3DMDA

Structures and conformations in solution of the signal recognition particle receptor from the archaeon pyrococcus furiosus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
318
structure length
310
Chain Sequence
b'MFGKLREKLKSFVKRVEEEVEKEEEEVELTVEIKEKDVDKALDELEIDLLEADVALEVVDALREKIKQKLVGKKVRIGTDKGKIIEEAVKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADARGGAALSISYVIDAPILFVGVGQGYDDLRPFEKEWFLERIFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle receptor
molecule tags Transport protein
source organism Pyrococcus furiosus
publication title Structures of the Signal Recognition Particle Receptor from the Archaeon Pyrococcus furiosus: Implications for the Targeting Step at the Membrane.
pubmed doi rcsb
total genus 116
structure length 310
sequence length 318
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dmdA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dmdA02
3TSOA 1RRFA 3WYAA 1IJFA 3VFDA 2W2TA 5B64A 2W0MA 3W90A 2EQBA 1XEXB 4PC3A 1G7CA 2RMKA 4RFSA 5BYKA 1KI8A 4Q03A 2GZHA 3GJ7A 3CONA 3LLMA 1AA9A 4TYWA 1VHLA 1EWQA 1SVMA 3TNFA 5EE9A 1NN1A 2SHKA 1U2RA 3K09A 2GEVA 4J0QA 1ZU4A 1MABA 1ZCBA 5E3HA 3CF6R 2V7QA 2BJWA 2O8DA 3AB3A 1TPZA 3EG5A 4MQBA 3WY9A 1E0AA 3B13B 4HLQB 2C96A 2FEOA 2PMDA 1WBBA 2C04A 2QQ0A 3NHBA 1S2MA 4Q18A 1MT0A 1X1SA 1ZD8A 1RPZA 4NDZA 3FHOA 4E03A 1W4AA 3K0CA 3UMFA 1I4DD 3QPVA 4IDOA 4TL8A 4RD4A 3JVUA 4XSGA 3GMTA 3CBQA 4NYJQ 2VP2A 2ZPTX 3K9NA 5FOUA 1GL7A 1G64A 4IDHA 1G8FA 1Z28A 4JL8A 1NN0A 1TQ4A 2C78A 1UBFA 1TU4A 1W5SA 1Z83A 3GEEA 2ZRMA 4PC7A 2FZLA 4HI0E 3KXLA 3GLFA 3CRMA 3QBVA 5CLQA 1KK2A 1UM8A 3IQWA 1GRRA 4JLAA 4JKIA 3ECCA 1JECA 2VSOA 3RS3A 4C2TA 4ESHA 4B33A 2CCGA 3AVVA 4D25A 1GKYA 2FSFA 2HEIA 3VHLB 2CHGA 1XRJA 3T1QA 3AF2A 4QM7A 4ZCMA 2WZQA 5B2ZA 3X2SA 5HTKA 1Z06A 4DLZA 1CR2A 5G3YA 2NO6A 5TDHA 3T1OA 2ANBA 2P6NA 3HYTA 5HCNA 3AVXA 1NBMA 4GFDA 4LV5B 2A2ZA 1BO6A 1H8HD 3OEHD 4AC9A 4DXAA 4MH0R 3ICEA 1F2UA 1KI6B 2IHYA 4EFNA 3SYKA 2NO9A 4Q00A 2MSCB 1R6BX 1JJ7A 2CBZA 3BORA 2PJZA 2ZR0A 2DBYA 3QKSA 2CEAA 4MYUA 4BFZA 5FTKA 4M0LA 4ZDWA 1VIAA 2H5EA 2WV9A 1L4YA 1P7CA 2GILA 5C18A 4RFVA 2PLFA 3PQCA 3SEAA 2OE2A 4NONA 3QNUA 3U5ZB 4HSEA 1CKEA 1OKKD 2GJSA 4KO8A 2OFOA 1AKEA 3QQ5A 1V5WA 2IHBA 2DFLA 4M8NE 3TQFA 1EXMA 2J59A 2ZE8A 3QEOA 1U9IC 5C2JB 1W36D 1E94E 3GFPA 3QKRB 2W6JD 1OJLA 3DKPA 4G01B 3THXB 2CHVA 4G5SA 2W6IA 4AKHA 3EA0A 1X8LA 2C9CA 4G3XA 1G16A 5K8IA 3IDQA 1WBDA 