1HEIA 2QRZA 3AF4A 4RD6A 4RZ3A 2LWIA 3B2EA 2IYTA 1G20E 1GWNA 1XMIA 2GWHA 3O8DA 4ZCIA 3TW8B 2CXXA 3BXZA 4HI0E 3KB1A 4NH0A 5CIWA 3QKTA 1H8EA 3EPJA 2JDIA 5HE9A 1R0WA 2VBCA 1AKEA 2X19A 4U02A 4EPWA 4D0LB 4Q7KA 1S8FA 2EFDB 3EIHA 2D4HA 2QBYA 2EVWX 5FTLA 3QXHA 1EGAA 5G40A 3QKSB 1CR4A 4LYFA 4M9SA 5E7IA 5KDLA 1NG9A 1YRBA 2BBTA 1U9IA 2UVQA 4XWKA 5KDOA 4GOKA 2ZRBA 5KPJA 1G17A 3FYHA 5DI9A 2PZGA 2GCOB 4FMDB 4GBMA 1XF9A 3FHCB 4PPQA 1RJ9B 5HZKA 2B8TA 1T91A 5CM9C 1ELOA 4F92B 4IDNA 1XJQA 3NIBA 1OIWA 3F0TA 1NKTA 4RJLA 1TU3A 3D31A 1Z07A 2WJGA 1R8SA 1QVRA 3CF2A 1RYHA 1G3UA 4IFEA 4W5JA 3B82A 5BYKA 2R65A 1JR6A 2I3BA 1UEIA 2XSZD 1P2VA 3SYNA 2V7QD 3AF0A 5HKKD 3VNVA 1ZBDA 4NCKA 4BLOA 2NQ2C 3LVQE 2ZAMA 4Q1FA 4HUQA 2G0NA 4JLMA 5L3QB 3ADDA 4C4PA 1XPUA 5DLQC 3A8TA 3ECCA 2FU5C 3BB1A 1CXZA 1Z8FA 5AUOB 4UNPA 1YVDA 1N5LA 3OESA 5KNDA 2OM2A 3B7GA 1CR0A 2CEAA 2OBMA 5EXPA 1JR3A 1OYWA 3NEYA 2ZQ5A 1W2HA 3KTAA 4FN5A 1N6RA 3TAHA 1D8TA 4GOXA 2PX3A 3TGPA 4ASUA 1S4QA 3M1IA 3UKDA 5BWMA 1GRNA 5CJPA 1KGDA 4DLWA 5JBQA 2NO0A 3D8BA 2VF8A 2XAUA 4BRUA 1TUIA 4URXR 1ZRHA 3IBGA 2ZSBA 3U7GA 4KLNA 4BLSA 2O8BA 2WM9B 3DVLA 3MGCA 5JEEA 1H65A 1II8A 2ZE6A 4GSYA 4AYXA 5JJLA 3T12A 4IVRA 4DLXA 5DHAA 4ITRC 5G3ZA 5GJVC 1XU4A 1NIPA 2VYFA 3CKLA 2ECKA 2O8FB 1CP2A 2GEDA 5JZVA 1XPRA 3T15A 4TT3D 5F9FA 2ZS7A 1E9BA 5KU1A 1EXMA 3CRW1 4YQFA 4LHWA 1OXUA 1UDWA 3Q72A 4FMCF 1AZTA 5CK5A 1OSNA 3NWJA 1NBMD 4CEJA 5J47A 2YKGA 2OLKA 4PANA 2O8DA 1Y3AA 1PLLA 1XMSA 1JXMA 2W83A 1GL9B 4MH0R 4RFSA 4TLCA 2DB3A 2QQ0A 5A0FA 2V6JA 1F2UA 1UJ2A 3LBNA 4AD8A 1GILA 3G5UA 2QBYB 1N2CE 2QL6A 3A58B 4HLQB 4YXWA 4BFUA 4HUQB 4LYJA 1FUUA 2ZRCA 2IXEA 1D2MA 1ZIOA 1NF3A 2IYZA 1NIJA 5JS8A 1S3GA 3F5FA 4LGMA 3FMOB 4WXPA 2RGNC 1U9IC 4LHYA 1E9SA 2E1RA 4HATA 3MJRA 4Q1BA 3TUZC 2BV3A 1WA5A 1Z5ZA 2YOFA 4BGDA 3I5YA 2GF0A 2BOVA 2JATA 3NEJA 4AC9A 3GJ4A 1KKLA 5ELXA 4NE2A 5D3MB 3WMEA 1F6BA 3R9XA 1OH8A 3RRYA 3FE2A 4F91B 1DAGA 4A6PA 3P26A 2P5TB 3A1TA 4B75A 3ADBA 2N46A 1NMZA 4Q21A 2J0VA 1UKVY 1QDEA 5FUXA 1OKKD 3Q3JB 1EG7A 1E2FA 4C3ZA 1R5OA 1TPZA 1Z3IX 2QAGC 2R6FA 1NLFA 2VO1A 2BKEA 5EE3A 1NNEA 1WE2A 3BB3A 3KXKA 5GADl 3CF6R 3AP3A 1W0KD 2WOJA 4PHHA 5KDDA 2H17A 5J40A 4G5SA 1KO4A 3GJ0A 2GBLA 3DOEA 2B6HA 3X1WA 4BFWA 2QMEA 1QHXA 2IYYA 1KDOA 1YZGA 3K0FB 3DDCA 3K53A 3NC0C 3U4QB 4L15A 2O8DB 1ZNWA 4JYCA 1GKIA 3I62A 2QSZA 2WOOA 4UXJA 2MSDB 3DKVA 4JLVA 4Q4AA 3VQTA 4MRNA 1BIFA 3THOA 1TNDA 1D2NA 1MKYA 3KFVA 1IXSB 3K0AB 3MLEA 4ZI3A 3C4JA 2PEYA 4MGYR 5TXGA 3U5ZB 1A5TA 4LX0A 4PSVA 2EYUA 1DBSA 4DDVA 4IVPA 2GCPA 4G0NA 1UF9A 3A36A 3DPUA 4HAVA 4G5QA 3RRMA 5FR1A 1VMAA 1E94E 3MAAC 2J7PD 2FOLA 1FMJA 2ZI5A 4Z1MD 3L82B 4PC2A 4Q66C 5F9HA 2JLWA 2R6AA 3RS7A 3TJZA 1V43A 1ZYUA 3NH6A 3PIRA 4AURA 4DLRA 1U81A 2BMJA 4A2QA 1QHSA 4D2IA 2PJRA 3SYKA 3THWA 3BBPA 5FL7D 4DCSA 4NYJQ 2DWQA 3RS5A 1W4RA 1R5NA 4DUGD 3THYB 1VG0B 1ZUIA 1L4UA 1GNRA 2OG2A 2YC4C 3VU9A 1ONBA 1OXTA 3Q7PA 3GLIE 3K9HA 2GETA 4P33A 3TUJC 3EC2A 1SULA 4OJKA 1P2TA 2J41A 421PA 4GDFA 4EPTA 4A0HA 2X2FA 1TTTA 2C78A 2WPDA 4IOLA 3M0EA 1RRFA 1E6CA 1RRPA 1SVKA 4QJ3A 1JQLB 3B5JA 1E2NA 4ACBA 5HKKA 2CL7X 2ZYVX 4LYHA 3UPUA 4CEIA 2WMNB 1UFQA 1HTWA 4LPKA 4E5UA 1JAHA 3AVQA 1XXHB 1E4YA 3C5CA 1Z29A 3SHFA 4DT1A 1CS4C 1IY1A 3PEUA 3QSYA 3CRVA 4RD0A 2PCLA 3NG1A 3RRZA 2OT3B 1UEJA 1WP9A 2AWNA 1CLUA 4TYWA 4XIGS 4C2UA 2QG6A 4JLDA 2WKPA 4KODA 1E99A 2GXAA 3IHLA 2HLDA 2QTVB 1RJ9A 1SVWA 3RSOA 4CRWB 3PR1A 3KUDA 4POAA 3SDZA 1DO0A 4B6EA 2RAPA 2IHYA 2NOAA 3NDPA 1ZCBA 2DFTA 1YHNA 4N3NA 4X8MA 3GLGB 3OIYA 4PX9A 2C9OA 1VIYA 2W6JD 1Z22A 3U3RA 4TQUS 5KOYA 1WCV1 2CE2X 5DE3A 4Q4JB 1YE8A 1Q1BA 3QPWA 4KO8A 4ZDKA 2XTMA 1E32A 4FMBB 2Q3MA 3PUXA 4TSFD 4DIEA 3SEAA 4QKQA 4QNMA 3CBQA 4TT3A 4FXPA 1OV4A 4KVAA 4HAUA 2JLYA 1U0HC 2V3CC 3U3KA 1G6OA 2IYUA 3GFPA 2IUSA 1Z2AA 2VHCA 2WJJA 3CZQA 2D7CA 3K0CC 1OKKA 3L0PA 3W34A 1R2QA 4RD4A 1KSGA 3W3ZB 1E2QA 1KMHA 1ZM7A 2JJ2D 3SR0A 5LD2B 1S1CA 4JSTA 4OBEA 3U61B 2QPAA 1G16A 2ZSAA 3DZ8A 4DEYA 1N25A 2FMXA 3CZPA 3CUEF 1AN0A 3KJEA 4F38A 4LBZA 4JSYA 2IK8A 4D4KA 1KK2A 3QXCA 4LJ5A 3T06B 2VPPA 2P6NA 2WMOB 3SHWA 5JJIA 4Q7LA 1CULC 2AXNA 2OFXA 3IDQA 4RKFA 3VHLB 4JMPA 1CR2A 2OO7A 2WV9A 3MMPA 2F1JA 2D74A 3QKUA 4PFSA 3RC3A 5FH9A 1WB9A 4NCHA 1LS6A 1BOFA 3DMDA 2OCYC 3EWAA 4JKYA 1U98A 4QBIA 2OUKA 3LA6A 4Q1DA 3VR4A 3QVUA 1UM8A 4A4DA 4JBWA 4A1FA 3AB3A 1G3RA 4TMKA 1G19A 4PO8A 2DWOA 1S2MA 4NYJR 5JJKA 3A4NA 3AEZA 3ZQJA 1X1RA 2OBNA 3C16C 1G5PA 2IC5A 3N5CA 3LBHA 1R0YA 2QUZA 3MJHA 4AYTA 1M8PA 3L8YA 3VR5A 2CJWA 1ZC4A 3BAFA 3NBZC 1SVIA 2OLJA 3EG5A 5DISB 4B48A 4JIMA 4RKEA 4P4UA 4GP6A 5HR5A 1Z6YA 4MYCA 2WWYA 1MR3F 3CX7A 4B2LA 1KMHB 3WBKA 5CB8A 2Q0HA 4HLUA 2J1LA 5M04A 1X3SA 5KNCA 1D5CA 4C2TA 1NVUQ 1OFHA 2GK7A 3LDAA 1E2EA 2C96A 1G21E 4TMZA 1TEXA 1OT3A 2REXB 5AJYA 5FI1B 3TH5A 1ZD9A 1HT1E 2TMKA 