3DMDA

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
318
structure length
310
Chain Sequence
MFGKLREKLKSFVKRVEEEVEKEEEEVELTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Signal Recognition Particle Receptor from the Archaeon Pyrococcus furiosus: Implications for the Targeting Step at the Membrane.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transport protein
molecule keywords Signal recognition particle receptor
total genus 116
structure length 310
sequence length 318
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dmdA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dmdA02
1N6LA 1S0UA 3NBZC 2YJTD 1N0UA 5IK2A 4NL4H 2ANCA 4HI0E 3SFZA 2JIZD 1Q57A 4JL8A 5LD2B 3AF0A 5EP2A 2A2ZA 4PR0A 3MMPA 5M04A 1E1QA 5FPKA 2JASA 4HLQB 4P4SB 1N25A 2BM1A 2G0NA 1R10A 4II7A 3FKSA 2ZUDA 4FW9A 4DUGA 1TQ6A 4V02A 1ZU5A 1A5TA 3MJRA 3QXCA 1KSGA 3R20A 4OHVA 2EU8A 4NHOA 2ZR9A 3TAHA 1GOTA 1KJZA 3U44A 3WMEA 2VHQA 2GEDA 5FOSA 2CE2X 3LX8A 4ASUD 4BEJA 1NY6A 4PHFA 2GVZC 3E2IA 3AEZA 1QG2A 4RKEA 2J3EA 3ICEA 1J2JA 1FX0B 1NN5A 1SXJE 4W5JA 5FFMA 4ESVA 3THXB 2E1RA 5FUWA 2ZSAA 4UKDA 3GP8A 4MKGA 4RCZA 1I4TD 2DY1A 3K0FA 3EWSA 3LW8A 3BXZA 3OE7D 3THOA 4DLZA 4GDFA 2FG5A 2WIBA 2CK3A 4B48A 4V0MA 3QPUA 5DIFA 1FUKA 1H8ED 1T3SA 1SVIA 1FQKA 1KAGA 2X8AA 5FL7A 4YONB 1VMAA 1JJVA 4CEJB 3D3QA 5JEDA 2J0UA 1Q1ZA 3OIUA 4Z8YA 2WWXA 4IDPA 1S8FA 5B30A 5EP3A 3CX6A 4M9QA 3AV0B 3RHFA 2GJSA 4PAOA 2D06A 3TR0A 3RS0A 1NN0A 3LY5A 2FEOA 3GFPA 4JLJA 2PJRA 3TSOA 2V9PA 3WYAA 2V6IA 2HYDA 1A2KC 1O87A 3W3AA 3OZXA 5TVKA 4TYQA 3AVXA 4PC7A 2ODBA 5LBIA 2ZROA 3Q8XB 5KDOA 4A1FA 1EXMA 2V8OA 2ZRPA 2GCNA 3LLMA 1JJ7A 1UAAA 3B8HA 4HAXA 4PQRA 2IYSA 2YWEA 1G8GA 4RFSA 1AKYA 2QRZA 3FPAA 2FSGA 3LBHA 3LNCA 3GJ7A 1GDDA 5KUTA 4TYWA 1Z2CA 1MRSA 2WJJA 4JSTA 4MGIR 1VYTA 5FR2A 3KJGA 4DSOA 1EFUA 3MWJA 4IOKA 5FTKA 3W5IA 1G16A 5BN3A 2IYRA 4GZLA 3EC1A 3U44B 2CK3D 1SVLA 1YU9A 2I1QA 1G6HA 1CEEA 5LPNA 1CJTC 2X1VA 1XB2A 1IN8A 3BB1A 1KMHA 4DEXA 3U2QA 3KQLA 4X8MA 3UMRA 2ZJYA 1E9SA 5FR1A 1Z0KA 4QJ5A 1XZQA 3VNVA 2Q21A 4I99A 1SXJA 1NMXA 4GPTA 4IOLA 1DTSA 4NE2A 4TQUS 3VHXA 1G41A 2FGKA 1QHIA 5CK4A 3N70A 2IYYA 2ZI4A 1JNYA 4U7DA 3MSXA 3MWYW 2Q3MA 1FQJA 2QEQA 2W6JD 1J7KA 2QT1A 2CNWD 3K0AB 3QXJA 4V0OA 1YR6A 3OE7A 2Q9AA 2ZS9A 2CHVA 3MAAC 421PA 2R65A 3U6BA 2PEYA 5JEEA 4XSGA 3ZVRA 4CEHB 2JLQA 2WJVA 4RD0A 3U60B 1OLOA 2MSEB 1EESA 3MCAA 4NCKA 4EFNA 4DIDA 4ZCIA 4LRWA 4BPBA 1HT2E 2V54A 1M6NA 1XTKA 2QTVB 3PIRA 3U3RA 3TKLA 1EFCA 4BLTA 2QA5A 1W36D 5KNCA 5JWRA 3SI7A 2GRJA 3B1ZA 3FWYA 1K5GA 1UBFA 4NPHA 3ZQ6A 5L8VA 3GCGA 2ZRCA 1NG1A 2AWNA 2JLSA 1PJRA 2CLDX 1IAQA 1HH4A 1C9KA 1JAHA 1CLUA 3SFVA 3A1UA 4QNRA 4NCHA 2H8KA 2X77A 2IXFA 4BZQA 1W49A 2ORWA 4CDGA 1J99A 4N0DA 2BMFA 1WCV1 2ZI3A 2IUSA 3VAAA 4JYBA 2BMJA 3IILA 2GAOA 4LJ7A 1E2DA 3W6PA 1CTQA 2AFIE 3RS7A 1CRPA 2ZANA 1UDWA 1KSJA 1E4VA 1OXSC 1AGPA 2B6HA 2CJWA 5FOTA 2X2EA 3SS8A 2DPXA 4EAQA 4F38A 1E1RD 3CH5A 4B3DA 5IRCD 1ZM2A 4Q4AA 4Q21A 2GHIA 2JAQA 2FPKA 3O8CA 1E2GA 2BIFA 3EZ6A 3L2OB 4RZ3A 1KI8A 1ANKA 1UKZA 1GSIA 4WAUA 1F5NA 4US2R 2AD1A 1RW4A 4JBYA 2FFHA 5AK0A 2ZQ5A 5DYGA 1X86B 4JZKA 2PX0A 5JHGB 1QZXA 1W5SA 4DDTA 1US8A 1I2DA 3CNNA 1COWA 4PPGA 4MGYR 3LDAA 2WWHA 4IDQA 5J5CA 1TMKA 3PUYA 3AUYA 5B2ZA 1J8MF 4KBFA 4RD3A 2JATA 4JJZA 5G3YA 3K0SA 1YQTA 1KYIA 3F8TA 2J7PD 4TN1A 3U3MA 3HYTA 2C03A 4P31A 1DOAA 4TLCA 5AJYA 2GXUA 5EUQB 3THYB 1XCPA 4MKHA 3LO5A 4WZAE 4U02A 2HDNB 3PEVA 2ZRMA 4RVCA 521PA 4DJTA 1F48A 2C2HA 2YV5A 2QE7D 4M2LA 5AJXA 3IPYA 2ZE5A 3L82B 3RRMA 1Z0DA 2OEPA 2Z83A 3C8UA 1V5WA 3WP0A 4EJSA 3CZQA 3WBJA 5F3WB 1WQ1R 2VP6A 3AP1A 1IXRC 4F4JA 1IONA 2C5LA 4QJ4A 1MRNA 3AVQA 4WXRA 1UEIA 1G64A 5EE5B 3CW2A 1ZUNB 2G77B 4MH0R 3CPJB 4CEIA 3EARA 1NP6A 2D62A 3A37A 2F43B 3KQNA 2JEOA 2RGNA 2IX3A 5KDLA 4QHTA 3PEYA 1ESNA 2XJ9A 1G6OA 1SVMA 5CM9C 4KBGA 5DLQC 4URYR 1UEJA 3EIQA 2PEZA 3CO5A 5KPDA 4KFRA 1DAIA 5AJVB 3RLFA 3VR3A 1PLJA 4DBLC 5TDHA 4G0NA 2OM2A 1NVVR 1YZUA 2ZJ5A 4HUQB 1VCMA 5G53C 1LNZA 2V7QD 3UG7A 4M9ZA 1PV4A 4Q48A 2GETA 1Z29A 4TL9A 2GJKA 1S1MA 1TTTA 4AYWA 3ETLA 3PV0A 2Z4SA 3K0CA 4M1KA 3GLGB 4KO8A 1NBME 5L3QA 3WBKA 3LWNA 2WJIA 4NCNA 1FW6A 4TTQA 3G82C 3K53A 2LWIA 1S3SA 1ZUIA 3Q3JB 4FCTA 4PC2A 4HUQA 1S1CA 4M9XA 4NONA 1E6CA 2ZJBA 4WOPA 4D4KA 5CDFA 4G3XA 2QP9X 4B43A 1TF5A 2F3RA 3EPJA 4GRAA 3R8FA 2JLXA 1MO5A 1KOFA 1G5TA 2P0EA 2RGEA 3MLEA 2GJ8A 3QNUA 2CXXA 3K1JA 4OQXA 3MGCA 3O8RA 2NOAA 1OFTA 3IPXA 1W0KD 1GRQA 4A92A 2J7KA 3V4RA 5BYJA 5G41A 4FMCB 1RRPA 4O2LA 3TJZA 4IOMA 1X1RA 1N6IA 1Z0IA 3RWMB 4AD8A 1QBKC 5AUOB 3SR0A 4IFBA 1SVWA 2ZI7A 3K9NA 3KB1A 4DC9A 4OKSA 3MFYA 3OIVA 2JIZA 4H1VA 2H7VA 1X8JA 2GAAA 1HT1E 2W6IA 3QXSA 1E1QD 1VIAA 1Z07A 2ZYTX 4MQBA 4IEIA 1QVAA 3B6EA 3QF4B 1UKVY 1XFAA 3GLHB 2CJWB 2QI9C 1WF3A 5IHPA 1E32A 2OFWA 4YMTA 4U00A 3QEOA 1LS6A 2BKEA 1N2CE 5H68A 2ATVA 2Y8EA 3QBVA 3LA6A 4OQFA 2HXSA 4ZI3A 4EUNA 3NWJA 1TF2A 2V1XA 2FV8A 2CLCX 1W4BA 4JVNA 3T06B 2N1BA 4LHZA 3RWOA 5KPJA 2J0QA 3X1YA 4QRHA 3K70B 3PUZA 3C14C 2OESA 3G0HA 4JLDA 4U5XA 3VX3A 1CKEA 2QZ4A 4CT4B 1UJ2A 2XTMA 2OFOA 1W1WA 4ZKDA 4P4SA 4XH9B 4ZO4A 5AUQA 