3CX7A 1NG9A 1CULC 2FDCA 1WB9A 3FMPB 4W7SA 3GFTA 2QGNA 4LPSA 4A92A 5D3MA 3PR1A 1JPNA 1XMVA 1S1MA 2CL6X 4XWOA 3L0SA 4M4SA 4FCTA 3IPXA 3MJRA 1MR3F 1Q44A 4AURA 3TUZC 2A5YB 1RE0A 3K09C 4RY2A 3TBKA 4BFVA 1CR4A 1FTSA 3GD7A 4JLBA 4PQYA 4URUR 2VSFA 4RD3A 4M9XA 1BS1A 5IK2A 1VG1A 1AM4D 4JT4A 4A2QA 2ZE7A 1GUAA 1JEEA 1XNJA 1KGDA 4FW9A 3K70D 2YWFA 4LHVA 121PA 1LF5A 5J47A 5LD2B 1DS6A 3QG5A 4GP6A 3RAPR 1D2MA 2ZRJA 1KI9A 3ND8A 4NTZA 5DI3B 1QZXA 2NZJA 3ETLA 1UAAA 5HKKD 4JJZA 4YMWA 3IQXA 4LHWA 2WJGA 5BN3A 5AUNB 2DWPA 2YOGA 4LHYA 2VF8A 4MYHA 1G9XA 4B2PA 2N46A 4IDNA 4OHYA 5B57C 1Z22A 2Q9BA 3CX8A 3D6TB 2RGNC 1EFRA 1PUIA 5CK4A 2JLRA 2C98A 3ZYCA 4QJ3A 5TB5A 4PZLA 4C2UA 1AS3A 4ZCIA 1N6HA 2AKAB 4F4CA 4Q48A 2WHXA 3OIWA 1YRBA 3JZMA 3RYTC 5CDFA 1X8JA 2EU8A 4M1MA 3ZDQA 2Q0HA 2QU8A 2FSIA 1II8A 4C0AC 4LJ6A 3VR4A 4TT3A 1DEKA 2V55B 1T0JB 1Z29A 3GEHA 3TW8B 4DB2A 4AK9A 2VLIA 3OIYA 2NG1A 4HYYA 5FH9A 4BPBA 1SZPA 4PSVA 1E2KA 2H17A 2J0UA 2CK3A 1YZNA 1DAIA 2QE7D 4AD8A 5E7IA 5JFGA 1E9BA 4FI3C 1ELOA 4IHQA 4O2RA 4RKFA 2IL1A 1JAHA 4NE2A 4UXHA 5FPHA 3LRPA 3CWZA 3UANA 2ZIAA 3N2IA 1XPRA 4CEJB 3MWKA 1A2BA 3AVYA 4A82A 1HY3A 1T4GA 3MLEA 2XOKD 2WKRA 3VR1A 5FPKA 3AM1A 2ZJ8A 2Q3FA 4OKSA 4HB2A 2XXAB 2OHFA 4Y0AA 4KFUA 3X1WA 1R4AA 1R7RA 3OZXA 1E2FA 2IBMA 2ZI6A 3FGNA 2JLUA 3ZH9B 3REGA 5AJXA 1KSFX 2JATA 4I1VA 3K0AA 3NXSA 2XSZA 4QBIA 4RZ2A 3VAAA 1XXHA 5L3QA 2ZJYA 3U7FB 3FVQA 3AF4A 3VU9B 1S9DA 3KFXA 4BLRA 1CJUC 2P0EA 1N0VC 3MWLA 3KKOA 3OAAD 2FE4A 2RH5A 4PAMA 4G1UC 3TAUA 4D6PA 4NYMQ 5A5GA 2EFDB 2XNSA 3ADBA 2WTUA 2GCOB 1KAGA 3R8FA 1JR3E 1VCNA 2FFBA 1YE8A 3SHFA 2DFTA 3QIAA 5EXTA 2YOHA 1ZW6A 1E9FA 3L0PA 4KV9A 3AEZA 4DUGA 821PA 4Q9LA 4QM6A 1P2TA 4TLAA 1W49A 2IEZA 1A82A 4A2WA 5FPYA 3CRVA 2F7SA 1W0JD 3WNDA 1YJ5A 2Z6VA 4YMVA 3BOSA 5KO2A 1S9HA 3AQ4A 3RDPA 1Q57A 3FKQA 4M1YA 3SQWA 2EFCB 1KDTA 1NLZA 1JXOA 3GLHB 4I4LA 5SZKB 5EE0A 4LRWA 2OO7A 4FMCB 1NL3A 2GJKA 4OI2A 5L3SB 4A1FA 1ZAKA 4TMZA 3GP8A 3G5UA 2NQ2C 2F55A 1FX0B 4M9ZA 1CJVC 4DDTA 3O8RA 1NI3A 2JLZA 1J99A 2ZI4A 4P31A 1IQPA 2F1RA 1DVRA 1SVLA 4XJXA 2BMFA 5DI9A 4A36A 3K0EA 1UKVY 2GCNA 3CW2A 4MGKR 5DH9A 2GXSA 3F0TA 5J5CA 1UDXA 3RS2A 5IT5A 2D4HA 3LD9A 4DEXA 2XJ4A 1CTQA 5A4JA 1ZNWA 4OHVA 1W7AA 4LK2A 4IVPA 3THYB 4GZMA 3CX6A 1W2GA 1Z6TA 3FMOB 3HP1A 2FFAA 3QXXA 1QG4A 4F38A 2CDNA 5AJZA 1HT2E 1XEXA 2ODWA 1OB2A 3PUVA 1GIAA 3NH9A 4DCSA 3FDIA 4ZV4A 1XEFA 3K1JA 2WWHA 3DL0A 3PFIA 3H84A 4KBFA 4POAA 5BYJA 1XJQA 3CLVA 