1A7JA 1GRRA 2WBLC 2W58A 4I1OA 5C18A 1XTJA 4IFBA 4CYMA 2C03A 1GKUB 2G88A 3OEED 2OHFA 4MRPA 3W6NA 1KIMA 1UKYA 3BH0A 3KKMA 1NJGA 3B9QA 5L3SB 3SFVA 3PUWA 3FFAA 4JL5A 2CNWA 3ZS8A 4DLUA 1DAFA 4NMMA 5D3MA 1N6PA 3BFKA 4NDZA 3PEVA 2O8EB 1NKSA 1W49A 4XH9B 3VKGA 1UPTA 1DE0A 2JJ2A 2ZUCA 1AQYA 1FPMA 1TF7A 2D2FA 2H7VA 2IW3A 2VP9A 2ZVQX 2ANBA 3MWLA 2JLQA 4AIIA 3QKRB 2P65A 3LY5A 3PVSA 2H92A 3LBIA 1OH6A 1JPNA 3GLFA 5EQTA 2JIZD 1KZ7B 1E69A 2O5VA 3LVRE 3RC8A 2ORWA 2VQSA 1FFHA 4NKRA 3DEFA 5EJEA 3UG6A 1C1YA 4PQRA 1NMXA 2QT1A 3BB4A 1FTSA 1DVRA 5FOXA 5DYGA 3BC1A 1T8UA 2ASEA 2ZI6A 4FWIB 5HPYB 1CRQA 4URWR 2RMKA 3BH7A 4M22A 4MITA 3VR1A 1IN4A 2CDNA 4BRWA 1PUJA 4H1UA 2QROA 3ZZUA 1D9XA 3CM0A 2GKSA 5EP4A 3OEEA 2HYIC 4UNNA 3JZMA 1KSFX 1G6HA 4MRSA 2FX3A 5EXTA 3ZH9B 4PO1A 1T8TA 2ATXA 3TNFA 1OXXK 3BOSA 4WZBE 1NN5A 1NJFA 1UKEA 4HDOB 4EUNA 2WWFA 4UKDA 1M7GA 3AVXA 4GFDA 5E7JA 3UMFA 2DPXA 3KKPA 4QJ4A 2J5XA 3THWB 3HPQA 2J45A 3P20A 3QG5A 2G9NA 1GRQA 4C0AC 2AKYA 1G3QA 1GNQA 1SXJA 1Z47A 4KV9A 3W9YA 4KBGA 1AA9A 2VSOA 1HURA 4TYQA 3TR5A 3T35A 4A2WA 1S9DA 4TTRA 2RGNA 4XTCS 3TSZA 1KNQA 1Q3TA 4PXAA 1VYUA 1MO5A 5TMPA 4DSTA 2AKAB 1QHYA 2CE7A 2G3YA 1F5NA 2HT6A 1MRSA 4XVRA 3B60A 4Q9JA 1CJUC 5E95A 2PMDA 3QPUA 1LB1B 1PJRA 2WJYA 1KO7A 1P73A 4Y0AA 3RS2A 5FTNA 3QXSA 4US2R 4NU0A 2W6IA 3N2IA 1FL9A 3QEJA 1NBME 3C7KA 3KQNA 1SVLA 2WWIA 3NBFA 2CK3D 2NO1A 2NPIA 5KHOC 1AS0A 3OE7D 1HY3A 5FL7A 1EK0A 1CBUA 1N6NA 2FGJA 2X2EA 3DHWC 3ICQB 4LHVA 1JALA 4G5OA 3P1JA 1ZAKA 3K1JA 3EZ9A 4M1OA 3LXXA 3UMRA 3OZXA 2O8BB 2W2TA 3TMKA 1Z0DA 1AGRA 1T5IA 4XOIA 2IEZA 3RS0A 4BFZA 3AV0B 3H2YA 1KY2A 4FCWA 5GJCA 3LLMA 5KTYA 3KKQA 3EAQA 2AFHE 4W7SA 4OHYA 3BK7A 4TLBA 2RGDA 4QM6A 3O8RA 4RCYA 5JEDA 1OHHA 2REOA 4PTLA 4X8HA 2VL7A 2G83A 4HB4A 1T6NA 4H1VA 4TQ9A 4NYMQ 1EESA 2IS2A 3KX2A 1MT0A 121PA 4KFTA 1G8FA 3IEVA 3NH9A 2NO7A 4II7A 1ZMXA 5TVKA 2GCNA 3QPVA 2ATVA 3BE4A 4R98A 3C5HA 4LC0A 3MSXA 3SFZA 1DAIA 1E2DA 2AD5A 4IDHA 4G5RA 4QHYA 4GPTA 2ORIA 4PC7A 1N5IA 1A4RA 1XCMA 2XTZA 2IXGA 2NZ8A 3DO6A 5KSYA 5TB5A 4XWOA 3EZ2A 3CPHA 1J8YF 3IIJA 4L9SA 3FMPB 2P6UA 5KSPA 2Z5FA 2FFHA 2IWRA 4LRWA 1W36B 2YC2C 4WZAE 3OHMA 1OYYA 1T9HA 4NZYA 3ZD6A 2GVZC 4B3FX 1RPZA 2DFLA 2NTYC 5JSZA 1KJWA 2ZJ5A 3GEEA 3GPLA 2XXAB 4AKHA 2GZHA 5BW8A 4TQAA 1IONA 1KZGB 1V5WA 4B6FA 1TQ6A 5LB4A 1LVGA 3QF4A 1E2JA 1CIPA 1UBGA 4HEJA 1FNNA 1IN6A 4OHXA 1RC8A 1P2SA 4WZ6A 2W0SA 5IK2A 4Q01A 4RZUA 3CR7A 3FMIA 1BMFA 1VDZA 3IIMA 1H8HA 4V0LA 5CDFE 1F2UB 3DMNA 3L0OA 3NTUA 2V55B 1KDPA 2W0MA 4WBSA 2BEJA 3B6EA 821PA 3R9WA 3HDTA 2QT0A 3KKOA 1ZD1A 3I92A 4QHTA 4UNSA 3QBTA 2HCJB 4RZXA 4A36A 3X1DA 2PT7A 4ARZA 4YMVA 4Z54A 5F3WB 5FTKA 3LD9A 5JRZA 4IOKA 5L3RA 4R7ZA 4TMVA 1Z6GA 1IM2A 4S35A 2KB0A 3W5JA 2J9RA 5FR2A 5BQ5A 3SZRA 2W6JA 1RRGA 2C77A 4IDOA 3GQBA 3UMSA 3WRYC 3X1ZA 4BFSA 4DDWA 1ZC3A 2IYWA 2ZM5A 2R62A 2Y8EA 1GKYA 1W0JA 1ZJ6A 3QG1A 4LK2A 3Q9LA 2CVFA 3MCAA 3UIEA 1N0UA 2FNAA 4B76A 3AVYA 3FOZA 3H4MA 2C04A 1ESNA 2ZE5A 4MKFA 3C8UA 4KVGA 4KXFB 5GJBA 2VP5A 3HR8A 4DIDA 1RE0A 2IF0A 2V8OA 3K9LA 4M1KA 3C41J 4DZZA 1HT2E 1XMVA 2Z4RA 1TF5A 2XNDA 3A1SA 3D3QA 1N5JA 1VPLA 2HV8A 1E0SA 2OILA 3CRQA 3KJIA 4X8OA 5EP3A 1X86B 4GNKA 4LHZA 4CIDA 4ERNA 2R44A 1N0WA 1OFTA 2QMOA 2WIAA 2ZRJA 5BYJA 1EFUA 1LNZA 1ZM3A 3QF4B 4EDHA 1NVXQ 3CO5A 4B71A 5JI2E 3UK6A 1U99A 1K6MA 1C9KA 2A2ZA 4US0R 4Y0VA 4CEHA 2J3EA 4ZDIA 3SOPA 1TEVA 1JI0A 1Q44A 2CHVA 3QBVA 3A1VA 3LXRA 3TQFA 2AK3A 5KSZA 1J70A 1NVWQ 2I4IA 4NCIA 1DOAA 1COWD 1Z0AA 4OKSA 4V0KA 2GBLC 3KJGA 1YR7A 4A0FA 4EPRA 1XCPA 1W36C 2DFKB 4TWZA 2OV2A 1KO5A 4B43A 4K81B 4BUJA 4OI0A 1M2OB 5KYKA 1AGPA 2WWXA 3KDSE 3VKWA 1LTQA 5SZKB 1FTNA 2ZI3A 3NXSA 3U3JA 3PG5A 2O0JA 2RGCA 2IX3A 4ZDWA 3KFXA 2A7QA 3U7HB 2W6ID 5L3VA 1CRPA 3TRFA 3VR3A 4UJ5A 1T4GA 2DWPA 1G5RA 4GZLA 3SJBA 2N1BA 5IHPA 2QP4A 4FCVA 1U8AA 3QKSA 4Q4HA 4A0RA 4Q5IA 4MDEA 1GTVA 1O3YA 1II8B 4K8OA 3RWMB 4DCVA 2EFGA 5EP1A 2ONJA 4LI0A 2OXRA 3SBEA 4B2IA 1G5TA 2BHRA 4D0GA 1KK3A 4Q1AA 3T1TA 1ESMA 5J4LA 1GM5A 3K9NA 5FI0B 3UATA 1N3BA 221PA 3ONWA 4QXAA 2QAJA 1BO6A 1TAGA 1GITA 5J5CA 2QORA 4TSFA 4YMWA 4IVQA 1G1MA 2ZSFA 2AN9A 2AD1A 2YVUA 3KXIA 4PSAA 4DBLC 3M4YA 1Q22A 3BIFA 3IO3A 3PITA 4O3MA 4BLQA 2ZS9A 2BBSA 2VIIA 4EQ6A 1JBKA 5EUMA 1OHHD 3U7FB 2JA1A 1IXRC 1GG2A 3OIUA 5CYOA 2XJ9A 2ZVPX 4HLCA 4QRHA 3I73A 4L5BA 4LBWA 4JVSB 2WSSD 1TQ4A 4URZR 4CEHB 4M4SA 8OHMA 4UNRA 4IW3B 4ZKEA 5GVSA 4TL6A 1E9EA 5FPKA 2F1RA 1XPOA 3ZVMA 1ODFA 3T5DA 2R6CA 2GVDC 2N42A 1ZM2A 1M7BA 1LFDB 2ZJOA 1VG1A 4B3GA 1GZSA 4OYHA 4OHVA 2D62A 4TMXA 1G41A 4LJ7A 4EJSA 1MO4A 4M9QA 1HYQA 2P3SA 2Q21A 1FQJA 4PPFA 1P4SA 4BE7B 3I4LA 4KLZA 3E5HA 4CW7A 2B8WA 1XZPA 4JBYA 4JLOA 2AFIE 3LH5A 1D9ZA 1Z83A 1NSFA 1OPXA 1Z28A 4L4UA 3QVVA 3AP1A 4NCNA 5EE5B 3WMFA 2GRJA 4P31A 2YWHA 1E0JA 5EP2A 2A78A 3AGPA 1YZQA 2FDCA 3Q5EA 