4DT1A 2IUUA 1OYWA 3BFXA 3OF5A 1G5RA 4XD7D 1KDPA 1HEIA 3ASYA 2OSBA 1T5IA 2WHXA 1ZYUA 4FINA 1XMVA 1NKSA 4C0JA 2WWYA 3OEHD 2J45A 1VCIA 1T91A 3ZZTA 5EXPA 5JJLA 1X6VA 2ZU0C 5EJEA 5CDFE 3EZ7A 3KXLA 4Y0AA 2O8CA 3NBYC 3ZS9A 5ANRB 2QAJA 2PMDA 1E4YA 3K9LA 4QC2A 3DMNA 3L0OA 3N5CA 1N5IA 1OH8A 2A9KA 4CEJA 3OESA 2WSSA 3R7WA 1XRJA 2OZEA 3W6OA 1FPMA 2D2FA 4P32A 4AG5A 1OIXA 1NJFA 2NO0A 1OB5A 1W0KA 3BH0A 3KQUA 1EGAA 4TQAA 5LDDC 1PZNA 4Q4JA 4OI1A 2OBNA 3WP1B 1EK0A 2GKSA 4HATA 4TMWA 2BDTA 4GOJA 5IDVA 5JECA 1RYFA 2Z0MA 1ZNWA 3U7EB 1FL9A 1KDRA 1Q44A 1TQ2A 3M4YA 5CLQA 3SC3A 1C1YA 2R9VA 3NH6A 3AP3A 4PZLA 3LFUA 1E94E 2QU8A 3OFND 2F7SA 2MMGA 3QE0A 4WIAA 2XZPA 1KTVA 4YMUA 5J47A 2GJ9A 1P3JA 4BLQA 1P62B 1N5KA 2JJ2A 2ZE6A 1BMFD 1I4DD 1U0JA 2AK2A 4OYHA 5H1YA 4IXMA 1N0VC 2NIPA 4ZV4A 3THWA 5EP1A 3BFKA 2FZLA 3OEED 2VYFA 1G19A 3WNCA 2WZQA 1TPZA 3CPEA 1SKYE 3T1OA 5IT5A 3C7KA 3TW4A 4M0LA 2D2EA 1X3SA 4QOSA 1CJKC 1ZD8A 2CBZA 3DOEA 1EFRA 4P0TA 1GIAA 1G18A 3AUXA 3I1FA 5FPHA 3UWKA 5JCZA 2IUTA 3TK1A 4KVGA 3QPWA 4BZXA 3CRQA 4ARZA 5E7MA 1E9FA 3LBNA 3TQCA 3GFTA 3ZZUA 1U90A 3R7WB 4NYIR 3H2YA 2C98A 1XJCA 2N42A 1OPXA 2IS1A 4LJ9A 3F3YA 3UK6A 4AK9A 4RY2A 2WAXA 4WXPA 2A3RA 5DNYB 1HE1C 3P4XA 4JLMA 1YR7A 3CB4A 4P3YA 3E5HA 3U4QA 1ZINA 3L0IB 3QUSA 3R9WA 3IHLA 2IL1A 1AJEA 5AR1A 2I4IA 2Q3FA 2ZI5A 3SQXA 2VQSA 1EWQA 2G88A 2BCGY 1CULC 4FIDA 2VA8A 5JI3E 1NVVQ 3BB3A 4PSAA 4TLBA 5B57C 2ODWA 4Q66C 2B92A 3B82A 4DEYA 4TMKA 4IVQA 5L3SB 2DB3A 2GBLA 4B76A 4OI2A 2VPPA 4CZ2A 1X8KA 2RGNC 4OK3A 1VG8A 3SZRA 3T34A 2WTUA 2W2VA 2WBLC 4PAQA 2GDJA 5L3QB 2PLFA 2JLVA 2AD5A 1PLKA 2Z5FA 3QQ5A 4KVAA 5FPSA 5KU1A 1AIPA 1DG1G 4QL3A 4AKHA 3QF7A 2VP2A 1QVRA 1E2HA 1DBSA 1A82A 3VKWA 4DIEA 4JLOA 3OFNA 5J4KA 2E9SA 5CLLA 4JLVA 4D26A 3JVVA 3I62A 3SNHA 2O0KA 3T35A 2CEAA 1TEVA 1ZJ6A 3P32A 1NN1A 3AKEA 2KI5A 1VKJA 2X2FA 1GM5A 4E22A 2WM9B 2P2LA 1VDZA 4AYTA 4BRWA 4UQOA 5HKKA 1NNEA 1RC8A 4KCGA 2ZRBA 5HCNA 2OFXA 3TVTA 2A78A 4TZ6A 1T3HA 5JLJA 3G5UA 3AF4A 3NVAA 1XDBA 1L8QA 1I2MA 1Q12A 2H5EA 3FMPB 1Q1EA 5HZHA 4DSUA 4NYIQ 4JLBA 2YNMA 4LJ8A 3QG1A 4GMDA 2QP3A 3DMDA 5L3VA 3PXGA 3B60A 3HP1A 1IXZA 1U8AA 3U4QB 3PJRA 2VO1A 1Z06A 1KI3A 1S3GA 2WWIA 3THYA 3AVUA 4PO8A 2J41A 2EW1A 3FVQA 3K9HA 1T3LA 2P6UA 1ZU4A 1ZCAA 2WOJA 4WW0A 3KFVA 3AVVA 1L7VC 1LF0A 2O8EB 1YZTA 4KAXA 1P9NA 1VHTA 4M21A 4YQFA 1NLZA 4YMVA 1PUIA 2KBFA 1D8TA 4Q4HA 5LB4A 3VQTA 4BFSA 621PA 2XXAA 1IXSB 2JLZA 1GP2A 4WA7A 1AK2A 5JBQA 4A8JA 4DZZA 3GEHA 2GCPA 3W3ZB 3IIJA 1E2EA 2QN6A 3IEUA 2J5XA 2PCJA 1UKEA 4HAWA 5TXGA 2ZS7A 3K0EA 1QHXA 1NIJA 1D6JA 2R62A 4LJ4A 2WJGA 4FCWA 4HZIA 3SDZA 4RKFA 1HY3A 2N46A 4Q1CA 1E2IA 3V9PA 2VP5A 3TR5A 4EPTA 4F4CA 2EFCB 2F43A 3I3SR 2OXRA 3VFDA 4OHZA 3MUFA 2ODEA 4Q1BA 5H8WA 2QBYA 3ADDA 3QXHA 3B1XA 4M1TA 2OLJA 3Q7PA 5C2JB 3Q85A 1AZSC 1XU4A 3RRZA 4B2LA 1Y3AA 4HDQB 3KX2A 4BUJA 3CNOA 1KSHA 1A1VA 1ODFA 4A0RA 3LXRA 4JVLA 4JYCA 4Q7LA 3QI2A 2FSHA 5HKKD 2DHRA 2BC9A 3C5CA 2A5GA 3BD9A 3SU8A 2VSOA 3CH4B 1UF9A 2KB0A 3ZJYA 1M8PA 2EYQA 2PH1A 1NSFA 3KL4A 1GTVA 4C0SA 2QPOA 2REXB 3LBIA 4OHYA 1PLLA 2GEVA 4OJKA 1DS6A 4HLUC 1KK3A 1CXZA 1TEXA 2ATXA 3RS3A 4BFXA 1M2OB 1N5JA 5LD2C 1XTSA 1RPZA 2J0VA 3I32A 4EKDA 4OHWA 4D80A 2PBRA 5FBLB 1DO2A 2JGNA 1S2MA 2XX3A 3AVTA 3VR6A 1IHUA 1II0A 4ZPXA 3JZAA 1NLYA 4XWAA 1G5PA 3K9GA 4I81A 4OQNA 4NKRA 4DDUA 5L3SA 4M4SA 3GLHA 3IBGA 1IM2A 4NBSA 2HCBA 1XNJA 3H1TA 3WNDA 2AXPA 1R6BX 3C4JA 3H0KA 3WXMA 4A6XA 1QHYA 4C0QC 1XPUA 3OIWA 4OK6A 3VR1A 1XMJA 1DADA 2FX3A 3REFA 5IF9A 3Q72A 3DM9B 1E2MA 4YMWA 1MR3F 2C77A 2A7QA 1CP2A 4A0FA 2RGAA 1CIPA 3ZIAD 2DFNA 3HPRA 2C9CA 3A4NA 3WHLA 4D0LB 3QSYA 1XXHE 4KLNA 3C5HA 3KDSE 4Q5IA 1G3IA 5D3MA 3HR7A 2XITA 3SJCA 4EPVA 4X8LA 2VTKA 4HZUB 4CVNA 1XEWY 2WICA 1KDOA 2VL7A 4NP6A 4D6PA 4GL2A 4QGHA 4LHXA 2O8FB 1H65A 2EFDB 4OJQA 1COWD 4Q02A 4C0HA 4TL7A 2XNDA 1X1SA 4EIWA 1OE0A 2YC4C 4PFSA 3T15A 2A5JA 5DSZA 1JPJA 1N6HA 1RKBA 4M1YA 3BRWD 4Q4LA 2KJQA 4W5WA 3DZ8A 5EE1A 2QMOA 1YZGA 1M34E 4FD2A 3GJ5A 3QKTA 1JPNA 3ZH9B 2MMCA 1NIPA 4QGGA 3T1TA 2PZEA 3CONA 4R7ZA 2ZJAA 1WMSA 1AGRA 3ZZ0A 3I61A 1S9HA 1TU4A 1AN0A 1FMJA 4ZIRB 4HB4A 4QGAA 3R9IA 2ZAMA 2ZSFA 4KV9A 4CGZA 1NI3A 2QQ0A 3LH5A 3SBEA 5JWHA 1ZM9A 1YZNA 3KXIA 4BEBA 3IO5A 4DLYA 4KITB 5J4YA 1K5DA 1KAOA 2IYZA 1E9DA 2JJ2D 2WIAA 5SZHB 2VHCA 1VTKA 2KSQA 3IBYA 1YE8A 3AGPA 1JQJC 1FX0A 1LFDB 1U8YA 2Z43A 2ZJ8A 1DAKA 3M6AA 1YZQA 1E96A 1NL3A 1Z22A 4JS0A 5HE8A 4ARZB 4XJXA 3B9QA 2QAGB 1Q22A 2XNSA 1DAGA 4JBWA 5TY0A 5SZIA 4HEJA 4QJ3A 3RS5A 4QBHA 1XXHB 3NXSA 4NU0A 4P4TA 4C9BA 3AVYA 5EZ5A 4EDHA 1OJLA 3AH8A 3GLIA 1KHTA 4QKQA 2CL6X 2FOLA 4KJZA 5HTKA 4IFEA 4BZPA 1OB2A 4O0MA 4LV8B 2IYQA 3L0PA 4EPWA 2ZTSA 3IGFA 2NO9A 1WA5A 1P72A 1ZCBA 3CX7A 3ND9A 4I1UA 1UBEA 5GJCA 5KTYA 4CEHA 1E0KA 1L2TA 3NEJA 4DCVA 2HLDA 1BO6A 1CJUC 2IXEA 2OCYC 2BBTA 1Z6XA 4PZZA 4B2PA 2P67A 5BXQC 2OCBA 2R44A 1T4GA 2FSFA 1OIVA 1P5ZB 4B3XA 1CF4A 1TU3A 1P2UA 121PA 2C95A 2NZJA 2OUKA 4YXWD 3TNFA 1G4AE 2BBWA 1T8TA 1MABA 4KSBA 4A15A 2CDNA 2CVFA 2FFQA 1OT3A 3E70C 1TX4B 4LC1A 4HAUA 4BWYA 2QM8A 3NTUA 4IKEA 1GZSA 2Z4RA 2IS6A 3R9XA 2RKOA 1XTJA 3T5DA 1W4RA 3WYFA 1E79A 