3KQKA 1PVOA 1Q1BA 3W6NA 1KI2A 2I1VB 2X77A 3P32A 2IF2A 4FCWA 4JVSB 3PJRA 3NBXX 3PVSA 2OBLA 1RZ3A 1NNEA 4JLKA 3FOZA 3O8CA 3VX3A 2IXGA 1YZKA 1M7HA 3LY5A 3ND9A 3CNLA 1UFQA 3RSOA 4B3BA 2PEZA 3UKDA 1KDRA 3WBJA 1XFAA 1RW4A 2IS2A 5IHPA 1UF9A 4F4JA 4DSTA 1DO2A 1CBUA 1QHHA 1U0LA 1ZUHA 2WKQA 4OQNA 4Q4AA 5KSOA 5IF9A 3WNCA 1M74A 4LYHA 1L4UA 2JJ2A 4B32A 1IAQA 1LTQA 3FE2A 3QOFA 2ZQ5A 4E09A 1JPJA 1VCIA 5GJWC 3OHMA 3V4RA 4QBGB 2J0VA 1WQ1R 5FPTA 2FFHA 2O0KA 2QTHA 3RLFA 1PZNA 2FPKA 4IOJA 2O8CA 1DELA 2ZUBA 4HUQA 2ZJ2A 1IY1A 1E0JA 4L16A 1NVVR 3BB1A 4AKIA 4C0BA 4TL6A 3B1WA 5SZHB 5TV2A 3DPUA 1XCMA 4LBZA 2UZ3A 1Z0FA 3DVLA 4O25A 2VF7A 4BLTA 4RD6A 4L4UA 1AS2A 2OFXA 1HEIA 4TMKA 4UQOA 3VKHA 3C15C 5EJEA 2ERYA 1U8ZA 2DFKB 4LJ4A 1DPFA 4BZPA 4V02A 4Q02A 3DZDA 3B9PA 4YMSA 4OYHA 4BFTA 2ODNA 1KMQA 1KY2A 3THXA 1Z3IX 2GBLC 3ZLJA 1MRSA 1IY2A 1XB2A 2ZYVX 1Z8FA 1FMJA 2C95A 4D0LB 3TSWA 3ZZTA 3I62A 3ZGXA 4S35A 4KFTA 1E2IA 1D8TA 1BYIA 4N0DA 1G1MA 1E2DA 2YZ2A 3P4YA 4C0KA 1G20E 4KAXA 2IUUA 5ELXA 2AXNA 4IEEA 4ZO4A 3BFXA 3QF4B 2D3WA 2DWQA 1COWD 1KSJA 1QF9A 2K5UA 3NBFA 5EE5B 4ZPXA 4HAXA 4ZCLA 2ZJOA 3CO5A 1G18A 4ASUD 1N25A 2QMEA 2IYXA 4CDGA 1E2LA 3MAAC 1GRQA 1JR3D 2WWYA 4TMWA 5L3VA 1N5JA 4OBEA 2MSEB 2P67A 3QUSA 1JALA 2RKOA 3VKWA 5JI2E 4IJMA 3K0SA 1NKTA 4XWAA 3BH7A 3GLIB 2HF9A 1Q12A 2REOA 2FZ4A 2WOOA 4LCBA 1XMSA 1RJ9B 1ESMA 4P3YA 1KDPA 2YNMA 2WJYA 5FUWA 3M4YA 3W6PA 1TAGA 2G0TA 1B0UA 2HCJB 2DYKA 4GP7A 5BQ5A 1GKIA 3BXZA 2ZSFA 4YXWA 3THYA 1BMFA 4DSUA 3NH6A 5L8VA 3DMNA 1OH8A 2H1LA 5ANRB 4EQ6A 3GLFB 3LDAA 1S0UA 5FOWA 4JLNA 1EESA 3CIOA 4GMXA 2Q9CA 3WNBA 1O87A 221PA 3GLFE 1FX0A 5FOSA 4IFEA 1GNRA 4BLPA 2VHTA 2EFEB 4D4JA 1T6NA 3D8BA 2FGJA 3KXIA 1TQDA 4NCHA 5JBQA 2FFQA 2OV2A 3Q9LA 4HZUA 1NVXQ 1OPXA 1RFLA 1SVIA 2QMOA 1ZM3A 3IUYA 4QRHA 2RGGA 3HYRA 1XWIA 2ZR7A 2OCBA 1W48A 2IT1A 3LA6A 2C8VA 2NPFA 2WSSA 3M6AA 3MUFA 2NZ8A 4MRRA 3KJGA 5GJVC 4BUJA 1E2JA 3SQXA 4LZZA 5H1YA 1E3MA 1EX6A 1LW7A 5DHFA 4B74A 1TEXA 4DRZA 1N6KA 3OESA 3QXJA 4HEJA 2Q9AA 1F60A 1VYUA 2ZSAA 1AQYA 1CRQA 3WMGA 4GZLA 3SBDA 2PCJA 4DT1B 2AD5A 3GJ6A 1FNMA 4PAOA 1Y3AA 2DFNA 1GP2A 4NYIR 1UADA 2OLKA 2WIBA 3SZRA 5DN6A 2N42A 2J0SA 4OHXA 3ASYA 4Q9HA 4IVQA 4PC2A 4IRUB 4TMTA 3TKLA 4Z51A 4DHEA 1K5DA 4OQFA 4C3ZA 4AG5A 2E9SA 3CB4A 2VHUA 4D4LA 3PENA 4IOKA 2VL7A 2DWOA 4JS0A 4FCVA 4K81B 3QKSB 5CLLA 2BM1A 2VBCA 1QHNA 3VR5A 1SKQA 2O5VA 5JMTA 3VMFA 2IK8A 2IA5A 1AQUA 3JZAA 4W5HA 1EFCA 2WAYA 2XNDA 3OFND 