4R2IA 4AI6A 3KJHA 2CJWB 4Q4LA 4V0NA 3WNCA 1GUAA 4ZIRB 1W36D 1KAGA 3NDBB 3FHOA 2X77A 4D82A 1KAOA 3HWSA 3A4LA 1QHGA 2J87A 3LLUA 3GJXC 4QGGA 4YDSA 2QENA 4YC7A 4ZO4A 1KY3A 5FPSA 3WHLA 2FE4A 3U6KA 3GLFE 1IBRA 1YZKA 1J8MF 3DOFA 4PC3A 5LB2A 3ASZA 4OK6A 3BORA 2F7SA 1SVMA 1C4OA 1CR1A 1E1RA 1G7SA 2YOHA 4MYTA 2JLXA 1FW6A 4ZCMA 4DCTA 1EX7A 1GP2A 1XDBA 5EE0A 4DHEA 4BPBA 2WZQA 2A5YB 2KWIA 4D4JA 2GJSA 4Q7MB 4MDFA 1TF2A 1M74A 2AL7A 4A8JA 1B23P 2IYXA 4P4SA 3CR8A 1DAEA 2HJGA 1E2PA 1GDDA 2EFHB 3V9PA 3ZYCA 4C0HA 3PUYA 1E1QD 4OQLA 2ZROA 4M1MA 2BKUA 4OK5A 1KOFA 2B21A 5FTMA 2NG1A 2ZYTX 3QNUA 1GSIA 2OCAA 2QI9C 1QHIA 2VTKA 4A15A 3IEUA 4KU4A 4M1SA 1U2RA 4MRVA 1W7AA 1KSJA 2RH5A 5BN4A 5P21A 4PC6A 2QM7A 2OZEA 3K0SA 1RYFA 4OQXA 2OCPA 2OAQ1 1J99A 4Q7JB 5DN6A 5K8LA 1G3IA 3EW9A 4YMSA 4BFYA 4MKIA 4V0OA 4EFLA 2GAAA 2P5SA 2C9YA 2XB4A 4KFRA 5CK4A 4JS0A 5TDHA 3PEYA 2ODBA 5K8TA 1E9RA 2ANCA 3L0SA 2RB4A 4PZYA 1G4AE 1P75A 4CVNA 1N6HA 4M8NE 4OI4A 2DBYA 2L0XA 4OQMA 3OE7A 2VH5R 1XMJA 4BFTA 2BM0A 1QHNA 4P0TA 3SYLA 2LCFA 4DWJA 1E9CA 3ND8A 4A0GA 2HXYA 4GMXA 4HDQB 2QM8A 3S1AA 3BRWD 2ERYA 3GJ6A 1NI3A 1DEKA 1M7HA 1L8QA 1W46A 2GEVA 2FFBA 3BD9A 2NPFA 3GLIB 1XTIA 4WA7A 2QN6A 3P4XA 5F2EA 4DB2A 4I99A 4P4TA 2H8KA 2VHUA 1QRAA 4DLSA 3LX8A 1XTRA 1SVSA 3LRPA 1WBDA 4XD7D 3NHAA 5AJWA 3L43A 4KBFA 1KJZA 3QUSA 3CRRA 1SQ5A 4V02A 1YQTA 2PLFA 1T5LA 1HH4A 1WF3A 1HUQA 1LW7A 3LWNA 5FBQB 3VAAA 3AVVA 1G8GA 3THXA 2C98A 4EFNA 2ODEA 4D0NA 4Q9LA 2VSXA 3FKSA 2WJHA 5H68A 1G8YA 3I8SA 3FKQA 5IDVA 1Z0FA 3GCGA 4NHOA 3EZ6A 1ETUA 4QM7A 2BEKA 2FZ4A 4BLRA 2IEYA 3A37A 1KTVA 4J0QA 2Q3FA 5ANRB 4OHWA 1I2MA 2H1LA 3IUYA 2CCJA 1M34E 1HE1C 1OIXA 1QVAA 3GLHA 4IEIA 4ZV4A 1DTSA 3IKJA 2YWEA 1CJMA 4JJKA 1T3HA 2QY9A 2CMKA 4MKGA 1IXZA 2O52A 4Q47A 2OFWA 2G77B 2GF9A 2PH1A 3CWZA 4XTRA 3EPLA 2I1QA 3SC3A 2EWWA 4IEEA 1VECA 2I1VB 5JLJA 5JHHB 1DARA 1XXHA 1A1VA 3K70B 2V4ZA 3RS3A 2CHGA 2RCNA 4ZCLA 1YZUA 3U3OA 3QEOA 1T0HB 2FSGA 3SQXA 1NLZA 3H1TA 3GJ3A 4QC2A 1F48A 1COWA 2YWGA 4Q19A 2BIFA 3W6OA 1DAKA 4FMCB 1U0JA 1KI8A 1N6LA 1YJ5A 1Q3HA 1DAMA 2G6BA 4OI1A 3RDPA 5JHGB 4NYMR 2WKQA 3GLIA 1L4YA 1FUKA 4GI7A 521PA 2JLRA 1XEWX 1SZPA 2RGGA 5IT5A 4ZPXA 1WGWA 2YJTD 2P0EA 4EQ6B 5FUWA 1LV7A 3TQCA 3ZIAD 3ZS9A 1Q12A 4NP6A 2ZR7A 2JEOA 3B9PA 4GRAA 4WW0A 3EIEA 3V4FA 2ZRGA 4GL2A 1CF4A 4M53A 2PJZA 4ABYA 5BXQC 3BFXA 5UKDA 3B13B 4CT4B 1XJCA 4OQFA 1GIAA 5LDDC 1AS2A 2HYDA 3TUIC 4AY2A 2Z0MA 3IO5A 4LY6A 1E2LA 1Z0KA 3HP1A 4NCJA 4TYYA 4JVLA 4TL7A 1GVNB 1XP8A 1X6VA 2BCJQ 4JVNA 4TN1A 2GJAA 3CWQA 1Z6TA 1EFRA 2ZJ8A 1FZQA 4Z51A 2KE5A 1XD8A 4EJSB 1SHZA 2IL1A 1G8HA 3G82C 3QKRA 1Q1QA 4FW9A 1JR3D 2HLDD 2FSHA 4AK9A 1NRJB 1IHUA 3UWOA 1FX0A 1LF0A 3F3YA 1G7CA 2YHSA 4FWTA 1SXJE 2FEMA 3OAAD 621PA 5JSZB 2ZE8A 2HF9A 3NKVA 2GTPA 4URVR 1P61B 1Z6XA 1LY1A 3U3MA 1BYUA 4O0MA 2ZJBA 2PLRA 4D4MA 5DIFA 4E07A 4W5HA 4EPXA 4OI2A 4IDQA 1U90A 3MUFA 5IK2D 3KQHA 2ODNA 4G1UC 3A1WA 2EFEB 2XSZA 1P2UA 1UADA 3KQKA 1W5SA 2XITA 2ZAOA 3IILA 3WNBA 5B30A 1U8YA 4KI0A 1BH2A 4YLGA 2OCBA 4KYUA 3JVUA 1XJ0A 1NBMA 3EPHA 1XZQA 3HJNA 3K09C 1QHHA 1UAAA 3K0FA 1KI6B 3W8RA 2HCBA 4MKHA 2O8FA 2Z43A 3EX7C 1E4VA 1VCNA 2R6DA 4M9ZA 2XOKD 2AR7A 3CONA 3UANA 4QBGB 1OXSC 3HU1A 1W4BA 5D3QA 4ESHA 5CITA 721PA 3AVTA 2CBZA 1UBEA 3HR7A 1KI9A 3U60B 2A3RA 2DCUA 3ASYA 2GILA 4ACAA 3WXMA 3ZVRA 2MSCB 2YINC 2FV8A 3SQWA 3DL0A 2FFAA 2WWHA 3BH6A 5K8IA 3KQLA 1XD2A 4C9BA 4JZKA 1PV4A 5HCNA 3MWJA 5LPNA 1P60A 3U2QA 3CIOA 1JJ7A 4RY2A 4EJSC 2ZRMA 3SJZA 3VR6A 4O2RA 5EXXA 2WVJA 2FJUA 2VRWA 3K09A 4B3XA 3P27A 4LJAA 4F7WA 3EARA 1J90A 1FQKA 1N6OA 1IN5A 1YZTA 4N1AA 2PEZA 1TQ2A 1ZU4A 3PUZA 1S3SA 5GVRA 3X1YA 2XZPA 5EE9A 2BBWA 4B33A 4MYUA 4DC9A 3Q5DA 3AM1A 2F1HA 5KNBA 2ZANA 1RW4A 1ZNXA 2C9CA 3K0AA 4DSUA 1HV8A 1R6BX 2F3RA 2QP3A 2XGJA 1XNJA 4DT1B 1Q21A 4B3DA 2YWFA 4HAWA 1DAHA 1CEEA 1X8KA 2WPDD 5CLQA 4XVUA 1QHHB 3LNCA 1P72A 1U8ZA 3OFND 3QE0A 2D3WA 2IYSA 2PBRA 3PEWA 1SKQA 1KO8A 1E2KA 5H8WA 4HSEA 3VX4A 4CDGA 4LV5B 2ZE7A 1UBFA 5DNYB 1GOTA 3QF7A 2IS6A 2ZREA 1G7TA 2CCGA 3QI2A 2XXAA 1Y63A 1S0UA 3IQWA 3MG9A 3ZVNA 2QE7D 4TL9A 4E22A 5JFGA 1OB5A 2FEOA 3IBYA 3U44A 2ZYWX 3K70C 2JCSA 2WIBA 1OH7A 5C1BA 4G01B 2FSFA 3VX3A 3RSLA 2OEPA 3AF3A 4I4LA 2AX4A 1R10A 1VHTA 2X8AA 3GJ8A 1YU9A 4IOJA 2XNSA 3D7MA 5G41A 5L8VA 4E09A 4YMTA 3PCRB 1DADA 1G64A 2EQBA 4IXNA 4OQNA 1NMYA 4MA4A 4NL4H 5JECA 1T3LA 1NN3A 4CEIB 1EX6A 1RVDA 4UJ3A 1N5KA 4TLEA 3CPJB 3N2EA 1VKJA 3TSWA 3B8HA 1CJKC 3NVAA 4B32A 2NO9A 2GDJA 2WKRA 3W3AA 2X1VA 2PZEA 4O2LA 5G53C 3B78A 1QG4A 2GZAA 5DH9A 4B3BA 4N0DA 2FSIA 3ZD7A 3IQXA 3VTKA 2IYLD 3R7WA 1OXVA 2IYQA 3AKDA 4I81A 1KYIA 2HUPA 2GAOA 2ORVA 4Z8YA 5HTKA 1DELA 4C7OA 3K8YA 4W5WA 3AP2A 3KKNA 3SN6A 3ZIAA 3CNNA 3T1OA 1TU4A 4IKEA 3QQ5A 4KSCA 1W4AA 4DLYA 4TZ0A 3AF2A 2UKDA 3FGNA 3ZLJA 1NY6A 1HA3A 1TL7C 2F9LA 