4C7OA 5FOVA 1ESMA 1BKDR 1MOZA 4C2TA 1A2BA 3I92A 1CS4C 1HYQA 3L0SA 4A6PA 1JR3A 2ZPTX 4JSYA 3GPLA 1NG9A 2QG6A 4K46A 4D0GA 5SZKB 4NYMR 2MSDB 3IIKA 4UJ3A 3DPUA 3UMSA 4TT3A 1TUEA 2IWRA 2JLUA 3S1AA 1HUQA 5KHOC 4MITA 2H18A 3IHWA 4ZDIA 4RZ2A 1KJYA 1KO4A 4C30A 1XPRA 4BRUA 2GZAA 1E9EA 2GZHA 3UANA 1KKMA 2YWGA 4PQFA 1GNQA 1YZKA 4LJ5A 4MKIA 4ERNA 1TAGA 2VIIA 3BGWA 5P21A 3ZYCA 3SJZA 1XX6A 3EC2A 4LI0A 4C0AC 1ZD1A 2YZ2A 2FFBA 4CT5A 4PTLA 4D4JA 5BWMA 4D4LA 1IN7A 1GKIA 1FNMA 3CWZA 4TQ9A 4JT4A 5CIWA 3TUIC 1GNPA 2RGBA 3CRRA 4XVUA 1OXVA 4JVMA 4P33A 1L4YA 3LAWA 5AUPB 1IJFA 5G40A 3TVDA 4UXIA 1E9RA 2WPDA 3QXXA 2ZSBA 3RAPR 4C0LA 1JXOA 1E79D 1OXTA 3KQKA 4KLZA 1JR3D 1KK0A 4FWIB 4EFLA 4RJLA 1P60A 2DYKA 1EFTA 1US8B 5DH9A 5BN4A 2X19A 4Q9HA 3UKDA 5GJWC 4Q1AA 3FOZA 2RB4A 3TAUA 1N3BA 5EQTA 3X1XA 4DVGA 4URXR 5J4LA 1A4RA 1MO3A 4DHEA 2J9RA 3K8YA 3FKSD 1KIMA 2QL6A 5KO2A 4TL8A 4C2UA 4BFYA 3ASZA 2FU5C 4Q01A 1VECA 2AKYA 2GZDA 4MDEA 2IF2A 3OIYA 1LW7A 3HU2A 4UNSA 4O2RA 4TMZA 4US1R 4W7SA 2QP4A 3QKSB 5FBQB 1KO1A 2AFHE 4X8OA 4QNMA 4DLRA 5KSYA 4RZUA 1OFUX 4LDJA 5DE3A 2FGJA 1FP6A 3PUWA 4EPYA 2DBYA 3JZMA 3H84A 1KO5A 3QEJA 4ZIRA 2ZRIA 1JI0A 5DGXA 4EJSB 1ZD9A 1RE0A 1ZUHA 2BHRA 3EIHA 1S9DA 2W2TA 2IHBA 3NG1A 1XTRA 4RCYA 2IWHA 1P61B 3NC0C 3FMOB 3QKRA 1OKKA 1W0JA 4HDCA 1YKSA 1NMYA 3HPQA 5F9HA 2PX3A 4PC6A 1SHZA 4L16A 1GVNB 4URUR 1G1MA 2EFHB 3CBQA 2QNRA 1ZC4A 5CITA 4LPSA 3I8SA 1OHHD 4W9MC 3LQRA 3M1IA 2PJZA 1IN6A 2R8RA 4I1OA 3TLXA 1AA9A 3K0FB 3MJHA 1HTWA 1T8UA 2GBLC 4Q4JB 1SULA 2PZGA 3VU9A 4PANA 1XXHA 1U8ZA 1GL6A 1MV5A 2F9MA 2YYZA 2PLRA 2ZUBA 3AP2A 4RD2A 2BJWA 3OEEA 4R2IA 5FL3A 1UKYA 4QG7A 4LJ6A 2WMNB 3HU3A 3GLGA 4HLDA 4JLKA 2ZRFA 1LTQA 2QTFA 2WJHA 4L9WA 4AKIA 2ONJA 1EFRD 2ZXUA 1F2TB 2GEUA 5FL7D 2ZRAA 5F2EA 4KI0A 3GLFB 3LX5A 4PPNA 2NO6A 3QVVA 5AJWA 1AZTA 1E69A 2CL0X 1Q20A 4DLUA 3PEUA 2VSXA 4GOKA 4EPRA 1CR1A 2BJVA 4O3MA 1IN5A 1XD9A 1E9AA 2ZRDA 3HU1A 4OBEA 5BYKA 4NYJQ 4MRVA 1KGDA 3AB3A 1VG0B 3DHWC 4QFMA 5FTMA 1J8YF 1E2PA 1XCGB 2RHDA 1KZGB 1Z3IX 3X1ZA 2G6BA 2C99A 1G7SA 1HURA 3CWQA 3RANA 1ELOA 3K09A 3KFXA 2ZITA 3KJEA 1J90A 1XJ0A 1II8A 3B5JA 4MRSA 3SYLA 1GUAA 1KI7A 3ECCA 4LK2A 4Q4HB 2VBCA 4BLRA 1V43A 1WB9A 3CR7A 1GWNA 2CMKA 5C4GB 2CCGA 4NCJA 4D25A 1W36C 3KKPA 3AF3A 2B7CA 1W2HA 1BYUA 1ZNZA 2VHJA 5EXTA 3AGQA 4UXJA 3VHLB 3GLIB 4ZCMA 3KZ1E 1PVOA 2W6JA 3EASA 1G17A 4A9AA 1AS0A 3FKQA 3FYHA 5EZ6B 3U7FB 3NHBA 1NRJB 1RJ9B 1KSFX 1K8RA 4GP6A 3O8BA 2Q3HA 4MKFA 2QORA 2ZRJA 3A4LA 3KKMA 2P65A 2B7BA 5JJKA 3BIFA 2QRNA 1BIFA 1UFQA 4G5GA 2C8VA 3CNLA 4G01B 3H86A 2O8DB 2W0MA 1U94A 1W44A 5E4FA 2BVNA 2IYTA 4A0HA 2BMDA 5FTLA 1T6NA 1KZ7B 1NBMD 3NH9A 3CF6R 2ZRGA 1MO6A 4F7WA 2WSSD 1OFIA 1YR8A 4C0KA 4B3FX 2F9LA 2QT0A 2LKDA 1JALA 3DO6A 5DHFA 2ZIAA 3QJYA 4HLUA 2O8DA 3K0CC 2KE5A 4L5BA 2JLRA 4PO1A 2BOVA 3BH6A 4MRPA 2IK8A 3DDCA 3CLVA 4KFSA 2RGCA 3A6PC 3FHTA 4YDSA 4LYAA 5FOUA 5IK2D 2QMUA 4QGFA 3EWAA 2EWWA 5FBRB 3QENA 4Q9LA 3VR2A 4PHHA 5HZKA 1QDEA 4B74A 1VHLA 3BB4A 1XEWX 3FMIA 3QKSA 4BFVA 2VP9A 2V3CC 2XTZA 1XD2B 2A30A 2GF0A 3CF0A 1G20E 1DPFA 1VG1A 4I1SA 4IW3B 4LCBA 3TMKA 3SQWA 1OFHA 2XOKD 1Z47A 1RYHA 1VYVA 2WSMA 1Z0FA 1E2NA 1G8YA 3GLIE 2HCJB 3BC1A 3K70D 3LXXA 2QY9A 4AURA 4DCNA 5CB6A 3RRNA 1XEXB 1UPTA 2R6DA 3PG5A 1XPOA 4Y0VA 3DEFA 4QBIA 1G8PA 1JEDA 4WBSA 4JJKA 4B75A 3KQHA 1OXXK 2EYUA 2HF9A 4DXAA 5FUXA 2YINC 3CM0A 3FGNA 4GT1A 3SYNA 1YRAA 1P7CA 2RHMA 1XCMA 3QG5A 2G3YA 2EFEB 1FZQA 2VRWA 4PC3A 5DISB 2UZIR 2KWIA 1AS2A 1PUJA 4IDHA 5K8LA 3RC8A 3PQCA 3BS4A 2IA5A 4LY6A 2UZ3A 3TGPA 3WMFA 2QAGC 3EIEA 3W8NA 5J40A 2W58A 1KK2A 2DR3A 4QBFA 2FFAA 4MDFA 3OAAA 4TMVA 4EFMA 4YDHB 2GNOA 2GK6A 2R6CA 3ICQB 4TLDA 2TMKA 1CRQA 4CW7A 5GVSA 1ZMXA 2HF8A 5F9FA 2GESA 3LVQE 3KKQA 3KXKA 1D9XA 3I8XA 1T0HB 4TZ0A 4I1VA 4A0GA 5E95A 4Z1MA 2W00A 4A2PA 1XMSA 2AK3A 1ZM3A 4NMMA 3SHFA 4O25A 4XTRA 4XVRA 2ZSEA 2PT5A 4ON9A 1SVKA 3CRVA 2RGDA 4B34A 2G0TA 4TT3D 4L8GA 2IYVA 4LPKA 4UNRA 1DG3A 2V7QA 3L8ZA 3THWB 3F0TA 2AXNA 3U7HB 2FF7A 2OT3B 2AKAB 3GD7A 1F60A 4TWZA 5EXSA 2CNWA 1U81A 2QROA 1Z6AA 4BFWA 1FUUA 1U0LA 2DWOA 4M9SA 3U3KA 4JBXA 1QHHA 3IO3A 1GITA 1IJEA 1ZNXA 4OI4A 2NMVA 4B33A 1Z0AA 4DCTA 1FMLA 2XOKA 2QENA 1G4UR 2NZ8A 4DDVA 4NZYA 1NSTA 1H8HD 2JDIA 5GJBA 3PUXA 2NO1A 1X8LA 4LGMA 4W5HA 4TTRA 4Q03A 2OAP1 2O0JA 4OQLA 4V0LA 3SE0A 3IEVA 1EFHA 1E98A 2B8WA 2WPDD 4FN5A 5FBWB 3HDTA 3FMFA 4Q1FA 1EX7A 4XVQA 2IYUA 5D3MB 5JHHB 4POAA 3ZIAA 4QXAA 2PZFA 3IQXA 3NEYA 1E2LA 2OG2A 1UADA 1HV8A 3NKVA 1D2EA 2GXAA 2D7CA 2NO7A 4FMDB 3NIBA 2CLSA 5KSPA 4AI6A 3NBXX 4V0NA 2ZUCA 3GJ3A 4GOXA 1F2UA 3P1JA 5AWFC 2QMHA 4IXNA 4M53A 1VG9B 1DARA 2QGZA 1UBGA 4B73A 2VP0A 2KBEA 3LLUA 5TARA 4KHZA 4EPXA 4YC7A 1ZIPA 1KNQA 4FMCF 1VIYA 4CF7A 4TYYA 1GFIA 5EE0A 4PPQA 4XWOA 4B3CA 4OHXA 4BASA 221PA 2NG1A 4AIIA 3T1VA 3CF2A 3IDQA 4URVR 5FTJA 5JRZA 2BWJA 1YVDA 1Z5ZA 3W9YA 4PAMA 1T5LA 2A5FA 4TTPA 3TUZC 1FFHA 3U61B 3UPUA 4XD7A 5CIQA 4DLTA 1XF9A 1FOEB 4MUBA 5JCPA 2FSIA 1Z63A 3NC1C 3X1DA 1UBCA 3LQQA 3N2EA 1NVXQ 3SYKA 3TE6A 4M22A 4B35A 2IEYA 3PR1A 1SHKA 1BYIA 2C9OA 3PITA 3GJXC 2GTPA 4LX0A 4Z8XA 4DWJA 3I5XA 1GG2A 4Q1EA 3T1QA 2NPIA 1DE0A 