3QXSA 2AX4A 3BFKA 2OZEA 4KLNA 5AUOB 4P32A 2BOVA 1E2EA 2IYQA 1FP7A 1DAMA 5KNDA 3U4QA 5FBRB 3UWOA 4MRVA 1ZM2A 4NBSA 2L0XA 2PZFA 2FNAA 1X6VA 5P21A 1E2HA 1T9HA 3HPQA 1PLKA 4LY6A 4EPVA 1XZQA 1K8RA 2V1XA 1MV5A 2PBRA 2QAGA 5JS8A 1S3SA 2VO1A 2XTNA 4LYJA 1LS6A 2NIPA 2GAAA 4C0LA 4D4KA 2KWIA 2XJ9A 2D62A 3CRQA 1E99A 1T0HB 3U3RA 4OJKA 2ZJAA 4R2IA 3KQNA 5EXXA 1P61B 4EDHA 5EQTA 3W34A 4TZ0A 1QVAA 3SS8A 1Q1ZA 1W36B 1CR1A 1YZUA 3W6OA 2WVJA 1TF7A 5AUQA 4JMPA 3NEYA 4PPFA 1U9IA 3TR0A 4MDFA 5AJYA 1XEWY 4B3CA 3MFYA 4QGGA 3MCAA 4FINA 4MUBA 4A8JB 2B92A 2EYUA 3K70C 1OYYA 1U90A 4H1VA 5JWRA 3N5CA 5AK0A 5CM9C 4E5UA 2IX3A 1JR6A 3A37A 4FMDF 3IIMA 4AYTA 1DARA 5LB2A 5EUQB 3ZJYA 1GG2A 4W5WA 1FNNA 5JS7A 1ONBA 3EPJA 2A30A 3SC3A 5CYPA 1S4QA 2E87A 2JLXA 4MYCA 1KI4A 2HXSA 3T5GA 1XJ0A 5KDDA 1QHIA 1JBKA 2LWIA 1E96A 4Q1EA 3EPKA 1Z47A 2BWJA 1D5CA 3AUXA 3C41J 4OQXA 4URZR 3BRWD 2PX3A 4M1WA 1S8FA 3PUYA 2IWHA 4HUTA 4R71A 3A1WA 3TIFA 4CEIB 3M1IA 3C14C 3NC0C 1NF3A 3SOPA 2ZETA 1KNQA 2R6GA 3A6PC 2O8FB 2ANCA 1NJGA 1LNZA 5CB6A 1II8B 3I5XA 5CK5A 2QORA 2BEJA 3SFZA 4EPYA 1EK0A 2ZTSA 3OEEA 3V00A 1I4TD 3K70B 1NVWQ 2VP5A 4GOKA 4KITB 1UJ2A 4QFMA 1R8SA 1Z0IA 4ABYA 2ZRIA 4W5JA 2XX3A 4UKDA 5FR2A 1M6NA 3EZ6A 2BMEA 4QXAA 2HF8A 1G4UR 2CL0X 3QKRA 2NO1A 4UXIA 4QBHA 4TTQA 2YV5A 1XTSA 2G6BA 3A58B 2KJQA 1XMIA 2W58A 1MKYA 3ZVLA 2RCNA 3KXKA 4EPTA 4DKXA 1P62B 3OE7A 2VQSA 4MRNA 4DSOA 2JLYA 4B75A 5H70A 4DVGA 4KU4A 4DLTA 4B3GA 1EWRA 2QPTA 4EJSA 3N70A 3GPLA 2IUSA 1MO6A 4Q7LA 1KDOA 1ZNZA 1GILA 1HUQA 1DAFA 2WJIA 3EIQA 3W3AA 4TWZA 2DR3A 1R5BA 2WMOB 3A4MA 3U60B 2GWHA 2V4ZA 2P6RA 1XD2A 2ZRBA 4EIWA 1UBEA 2FOLA 4LV6A 5EP3A 4NCJA 3RWOA 3V9PA 1VG0B 2Q3HA 3VX4A 2VA8A 3F3YA 3KL4A 4HAVA 1IOZA 3FYHA 1G3MA 2OM2A 2HJGA 4KSBA 4XH9B 3RS0A 2O8EB 4UNRA 4HDCA 2WIAA 2ZSEA 5CJPA 2VP0A 1UEIA 2V1UA 1P73A 2BBSA 4V0NA 4QJ4A 3RSLA 1OE0A 1TTTA 3EPHA 3OEHA 5FUVA 3RC3A 1ZIOA 2PX0A 2Z43A 4ESVA 2AHOA 2CNWD 2KBEA 1EG7A 3Q5DA 1N6RA 4PO8A 3LBIA 4JLJA 2IS4A 2YKGA 3AKDA 3SJBA 4DCVA 1Z0DA 3LFUA 3BERA 1AS0A 1JI0A 3EPLA 4BRUA 1IBRA 2OFWA 4OI0A 5FBVB 4JL5A 5FTJA 4XTRA 621PA 1RC8A 1GVNB 2J5XA 4HATA 1OIWA 2Z0MA 2ZSDA 1TX4B 2MMGA 3MWYW 2WWWA 2V3CC 4O0MA 2BBOA 4PXAA 2O8EA 2ATXA 3TE6A 1RRPA 3O47A 2CVFA 5KNCA 1CP2A 1LY1A 2PMKA 4TLDA 3UWKA 3ZIAA 2PH1A 4PHHA 2W6JA 3K9HA 3U61B 3FWYA 3KUDA 2MMCA 3L8YA 3UMSA 2RAPA 1O3YA 2ZYWX 3TLXA 1WE2A 4B44A 2QTVB 2WPDD 1ZMXA 3TRFA 4QG7A 3KJIA 3QSYA 2HCBA 3L0OA 4KJZA 4PQFA 