4G5GA 3PENA 5DHFA 1G8PA 1W5TA 2VP0A 2FA9A 1G291 4BEBA 4BWYA 4S2EA 1E79D 4IDPA 5LD2C 4PO9A 3OEHD 1KI2A 2QNRA 3OAAA 2REBA 3IGFA 2QP9X 4EKDA 1XWIA 2ZU0C 3K9GA 1SVOA 5KPDA 3SI7A 3AKEA 1WQ1R 2ZRNA 2ZUDA 1NL3A 4DCNA 2YZ2A 5FBVB 3V00A 4A82A 1G3MA 1Z08A 4FD2A 4F4IA 2CL0X 1KI7A 1ZUNB 2WTUA 1G9XA 2KI5A 1E0KA 2WAXA 2J0QA 4NTZA 4U5XA 4M1TA 1MH1A 1F2TB 1R4AA 2DFNA 5DO9A 1ZW6A 3B1ZA 2IXFA 4YDHB 1XB2A 4FIDA 1KJYA 1E9DA 2A9KA 4V0MA 4QBHA 1XEFA 1K5GA 1SXJB 2OAP1 2ZR0A 3GEHA 5FL3A 2J7KA 1CJVC 2DY1A 5IRCD 1N6KA 3KZ1E 1J7KA 5EUQB 1M1YE 4HUTA 1G4UR 2D2EA 4PHTA 4Q9KA 3B1WA 2FH5B 3PFIA 2Q9BA 2RHDA 1LS1A 3AQ4A 4QL3A 1GFIA 2ZS8A 3IPYA 4Q02A 3FVQA 2RGBA 3TE6A 3AVUA 2ZIAA 4BECA 5DI3A 3LAWA 4CGZA 1ZD8A 3Q7QA 3RS4A 2OE2A 1AIPA 5SZIA 1II9A 2Z83A 4PQYA 3K0EA 4CEJB 3VMFA 2JJ1D 3BERA 5J4YA 4R9UC 2VEDA 3QIAA 1X1SA 4MQBA 4D4LA 1PUIA 4QHSA 3HU3A 1EFCA 4KFSA 5CM8B 4F4JA 4ZI2A 1A2KC 3FMFA 3CF0A 2ZR9A 5FFMA 4B34A 1W0JD 1XBTA 4PPNA 2QQEA 4AG5A 2GXQA 1IN7A 4LSGA 2P2LA 2A5DA 1ZINA 2CVHA 3H0KA 4ASUD 3W5IA 3CNLA 3GP8A 3LX5A 4Z1MA 2EU8A 1A2BA 4HB0A 1IAQA 4LZZA 5H70A 1GL7A 2HJVA 1RIFA 3EA0A 1FX0B 3SS8A 2C8VA 2HDNB 4HB2A 2AK2A 4H9GA 4EFMA 4RFSB 5AR1A 5FOVA 2VP4A 2P67A 4BEJA 4MYHA 4UQOA 5JMTA 5CLLA 3P32A 5JWRA 2ZRAA 3VU9B 3E1SA 2XTNA 2ZPTX 3ICEA 1OLOA 1SXJC 1VCOA 4JYBA 4TZ6A 2QSYA 4E03A 2YYZA 4JT4A 4Q1CA 2F43A 2E9SA 5JCPA 3ZDQA 4B73A 1Q1ZA 1SGWA 3QJYA 1KK0A 2V1UA 4HDCA 4L9WA 5EZ5A 4HLDA 1J2JA 2GJ8A 3KXLA 4FCTA 4TYNA 4RD1A 5FBLB 1IJFA 5FOSA 5FPYA 3SBDA 4BLPA 2W2XA 1VYTA 3GFTA 2H18A 3AF1A 2DHRA 3ZZ0A 2R2AA 1ZIPA 3TW4A 3TLXA 1E96A 1JQJC 4XVQA 1NN1A 4JL8A 5B57C 1E1QA 5L3SA 2ZXUA 4LCBA 1VIAA 2QEQA 3QENA 4EPYA 3CLVA 3K0CA 4IHQA 2WJIA 4XSGA 3WHKA 1Z2CA 4N0EA 3KB2A 2UZ3A 4O25A 1D2EA 3ETLA 2W00A 3ZGXA 2VA8A 4LJ8A 1XEXB 5H1YA 4QBFA 2CHQA 1OJLA 1G7RA 2ZRPA 2VSFA 4DEXA 2OSBA 2LKCA 3JVVA 1QZXA 1QG2A 2VF7A 3CB4A 1UDXA 4OHZA 1YZLA 1KDTA 4KHZA 4OL0A 1PLJA 2PCJA 1AZSC 3R9IA 1Z6AA 2SHKA 2FPLA 2ZI4A 2F3TA 2J0UA 4A8JC 3KQUA 3EA5A 3PJRA 2IYRA 2ONKA 1US8A 3EASA 3H86A 2G0TA 4JL6A 5HZHA 1UBCA 4PZZA 4KCGA 6Q21A 3HYRA 1T3SA 1NP6A 2F43B 4BZXA 2JAQA 1OIVA 4M1YA 4GP7A 2GESA 3O8CA 1I4TD 4HZIA 3RHFA 4GT1A 3U6BA 1DPFA 1FNMA 3AUYA 4WOPA 2BJVA 2BWJA 2QMUA 3VFDA 1XX6A 2JGNA 3V4RA 3TIFA 3CX8A 1HQYE 2KJQA 1ZM9A 1O87A 4XSHA 1WBBA 1OFIA 3SJCA 3O47A 4JLAA 1MABB 4DLTA 4DJTA 1Q57A 4DSNA 1DG1G 1ZM4A 4HLUC 2F1IA 1X8LA 1HQCA 1ZVQA 3RANA 1A82A 1XCGB 2CNWD 2BMDA 2QMHA 5CIQA 3REFA 5IF9A 5JRJA 2OESA 4CZ2A 3N70A 2JASA 2GZDA 3AUXA 4PHGA 3ADCA 2ZRLA 5F98A 4QGFA 3WMGA 4A6XA 1VCIA 5J4KA 1IJEA 1MRNA 1CTQA 1Z0JA 2CCKA 3GFOA 4LUCA 4IOMA 3FWYA 1B0UA 2GXUA 1MO3A 2D06A 4HB3A 3NHBA 1Q20A 2J46A 5EE1A 1YKSA 4GZMA 2G1JA 2H5EA 2FGKA 1SHKA 4Q4JA 3A4MA 1G18A 4G3XA 4KAXA 2IHBA 2VHJA 1NN0A 1R7RA 4LPSA 1E3MA 2C5LA 4XD7A 3BWDD 5B64A 4DLVA 3RVBA 3DKPA 1E9AA 4NBSA 4TMWA 4AKGA 2WJVA 2XZOA 3W8NA 5JCZA 2QPTA 4US1R 3X2SA 4PQFA 3GEIA 1OE0A 1E1RD 1ZU5A 4EPVA 4GOJA 2ZSEA 4QG7A 5AUPB 3I8XA 3EWSA 5JWOA 1VTKA 4QJ5A 1F3OA 3I61A 3R8CA 4U7DA 4C0SA 2CLCX 3GJ7A 5K8UA 4HZUA 3RNLA 3MD0A 3J81k 5FOUA 4DDUA 4ESVA 2Q6TA 1JAIA 3L8ZA 3FHTA 4M21A 2FWRA 3GD7A 1I4DD 3T1VA 1JJVA 1AJEA 5AJXA 1L2TA 4HZUB 1XTQA 3SE0A 1P9RA 4P3YA 5J4HA 4Q00A 4YMUA 4R2HA 2JLVA 2CK3A 4B35A 3ND9A 3GLFB 2GHIA 2RKOA 5KO2A 5FPTA 5JWHA 4JLBA 3B1VA 3NC1C 4HAYA 3KL4A 3MWKA 5DN6D 3CRMA 1SKYE 4PZLA 3OEHA 4LBYA 2YV5A 2EYQA 4C0LA 4WAUA 4KITB 3VKHA 3C14C 2VHTA 4D80A 2O8EA 4BASA 2QTHA 4C7OB 5E4FA 3RAPR 2WSMA 3LW8A 1DS6A 2MMCA 1BS1A 4JT2A 4URUR 4DLZA 4BQSA 3RABA 1Z63A 3TR0A 2ZJAA 3LFUA 1XEWY 2ZI9A 2Q9CA 1NG1A 1NSTA 2EWVA 2FG5A 1ZCAA 4TMTA 1W1WA 1R0XA 3AGQA 2VP2A 1EFRD 4KYIB 4LV8B 1XTKA 1MOZA 4B74A 3SJAA 2MMGA 3TK1A 4M9XA 5J4VA 4YONB 4DRZA 5CB6A 3BS4A 4LJ6A 1EFHA 4XJXA 5HCIA 2GNOA 2VLIA 2ZI7A 2WWGA 3GMTA 4K46A 2PZFA 4B2PA 1P62B 1WDTA 3Q8XB 1ANKA 2QAGB 3PXGA 2P6RA 1Q0UA 4V03A 3UG7A 2IT1A 2F9MA 4V0ME 3RRNA 3W90A 4OJQA 3THYA 2JDID 2WSSA 1P3JA 4M2LA 3QY0A 2IUUA 2QA5A 4JLKA 3E70C 3GLGE 2ZJZA 4A92A 3OF5A 1YR9A 5KUTA 2AHOA 2IS4A 4DB4A 2NMVA 2BVNA 3BJIC 3I72A 5SZHB 2UZIR 1R8QA 2ZYUX 3PQCA 4JLPA 3WNDA 3VNUA 3VHXA 3SU8A 5C4MA 2QE7A 5FOWA 2QZ4A 1PZNA 3WYFA 4C0BA 5EZ6B 1II0A 1NVVQ 1ZNZA 1XD2B 2QTFA 1E2GA 1E98A 4RCZA 2H57A 4YXWD 2Z6VA 3GLHB 3DM9B 2EW1A 5EXSA 2O0HA 4TLDA 2XX3A 3T61A 2RHMA 4PHFA 2V1XA 3R8FA 1KHTA 2JJ8A 5FBWB 3TVTA 1JPJA 1NLYA 1ZNYA 2BCGY 4PAMA 3ADKA 1JB1A 1F60A 2PL3A 3B1XA 4PC1A 3HPRA 1E2MA 2C95A 3AVPA 2Z4SA 3AKCA 4X8LA 4PR0A 5E7MA 2V54A 3TSOA 3IHWA 1I2DA 3AVOA 5DSZA 4TLAA 4DVGA 5A4JA 1KNXA 1KI6A 1RZ3A 3U4QA 2GCOA 5G3YA 3FTQA 1KO1A 2ZU6A 5BN5A 3M6AA 1KDRA 2FF7A 4LWZA 4Z8XA 2ZRKA 4MGIR 3FDIA 3SNHA 3I5XA 1PVOA 4BLTA 4PAQA 1UKZA 4IJMA 2AWOA 1HE8B 2KSQA 4L16A 1US8B 4JLNA 4CF7A 1W48A 1X8JA 3FB4A 1I4LD 4ZDJA 2J0UB 2ZEJA 3WP1B 