2RH5A 2WJYA 5C46F 3THXA 4PSVA 3TIFA 3CR8A 4A2QA 1E3MA 1E2KA 2XB2A 3TH5A 2GVDC 3U3JA 4LBVA 3EA5A 1D5CA 1QG4A 3LD9A 3GLHE 5AJZA 2GCOB 4Q4AB 5E3HA 2O8CB 1KI6A 4BFTA 4ZKEA 4X8HA 4ZCLA 5DHAA 1KY2A 3DZDA 1AQYA 2HV8A 4HAYA 1NVWQ 1BOFA 3VMFA 5KDDA 4FWTA 2IYXA 2P5TB 2ZSDA 4BFZA 5L3RA 5KSOA 5ELXA 3QBTA 3W6NA 3FFBA 2CCKA 3GMTA 4OL0A 1P9WA 2PMKA 4Q19A 1F2UB 4ZDWA 3SEAA 1ZVQA 1SKQA 3KKOA 1QF9A 4ABYA 3ZVNA 2LKCA 4JL6A 4LHWA 5HE9A 5AUNB 3LW7A 2P3SA 3Q5EA 4L4UA 4G1UC 4AY2A 2R6GA 3ONWA 5JFGA 3K09C 4R2HA 4LUCA 4B3GA 2J87A 2HYIC 1WGWA 1M7HA 1ZNYA 3VX4A 2WAYA 1NF3A 4N1AA 1N6OA 2IS2A 4US0R 1JBKA 2FJUA 2W83A 1MABB 1W4CA 2OXCA 5TV2A 2GK7A 4XTCS 4D0NA 2YOGA 2GJAA 2EFGA 3Q9LA 2QBYB 1QHNA 1U0HC 4QBGB 1RRFA 2VEDA 5FBVB 3ZGXA 1M7GA 2F1RA 2W0SA 2V55B 1SXJB 4JMPA 3AQ4A 1XWIA 4OQMA 4URZR 2ZI6A 4R9UC 2H57A 3T5GA 2ZYUX 4WZBE 1Z0JA 3AF1A 1E0SA 4AKEA 3B1VA 5EP4A 1XEXA 3CUEF 1E2QA 2XSZA 2ZE7A 2OE2A 2ORVA 3JVUA 2GCOA 2H16A 3WRYC 5CYPA 2FWRA 4BE7B 3AF2A 2W2XA 4A2WA 4HZUA 2OCAA 3TRFA 1R5NA 2O52A 4KFTA 3D7MA 2OO7A 4QHSA 4FCVA 5DI3B 5JJIA 1TQ4A 2LCFA 4NH0A 1ZM7A 4B6FA 5EE3A 3A1WA 3BORA 1JEEA 2L0XA 5TMPA 5CB8A 1RJ9A 4H1UA 5C18A 3VNUA 5EE9A 2DCUA 3S1AB 3V4FA 4RFSB 3ADBA 1RRGA 1Q21A 3D8BA 4HDOB 2BEJA 2C04A 4HLCA 5DYIA 1HQYE 3MRSA 3B1WA 4DSTA 3NDPA 2ZEJA 5C1BA 1B23P 2RMKA 1SKYB 4EQ6A 1W2GA 4KFUA 3HYRA 2AWOA 1RFLA 3ZLJA 1XJQA 2YWFA 4CEIB 4IEEA 1GL9B 2IC5A 1DO0A 2XJ4A 3CZPA 4B32A 3FHOA 4KXFB 2C96A 4GP7A 1KI1A 4AWXA 3L43A 2DFKB 3ZD6A 1JAIA 2EWVA 4F92B 1S96A 3A8TA 2AHOA 4C0BA 3ZQJA 3K0AA 2ODNA 2FZ4A 2GXQA 2WVJA 3N2IA 4IVPA 2Q9CA 2O5VA 3IQWA 5FUVA 1SXJD 3ADKA 4RD4A 4Q9JA 4ZDJA 2DFTA 1JR6A 2ERXA 2WKQA 5FI0B 3UIEA 1TL7C 5DO9A 3W90A 4TLAA 2F55A 4Z51A 4Q00A 3EG5A 1LS1A 2WWWA 3B9PA 3LV8A 4PXAA 1G7TA 4JLAA 4CRWB 4ZI2A 1OKKD 1W0JD 2BEKA 1MKYA 1A7JA 4JL5A 3TSZA 3IKJA 4LJYA 5EUMA 4K81B 1RZ3A 3MWLA 1KI9A 1LV7A 3VR4A 5HPYB 5E7IA 1OXUA 3BBPA 2G1JA 1N6NA 1P2TA 1SZPA 2HLDD 3BK7A 2QMEA 3OAAD 3UXMA 2ZJOA 1G7RA 3TBKA 2ZVPX 4OI0A 2O8BB 2ERYA 3PFIA 1WE2A 1OF1A 1Q0UA 2J46A 1WXQA 1FNNA 3P27A 4JVSB 4TYPA 3RSOA 2A5DA 1N6RA 4AKGA 1R8QA 4Z1MD 4DDWA 4MGKR 4LBZA 3EX7C 1WBBA 3KUDA 4L9SA 2IF0A 3PCRB 5DN6A 3B78A 3AM1A 4ZDKA 3GJ0A 4GFDA 5JS8A 5HR5A 4RD1A 3GQBA 2ORIA 1KJWA 4ACAA 4K8OA 1XD2A 2P5SA 1D2MA 1ZP6A 3FHCB 3KJHA 4HB3A 1XD8A 4JKYA 5CJPA 1G9XA 1NVUQ 2ECKA 3UWOA 4A8JB 1CU1A 2IS4A 3A4MA 1ZBDA 4R98A 1E1RA 1ZW6A 1NN3A 2ZR0A 1VCOA 4IRUB 3QPVA 5FUYA 3VU9B 2FEMA 2IW3A 3A1TA 2OV2A 5GJVC 3RRYA 3UG6A 4M1SA 821PA 2GWHA 3ZVLA 4DLXA 3ZVMA 1LY1A 1OIWA 4LYJA 4E09A 3AKCA 4MRRA 4PC1A 5JRJA 1XEFA 1U9IC 4JLNA 3NDBB 4LWZA 4GBMA 1R2QA 3KTAB 3ZDQA 1DAMA 2BV3A 1H8HA 3QVUA 4PPFA 4ESHA 2QPAA 2ZRNA 2ZREA 1XP8A 4AC9A 3C16C 4LJAA 4RSGA 1GRRA 2BKUA 2E87A 2GILA 1E0JA 1VPLA 4G5OA 3I72A 2ZU6A 3RS2A 4B3BA 2ZYVX 3RYTC 4LYHA 2XTNA 4YLGA 1ZIOA 6Q21A 5JZVA 2JJ8A 1GKUB 1Z83A 4FMBB 4FXPA 1C4OA 2REBA 1Z6GA 2VLIA 4FMDF 1B0UA 5FOXA 1QRAA 4G5QA 2AN9A 4DRZA 5K8UA 5UKDA 2SHKA 1ONBA 1E99A 3PVSA 1JXMA 2HJGA 2EVWX 2YOFA 2G1KA 2RGGA 1DAFA 3WY9A 5K8TA 2ONKA 4Q47A 5FTNA 2GA8A 4HB2A 4J0QA 4HB0A 2BBSA 2QTHA 5K8IA 4JT2A 1HA3A 3EPHA 1D2NA 3SHWA 5GVRA 4DCUA 2G9NA 4FI3C 4E07A 3TSWA 3CRMA 1W46A 4Q1DA 2BBOA 1F2TA 5B58C 3EXAA 1O3YA 3A1VA 4IHQA 2BCJQ 4XIGS 2NPFA 2VF8A 4LV5B 2P6NA 3GFOA 5CK5A 2PL3A 2ZVQX 2G83A 3E1SA 3SOPA 4R71A 3GJ8A 2PCLA 3AVOA 3KJIA 2NGRA 3B1YA 5JS7A 2FDCA 1Y63A 3MG9A 3DKPA 5DN6D 3VR5A 5SZJA 3BFVA 1ZM4A 1XTIA 4QHYA 5FPTA 4Q18A 3D6TB 5CM8B 4EJSC 3LVRE 1TADA 3C15C 1HQCA 2FE4A 3LRPA 3GJ6A 1IQPA 1OH7A 3R8CA 3RNLA 4B6EA 3DKVA 1NJGA 1GKYA 3AKDA 1EX6A 1GRNA 4NYMQ 2NQ2C 4RFVA 4DT1B 5KNBA 1S4QA 2I1VB 1XTQA 3EAQA 3WNBA 2OBLA 4GI7A 3RC3A 4B2IA 2V4ZA 1Z8FA 2IYWA 4GZMA 4MYHA 5JMTA 3B7GA 4KYIB 4NDZA 3FB4A 5HCIA 5KNDA 1IN4A 4B71A 1VYUA 1G7CA 3PEWA 3VKGA 2UVQA 2XNDD 5BW8A 2XZLA 1KDTA 2AL7A 4PHTA 2YKGA 3IUYA 1KY3A 1FP7A 4V0KA 721PA 1U2RA 1QHGA 5JSZA 2H92A 1G3MA 3PUVA 4LYFA 2BM0A 2CHGA 1NY5A 2FA9A 4GNKA 1GILA 3B2EA 1JQLB 1Q1QA 3GLFA 3BE4A 1N6KA 1OSNA 2PT7A 1EG7A 3MWKA 4BLSA 2OAQ1 3VTKA 1P6XA 2F1JA 2D4HA 2V6JA 1R0YA 1WBDA 2WWGA 1OYYA 1SVSA 1R4AA 4UNNA 4A4DA 4B47A 1TQDA 1LB1B 3CPHA 4C3ZA 3CIOA 3UMFA 1KI4A 1P4SA 1G3RA 3DL0A 4KODA 2ZI9A 4MYCA 4UXHA 3B13B 1QHHB 1JR3E 1AKEA 4MYUA 4KYUA 2AX4A 4ACBA 3W5JA 2XGJA 2ZJ2A 4WVFA 1KO7A 4WZ6A 1LF5A 4D4MA 3DVLA 2REOA 3QKRB 2Q9BA 1CJVC 1G291 3BH7A 8OHMA 3K70C 1OV4A 4ASUA 5BN5A 3MD0A 2VH5R 1W36B 1U98A 2ZETA 1XBTA 5A4JA 2HUPA 1HE8B 2ZYWX 4LZZA 1P75A 1R0WA 2Q6TA 2ZAOA 4BFUA 2O0HA 2J7PA 2GF9A 2ZRLA 2CL7X 4N0EA 1TNDA 2XEXA 3U7GA 2XXAB 3PENA 4MRNA 1DAEA 2XB4A 2XSZD 2QAGA 3BJIC 1H8EA 1RVDA 2F1IA 1DEKA 4PHGA 3TUJC 2O8FA 2RAPA 2RGXA 1G8FA 4TSFA 2YOHA 1Z2AA 5J4HA 2B8TA 1WP9A 3P4YA 4ITRC 2QE7A 3W8RA 4PZYA 2FPMA 2ANBA 1G8HA 4IDOA 2WMOB 4I4LA 4YXWA 5J4VA 1P73A 2P6RA 1L4UA 3HR8A 4V0ME 1Q3HA 5JSZB 4TMXA 1Z6YA 2DWPA 1KK1A 3SJBA 1G21E 1T0JB 2WOOA 1AQUA 4Q9KA 5A0FA 5JWOA 2IEZA 1SXJC 1GNRA 1N6PA 3I5YA 1P2VA 2HXYA 3EA0A 1E2FA 2OILA 3SBDA 4F93B 2IBMA 4Q7KA 3H4MA 4NCIA 4IOJA 4ILEA 1NMZA 1DAHA 3BAFA 3GLFE 2A5YB 5BQ5A 2QSYA 4D82A 1SVOA 1BS1A 2QGNA 5G3ZA 