4KSCA 5FBQB 2V8OA 4FD2A 1HH4A 5B58C 1II0A 2G1KA 5G3ZA 4ERNA 1G6HA 2QSZA 3IKJA 2HYIC 2JJ1A 1KK1A 3G82C 4Z8XA 1G8PA 3S1AB 1MOZA 2P2LA 1N6NA 2F9LA 3QBTA 1OLOA 1CLUA 1N0WA 2P3SA 4CT5A 4M9SA 3R9WA 5AJWA 3U6KA 3Q72A 1XX6A 4DBLC 2BKEA 5E95A 3SR0A 2R62A 2BBWA 3FB4A 4HDQB 1VG8A 4LDJA 2J9RA 2AKYA 2G77B 4QHSA 5FL7D 2CLCX 1R0XA 3GCGA 1W5TA 4BEJA 3HU1A 3KJEA 4JJKA 5FI0B 2W6ID 3THOA 4Z54A 1FP6A 4AYWA 2IS1A 3PITA 1R5NA 3KKPA 4BASA 3MJHA 4GOJA 4TMXA 4YDSA 5K8UA 1VDZA 2JDID 1JQLB 2ZRDA 3CPJB 3KZ1E 4LYFA 2QG6A 4RJLA 4TQAA 2GZAA 4A6PA 1NBME 1E32A 4G5OA 4OK3A 2I1QA 2QNRA 1E2PA 3PUXA 4PFSA 4Q9KA 1ZBDA 2GJ9A 3S1AA 3TK1A 1XMJA 2BMJA 3HJNA 1L7VC 1WP9A 2A3RA 1KSGA 4CEIA 5J4HA 1YZTA 1RKBA 4PSKA 4ITRC 4NMMA 4ZDIA 2PT7A 2OBMA 1Q1EA 4EUNA 1ZINA 5G40A 1G7SA 3NG1A 2CMKA 4YC7A 4S2EA 4HB0A 4F92B 5IK2D 1J2JA 2OILA 5EP2A 1GAJA 2VP4A 3Q3JB 1NMXA 2FN4A 1AZSC 4A15A 4M1SA 1ZP6A 3T1TA 1X8KA 5G53C 5FTLA 5LPNA 2GXUA 4NU0A 4MDEA 4A0GA 3Q8XB 4N0EA 3I8SA 3PIRA 5F9FA 5AJVB 1TF5A 2C9YA 1CJTC 3AGPA 5FTNA 2IW3A 5HKKA 5FR1A 4IW3B 3AP2A 1G4AE 1VG9B 3CM0A 3WP0A 2QENA 3MMPA 4ZI3A 3AVPA 4M1KA 1KZGB 1XTRA 2F1IA 2QE7A 5DE3A 4KVAA 5HPYB 3U7HB 1FQJA 1XXHE 3FMIA 1OKKA 2AN9A 5HE9A 1XTQA 5DYIA 2AR7A 4Z8YA 4B48A 1GTVA 3AKCA 4NCKA 4BZQA 5D3MB 4LBYA 1UKEA 2ONJA 4HAZA 5SZJA 1Q3HA 3KJHA 2F3TA 4TN1A 1E69A 1KI1A 1GWNA 2HDNB 5IRCD 3UK6A 2BC9A 3CWQA 3KKQA 1J90A 3PCRB 2OCYC 4LHZA 3OEED 1KMHA 4A4DA 1F48A 5M04A 2YWHA 1C1YA 3B1YA 4HLDA 5EUMA 5KSYA 2DY1A 2G9NA 3ZQJA 4D80A 1DO0A 1FOEB 1TU3A 5F2EA 5HE8A 4AKGA 4P4SB 1JQJC 4XSHA 3IHLA 2YWEA 2F43B 3BH6A 2J7PD 4IDQA 4WZ6A 2D06A 2OEPA 4G5QA 1CF4A 1A4RA 4KI0A 2W83A 3GLGB 3E5HA 4E07A 4ZI2A 3U44B 2R6CA 4GNKA 1OFUX 5FBWB 1E9DA 5FOVA 4QOSA 1DAGA 3W8RA 4B6FA 3BH0A 1VYVA 3GEIA 2XGJA 4EAQA 1Z2CA 3PEYA 5J4YA 3UG6A 5KSZA 1ZNXA 2FPLA 4Q9JA 2JLSA 3K0FA 4QJ5A 5J4KA 2VHQA 5KTYA 1FTNA 3CPEA 1SVWA 2GVZC 1E0SA 4V0OA 2H7VA 3IPYA 4L8GA 1G17A 1OV4A 2AK3A 2XOKA 3QJYA 3R9IA 1W0JA 3TVTA 3ZZ0A 4JLOA 3B7GA 5TY0A 1XCGB 1RYFA 3BBPA 1U8YA 4UNNA 4DCNA 3VNVA 2JGNA 4C4PA 4Q4HA 4Q7JB 4QGFA 4JSYA 4JBXA 5HR5A 1JXMA 4F7WA 4V03A 4CYMA 2B8WA 4JT2A 2QP3A 4QHTA 1Z5ZA 4HUQB 4X8HA 4TYYA 4RVCA 2AL7A 4V0LA 4KHZA 2A5DA 1E79D 2ZAMA 4PHFA 3VR3A 1ZU5A 2YJTD 4BLOA 3CRRA 3MWJA 2VSXA 3QI2A 3EIEA 5KYKA 3U7GA 2IYSA 3EASA 2BEKA 3NVAA 3TR5A 1G19A 3TH5A 2X8AA 4I81A 3Q7QA 2IYRA 1M7GA 1VECA 5FUXA 1ESNA 3QG1A 1Z2AA 4TLBA 4DUGD 1MO4A 3A1SA 4V0MA 1J8YF 3T12A 4DJTA 1BH2A 5B30A 