3A1UA 2DYKA 3THXB 1XTSA 3ZVLA 2QPOA 5TV2A 1QBKC 2KBEA 2GJ9A 2B92A 2DR3A 1XFAA 2BM1A 2RGAA 1YZNA 1ZUHA 5B58C 2A5FA 3R20A 4PAOA 2JJ1A 4KFUA 1VHLA 2NO6A 1JECA 2IUTA 3IIKA 1AM4D 4Q1EA 2OFOA 2GK6A 2ZJYA 2ZRIA 2JIZA 4WXRA 3E2IA 4NYIR 2B7CA 3LW7A 1IY2A 5AK0A 5A5GA 1CU1A 2ZTSA 4Q18A 3EPKA 5FBRB 1KKMA 3B1YA 4MRRA 4LJ4A 3LQQA 3EZFA 2VHQA 1ZP6A 2QGZA 3R7WB 2QGNA 4QOSA 4HAZA 4JJZA 3TVDA 3PUVA 2J7PA 4M1WA 2FPKA 2O0KA 1WXQA 4NONA 2OXCA 3NBYC 4M0LA 2CLSA 1SKYB 3IPXA 4EAQA 4KSBA 2FPMA 4B47A 3TAUA 4RZ2A 1GL6A 1AKYA 2XJ4A 3I3SR 5DGXA 3GLGA 1BYIA 1N0VC 2IBMA 2XZLA 5TARA 1JNYA 4UXHA 1W47A 4U00A 1VCMA 1P9WA 1W2GA 5FPHA 5C4GB 3U7EB 1OF1A 3FFBA 4F93B 5SZJA 3TBKA 4QGHA 1E2IA 1DG3A 2C2HA 4BFXA 4XWAA 1Z0IA 1NVVR 3H84A 2ZSDA 4A9AA 4AKEA 2XB2A 2JLSA 1XRJA 2KBFA 2QU8A 5CYPA 4AWXA 3LV8A 3Q85A 5FUVA 2OBLA 3KTAB 3BFVA 4ARZB 2K5UA 2YNMA 4ILEA 1YRAA 4MGKR 4EIWA 4BZQA 2B7BA 2GA8A 1FOEB 2O8CB 4DSOA 5AJZA 4IRUB 2RGXA 3LQRA 4JVMA 3F8TA 2ZJ2A 5GJWC 3G0HA 3RLFA 4IXMA 3GLHE 2IS1A 5AUNB 1TX4B 4I1VA 2NGRA 4AYWA 3O8BA 2G1KA 2ZUBA 2GEUA 1TMKA 3QXXA 3A6PC 4LJ9A 1RKBA 4KJZA 2AXPA 4FI3C 1PLKA 1CKEA 1WMSA 4RD2A 1P5ZB 3CX6A 4R71A 4ON9A 2ZRHA 4LYAA 2PMKA 3CNOA 4D26A 2CL6X 2RGEA 3WYGA 5JS7A 1IQPA 2XOKA 2W2VA 1TUEA 2E87A 3MRSA 3OFNA 4QGAA 4LBVA 2NIPA 2HF8A 3CH4B 2F55A 3QXJA
chains in the Genus database with same CATH superfamily
1X9GA 5E3CA 3D6TB 3PFGA 4WIAA 2FPSA 3PQ6A 3RYTC 1CF9A 4WBXC 5K3CA 1IU9A 4FHCA 4C01A 4ZI7B 4YT2A 1DC8A 2OBBA 1SWWA 4XVHA 3AVWA 2VDLB 3EZ7A 2ZJ4A 5AK4A 3CSUA 3IDFA 4BFVA 4LDPA 4F12A 2PRSA 1C0PA 3WO1A 4TTAA 3IOMA 5DX8A 5FTJA 1KZYC 1J0DA 1O54A 1YS4A 2A5LA 4ZVLA 1A9SA 3QBJA 4AKIA 5BOVA 3GJ5A 3H05A 3QJ5A 5BSKA 4UM9B 1E89A 3O91A 3CH5A 2P7IA 1Z8HA 1DQSA 4ZKDA 1XMQB 1X2EA 2ZITA 1Z7Qc 1F12A 2QYOA 1T0IA 3HB5X 5IN5A 1Q11A 2H16A 2I3ZA 2ZLBA 3IEIA 4OA5A 3UWKA 3RGWS 4HXYA 3FCYA 1N77A 3RIHA 3RRFA 2BFEB 4MW3A 1H3EA 4ZT7A 1C4XA 2FN4A 3GDFA 5K3BA 4BO4A 2HCTA 4OFWA 3ZJYA 4B3CA 4M36A 4RSGA 4FR2A 1B43A 1N5RA 3F74A 1QS0B 4HLNA 1FVFA 1PTKA 3HUEA 1FP6A 1HRKA 4ZA2A 2XSEA 2CUKA 4NYIQ 2ZXRA 1IZ0A 1YR3A 4HBZA 4EB6A 1FUIA 2AC2A 3MFYA 4V1CB 1QG6A 2GA0A 3V4VB 1IK4A 1M6NA 1TKRA 1D2HA 1T8YA 4LCJA 3KYCB 3I9V6 1T2VA 4ENVA 5F7OA 3PXAA 4P4SB 5KYNA 3QPAA 3CW2A 4GWKA 4HY3A 5KTNA 1DINA 1G2IA 5GZ6A 4BMPB 3AFMA 4IGFA 1NW6A 3ET5A 5LOVF 2EIHA 1F9EA 1WCWA 4WZAA 1L4BA 3AHFA 3D7SA 3VBEA 3QFSA 3RS9A 2HTEA 5CHYA 1R0ZA 1RFLA 2VNHA 4OINF 2NZWA 4HDMA 2B6NA 4BCCA 4D6XA 4DMUB 4EGSA 3FKSD 2IA5A 2PZBA 4YX9A 4M3NA 4QECA 1O1YA 1AOXA 3UAGA 1NSYA 4A10A 1M1YA 2SKCA 3ZLTA 1ZOLA 4Q9IA 3VO8A 1W8IA 4D7AA 3UWDA 3GEBA 3TOLA 1BKDR 3W6PA 3QMKA 1DV2A 4L8GA 1GDTA 2ZETA 1D2AA 5CJ2A 5HSGA 1X7WA 3DOUA 2IITA 3LUBA 4HO1X 4NARA 2M6LA 4Q3OA 1YULA 3FR7A 1KMQA 2BR4A 3KUCA 3WIVA 4ZIRA 2QLAA 1V5IA 2H63A 5IC5A 1G8SA 4BMYA 4EUNA 3HBMA 1TQDA 2PX0A 4A4AA 3KFLA 3ETHA 4J1NA 5DI3B 2WWWA 1YJBA 5ESRA 1Z73A 2YIMA 3HYTA 2FZLA 2BSXA 1HWYA 3H2JA 3NAGA 1I14A 3PWSA 1LSSA 4UNQA 2BEVA 5BV2P 1B0ZA 4MWGA 3FVTA 1X94A 2NZJA 2Y6UA 2PSJA 4I9FA 3SEFA 3ZZTA 2ZKLA 1OMOA 4B4UA 1SXJD 2MSEB 2ZJ7A 3H8JA 2JIRA 4I1OB 4RPKA 3ICWA 3LIIA 4FEAA 1IOZA 3OZ7A 1NUQA 1H8HD 5IT4A 2ZJ1A 3QWIA 1U7UA 4HDKB 4BKUA 2AKEA 4B44A 4DUGA 3WRXC 3JZAA 4FGUA 4IKOA 5E0KB 1ISPA 4GVPA 3LO5A 1ZI8A 1MAAA 2PT5A 3UW3A 5JTUA 5C80A 5AVUA 1YA6A 2R7WA 5HWSA 2BBOA 1VYVA 1E7WA 2H5IA 2MHCA 2CNKA 2G9VA 1BXGB 3FSRA 1Y33E 2C7GA 4BNDA 1W44A 2HB6A 3N2KB 1P7CA 4HEQA 4JKIA 2ZRDA 4QARA 5CDFA 2A9PA 4XDGA 4ZT2A 3U3ZA 1JSLA 2QXTA 2R6ZA 3VR2A 3W05A 5BNWA 1SJ9A 1DC3A 5ITVA 2Q1UA 2VQEB 2EBHX 4RVCA 2PL5A 3AH8A 1JIJA 3JQGA 5E9WA 2GPSA 2JFZA 3A6HA 4C0JA 4MWDA 4C0KA 1AY0A 2W8ZA 5TX7A 1RHQA 3BRSA 4TYPA 2IHNA 3T7JA 4INZA 4OO3A 5A71A 1E5DA 1W5BA 4BX3A 3I04A 4U9DA 3RU7A 2XDWA 1AHNA 3LEOA 1PK8A 2HXSA 3AETB 4RPCA 3UCXA 5KSOA 1SR2A 3H3JA 2IY9A 4RFVA 2IF2A 4LHXA 1W36B 3B85A 3OIVA 1JEDA 3CMCO 3LYUA 4I9GA 4X92A 3AF4A 3JAKA 4PYKA 4RD6A 5JZ9A 1RRCA 2XRFA 2HU5A 1G20E 1XZFA 1GWNA 2IYTA 3L07A 4B3HA 5JATA 4CXMA 4ZCIA 4G0OA 2CXXA 2WQZA 2RJNA 2NTNA 3AUSA 5M29A 3QKTA 1YL5A 4FNGA 3JATA 3IKLA 5CH8A 2Y71A 1TO1E 4N6OA 1X7XA 1L3PA 1V9LA 2W48A 4JMLA 4EPWA 4BNUA 2EFDB 1ZGAA 2R87A 2QBYA 2EXXA 5E4TA 2IXTA 1X39A 3AIKA 5G40A 3K9QO 3EVCA 3VSAA 4L8WB 5KDLA 3DV2A 1COZA 3L7AA 1U9IA 4BB5A 1F51E 2P0AA 1JG2A 1U3CA 4M54A 3V1MA 2PZGA 2QHXA 2FN8A 1U3VA 1WOLA 3X2FA 4X64B 4C4YA 1TVMA 3PGLA 4PPQA 7GPBA 3SF0A 4GIBA 4P0PB 3DTVB 3N8KA 2W2NA 3AY6A 2I6XA 1U7DA 3IULA 1DP4A 5BQFA 2OR3A 3ZBTA 3QLEA 1K1EA 3D31A 4KO1S 4O6MA 1R8SA 4QPCA 2IHTA 1G8AA 1ZI9A 1E6EA 3CF2A 2I2XB 1JR6A 3B82A 4E2YA 2R65A 4M87A 4L85A 1UEIA 2XSZD 2OGUA 1GGQA 2IODA 3I64A 4LCEA 5EG5A 1DKOA 1R3DA 1X0VA 2OVFA 4P4LA 3SZMA 4YV1A 4WRRA 3RRJA 3ZGZA 4R8RA 3VNVA 4K8RB 4NCKA 1AQ6A 3GY0A 4BLOA 3PRHA 2I6FA 4NV0A 2ZQZA 4E88A 