4DLSA 4E03A 4QM7A 1G3QA 3ZD7A 2HT1A 2R6FA 1AS3A 2HJVA 2OBMA 1RRCA 2RCNA 4GMXA 5GADl 1W4AA 3KKNA 1QHSA 2R2AA 1CJMA 4TL6A 3U3OA 4EQ6B 4BQSA 1U99A 1NLFA 1DVRA 4JLPA 5FOWA 5FPYA 3GEEA 2ZRHA 3WYGA 1YJ5A 4A36A 2FH5B 2JLYA 4HAVA 3KUCA 4XSHA 3AVWA 1N5LA 1CBUA 3C41J 4TSFD 2C78A 2J1LA 4NYJR 3QIAA 4S2EA 1ZAKA 1KI2A 2J0UB 3EW9A 3I73A 2ZM5A 1E0AA 4YMSA 2H1LA 4H9GA 5KSZA 3FFAA 3U5ZB 3AKYA 1UDXA 3J81k 4TYNA 3CKLA 3HWSA 4B44A 4IJMA 5B64A 4DB2A 2HT6A 1IOZA 1CR0A 2OCPA 1YZLA 2MSCB 5DI3A 4UNQA 4DLVA 1N0WA 3WHKA 2VHTA 1IBRA 2QSZA 1E9CA 3A36A 4BLPA 3QOFA 1KI6B 3KB2A 1NKTA 3ND8A 3FDIA 1MT0A 4G5SA 4S35A 3X2SA 4DLWA 4MYTA 1WRBA 3NHAA 3F5FA 2YWHA 4HUTA 1R7RA 1W47A 4CIDA 1OH6A 5A5GA 2D74A 1Q1BA 2FMXA 3GLGE 2UKDA 1DELA 2IHYA 1ETUA 4M1WA 4MUAA 1E2JA 2XZOA 2V1UA 2JJ1A 1SQ5A 1OW3B 3SN6A 1FTSA 4KSCA 1D9ZA 1RIFA 4TMTA 3UATA 4XOIA 1T9HA 4PX9A 1FTNA 5CJ2A 2JLWA 2D3WA 1M1YE 2GXSA 4PQYA 3ZS8A 4RD6A 1KMHB 1MH1A 2YC2C 3EPKA 3VKHA 3KTAA 4P4UA 2BMEA 1MO4A 4LHVA 4D81A 2CCJA 3A58B 4UJ5A 4C7OB 2W6ID 1JECA 3A1SA 4LBYA 3REGA 1JB1A 4M8NE 4NTZA 4N3NA 3EZFA 2C9YA 2IT1A 4V03A 3WRXC 4URWR 2O8EA 1R0XA 2QPTA 2F3TA 4Z54A 2I3BA 2R6AA 1Q3TA 4Q7MB 4IVRA 2ASEA 3RDPA 3IIMA 4TLEA 3D31A 3WMGA 3W34A 2WKRA 3Q5DA 2J0SA 2D7DA 2J59A 2JA1A 5JI2E 3TQFA 2WKPA 1R5BA 3RS4A 2VF7A 3X1WA 1SGWA 3DOFA 4A8JC 1KO8A 2QM7A 2JDID 3V00A 1XMIA 2XAUA 4LV6A 4DSNA 4QM6A 1R8SA 3QKUA 5KOYA 4BLOA 1Z28A 4LC0A 2QUZA 3L8YA 4Q9IA 2ZS8A 2K5UA 2VHUA 4MA4A 1CR4A 5FI1B 2Z6VA 4C4PA 4LSGA 5LB2A 3I4LA 4E5UA 2EQBA 2O8BA 1M74A 2CHQA 4DB4A 5TB5A 1OHHA 3OEHA 2DFLA 2JCSA 2YVUA 3EZ2A 3BERA 3M0EA 4M1OA 1F6BA 4F91B 2F1HA 3AVPA 4IDNA 4OK5A 3BWDD 1YHNA 4JIMA 3B85A 1YR9A 1VCNA 4BECA 2NTYC 3BOSA 3SJAA 4AYXA 5D3QA 5E7JA 3Q7QA 4HAZA 3T12A 2JJ1D 1M7BA 2QQEA 2CVHA 1R5OA 2OHFA 4LBWA 1BH2A 4PSKA 4KU4A 4Q7JB 1AM4D 4F4IA 3T61A 3U6KA 1YRBA 4HSEA 4A82A 2VSFA 1E9BA 5H70A 3FTQA 3DM5A 3FE2A 1W48A 4PO9A 1EWRA 2FNAA 1W5TA 1F3OA 5EXXA 2ZRKA 3EZ9A 1I4LD 4BGDA 1P2SA 4LOAA 1II8B 1GAJA 1XZPA 3CX8A 4XWKA 3O47A 3TW8B 2ZR7A 1W7AA 2IYLD 1U9IA 4G5RA 1GL7A 2FN4A 3RABA 2ZE8A 4D2IA 4UNPA 4DCSA 2HEIA 1TF7A 3EPLA 4DUGD 1II9A 1CR2A 4JKIA 5DI9A 1TUIA 4M1MA 3NBFA 1G3UA 2FPLA 1ZRHA 2WV9A 3RVBA 2YHSA 5KYKA 4L15A 3GEIA 1J70A 1Z08A 4LHYA 1BMFA 1OH5A 3O8DA 2AR7A 4MGZR 1IY0A 2H17A 3RSLA 1KMQA 1NBMA 3QF4A 2WWFA 3CRW1 3HJNA 1IY2A 2OLKA 2DWQA 2IXGA 5C4MA 1K6MA 4HYYA 2Q0HA 3GJ4A 1Z6TA 1UM8A 5F98A 2ZJZA 4CYMA 3P26A 4DKXA 4AG6A 1IY1A 2CE7A 3QY0A 4RZXA 3P20A 2F6RA 4GSYA 1P9RA 1WDTA 5CYOA 3OHMA 1ZC3A 1LVGA 1R0ZA 1KNXA 2B21A 2VP4A 1KKLA 5FH9A 3ADCA
chains in the Genus database with same CATH superfamily
1N6LA 2FPUA 2YJTD 2FG7C 3JQAD 1N0UA 2O8BB 1A9XB 2ANCA 2ZKLA 2QSUA 4MW0A 3ZHCA 5EP2A 4DV2B 3WODF 5KOIA 2O8NA 3MMPA 5CVJA 4TSKA 2WIFA 1BMDA 2D4AA 4H6VA 3D4LA 4XW2A 1OWMA 2MSKA 4P4SB 3HQ4O 5BR4A 2H85A 2BM1A 1JHDA 1GYPA 3FSJX 3FYDA 4FW9A 4II7A 5HMMA 3AHHA 1QCDA 2ZVDA 1ZU5A 4PN7A 1A5TA 1P0MA 1FVHA 1IHYA 2CJFA 3QXCA 1DQRA 4ZALA 3R20A 3GORA 5DW0A 2XLHA 1VL6A 5ESWA 5HG0A 2DG2A 2BMWA 1JAXA 2VKTA 3LKBA 4I14A 2HMSA 4CJGA 1LSOA 2DSNA 3L49A 4QPCA 4R1QA 3VNAA 3UAXA 2VHQA 4W99A 3AY3A 3WNQA 4JYZA 3GLKA 1N1GA 5FOSA 1M1UA 1MA3A 1KYQA 3SIRA 3WB2A 3T9CA 4ASUD 3I6IA 3N2NA 1IWOA 2WE7A 2GVZC 3E2IA 3QJGA 4PHFA 3PHCA 1FX0B 1NN5A 1WUTA 2X8WA 4JGGA 4Y6GB 4Q9AA 3QVJA 2Q8NA 3K2BA 1IW7F 3AGTA 1E5XA 4WABA 2WIDA 4K9SA 1W6UA 1EQ1A 2Q8PA 5JZ9A 1VE5A 4X9XA 3ZY3A 1R66A 3DONA 4MKGA 4RCZA 3PQDA 3OE7D 3K0FA 5F77A 3ZWKA 1K0UA 3BXZA 1EG2A 2J5QA 1SUCA 5DIFA 2K2WA 1B42A 5FL7A 1UBUS 1D2RA 1K7XB 3KQOA 4JLSA 4HOYA 4MW3A 4NS4A 4YONB 2UXCB 1LE2A 2J0UA 3O8QA 1Q1ZA 4Z8YA 3ZWNA 2WWXA 1YQGA 1T35A 3TOMA 2HJSA 3GT7A 1MX9A 4E5MA 5IWCA 3CX6A 1QS0B 1J7JA 2G9VA 2RJOA 2XUKA 3GAFA 1SRQA 2QL7A 1PEKE 2NW6A 3RHFA 1P7VA 1OTXA 4YRTA 1JLKA 3HBJA 3Q8LA 4EENA 2WUDA 3B12A 2FEOA 2J08A 1BD4A 2WAMA 3GFPA 5CTAA 2V9PA 4NJEA 1A0OA 4KN8A 4D3FA 4OB8A 2V6IA 3HABA 2EG9A 3FOAA 2PMBA 1SD1A 3UJ8A 3NUZA 4F0JA 1SK8A 4CMHA 4RSMA 5BURA 4PC7A 4NY3A 3ONDA 4O59O 5LBIA 4YV1A 1DFGA 5KMGB 1B16A 2YIMA 1VFPA 1ZHHA 1EXMA 3ENKA 5IXSA 1IL0A 2B8JA 2GCNA 1QP8A 1UAAA 2C3MA 2A68F 3B8HA 2WQ7A 2X1HA 1P44A 1PFGA 1G8GA 4R3NA 4H7KA 1AKYA 2DHQA 3LUGA 4MYDA 1JG2A 4R9RA 4RFSA 2QRZA 1NFRA 3GWGA 3FPAA 2FSGA 1JHOA 2HOQA 1GDDA 4NECA 4PG6A 5DKFA 5DWDA 4JSTA 2P2ZA 2O1SA 3JASA 4HAIA 4MGIR 4CMGA 3EDRA 5CB4F 2BYTA 2EDCA 1IVYA 4E94A 1SB8A 4DSOA 1EFUA 4JXJA 3MWJA 5FTKA 3W1VA 3W5IA 1J0BA 3PDWA 1XFDA 4BO1A 4ZT5A 1SO8A 1SVLA 2LCQA 3B9BA 4IDDA 1V16B 4O5OA 4DNQA 1G6HA 5MN5A 4AX4A 2CV1A 1CEEA 1CJTC 1LSUA 2CXHA 2X1VA 4WN3A 1XB2A 3T94A 5H4GA 1KMHA 4DEXA 1PT7A 2DERA 1FJHA 3U2QA 4QASA 4AJLA 5FBZA 5BQOA 4GEHA 1B6GA 1E9SA 1Z0KA 3H3XA 4PK4A 5FR1A 4QJ5A 2C7QA 1XG5A 1X1EA 4MLDA 3OLQA 4FFPA 3QVZA 1T25A 4IOLA 4YP7A 2WZDA 2P4SA 5FOQA 2IXBA 4ZQIA 3KYJB 1JNYA 4U7DA 3MWYW 3T5PA 4X1IB 2ADOA 3H11A 5LQKA 1BE1A 2W6JD 4TS3A 1QV7A 1U2GA 4C01A 3K0AB 2I3AA 4V0OA 3GLRA 3OE7A 3UEOA 2PFDA 3TEMA 2XTJA 2R65A 1ENZA 3STHA 3WG9A 5JEEA 4P86A 2JLQA 1TRKA 3U60B 3U40A 3HCAA 2ZDQA 2PWBA 4PLYA 2YRWA 1H2YA 3LQ2A 4E2WA 3OZUA 4P53A 1M1YA 2V54A 1FYEA 