4NCIA 2O8CB 4LPKA 3X1XA 1KSHA 3SJCA 1XD9A 2WKPA 5KPJA 3AVOA 3GJ0A 5AWFC 4B71A 4EPWA 4CZ2A 1Z6AA 2QL6A 2V6IA 1XD2B 4OK6A 3F8TA 2J46A 1Q3TA 3LQRA 4NL4H 1H8ED 5JJIA 4CRWB 4GPTA 1TL7C 2H16A 1NG1A 1TQ6A 1JJVA 1ZC4A 2NOAA 4DIEA 1QHYA 5EE1A 2WPDA 2RGDA 1NP6A 1MO3A 3CUEF 3TSZA 4PPNA 1X86B 3NBZC 2D2EA 3LNCA 3UG7A 3BIFA 5KU1A 2DCUA 2QTFA 3UMRA 4A0RA 1RVDA 1U98A 2WJJA 3HPRA 1FL9A 2GCPA 4Q1AA 1KAOA 3BWDD 3PXGA 4D82A 3VNUA 2HJVA 4QGHA 2ZITA 5J40A 1KJWA 4U02A 4CW7A 1QBKC 1IN5A 4R7ZA 1JB1A 2ZREA 3JVVA 3TQCA 2REXB 3C8UA 1GFIA 1C4OA 1OHHA 4LHXA 4PPQA 3P27A 4QL3A 8OHMA 2ZS7A 3DM9B 4CIDA 1DADA 5CIQA 3THWB 1CU1A 3GFOA 2JASA 3LWNA 5JEDA 4MA4A 4TQ9A 4AKEA 3MSXA 1DE0A 5EZ6B 1ZM9A 4Q5IA 1Q22A 4OI4A 4B76A 2IXFA 2WICA 4DLUA 1HURA 1FZQA 4XD7A 1NSFA 1F3OA 3GLHA 1YQTA 1E6CA 1VMAA 4ZDKA 2MSDB 1HQCA 1QHGA 3AKEA 2OCAA 4KVGA 1F5NA 4D0NA 3T34A 5AUPB 4JYCA 1LFDB 3EZ9A 1D2EA 1U8AA 4ZKDA 4GDFA 1T3LA 1Z6GA 2BCGY 5BXQC 3IGFA 4HLUC 1W0KD 3GLHE 2E1RA 5LDDC 2CXXA 1F2UB 1KI6A 2R8RA 3IBGA 4CEHB 1SHZA 1OW3B 1YU9A 1D6JA 3PEUA 4US1R 2GXAA 4CGZA 2ZRPA 2FWRA 1OH7A 4B3FX 4C7OB 4QC2A 3WBKA 1I2DA 2GJ8A 3LXRA 2QAGC 4WXRA 5HZKA 3CNOA 1G8HA 1P2UA 4PX9A 4N1AA 1NMZA 5KDLA 4KBGA 3FFAA 4C7OA 4LYAA 3CF0A 3FHCB 4JLPA 1G7TA 1N3BA 1GDDA 2QROA 2GVDC 1GM5A 2QP9X 3C5CA 4DLSA 2O8BA 1CRPA 3QPWA 2P6UA 5CB8A 1PLLA 2AD1A 5EZ5A 2C03A 2FSGA 4BFYA 3IIKA 3KKMA 4IOMA 1JEDA 1NLFA 1Z63A 1OH6A 1NY5A 2VTKA 2CJWA 3AF3A 2KSQA 4LJAA 1AJEA 1GKUB 4CEJA 4NCNA 4IFBA 4A2PA 2ASEA 4IOLA 4DSNA 4TTRA 1E1QA 1UPTA 3DEFA 2CJWB 3PEVA 4Q4JB 2BHRA 5FL3A 1E2QA 1W46A 2GZDA 1E1RA 3KFVA 1IN4A 2DHRA 1AGPA 3K0AB 1E9RA 3NBYC 2EYQA 1KY3A 3RRMA 3RVBA 3ZVMA 2I3BA 1TUIA 2OBNA 4KFRA 3P26A 2OAQ1 1OYWA 3ZD6A 2WJHA 1II9A 1ZNYA 4TLEA 2H92A 2IYLD 2IF0A 3NDPA 3DOFA 4O2LA 1OB5A 1YZLA 3SYLA 4WZAE 2GRJA 2JIZD 2YC2C 4HDOB 3GJ8A 1BMFD 1VCOA 2D7DA 4Q19A 3E70C 4PO1A 2HXYA 1Z07A 3LLUA 3W5JA 4BE7B 2HLDA 4NPHA 1TQ2A 3CRW1 3AV0B 2GK7A 4LUCA 1IN6A 2AWNA 4RZ3A 4JLDA 1S96A 3F5FA 3SE0A 4Q4LA 4Q1BA 2WJVA 4TMVA 3GJ4A 4G5RA 4PAQA 3LBNA 1M8PA 3Q7PA 1W47A 4R9UC 4JBYA 3I72A 3KQLA 2V54A 3O8BA 4I1OA 2RGBA 3ZQ6A 3A1UA 5CITA 1KK3A 2J1LA 2VPPA 1QHSA 1NN5A 2JA1A 2NO7A 2GNOA 3EZFA 2BKUA 2G0NA 2RHMA 3R9XA 4Q47A 1HA3A 5HCIA 5CDFE 4PC1A 4ZKEA 2X1VA 1FMLA 2F43A 1IN8A 1NLYA 4PTLA 4LJYA 3ICQB 1XF9A 3K9GA 4LC0A 4MKGA 1OIVA 2QBYB 1E9AA 4YXWD 1G291 2ZAOA 3KKNA 4Q21A 2QSYA 3RRNA 4YQFA 3B82A 4NHOA 2ZXUA 3EWAA 1KMHB 3U7EB 4TTPA 1E2GA 