4Z9FA 4ZLDA 2ZAMA 3QVKA 3V2GA 3ZGVA 4DIUA 3BSWA 3RF7A 5JW6A 3E9MA 1EJ0A 1OGIA 3WODF 3ECCA 2FU5C 4ZAXA 1H2HA 2FFRA 1ZKMA 3BB1A 3DZHA 4ALKA 5I7EA 3U2MA 3R3VA 3AYXB 3O0TA 5IWCA 4RC9A 2OZKA 4FHGA 5FTWA 5C37A 1PGNA 1YVDA 4CFSA 1NTRA 3DH0A 2OM2A 2VR1A 3RQSA 1CR0A 2J3IA 3ZDLA 3WB9A 3PWKA 4BKPA 1OYWA 2GPNA 4RKRA 3L7YA 3PXUA 4FN5A 4WDRA 1MQVA 4C3VA 4JEHA 3TAHA 1D8TA 1J9ZA 2H2GA 4XYBA 3TGPA 5A9SA 3WAGA 3HNRA 3M1IA 4IYJA 3UKDA 1S05A 1KGDA 1YS7A 5JBQA 3G68A 2VF8A 3UFXB 1VJTA 4BRUA 2H1RA 1CF2O 1EE1A 4ZVRA 1XHLA 4RMNA 3U7GA 4YL0A 1L5QA 2F3PA 2FSVA 3CISA 2WM9B 3FNQA 2IH4A 1GNLA 5JEEA 5DHUA 4I66A 3VPAA 4E7SA 3VYVA 3US6A 5BVHA 2OZVA 2WFZA 3P8ZA 1TKCA 3M6LA 4IVRA 4DLXA 3RF3A 3KVNA 2HBRA 2GCEA 2JIDA 2QRUA 2VYFA 5A5FA 3CKLA 1DTWA 1OI2A 1WPXA 4QTUB 5JG7A 4MNTA 2QN8A 5JZVA 2AOUA 3GEDA 1QRRA 1W2WB 1DZ3A 2BGNA 4HYTA 4C6SA 5EL0A 1JA9A 3JQAA 1OXUA 5BNIA 3Q72A 2Q5OA 3ZJUA 1D2GA 2YVAA 1AUOA 1RJGA 5J47A 3ZHZA 3PP8A 4ITUA 1RI2A 2VDPB 5JR3A 1CY7A 1M83A 4N5DA 1K0UA 3QYPA 2JH8A 3BSFA 4ROSA 2AOUB 1C7RA 1JXMA 1XMSA 5JSLA 1GL9B 4RFSA 3NC4A 1ZW3A 4XQEA 1PJBA 1GQFA 3KEGA 1FTYA 4RLQA 1ULZA 2WU0A 3TM4A 5D00A 3Q3EA 2WVNA 2I2DA 3SX2A 3DB1A 1GILA 3G5UA 4AD8A 2QBYB 5LYJA 4Z53A 1OXBB 2H65A 3W8EA 5CDHA 3W04A 2W6QA 2ODPA 3F71A 4GP9A 4LYJA 1FUUA 1PWEA 1UPXA 2IXEA 1M8JA 1QFSA 3C62A 3IB3A 3KOYA 3KWJA 1ZIOA 2HN9A 3PLAE 3UCFA 2WUVA 3KS9A 1HG1A 1PVDA 4WXPA 4PX2A 4CLEA 4LTDA 1FMVA 5K20A 2VJNA 4FYIA 2C4HA 4G81A 3A2LA 3RRXA 2WVOA 1LX6A 3I45A 2GF0A 3E4DA 1DL5A 3KV3O 2VJMA 4HWGA 4QRDA 2CB9A 4RPIA 1TW2A 2ZSKA 4EGCB 2UUIA 2BM8A 4EW1A 2BKLA 4NE2A 3WMEA 2B4QA 5HQJA 3TMYA 5BRJA 1H5UA 1T26A 4O2AF 1PEKE 3JQCA 3NW9A 4F91B 1DAGA 4MTCA 4ZEXA 3K1IA 4G4SO 3WGHA 4LF8B 1SRQA 1IOWA 3MX3A 2G06A 1KAMA 3B7WA 1G1AA 3H9EO 4Q93A 5FHRA 4C04A 3STYA 4GLOA 1YTUA 1N32B 4ZYVA 2B83A 3WLMA 1PSWA 4EF4A 1GLNA 1LJ8A 1F0PA 1TM5E 1QV9A 1EG7A 2G3KA 1HDIA 3INGA 4TV8F 2OJQA 1B2RA 3IP6A 4NZPA 3DKKA 5JD3A 1V4VA 1NLFA 4D9GA 5CA1B 2GTIA 3N7AA 2ZYHA 1NNEA 3EDMA 1DIOB 4CFYA 3CKMA 4KXVA 2ZBQA 3BB3A 1QSPA 3RJTA 1U04A 4H3HB 5BORA 2WF6A 3PFNA 4UCQA 1VYIA 1P33A 3NWEA 2IYEA 1VTMP 3RYFB 4CI0B 2DZDA 1TWHA 2Y67A 4X6XA 4EARA 1HG0A 1XMOB 4BGUA 2ICWG 4Z7JA 4BFWA 3SP1A 1KDOA 1PU2A 2LSEA 1L4EA 3DDCA 5K0JA 3NC0C 2PXHA 4GE3A 4L15A 3TIXB 2FGYA 2UAGA 4IJQA 5FUMA 2QSZA 3D5QA 3DKVA 4Q4AA 3RYFA 4D4NA 1BX1A 4AZ0A 3FOOA 1MKYA 1PJCA 1WPQA 2XBUA 5KYYA 3K0AB 4U2FA 1DLIA 1QP8A 1Z7WA 2PEYA 3B36A 2IKSA 1QIJA 4QUJA 1A5TA 3O4IA 1YYJA 4EA6A 3DNFA 4RIHA 3H13A 3K1AB 3R4VA 4BAGA 3SXMA 4N3BA 3DPUA 3GLRA 2BFDB 3CRZA 1RXCA 4G5QA 4GPEA 4O4LB 4RNCA 1AURA 4DN6A 5KWIA 3MAAC 3IMFA 4QLOA 2J7PD 1SCAA 1FMJA 4UHEA 3OA0A 3U5TA 4PC2A 1GT6A 1N5MA 1X87A 3D4LA 2HM7A 3GLQA 4RS4A 5ALNA 3RS7A 3TJZA 4EYSA 3GYGA 2N47A 4Q3LA 4XEVA 1U81A 3EZNA 1GUYA 1QHSA 2WTBA 3LRTA 3AZQA 4YFYA 3S68A 2WILA 4GYTA 4MVJA 4RSHA 3FTCA 3O4JA 2DWQA 3GFVA 3ZQVA 1LI4A 1V8ZA 1W4RA 1WAMA 4D9JA 2P7HA 3NIGB 4F6CA 5MGBA 2X4DA 4S1PA 1R5NA 4ZQCB 4G0YA 3TB6A 3WOHA 1RSZA 3HGQA 4DRJB 1VG0B 2JD2A 2Z6UA 2OYRA 5JQGF 3UJ3X 3IIIA 2F1KA 3IJRA 3VU9A 2ST1A 1DU4A 2Z1MA 3Q7PA 2O05A 1UDRA 3FZNA 4EVIA 4GDFA 4LOIA 4OJKA 1P2TA 4EPTA 3QYFA 3MJCA 2AT1A 4MQFB 3R7NA 3KLMX 3AW8A 1VIDA 4I19A 2GN8A 3L77A 3M0EA 4D8TA 4E4TA 1RRPA 1HNWB 3PFFA 2IKQA 3GO4A 2B36A 1RMQA 4GGPA 1C7QA 5ESDA 4CV1A 3PDHA 5HKKA 2EOAA 2CL7X 2VXOA 1BROA 2OK7A 2BH2A 4HFNA 2ECPA 3F4KA 3M34A 1TKNA 1UJBA 1UOOA 4MHOA 1TCBA 3QELB 5DYYA 5JQGB 1XXHB 4RADA 1Z29A 5IZCC 3PEUA 3QSYA 4MW9A 3DMTC 4XEHA 5JRDS 3E1KA 3M6XA 5T8KC 3GLVA 3AILA 3ITDA 3RYIA 3UR3C 1IK6A 1VIMA 1Y3FE 3F5QA 1S7GA 4MQLA 1RKCA 4JJGA 2QG6A 4MV4A 5FXMA 2MR6A 4JRZA 3LK6A 2HHCA 3VZSA 4KODA 1E99A 4RMJA 5JPCA 2GXAA 1RJ9A 2QTVB 3HXQA 3RSOA 3A1EA 3B48A 2K2WA 4OBXA 1A98A 1JHZA 1YSCA 3GGJA 3UKOA 2ZJ6A 4G86A 3SDZA 1DO0A 1ESCA 5JAHA 5MFPA 3F9CA 2ENWA 3G13A 1XA4A 2IHYA 1JJFA 1OX4A 4HH3C 2NOAA 1H5NA 3NDPA 3V7OA 1ZCBA 3NHUA 3W2IA 3OT1A 4W8PA 2W6JD 3ZLUA 1LDNA 4TV9F 2ZP1A 1O97C 1DGQA 3P97A 3CVVA 4TQUS 5FLXA 2RFLA 4MQ9F 2ZUFA 1QZTA 1H4SA 4G1BA 1AD2A 2G8LA 4Q4JB 3O3NB 4XQGA 4QXPA 1YE8A 2FQYA 4C0BA 1SUSA 1I7NA 1QF7A 2HSEA 4XJSA 3W78A 3EMDA 3A28A 4U3JA 1MVLA 1O7JA 2Q3MA 4G07A 2I4TA 1Y48E 4E30A 4EHIA 2KJGA 1EBBA 2OK8A 4NESA 4TT3A 4QKQA 1SKMA 2YCBA 4KVAA 1NYQA 2PN1A 1W88A 5IASA 4HAUA 2GVNA 4PG7A 2L6HA 5I9BA 5KYYB 3U3KA 3VDNB 5G0WA 1YQDA 1Z2AA 2IUSA 1NWCA 2WJJA 1N78A 1F6WA 2C61A 4UAVA 1CUGA 4QGSA 1R2QA 3O73A 4B3SB 3DXYA 5EEHA 1QX3A 4D9HA 1GN9A 3ANSA 2JGMA 4FN4A 3SR0A 5C52B 1XE3A 4JSTA 5LD2B 3GUYA 1M1XB 2XB9A 3MRVA 4K05A 1TO2E 2PUJA 3PPXA 4MOWA 3QVYA 1O5TA 3HKCA 3QY9A 1ZH2A 1LDYA 3MLGA 2FAXA 3Q6IA 4CG3A 1AN0A 5CCEA 3G5TA 3PVCA 3V7NA 2Q4BA 2XUDA 3KZVA 3EDCA 4ZVKA 2VK4A 2QD2A 1UK7A 2G09A 3KAPA 2WMOB 3SHWA 2D1RA 4Q7LA 1V5GA 2YW9A 3R3JA 5DNWA 2F1JA 4FJ0A 