1M6NA 4XUDA 3U3RA 1O96A 4KYVA 5JO0A 3TKLA 4BLTA 4M0MA 2YIJA 1G59A 1DBWA 2C57A 1TDJA 3QW2A 2ZBUA 5CFLA 4MI6A 3S70A 2PUFA 4IIYA 3L7BA 3BJMA 4BKUA 2D6FA 1TTPB 3ZQ6A 4PBSA 2J09A 5IN4A 2CLDX 2JLSA 3KDAA 1PGOA 5KU7A 4JFAA 1HH4A 1O9HA 3A1UA 3A4YA 3GFRA 3JAKB 4LDNA 2X77A 1D8AA 1T1GA 4NCHA 4PCUA 3OBIA 2NT4A 2HA4A 4R6XA 2TECE 4ZCPA 4E2FA 4O4IB 5BNIA 5DRYA 5GONA 1T26A 1W49A 2QL9A 3KJQA 1P81A 2JFNA 1G9TA 2C2MA 1U2PA 3JARA 4EG0A 3AYZB 1JTFA 3ETNA 2PGLA 4MQEA 5HZMA 2PXCA 5JMOA 2BDUA 3CZ9A 1KS2A 4IGIA 3UQYS 2AFIE 5JVDB 4ENWA 4I9FA 4P98A 5J1SB 2E48A 3VKVA 4HX2A 3KSBC 4GKKB 2PVPA 5YASA 4OU5A 2WY2D 2DPXA 2CVZA 4F38A 1IBCA 4FESA 1D4OA 3CH5A 2R7XA 3O6VA 3PR2B 1M2WA 4OV6B 2W4QA 4B3DA 4WT7A 4CIVA 1V7PC 1Z5OA 2CXNA 2GHIA 3W9BA 3WE7A 1K0FA 1KRHA 3JVIA 5BMVB 1E2GA 1ILWA 1L7QA 2BIFA 2P4EA 1KI8A 1UKZA 4GM4A 1ZOSA 2QGFA 1PTJA 2EZ9A 4MVJM 3SSOA 1VKOA 3WLIA 3ZV6A 4DXHA 2QX9A 5ALZA 4FEGA 4U2FA 3ILSA 3R4VA 4EVRA 2JIDA 3TZ6A 1X86B 4JZKA 4R7TA 1P2FA 3C3CA 5CB4A 2CUNA 2EJVA 3F90A 4JI2B 1W5SA 5HIIA 3PXUA 1X74A 5IJ9A 1ZN7A 2GYVA 3WXBA 5BXYA 2WWHA 3LG2A 4RULA 2BFPA 1Y5RA 5J5CA 5JZOA 3PTZA 3SMVA 1NMSA 3NEAA 5PGMA 3P2YA 5CNJA 3K0SA 1P0CA 2CV0A 1C4WA 5FWNA 1RKQA 4OATA 4IWXA 1ORIA 4FZ3A 2O2GA 4GI1A 4H1TA 2ETXA 5ELMA 1QONA 1VIVA 3WGHA 4BDSA 4JR1A 5AJYA 4TLCA 1XCPA 4QEDA 3DZCA 2CVPA 3AY7A 4GOND 3W0LB 3UK0A 3O90A 3SCZA 3DOOA 4PSCA 1Q0SA 1A9PA 2HDNB 3F49S 2NXJA 3PEVA 1XLWA 2I6TA 3QMPA 2C2HA 2YV5A 4RVCA 4UE3S 4XFDA 5AJXA 4AXXA 4CS9A 3Q6NA 1MJHA 2QX4A 2OEPA 2Z83A 5FWAA 3W79A 2BHNA 4CCSA 3C8UA 4PINA 2HV9A 1WQ1R 3EULA 2DPYA 4F4JA 2LR0A 1QE5A 3RJ9A 1ZHTA 3ZJUA 3DLIA 1JIVA 5A5EA 1MRNA 4UUPA 5LLDA 1G64A 2I67A 4YI5A 4Z9XA 5EE5B 1H6BA 1PQWA 1ZUNB 4MH0R 4BL5A 4DCMA 5DP2A 3GZTB 4CNQA 3EARA 3UQZA 1TQGA 4ZC1A 1DSSG 3VV2A 4Y2QA 4C5CA 5BVHA 3K7DA 4YRLA 4MUKA 5KDLA 1FLNA 2IX3A 3KBBA 3NHUA 3QE4A 1E5VA 1SVMA 4F5WA 3HI6A 3WB9A 4YFVA 2OR3A 3FXHA 5GGYA 1DAIA 3IV6A 4KX3A 1WQ4A 3ETCA 4UTNA 2OM2A 4HUQB 2ZJ5A 1TCAA 5BYBA 1JQKA 3LKDA 1PL7A 5CT4A 5G53C 5TQ0B 3COSA 4CMEC 1N2GA 2C59A 2GETA 1G2QA 2JRLA 4NX2A 4Q24A 4TL9A 1UP6A 1PR9A 2GJKA 3E7PA 3V48A 1QZTA 5JROA 1TTTA 3GLGB 4M1KA 1UPCA 1E18A 3Q2KA 1NBME 5L3QA 4G84A 5AKKA 4ND8B 3WBKA 4O79A 1KAHA 2WHEA 3GDOA 1I30A 1ADJA 2IY9A 4OD0A 3K53A 2HBRA 4MVUA 2GHTA 3UUGA 5HRCA 1VSTA 4OAPA 2HQ1A 3DW3X 1SC6A 2MR5A 3UA3A 4NONA 4OMCA 1E6CA 2ZJBA 5TRTA 4D45A 2HSWA 3HTXA 4CTNA 4G3XA 1GKKA 3VPAA 5CW2A 4XOUA 4J30B 4WZZA 1TYCA 3RYIA 1GY8A 3R41A 2P0EA 1O6ZA 4FE7A 3O1IC 1SUIA 2JJYA 1DU4A 2Y0DA 4WY8A 4MULA 3BCSA 3HBNA 1FU4A 1VJ1A 3LSTA 3PWTA 1F20A 4OQXA 3MGCA 3O8RA 2NOAA 4M99A 3ZK9A 4G6ZA 1B2RA 2GJ4A 5TX7A 1PW5A 2CZCA 3W1EA 4ZZ1A 3RVOA 3IHTA 3JWIA 1NE2A 1DQPA 1OVMA 1EJ0A 2HTFA 2O14A 3KPJA 3O8NA 4FMCB 1N3LA 1RRPA 2Z9DA 4HGZA 1LDEA 2EKZA 3I23A 3MMNA 3JAKA 1Z0IA 3RWMB 4IILA 1H5QA 4C1NA 5AUOB 4IFBA 1SVWA 2XRYA 3K9NA 4HQRA 4F5EA 1Y9ZA 1CQWA 3AFGA 4CKWA 2XDYA 3X1OA 1QAQA 3WGMA 1Q7EA 1RQRA 2AP3A 2HRDA 2W6IA 4GMHA 4NU6A 2YHBA 4FM9A 3HUTA 7MHTA 3MRVA 2FQ1A 1J22A 2O2HA 3F4KA 2ILTA 1IBLB 1PGPA 3QF4B 1UKVY 1XFAA 3VO9A 3MWDB 3HV2A 3IA7A 1QE0A 2QI9C 4F04A 3SXUB 4MVSA 3D5QA 4HO1X 3DDUA 4E7PA 2QTZA 3QEOA 4U9UA 3EGEA 4AJEA 3JX9A 3R7SA 2VDWA 4NMWA 4OPMA 3RC7A 4N41A 1K1EA 3SC2B 5H68A 1KA9H 3DLAA 4BUCA 4YCNA 4HNAB 3RKRA 3LA6A 1HM5A 3GPIA 3M9WA 2HXSA 1DIBA 2VDKB 4FQ5A 3NWJA 4OVKA 1TF2A 2V1XA 4EUNA 4Y2TA 2J3JA 2EW8A 1U3CA 3I4CA 1YB4A 3SX4A 1BJTA 4LHZA 1O03A 2M1ZA 2WJAA 2QD1A 3K70B 4QRHA 2IUFA 1ESDA 2PUDA 4JLDA 4U5XA 1LEHA 2V0GA 3UHPA 4NABA 5HGJA 4GXNA 3TW8A 1C2YA 1U9JA 2GM9A 1UJ2A 4TTAA 2XTMA 3GDWA 3R3JA 3TJMA 1E2UA 4MYRA 1KNYA 2VAPA 4P9TA 3IMCA 4OQ4A 1JVNA 1U3GA 3OF5A 1G5RA 4IMJB 2BKAA 1HEIA 1RAEA 5C8YA 6PFKA 2W42A 1N92A 3GRPA 2QN2A 4F56A 3ABKC 4KQ9A 3U0CA 3OEHD 3DMTC 2D5RB 4CT0A 4QOFA 3LOPA 1M1NA 3IOEA 1PS9A 1SZJG 1X6VA 2Y1WA 4W5NA 5EJEA 4TV8F 4Y0AA 5AW4A 1C7EA 1WZIA 3BGVA 1N77A 2H54A 2O8CA 3ZS9A 4MO9A 4I1YA 5ANRB 1OLXA 4AMUA 1TKAA 1VRVA 4EK9A 2PMDA 3CLRC 4PRYA 3I5QA 3L0OA 2P1DA 1OH8A 2P0AA 3L8IA 2A9KA 1L7NA 5A04A 3R7WA 2OZEA 1DRKA 1FPMA 2D2FA 4AG5A 4Z9BA 5TJ9A 2J9FA 3S6JA 5DNAA 1GU0A 2VDRB 4ETNA 1HGXA 4N9QA 1C30A 1Q6ZA 2V6BA 1U2QA 3PX2A 4GE0A 3SFTA 4ANFA 5K7SA 1OB5A 2IBTA 1B26A 1DINA 1PZNA 3E61A 1ISRA 1H5NA 3WLOA 2BFEA 4Y2XA 2GBFA 2RG1A 1MOSA 2PP4A 2CXPA 2MYNA 4EF6A 1PBTA 4MTCA 4P5EA 4Q3CA 4DBZA 5FNVF 2RG7A 2PO5A 2VBIA 1MOQA 5AKGA 5JECA 1OZFA 1IU9A 1XKXA 2JBHA 2PV0A 2YXEA 2EGUA 3FRHA 3RI3A 5F1PA 4OXQA 1A50B 4UNIA 1FL9A 3EVEA 2ENUA 4LOJA 4DRJB 3FPJA 3DEYX 3VSBA 1C1YA 3JD3A 2P3OA 3G2NA 5T64A 1WOYA 2YBEA 3QI7A 4RM3A 1JV2B 4P84A 5KC8A 2F7SA 2I3GA 1HPLA 3KEQA 3T9FA 4BEVA 2CC2A 4Q39A 1KTVA 1D5WA 5DTRA 3WLQA 4YMUA 3HEMA 1V48A 1P3JA 4FFBB 1FTQA 3IODA 4KQGA 1OCZC 1H2XA 2DPGA 3N3BC 4IINA 1C3OB 3NPAA 3REOA 1V25A 4L1KA 1RC1A 1U0JA 2AK2A 3G1TA 5GIOE 3FPEA 1N0VC 2NIPA 3RAEC 2ZIZA 4RENA 5JPIA 2FZLA 5JYBA 1U2TA 5DBEX 1Y7TA 4MP3A 4ZRMA 5LBTA 5A7FA 3IEXA 3VZCA 2WZQA 4E5SA 3CPEA 4UU7A 1SKYE 4CL8A 3P2OA 4OUKX 2NZXA 4XYMA 3TW4A 3K9CA 1NM5C 2D2EA 1XZJA 3IEIA 5HSWA 1OOEA 4M0LA 3SSAA 8GPBA 5LKRA 1BHQ1 1CF2O 1BDJA 3DOEA 4RORA 