2ORIA 3CR7A 5E4FA 3TVDA 3ZD7A 3L8ZA 5KHOC 4LOAA 1TEVA 2A5JA 3EA5A 4UJ3A 3I4LA 3K53A 1ZRHA 3L43A 3QEJA 3EIHA 3GQBA 3Q5EA 1KOFA 4KLZA 3H0KA 1B23P 3UXMA 5BW8A 1WRBA 5KDOA 3EX7C 4IDPA 1T5IA 4NH0A 2XTZA 1NBMD 4NYJR 3REFA 2Z83A 3FMFA 2GBLA 3BS4A 4RZXA 1U99A 1BYUA 3NDBB 2IYWA 4V0ME 2ZE6A 3LAWA 2IYTA 3W5IA 3SFVA 5JCZA 1AZTA 1I2MA 3U3JA 3BGWA 1HYQA 1T3SA 2REBA 3TW4A 3AVTA 3LXXA 5JJKA 3ASZA 1DTSA 4ON9A 3SJZA 4NKRA 4FXPA 5K8TA 1OXTA 2ZVQX 1TNDA 3IEUA 4KXFB 4B43A 4P4UA 3R7WA 4TL9A 1OSNA 3U3KA 1JAIA 2FSHA 3CPHA 5FFMA 2KB0A 1KK0A 2WAXA 1PV4A 4I1UA 1E9EA 1GITA 4B2IA 3ZS9A 3GJXC 2VP6A 2ZRKA 1XTIA 4YMTA 1E4YA 3OF5A 4GSYA 2ATVA 5DN6D 4HZUB 2PJRA 2YOFA 5GVSA 1WF3A 2FX3A 4GRAA 4ARZA 2QUZA 4NYIQ 1YR9A 4TSFD 4QGAA 4IKEA 3RC8A 4XOIA 2ORVA 5IDVA 1FQKA 1OHHD 2ZRLA 1VTKA 2WM9B 2ZJBA 4DDVA 4QBFA 3B5JA 2ZRHA 3HU3A 4X8MA 1GL6A 4Q66C 3TGPA 3KQHA 4PHTA 2IYZA 4NP6A 2BIFA 3P20A 2ZS9A 3E1SA 1IM2A 1CS4C 1OFHA 2XNDD 4XIGS 1OIXA 3EZ2A 3C16C 2RGAA 4MYTA 4DLWA 1EFUA 2AK2A 3FFBA 3X1YA 4IXMA 2G83A 1SULA 2F1JA 4AIIA 4WW0A 1D9ZA 4A6XA 2H18A 4L9SA 3H2YA 4A8JC 2XB2A 5JWOA 2OAP1 2NMVA 5F98A 4DDWA 3H1TA 2ZE5A 3QVUA 2XTMA 2ZYTX 4JSTA 1TF2A 1Z0AA 1CJMA 4I1SA 4D4MA 5JHGB 3FTQA 5AR1A 2ZR9A 1KI3A 1VCMA 1W0KA 2PLRA 1E9SA 2ZU6A 2HT6A 2NO0A 3ZS8A 4EJSC 4QNMA 2CE2X 4HB4A 5DISB 3QKUA 1OXSC 4JVNA 1XP8A 1WGWA 4Q9IA 1R8QA 3NHAA 2ZSBA 4I99A 1PUJA 3T15A 2F1HA 2TMKA 2QRZA 1M2OB 3AF0A 3PUZA 3SJAA 3MRSA 1QG2A 4GT1A 4YMUA 1P9RA 2VP9A 4W9MC 2YVUA 1EFRD 3DO6A 3V4FA 2ZM5A 4CT4B 2XZLA 1U0JA 2A9KA 2EVWX 2HYDA 4OK5A 1EX7A 4BZXA 3AKYA 1ETUA 2D2FA 3L2OB 4Q01A 4Q4JA 4P33A 4PHGA 3WXMA 1OXVA 4XVQA 1KYIA 1KHTA 3U2QA 1US8B 4JKYA 2IXEA 1I4LD 3DM5A 4BFSA 3LO5A 3BC1A 3KUCA 4M1OA 1LS1A 1T5LA 1W4BA 1IXRC 1EFHA 4JIMA 1M34E 1E98A 3BJIC 2GF0A 4V0KA 2IYVA 4AWXA 4LJ8A 4FWTA 4GL2A 2H8KA 2WWGA 5KSPA 1U81A 5FOXA 2RB4A 3EZ7A 5JSZB 4M53A 5F9HA 1NKSA 2ZRAA 4PC6A 3VTKA 2Q21A 1T8TA 4A8JA 1MRNA 2O8BB 3A4NA 1TUEA 4TYPA 1E1RD 3EXAA 2ZRGA 3ZVRA 4DCUA 1BKDR 1J7KA 4OQLA 4M2LA 2QPAA 3SU8A 2BVNA 4QNRA 1G5PA 3RS4A 4HAYA 2J45A 3LX5A 4Q7KA 5LBIA 4F93B 5CIWA 1MABB 4ILEA 1XTJA 4C0JA 2R65A 2UVQA 3NIBA 1G3IA 3LW7A 5G41A 3T35A 3FPAA 3RS7A 3WRXC 3SI7A 2GA8A 3NTUA 4CEHA 3LH5A 2FEMA 1SVOA 3VR6A 1Q0UA 1RIFA 4OJQA 1N2CE 1UBCA 3UIEA 2QA5A 1ZC3A 2GEUA 2ZI7A 3T06B 5C4GB 4DWJA 5JLJA 4EJSB 5L3RA 2XSZD 1YZQA 1W4RA 1YKSA 4AG6A 1WDTA 2A5FA 3RRZA 3CNNA 5L3QB 5TXGA 4MGYR 1R10A 2BM0A 1NVUQ 1SVSA 2ZVPX 4BLQA 