4LJRA 4WECA 4MWZA 4YQEA 5GONA 1P5HA 4RHYA 1L5GB 1XNQB 1JMVA 1BOFA 1I8TA 2R86A 4IHJF 4K2HA 2Y1CA 3BMQB 4JKYA 4UNIA 2CN1A 1G6Q1 4Y3UA 3O4HA 4YFVA 4N48A 3H2IA 1CS0B 1UM8A 4WZAB 4U0KA 1G3RA 2GJ4A 1NBHA 1KEVA 4MK4A 3A4NA 4NYJR 4R41A 1NSGB 1ONPA 3ZQJA 1IUPA 1J56A 4HQNA 3SHOA 3U3DA 1ZL2A 2BI8A 3H5WA 3OWHA 3IL2A 2DE0X 2IC5A 2IZ7A 1X9IA 3TRIA 3LBHA 3JQFC 2IOFA 1CVRA 3FDJA 1HFJA 1ZC4A 4ZMRA 2ODTX 4HAIA 2C3YA 5IJXA 4O4JB 3EG5A 4O6NA 2F00A 1LK7A 4FS3A 3WGGA 3Q2OA 4RKEA 1DX9A 1ZCFA 2VAMA 4EY5A 1RM0A 1Z6YA 2GRAA 3ME5A 4QO8A 5E9AA 4BLUA 1BE0A 5CB8A 5M04A 2E48A 4F9TA 2XZDA 1Z23A 1JRAA 1X3SA 4XGQA 1D5CA 1OYVA 5KNCA 1OFHA 4NG5A 3JV7A 2REXB 4XQ1A 2EZTA 1KC1A 5IEJA 3DEIA 1MMAA 1HT1E 1NHWA 2DYRC 1RE1A 2MSNA 1GAQA 1NW9B 2TMKA 3I76A 3EMBA 3O74A 3OTHA 2Q1TA 4I1OA 4LXXA 5C18A 4JD5A 4YCBA 5SV2A 2ID8A 1GKUB 1TMYA 1K8XB 1Z2DA 1T24A 2OHFA 2IIVA 3G2HA 3NALA 2YN4A 1YARO 1GFWA 3A4YA 2CF5A 3EGCA 2HMZA 3KKMA 4R8SA 3NP7A 3HB4X 3FFAA 3BZUA 2O2SA 5JFTA 2CNWA 3M2TA 4MV6A 2XUPA 4LMAA 4TYMA 1ETHA 5AM0A 5K0LA 1BXGA 2Q45A 2CWWA 3IUJA 4X0EA 1T2EA 1VKOA 3BFKA 3FOAA 3I12A 4NDZA 4UW9A 3PEVA 4FEGA 5AIBA 2GWRA 1NKSA 2LCQA 2W22A 3I2KA 4FKBA 4I4TF 3VKGA 4GLFA 4CKBA 3Q9NA 2ID4A 2E4AA 3SWWA 1TF7A 1F8GA 2ZB8A 2IW3A 4KIWA 3SLRA 4FESA 2ZCJA 2SBTA 3UJ8A 4CMIA 5DYTA 2JLQA 4AIIA 4ND8B 1JQDA 2P65A 3LY5A 3NV7A 1YKFA 1YJXA 2Q3JA 3GZJA 3PVSA 3QWAA 4L6IA 5JNRA 2QQFA 5C31A 4EG6A 2JIZD 1I30A 2R5NA 3ZTTA 4NFYA 3LVRE 4PFPA 3OZIA 5FNZA 1D7OA 2XOEA 3RC8A 4NWIA 2ORWA 2VQSA 3UZUA 1FFHA 1N5OX 1PG5A 2QX4A 4NKRA 3IUPA 1KP9A 5LL6P 2JPUA 3DEFA 4LE0A 1CNEA 1N2CA 1UIRA 3DLTA 4QNNA 4XE5A 1YHZA 4W5OA 1NUUA 2YXDA 4CNBA 4CCAA 4G8BA 2GBIA 3KQSA 4QTZA 3HJRA 2ASEA 4FWIB 1LI5A 1M1NA 1CRQA 1F20A 1OQAA 3PD7A 3PGVA 2W2MA 4PNZA 4URWR 3RIEA 3VR1A 2R7VA 2CDNA 1NM5A 2BFEA 5FV4A 2C9BA 3UH0A 2ONZA 2ET6A 3HWRA 3OEEA 1R9GA 4TMYA 2PKXA 1U5BA 2CLMB 4HF7A 3ROXA 1QS0A 4AWAA 3AOUA 5KYXA 2JD1A 4G41A 5BV1A 4J07A 2PKEA 2CBGA 3JZMA 3SK0A 3U4CA 1G6HA 1P2FA 4FDVA 4DIMA 5KWVA 5IM4F 1T8TA 2HD4A 5E1BA 2PAFA 4OHOA 4AO8A 1NN5A 4HDOB 2QLFA 2C92A 2VKQA 3CV3A 4OSEA 5LA6F 4ZVPA 4DYDA 5ER6A 2QNLA 4RW0A 4TVSA 4YAKA 4DMHA 4MPTA 1C9MA 2HQBA 3KXDA 3SEZA 5TQ0A 3AB7A 4IHJB 3THWB 3HA7A 3HPQA 2O2GA 3OZWA 3DEAA 4XWGA 2G9NA 1RQNA 4HCJA 4Q3KA 3B20A 3FPSA 2BY4A 1GNQA 1SXJA 3MRTA 4DJAA 5JD5A 4KV9A 4EHHA 2COUA 3ER6A 1VJ5A 3TR5A 4A2WA 2BFWA 3TMAA 5ALWA 1HDXA 3N3BC 3PQFA 1S9DA 5T6MA 1IH8A 1FU8A 3T35A 4K6MA 1RYDA 5J43A 4KWTA 3WWYA 4EW3A 1FTQA 2J0EA 5EIWA 1VYUA 1MO5A 3N8DA 5TMPA 3COJA 4L5JA 4AAYA 3BE6A 3JALA 2AKAB 2G3YA 3JS5A 4EEXA 2J3KA 2DYSC 3V48A 5CFPA 3MHPA 1UL1X 4OMCA 4MW0A 1T29A 1T9GS 3P0HA 5EQJB 3J81A 2O8VA 3PKIA 3B60A 4Q9JA 2QUAA 3WNZA 1CY1A 1CJUC 1DOVA 1Z2NX 4ZQBA 5A6SB 3B3GA 3JALB 4Y0AA 3TXYA 3GHHA 3QXSA 4US2R 5DRYA 4RA9A 4PM4A 3Q40A 5IKPA 2W6IA 4TRNA 1EDZA 3N2IA 3SLGA 4LGCA 4JYAB 2GN6A 2WWIA 1P1KA 3L6CA 3NBFA 4XGNA 3D6FA 5CH3A 2GEKA 3V32A 1CERA 1AS0A 1GPBA 1O6CA 2YN0A 2XL4A 2ADMA 3K96A 4DCPA 2C3UA 1JHYA 1W30A 5K6TA 5TEWA 1C4KA 4RABA 2BTEA 3ICQB 4Q4CA 1CVLA 1UPBA 4BMNA 2HREA 2I6GA 2CY0A 2PX6A 3AR4A 1ZAKA 3F4LA 4RF4A 3K1JA 3TZQA 5A4FS 4EFMA 4JLUA 4R9SA 4L5IA 3VR0A 2GAFA 3WL3A 2B99A 2HKIA 3L6RA 4BQRA 4KR3A 3SAJA 1KDYA 1A76A 2PIDA 3TMKA 1Z0DA 5I9SA 2XV1A 2VJCA 4ENWA 2FQQA 4X00A 1RQRA 3LPCA 3WYFA 4C1BA 1TEZA 5BQGA 3RS0A 4BFZA 1J97A 1MDFA 1P3Y1 3KQYA 3LLMA 3C1OA 3ZWKA 3KKQA 4MJLA 1RHMA 3F97A 3L0BA 4OJYA 4DG9A 2J85A 4YUWA 3DEHA 2XCTB 3W3AH 4EVQA 1BVHA 5F4ZA 1H66A 1U0FA 3HBFA 2RI0A 4O4HF 4TLBA 4FZ5A 4D9EA 4QM6A 5SY6A 1E6MA 1VQ1A 2NUPB 1VL8A 3TOVA 3HMQA 1NXTA 4MAMA 5IUNC 5KTOA 3GV0A 1M5RA 2B2XA 2WL8A 2Y05A 5DHPA 3KX2A 4UFOA 3SKVA 4HDKA 2CUNA 1U5AA 4P3KA 5DM1A 3EMKA 3LKDA 3L1MA 4BG0A 4II7A 3UXEA 4QASA 1Y4DE 3E7WA 4X5OA 2J0XA 2NSFA 3C5HA 3QUQA 3MSXA 4EHDA 4I1IA 4QXMA 1E2DA 5EJFA 2AD5A 4GKVA 2RJ3A 4G5RA 3EE6A 3IODA 1E20A 4E5KA 4E51A 1J23A 1SPXA 1YXMA 4JU9A 1HTBA 2XTZA 2NUAA 3N8NA 2YYSA 5KSYA 3BWYA 3N0VA 4BMOB 3K4HA 2KMLA 3IIJA 1ORDA 1P7PA 5KSPA 2Z5FA 2V74B 3AQIA 3KWFA 4AO7A 4B7AA 3F8WA 3GJSA 4LRWA 2IWRA 3VO9A 4D9NA 1I5RA 1A7AA 3QXGA 4EO7A 1NNSA 3GA5A 5DMHA 5FJIA 4OB8A 1RPZA 3TX6A 4FB4A 4DR4B 4FC6A 3QE9Y 4ZVSA 3BA1A 1YBMA 4DDMA 3HY3A 2V9ZA 3JD2A 2Y0DA 4F85A 4I4NA 4EWLA 1ULBA 3U16A 5JNUA 1R0BA 4ZOAA 4TQAA 2D00A 1KZGB 2J3QA 3DF9A 4BJ6A 1Z4LA 3AHCA 1TQ6A 3U0VA 4PR3A 2OQ2A 2OMKA 5LB4A 1TT7A 3UJPA 5K8VA 1OREA 1FDRA 5COAA 4AJ9A 1KRWA 4BLVA 3C5WP 4O7GA 1P2SA 3GODA 1Q0QA 3AFOA 2QLLA 1LRJA 3LKZA 3R2JA 4WZ6A 2WTMA 2W0SA 5EGNA 2FUG6 1CVIA 3PHJA 4WCFA 5JVDA 1VMDA 3CR7A 3JT1A 2FPGA 4MW8A 2HDHA 3MN1A 4G1VA 4ZFNA 4V0LA 1PVVA 3DPIA 2D0IA 3QFRA 2JEZA 1BXKA 4YR7A 1QLEC 1YDWA 2BEJA 2AGVA 4U5QA 4IBOA 3R9WA 2PFKA 1CUZA 1Q91A 4MKRA 2QT0A 1A95A 1OY1A 1ZD1A 2VWPA 4QHTA 3W2FA 4BYMA 4D0RA 3SF8B 1JBEA 