2W48A 2CSUA 1IG3A 4U6SA 4P0TA 4UHCA 1PKEA 2DGJA 2ONZA 3UV7A 2C2ZA 3AUXA 3GG9A 3PCXA 3WO0A 3UWKA 5JCZA 2IUTA 3NDRA 4BX9A 3TSCA 1XVLA 4PLZA 2DI3A 5DM4A 1C7RA 4X92A 3ZHYA 2HRZA 3FCAA 1E9FA 1RD4A 1NV8A 1YC5A 1U90A 3MCZA 3R7WB 3NHJA 3ZZUA 2R0QC 1JEJA 1EUDA 1ZUWA 3FCOA 1C3XA 4QDTA 1QANA 4KWCA 3RC9A 1ISHA 3WVNA 5EPEA 4BBPA 4LJ9A 2Q29A 2XLMA 3F3YA 3M6LA 3N59A 2ZKIA 4YROA 4AK9A 4XKJA 2C7OA 2WAXA 1OXKA 4U6QA 1TK3A 1ESEA 4ZCSA 4F8EA 4JLMA 2Q1XA 3ZWWA 4YRMA 2Y1LA 3DD7A 4KMRA 2NZUG 2Q4DA 3UFXA 2ZXPA 2HFJA 4N8EA 3SC4A 2ZW9A 4CLDA 5IPFA 1ULZA 3QUSA 1ZXBA 2BM9A 1EX1A 2IL1A 2W6ZA 1JHAA 1RKEA 3IHLA 1NF2A 2G4CA 3RW0A 4QULA 3WLAA 4EUSA 2RARA 4DA8A 3GZ4A 1EWQA 1T6BY 1UQUA 4INJA 4ALKA 2VA8A 4CS7A 4HS9A 1XZBA 2XQGA 1YTLA 4TLBA 5CXUA 1HKHA 3BXPA 1B76A 4AMGA 5LFAA 3DLTA 4TMKA 3DTNA 4QQRA 2DB3A 1GZHB 2I4OA 4MW7A 4OXIA 1Y4ZA 3DBRB 5ECGC 1KU6A 1Y8ZA 4BNMA 3OPXA 1RXCA 4Y2PA 3ESXA 3UJNA 1X8KA 2RGNC 3PHLA 2WVQA 3C8MA 3SZRA 3T34A 4MWTA 2HDWA 5FCDA 5T41A 2WJ3A 2PKYX 1Y3IA 2GDJA 1HDYA 2O2JA 3OZGA 1RJWA 4L4RA 3T0FA 2ISQA 3BMCA 3BXGA 4KVAA 4KO3S 5ES4B 1Y1RA 1GLNA 4RESA 4DANA 5IAOA 4WKCA 3AZOA 1CQIA 2XRMA 2LGJA 2VP2A 5KVQA 3EJWA 4O8ZA 2W2MA 2A9OA 4JLOA 1TLTA 5LYJF 3FMVA 2A1UB 2PZLA 5J4KA 4CE6A 4J1TA 2E9SA 2ISSD 3JVDA 4N5LA 4WESB 1M56C 5LYYA 1UQRA 4BV8A 1OZGA 3I62A 3RFUA 3I6ZA 2XGSA 4FWVA 3H17A 3ZZNA 4ZHQF 3IELA 2MIIA 3RU7A 3IQHX 2XE4A 2AC2A 2P4UA 3BCUA 1XP5A 4IDGA 3RVNA 1VXOA 4OM8A 2KI5A 4IS3A 2FY8A 3V6MA 3NT2A 1QH8B 3A3KA 3AUTA 2WM9B 4HQOA 3SG0A 4AYTA 2BTQA 1RAAA 2ZIUB 2GB4A 4RLFA 3WLEA 5KTPA 1RC8A 5COMA 1O54A 4X66B 3DVRX 1OREA 1H23A 5HCNA 3RODA 4EO4A 3AG1C 2OFXA 1T9CA 1UMBA 4TZ6A 2UU9B 5JLJA 3DWWA 4U63A 1UXIA 3AF4A 4E0BA 3PHHA 1ZHYA 5KX5F 4XFJA 3OX2A 1T9KA 4I50A 3ZHOA 3AFMA 1T10A 2XUIA 4JLBA 5TMEA 2YNMA 4Y1RB 4I5FA 4LJ8A 3D3WA 3QG1A 4GMDA 2RONA 4AB1A 4I4TA 3PJRA 1IXZA 1U8AA 2JL1A 4JOQA 3QX7A 3DE8A 4H3HB 4NZ9A 3AVUA 2EW1A 1MNAA 3K9HA 3L1JA 5CA0F 1T3LA 2P6UA 4E31A 4F96A 1Y34E 1ZH2A 2O6HA 2Q3LA 5J2TB 1JG3A 1K68A 1SG6A 5IAGA 3HVRA 1YZTA 1QU3A 5AC4A 1AHHA 4KAXA 1P9NA 1LVKA 2NV0A 2A3NA 5BY2A 1UDAA 4G1MB 1NLZA 3ZVKA 4YMVA 2O8FA 2KBFA 5LB4A 1D8TA 3O7MA 4Q4HA 621PA 3QKRB 4AQ7A 5JS1A 1BXGB 3MCTA 2ZPAA 4K40A 4WA7A 5EKUA 2QRVB 4A8JA 4LI3X 5LQMA 3VKFA 1ECGA 1Z7EA 1L5WA 1XZCA 2I34A 2GCPA 3C85A 3W3ZB 3IEUA 3TG2A 2PCJA 2P40A 2XTAA 3E15A 2ZS7A 3CKMA 5TXGA 2RGWA 4JB3A 4DCCA 1E62A 2HXGA 1D0YA 2IYFA 3GYGA 4LJ4A 4TMYA 3RUIA 4HN4B 5HZGA 4FCWA 3DDWA 4HZIA 4NZMA 3SDZA 3OJFA 3VDXA 1E2IA 3V9PA 3DVQX 3LYHA 1C30B 2FN3A 3F6RA 3C3JA 4DDKA 1VSBA 5LN1A 3O10A 1DBQA 2EFCB 3NTXA 5DLYA 3X1MA 1X7HA 2EBUA 3B20A 3J80A 2D5CA 4O2AA 4QOEA 3M89A 1Q0HA 2WT9A 3Q7PA 4UREA 5FLYA 1VGVA 1AZSC 3HNPA 3LRXA 4RIEA 1RC0A 2H2DA 3MB5A 2Z04A 1Y3AA 2HMUA 3KX2A 4EF5A 1I1HA 1AKNA 4BX2A 3CNOA 1NQWA 5BOVA 2W8BA 3V55A 2RKBA 1E5TA 2GZ3A 3I01M 16PKA 3NTOA 4I9NA 4A5SA 4JYCA 4Q7LA 4DWOA 1JIUA 1O94A 1X0XA 3EY4A 2O5CA 4N5NA 4EB6A 1F8XA 2FSHA 2YS7A 3L8HA 2BGJA 2DHRA 4F2GA 3UF0A 4YMIA 2C00A 2K7ZA 4P08A 3U4CA 5LZ5A 2ZYRA 1ABFA 4KNWA 1M8PA 2QK4A 5CFPA 1YCHA 1OX4A 3PDIB 3KL4A 1GTVA 1TA9A 3I2FA 2QTVA 5DJ5A 3EQ2A 2AFHB 3IP9A 1Y1SA 3PD7A 1DKLA 4OJKA 4KQ1A 5A6KA 4WKOA 1CXZA 4JXZA 3RS3A 4NJMA 3ZQYA 3RTGA 3ZV5A 5KYNA 4PJLA 1DZ3A 1ODKA 1NQAO 2JI8A 3TZHA 3KHKA 4TMFA 2QHXA 2X5KO 1AXEA 3D4NA 1TA4A 3F6YA 4MWOA 3HFRA 4F1KA 2C7BA 1L7DA 4C6RA 1CDOA 4I0WB 4W8HA 4E5NA 4D80A 4C4AA 2JGNA 3Q9UA 4Y7CA 5CCBA 2Y9PB 3VR6A 1ZYRF 4ZPXA 1VHDA 3C6QA 3Q1KA 2G3VA 3K9GA 3P2JA 1E85A 4JEIA 4FPXA 3GBPA 3H04A 1YJ8A 2JFZA 4NKRA 5E2AA 5JMWA 2H6EA 5I48A 4DV5B 1A8QA 1IM2A 1ZD2P 2FXVA 3AR4A 2GFIA 1XNJA 3R5KA 4FZJA 4NBSA 1LFAA 1U4OA 3C4JA 4MCHA 3L41A 2J32A 1TKRA 3G4XA 2DKFA 1HDEA 2IPXA 3IRUA 2ODAA 1NVFA 3DC7A 1XQ9A 4R51A 3N5KA 2PRKA 3HKCB 2HWUA 4QXOA 1DADA 1FP4A 3JQ7B 3THSA 3G2LA 1QF6A 3Q72A 4RA6B 2ZWAA 1CP3A 1CZNA 1GGFA 1L7AA 1MR3F 1XDWA 2XB6A 2XW6A 5CGQB 4WUVA 4I4IA 5CIYA 2NU8A 4EUKA 2RIRA 1RRVA 2RGAA 2ZJ4A 4OXYA 3TE7A 3V4RA 1VSVA 4O6YA 1N5MA 3ZNOA 1EE2A 2C9CA 2VATA 3RSGA 4WKGA 5SICE 4I55F 3C5HA 3D81A 5H82A 3KDSE 1W9HA 4Q5IA 1G3IA 3VJKA 3UTDA 1O9GA 2XITA 3D8NA 5C53B 3DGEC 3B3GA 4HZUB 2MINB 4MI3A 1E9VA 3PNYA 3RVRA 1NTRA 1I7SB 4GL2A 3L9WA 1WS6A 1FB5A 4DQLA 3DFUA 4C0HA 3COJA 4BC0A 5GOZA 3RTEA 4EIWA 2QAIA 1OE0A 2YC4C 3G2IA 3T15A 3ROFA 3ZLVA 2L6GA 2A5JA 4E32A 1GR0A 1IG0A 1N6HA 1LU9A 1PEAA 1QSGA 5NLLA 2QMOA 1AD2A 1M34E 1P7ZA 2OKUA 1T0IA 2AG0A 4FD2A 5IS2A 4HEA6 1JPNA 1YVRA 5IKXA 1ZUNA 3T1TA 4AZ3B 1UFBA 1H6GA 5JZSA 4EA6A 3CEXA 1N2IA 1PSDA 2Y1XA 4B5LA 3LDGA 3EHNA 1TM4E 4J1SA 1L7RA 4B3HA 1DJLA 4NCAA 1UOQA 1FMJA 3V8BA 4MS1B 5EEGA 1QYCA 3IAAA 3K1YA 4BAUA 1ADFA 2FEXA 1RKEB 1M75A 3EYAA 4OYRA 3JQ9C 5JWHA 5BMOA 2ZDGA 1FFXA 4BOYA 4QBKA 3KXIA 4GX2A 4HVAA 3VXKA 1MEJA 2Y05A 3H2IA 5A69A 3PDHA 2AC4A 1EI9A 2ZYHA 3N9IA 3S2FA 2WIAA 3K5PA 4FJ2A 4H2DA 3HO6A 2VHCA 2O05A 3LCJA 3OQIB 2Z2XA 3MHPA 3OPNA 4E7SA 5IY5C 1UT5A 1JSCA 1YE8A 2PWYA 2DULA 5AW9A 3FW1A 5JALA 1LFDB 1QIEA 2W98A 1DAKA 4UTRA 1GN9A 1YZQA 1E96A 4HY3A 1I9GA 3PLRA 3Q6IA 4JMLA 2CXOA 2FI1A 5EGSA 3OUTA 5HS6A 2RDMA 3DKKA 1NMEA 2NWQA 4JBWA 5TY0A 