1L5KA 4Z54A 3RAGA 4ARZA 4UMEA 5JRZA 2BFPA 4R4JA 2RHGB 4TS3A 1PO7A 3RKSA 3QHPA 5DTQA 3W5JA 5HTOA 1ZSNA 3DHEA 3SZRA 1DEOA 4XYEA 4F11A 5JYDA 1FEZA 4BQIA 4AS3A 3WV4A 1AXEA 3VOSA 2JVIA 1P39A 1OR2A 4CR7A 1ACLA 3DTVA 3FFXA 4NBLA 2JFQA 2ZM5A 1FLAA 4KUHA 2R62A 3DV0B 3FPJA 3I9JA 1QIDA 3OKAA 5KYWA 4BMDA 1ZJ6A 2XB6A 2GERA 2J6BA 2YFHA 2P6MA 2VKTA 1ESZA 2B0HA 3IPMO 2WPNA 1R0LA 3PDJA 1N0UA 3JD4A 4B76A 4EX7A 2BP7A 3TE7A 3FTEA 3GG9A 5GJBA 2ATCA 4KXFB 2LVBA 3HR8A 4UEKA 4CM9D 4DIDA 3UFXA 2GEFA 5HILA 4DRIB 1LTHR 2PIAA 1QO7A 2XADA 3BHIA 4JTDB 1KYVA 4MVJP 4ONEA 4OP3A 3T0GA 4DZZA 1YF3A 2X9VA 1WCIA 2WUWE 2XNDA 2YV4A 3D3QA 2QLJA 1VYKA 4V2UA 1P9OA 1VPLA 3BWCA 5H5JA 4BO3A 3EQ6A 1E0SA 1T35A 2QQGA 4YRRA 2NZ2A 5EP3A 3ILYA 1JLKA 3PSAA 2J3HA 2PY6A 3AHDA 1Q7GA 3FPKA 4ERNA 2WD7B 4HN9A 2LCHA 2XGMA 5GV7A 1R9NA 4PYIA 1WXHA 1EFUA 3QF4B 3RG8A 5C8VA 3D3NA 2PWPA 2DRIA 1ODLA 2Z98A 3EZGA 3PC7A 2HO5A 4JIGA 3QUTA 3UK6A 2A2ZA 2C2GA 2QS9A 2R1UA 2W2PA 1OXKA 4Y0VA 1PYGA 3V2IA 1GTMA 2HKVA 1P1CA 1OZGA 3I09A 3IAUA 2P9JA 3TR6A 4B7XA 4ZDIA 4NLLA 3TQFA 4PIVA 3SX0A 3JQPA 1JT9A 5IH3A 2QRJA 4NCXA 4ANJA 1O08A 2GBLC 2WW8A 1HPLA 4N3GA 2JEYA 4EPRA 1W36C 7YASA 3KE9A 4TWZA 2V7XA 4B43A 2FE1A 4BO7A 4O4JF 2WZCA 4XYMA 2VT6A 3HXPA 3QMMA 1M2OB 3UGTA 3U3JA 2ZI3A 4R01A 2WZBA 1D1BA 4IARA 2TSYB 3HB1A 5ED4A 1SU4A 3W1EA 3P0IA 3JRNA 5HYVA 2IX3A 4XIIA 3U7HB 3R0VA 3CIFA 1WXXA 2VRCD 4IJWA 1NWHA 4J0IA 1E3DA 1MO2A 2XLBA 5A6BD 4G9EA 4UJ5A 1QDUA 2DWPA 2X0EA 1NU7D 4GZLA 1OLSA 2PGIA 3CE9A 1SKUA 3MIZA 2C58A 1DI0A 3JWPA 2IU6A 5IHPA 2QP4A 1D1AA 1Q0LA 4GWGA 2HIMA 4UMFA 3QKSA 5ALFA 1P0MA 4AXBA 5C8ZA 4X66B 4MDEA 5KAMA 2W9YA 1O3YA 1XROA 2B2NA 1II8B 1TK9A 4K8OA 4KWCA 1QH8A 4R6XA 3NYWA 3ND5A 4OM7A 3EZIA 2R751 3SKYA 3RTAA 3S2IA 1LQ2A 3GCXA 2WJ3A 3T1TA 2VDNB 1KK3A 4Q1AA 1GU0A 1B6TA 1IL0A 5EHHA 1XI2A 1GM5A 4U5GA 2F3QA 2QMZA 3GAFA 5LYJB 1C8LA 1N3BA 1CIJA 1ZA2A 1BO6A 3RE1A 1J25A 3T7SA 4AX8A 5HS6A 1W0CA 4IVQA 1G20A 2ZSFA 1GZDA 3DMTA 1UBJS 4DBLC 3M4YA 4XLPF 1NPDA 1H1DA 3BIFA 5B3JC 3G7SA 1XOIA 1LBQA 1SUIA 5DK6A 1ZYRF 4BLQA 5GIPE 1WB6A 1FFTC 1ZHTA 1YQ9A 1NZEA 1TDJA 2ZJ0A 3NMIA 1GG2A 5CYOA 1MOSA 4M7RA 2X6QA 3OOWA 1SBTA 4IUYA 4QRHA 4WKOA 4LBWA 4E13A 3M4CA 1GVHA 4URZR 4CEHB 1XWFA 3S2SA 4EMBA 8OHMA 4UNRA 4KREA 1AQLA 5GVSA 2A86A 3GJTA 4AUNA 2PUAA 4JQZA 2BCEA 1EK1A 1BRTA 2RHLA 4LMBA 2O1WA 3HKCB 4YJKA 4LF6B 1ODFA 4XWWA 1XWWA 2VUHB 4PU0A 3M81A 3U37A 3ZBPA 4Z7OB 2N42A 1M7BA 1PK9A 3L8FA 3TSAA 3ZWMA 1VG1A 5JTTA 2BFDA 1GZSA 4OHVA 4PZUA 1NW3A 2MOKA 2IM8A 1E77A 2YZKA 3O75A 2P7VA 3L8EA 1RBQA 4DIKA 5ILOA 5KCMA 1G8JA 1O03A 1G5ZA 3RFFA 3D7KA 5AW4A 3DE1X 1YCFA 4BE7B 4H6VA 4CW7A 3E5HA 1MHPA 4DV4B 5LKAA 1NQ5A 4PVCA 2AEMA 2AFIE 1D9ZA 1Z83A 5JE8A 2HFKA 1NSFA 1Z28A 2CJYA 3DXFA 3IVGA 4IGIA 4N01A 4X1IA 2FPXA 2IDMA 3POVA 5ULLA 1BCRB 4KX5A 4NCNA 2NT3A 4IAOA 3WMFA 1I7PA 5K45A 4DYHA 4C1NA 2A78A 1ZH8A 3G9TA 4Y9SA 1LPSA 3WGQA 4FE7A 2BRUA 1HDZA 5HQ3B 5I7WA 3A4IA 3U40A 1YZQA 5J5VA 4FFNA 4R2IA 4AI6A 4RBNA 1H23A 2ZIGA 3Q7LA 2ZUSA 4IZHA 3G0GA 3UMJA 3KJHA 1AKNA 4QRIA 4V0NA 3UV6A 1NX6A 4P7KA 3RKOF 3QOXA 2PBEA 3NDBB 1Y8CA 4WJLA 4HNUA 5KAPA 1Y1RA 3T4EA 4X62B 1RLMA 1XTBA 2YUIA 3GJXC 3LC0A 3LLUA 5I8ZA 5K3AA 4Y1GA 3C5VA 4BWVA 1KY3A 1VXRA 3OF3A 3OLWA 3GLFE 3PT5A 5AQEA 3ZQUA 2YZMA 3MUOA 3ASZA 5CJJA 4R1UA 5CVUA 4ZRNA 4NS1A 4MB0A 4OMDA 4I7EA 1R5ID 4UTXA 4J76A 4RQAA 2H7CA 5JYEA 1DJMA 2YOHA 2JLXA 1TYCA 3OCCA 4DCTA 2FW0A 3VDRA 1GP2A 1XDBA 5I47A 4BPBA 2YMLA 2R8OA 4G09A 2DJIA 2VXYA 4KQIA 3CF4A 1TF2A 3QLJA 1M6TA 1RWXA 2P5YA 2CHUA 3DMHA 3SR3A 3IMKA 3DLPX 2O1EA 3VHXB 6GPBA 4EL0A 5IFLA 2G1PA 1B2LA 1TECE 2IYXA 4O6VA 1XTUA 1L7NA 1QQBA 3ZYCA 5CCBA 3HR4A 4C0HA 1WZIA 3PUYA 1E1QD 3M49A 1RMVA 1JPUA 2BKUA 4OK5A 5K3EA 3AUKA 3ULKA 2VQFB 5DBFA 9LDTA 3J80A 3RF6A 3AC0A 2QTRA 5T41A 4ATNA 3CJRA 2GMWA 2QIPA 2OCAA 4Y6QA 1N57A 2YIDA 3HCPA 4X9XA 4YRZA 1QHIA 3A4VA 3TRJA 2PSFA 4A15A 3QVZA 1PQPA 2O19A 1LM3B 3FI0A 1WP4A 1Z6ZA 2BI7A 5IJ9A 4S12A 3ZJTA 1W7AA 3GRYA 5P21A 3O95A 4PC6A 4WACA 4AJKA 1E6LA 2IOQA 5FI5A 5LKRA 3Q3GE 1XQXA 3HJBA 4AN1A 1AB6A 4OQXA 4K9KA 5JYCA 2E4WA 5AHKA 1TE2A 1U8CB 3LWBA 5DN6A 2GT1A 3TQHA 3C8GB 5B1SA 4JOSA 3CCBA 3S55A 1G2PA 4MKIA 2FW7A 1LPEA 4KXNA 2P5SA 4UPVA 2XB4A 2UYYA 5CK4A 1KU6A 2YV3A 1BJRE 3ZC3A 3PEYA 1Y89A 5K8TA 2GTHA 3B71A 4IWYA 1CD5A 1T0UA 2RB4A 1G4AE 1N2HA 1U02A 4M8NE 5E33A 2R60A 5K7SA 3OQNA 2Y39A 1E60A 5DF1A 3HUTA 3IE1A 1JX6A 2WTEA 4HVAA 2QTTA 4P0TA 1TWGA 1PT9A 3H17A 2LCFA 3TLBA 4BZWA 3AQCA 4QPNA 3MA0A 3VNQA 3MMZA 2FZEA 3ND8A 2IUEA 4A0GA 5JAIA 4Z0NA 3F6EX 2HXYA 5KDOA 3T7CA 1IY8A 1MD9A 3D6NB 3FRHA 1TYDE 3GNSA 2G9ZA 1Y6FA 3ZTMA 4R3WA 3DG9A 4KWIA 1UZAA 4M8KA 2CDQA 3CZAA 2QN6A 3PICA 3P4XA 5F2EA 3TI9A 3HHPA 3WL4A 1VE6A 1YMQA 4DRXA 1DRWA 1UMBB 4IRMA 1PFYA 1GKLA 1HGXA 1WBDA 5JH7B 3IALA 3NHAA 3AUFA