4JKVA 1WULS 3VZQA 5CHEA 5SZIA 3AUJB 2GPAA 3ZGVA 4MUEA 4L2IB 4QBHA 1BR2A 1QH1B 2RB5A 2DPMA 2XMBA 1V35A 3LXUX 5KNDH 4NOKA 4CR6A 1E83A 3O4RA 5K0CA 3AH8A 2WVAA 4LIPD 1VJ5A 1RKCA 5CFRA 3OU6A 4IFEA 1TYAE 4BZPA 4GUAA 4YAJA 2VT3A 4TLMB 1CY8A 4O0MA 1CSEE 2IYQA 3L0PA 4XUGB 3M4CA 4EPWA 3QLJA 3IGFA 3QUQA 4WKPA 1C7IA 1ZCBA 3ND9A 4I1UA 4LY0A 2P9FA 1UPFA 3NEJA 5JSKA 2HLDA 1TMGE 1CJUC 2CFCA 1NQUA 4LJLA 3FJYA 3OWHA 4Q9NA 2E4VA 2OFPA 5BXQC 5LYJB 2AEJA 1OU4A 4PGMA 1DZIA 2XYQA 4HG2A 4Q5SF 1SOAA 3LLIA 2RHRA 2QRPA 2HIMA 1SKAA 1ETHA 4ZRDA 2BBWA 2QS9A 2VJLA 4EI8A 3TGLA 1MABA 5BT8A 3DXFA 2CDNA 3V2UA 4FBLA 2BE7A 1WOMA 2FR8A 5DM2A 4HAUA 4BWYA 2HRQA 2B7LA 5LMUB 4UC0A 1GZSA 1QE3A 2CNLA 2Z4RA 2AZXA 1QFJA 1KWGA 3AHFA 3T5DA 1XTJA 2HNBA 2YHAA 1EVJA 4YHHB 3Q3HA 5K3OA 1MX1A 3KQVA 1BKSB 1HYQA 4G0WA 3L0SA 3RYHA 5K0SA 2R7NA 4A6PA 2PGDA 3QUBA 4CU2A 2WFLA 4C5BA 2PX8A 2C9BA 1M1XB 2CYAA 3O0DA 2MSDB 1W96A 3IIKA 2WQ6A 2JJMA 3UMSA 3S1AA 4QUBA 2YN4A 4YAKA 1QB7A 2ZATA 3OZDA 2PX6A 2H18A 4MITA 5AOBA 4RZ2A 5EWLB 5G0UA 3RS9A 1FTWA 4BRUA 3IVXA 2GZAA 1QOZA 4Y2RA 4GU5A 3FVWA 3OT4A 3RVDA 1RVV1 3TZLA 2ZRQA 1DRVA 4MKIA 1JZSA 2G1AA 4WZAA 5LBUA 2I7CA 3DVAA 1EVEA 2V26A 3G0CA 3QKIA 2ADMA 5HSGA 3BGWA 2YQZA 4RUKA 1UKBA 3EC2A 4ONEA 3ULKA 2VP3A 3OFJA 1J0AA 1EVLA 1RHJA 3KPWA 5M7EA 3FNHA 4UDOA 1WCIA 1V26A 2YS6A 3KYJA 1R8JA 4JT4A 5CIWA 1R74A 2XB9A 4IB4A 3PEEA 3ABZA 1OXVA 1L4YA 2CDAA 2O5RA 5E6UA 3GPCA 2FPSA 1P45A 5HP4A 2YV1A 5KBYA 1MHPA 3WZ2A 3AIKA 3ORYA 2ZSBA 3QXXA 4OYLA 4AFNA 1U1IA 1ML4A 1ZA2A 1OXTA 4RWZA 4Y9SA 3ZR4B 3GP5A 4KLZA 3CUWA 1I6MA 3LUJA 1JR3D 1E3DA 4W9NA 2OORA 4KSYA 1SG9A 1KAMA 2OHIA 2IDKA 3D0RA 4J0FA 5DH9A 5BN4A 1K7CA 5D51S 2X4IA 3WA7A 5GJWC 4EVSA 4LOLA 4Q1AA 1J09A 2AN4A 2G72A 2VCEA 1N3BA 1D4AA 5A05A 4URXR 5J4LA 4UATA 2Y4OA 2J9RA 1AXGA 1WLSA 2H51A 3LPNA 4IXTA 3V7YA 1H3EA 1LSJA 1UFKA 3K4HA 2QL6A 4TL8A 5JSFA 3I9LA 1C02A 3AFIA 2FU5C 3ZCSA 1SBZA 2AKYA 2GZDA 1KQGA 3UXEA 1PRYA 3HU2A 5T8KC 3KSAC 1KVQA 3NIDB 3KG2A 4AM8A 1RSZA 3Q12A 2AFHE 1CHDA 3R0ZA 4D8WA 2WNIA 4MAMA 4TTVA 5BSGA 4RZUA 2Z2ZA 4DV7B 2W9YA 5G4KB 2FGJA 3JQDA 4F8YA 3JAWB 4OLHA 2J48A 3OH8A 3CS3A 3EXFA 4R8VA 3R3XA 3CEPB 2WT4A 4ZIRA 2VNJA 3O3OB 4JC4A 5F35A 1KEPA 3UXYA 4DBLE 1DWOA 1ZD9A 2Z08A 3HUUA 2XLWA 3EIHA 4EA9A 1VPWA 4M6WA 1QYXA 1JE0A 2IHBA 1MPTA 4OD4A 2W2TA 4RCYA 3TRIA 1RPTA 1ND6A 1NMYA 1UBKS 3ACDA 2IU6A 3DTVA 4MOWA 1BW9A 1BMQA 3TIGA 4BVJA 4PC6A 2W9XA 5KSWB 5BPFA 1SR2A 1GVNB 2JCYA 2XNHA 4N12A 2AR9A 4URUR 4O29A 4OXKA 4WADA 4HMQA 3U49A 2B82A 1G42A 2VZ0A 2PQ0A 1MG5A 3SZOA 2FUEA 1X7ZA 3MWGA 3U3DA 2HWWA 3LQRA 5BUSA 4EFKA 2YXPX 4I1OA 4RLHA 4QATA 1AA9A 3KO8A 3TLXA 1DJMA 3K0FB 1YDEA 2D5IA 2NSDA 1T8UA 2GBLC 4KQJA 3VU9A 1RI5A 1YNOA 1WXEA 3AP2A 3HU5A 4DS3A 1J23A 2R8BA 5JAUA 2H8GA 5CDGA 4JEUA 1AEPA 4Z9IA 1GPH1 1OASA 1ZSYA 4RGBA 1B2LA 5A4IS 3A6HA 3C8GD 5FDFA 1XAIA 1Z4IA 1KE1A 3TB4A 3GLGA 3HU3A 4NMXB 4YQYA 1FTYA 4ZANA 4EMTA 4KBYA 1L5ZA 4R5MA 5KQMA 3CXUA 4B09A 2EPKX 4K1LA 2Y76A 4FDMA 4UAJA 3KSZO 4AKIA 1E63A 3PQ7A 2HO4A 1M54A 4TRMA 5T6MA 2GEUA 3QP9A 1ZNQO 2VNHA 1TFKB 2YL2A 4HL6A 5FL7D 1WMEA 3LMKA 1U1FA 4FUTA 2HBYA 4EB8A 3LX5A 4B4DA 2NO6A 2CKDA 3DAOA 1I1OA 3G8DA 3QVVA 3M5WA 5TQVA 1P9LA 5KTKA 3QPBA 2CXUA 2QUBA 1J8FA 2OVBA 3FFWA 3PEUA 4XWWA 4GOKA 5IX8A 1Z35A 4O3MA 3VR2D 4DLKA 2IY7A 2NU9A 4OBEA 1P0IA 2JGJA 4XDYA 2OHHA 4E51A 4W8KA 2SKDA 3VNRA 5BVHB 2ORED 4QFMA 1ZZEA 3O82A 5LQAA 4L8VA 4S1WA 1V8BA 3H7IA 4WKBA 1SU8A 1Z3IX 4YRCA 3HRKA 3X1ZA 1G7SA 1HURA 4PICA 1ELOA 4TXNA 1PT8A 4CKEB 4EX7A 4INAA 1XJ0A 1GQOA 3B5JA 2ZB4A 6CHYA 1SOWA 3KEFA 4R1PA 5KCMA 1F1BA 1ZQ1A 5J3JA 1QQ6A 3IDAA 4GI2A 4PR3A 5HM8A 4TTTS 2O7VA 3VDNB 2FEKA 5C4GB 2CCGA 1U3VA 1KEWA 3TMYA 4ZCRA 5B36A 1U6KA 5AO9A 4LZWA 2PIAA 6REQA 3H2HA 3AF3A 3CE9A 3UK7A 1ZNZA 2AU5A 3L8MA 5B4TA 2BE9A 3AGQA 4N6CA 3TBHA 4YMHA 3L6OO 1PZEA 2N9UA 1PVOA 3EOBI 3OM0A 4IIGA 1TAUA 1AS0A 1SIUA 3H5OA 4HEHA 5EZ6B 5JCOA 3NHBA 3WGYA 1K3FA 1HTBA 3UV3A 3M6FA 3ZEIA 3GL9A 4M76B 5ESRA 2EFJA 3DWFA 4GP6A 2DPHA 2HSBA 2Z6QA 3WRXA 3GVIA 4C20A 1Q6YA 1WVMA 1H69A 2ZRJA 3LF1A 3R6DA 4G8DA 1PZXA 3M2TA 2QJWA 3GG2A 2DRIA 3BIFA 2ZGVA 1QHEA 3G2OA 1TJ4A 2X4DA 4NC3A 3VU3A 2OP0A 3WQSB 4MPPA 1IM8A 2I0FA 3G8YA 2WV7A 4G01B 3VZDA 3H86A 2P2CA 1XDGA 4GBJA 1U94A 1PG2A 1W44A 2BVNA 4A0HA 1X1CA 4WWHA 3RLIA 4P5PA 1PO7A 4FXOA 1PG5A 4JDUA 1KZ7B 1FFSA 4FQ8A 3CF6R 4F7WA 2WSSD 5L4NA 1YR8A 2NTJA 4C0KA 1ULAA 2V5AA 4LA4A 3E53A 1HTTA 3TM4A 3X44A 4CMEA 1MMNA 2FPGA 4R83A 1DT5A 2R7AA 2WSBA 4HLUA 1U3UA 3RIGA 2KQUA 3K0CC 2KE5A 5COFA 4MRPA 1APCA 4FT2A 2CUKA 5F7ZA 3A6PC 3FHTA 3GBVA 4LYAA 3IIIA 1SAYA 1MVLA 3DUFA 4QGFA 1MC1A 2EWWA 4I55B 1AB6A 2H7BA 1SIBE 3A7DA 5AH0A 4N82A 5DT9A 3VR2A 5HZKA 4R9VA 1FMVA 1MZVA 5F1YA 5B55A 4LTNA 2EXXA 4UZEA 5D84A 3WQQA 2V3CC 2XTZA 2I7XA 1OV6A 3IE1A 1CUJA 5K8JB 1G20E 1VG1A 4WPGA 4ZJUA 5DNUA 1JAFA 1YQXA 2ZQYA 3TK0A 4ES6A 4CDNA 1WF6A 3SQWA 2XOKD 1MVOA 2DSTA 2HBQA 2WSMA 3NBUA 3U7RA 1RI1A 1Z0FA 3OMWA 1G8YA 3FZYA 4O4JA 4X3CA 3TWOA 3TXYA 3GLIE 4KREA 4R81A 4RK7A 2A0UA 4EECA 5IJZA 4WL0A 2IHUA 3LESA 2M64A 2C9DA 1XEXB 1AOXA 1CRLA 1XPOA 3D8TA 4EZBA 2BRUC 4FFOA 4QBIA