3DMDA 2J0UB 4F4IA 2ZROA 3P4XA 5DHAA 2CL7X 4LBWA 5H68A 5EXSA 3OE7D 4M9QA 3VR2A 1P3JA 5FPSA 3PUWA 1N5IA 5EP4A 1LV7A 3MGCA 4ZIRA 1IHUA 2ECKA 4LX0A 2J0QA 2VH5R 3B2EA 2X2FA 1LF0A 3IO5A 3X1DA 2FPMA 5CM8B 1H65A 2J87A 4LC1A 2QT1A 1QVRA 1SXJD 5TMPA 1XPUA 1KJZA 2VIIA 4WVFA 2IC5A 4PZYA 2WWIA 3O8DA 3BFVA 4WA7A 4GI7A 5E7MA 1G7RA 2QQEA 4X8LA 3R8CA 1M7BA 1G21E 1CR0A 3DKVA 3I73A 1IY0A 4B47A 2G1JA 2O8FA 4TYQA 5DIFA 1KKMA 1KKLA 2P5TB 4M22A 1GNPA 3PG5A 4PZZA 1OF1A 4BFXA 3SHWA 1R0YA 2LCFA 2B21A 4WXPA 5A0FA 3SNHA 3T1VA 1SXJE 3KX2A 4DIDA 1Z0KA 2CNWA 2NTYC 2VHCA 2YC4C 3NWJA 1K6MA 1Q1QA 1YVDA 2CLDX 2AFHE 3IHWA 3AF1A 2C9OA 2AXPA 1K5GA 1XTKA 3CF2A 2IYYA 1OT3A 2PZGA 3NKVA 5F3WB 2OCPA 3AP3A 3WMEA 2LKDA 4C0HA 4AY2A 1XXHB 2OXRA 3HR8A 5JCPA 5JRJA 1ZUIA 4ACAA 5C46F 4PR0A 1D2NA 1LB1B 3FKSD 1WCV1 1XCPA 1YZGA 3OAAA 1V43A 2AWOA 4OHWA 4LV8B 2FV8A 2HV8A 2NPIA 2CK3D 2FG5A 3ZIAD 3AGQA 2X2EA 3EC1A 5FL7A 3QF7A 2O8DB 2B7BA 4A9AA 3KTAB 1XDBA 4NZYA 3H4MA 2X19A 3EARA 4TSFA 4YONB 2QMUA 1TADA 1IXZA 1T91A 2C77A 2PCLA 1IONA 2R6AA 4U5XA 2QP4A 4DC9A 2JDIA 1SKYE 1AIPA 2GESA 2GXQA 5HZHA 1OXXK 4EFMA 2OSBA 2XEXA 3SBEA 6Q21A 4O3MA 3GLIA 2FMXA 2RGNA 1SQ5A 1FUUA 3U6BA 3D31A 2OG2A 2A5GA 2ZRFA 3BB4A 1U0HC 3AUYA 1VIYA 2KE5A 1M1YE 3TAHA 3VHXA 5KPDA 1N6OA 1P4SA 1VYTA 2R9VA 1Y63A 3L0IB 3P1JA 3B9QA 3C7KA 2IYUA 2BBTA 1T8UA 1ZVQA 2R6DA 421PA 5C1BA 3OIVA 2ZANA 4CVNA 5BN5A 1NIJA 3K0FB 4IXNA 2I4IA 3K0CC 4GBMA 4LBVA 2CLSA 1SHKA 2QN6A 3UPUA 4M1TA 5DSZA 3WYGA 4MKIA 4Q7MB 2ZRCA 4IEIA 5K8LA 4ZIRB 2PT5A 4C0SA 1E0KA 1IN7A 2EW1A 3LV8A 3X1ZA 1S1CA 4BECA 5C4MA 3ONWA 4MRSA 3GLGA 2JLVA 3CZQA 521PA 5TARA 2P5SA 4NYMR 4P4TA 4WZBE 1UKZA 4LJ5A 1KNXA 4YDHB 4B73A 2QEQA 1N6PA 1JNYA 1DOAA 1Q21A 3I92A 2EFHB 1WMSA 3QENA 4Q1DA 1QDEA 3QVVA 1UDWA 3LW8A 5TVKA 2F6RA 4HB3A 3BB3A 1DAEA 3B1XA 3IEVA 4B3DA 1T3HA 2YWGA 4M21A 4B6EA 2ZI9A 2GTPA 2ZI3A 4R98A 2R6FA 2ODBA 3HU2A 1C9KA 3QY0A 4DT1A 2GF9A 4FIDA 3ADKA 4RD0A 3W3ZB 2Z5FA 2RGXA 5FBLB 2A78A 3DHWC 1WA5A 4HLUA 3UATA 5GADl 3A1TA 2WBLC 2B7CA 2GK6A 1E4VA 1IXSB 2VYFA 4G0NA 5GVRA 5LD2C 2Q3MA 4TLCA 1EFTA 2JJ1D 2JJ8A 3K8YA 4ZDJA 1BIFA 1FFHA 4DDUA 3R7WB 1P9NA 4DLRA 2JCSA 2OT3B 3R20A 2BCJQ 5JWHA 2W2VA 4OL0A 4D26A 2CCJA 4URVR 2Q6TA 1SXJC 2JJ2D 5UKDA 2XXAA 2XZOA 4FMCF 3ADCA 3TJZA 1KZ7B 3EWSA 1F2TA 5JECA 1VHTA 4QKQA 3D3QA 3AVWA 1XBTA 3EW9A 3LQQA 1P9WA 4UJ5A 4Z1MA 4DLXA 5KOYA 1YHNA 1N5KA 2QAGB 1Q20A 4C9BA 4JYBA 2UKDA 1GSIA 1F2TB 1TMKA 4PO9A 4BFUA 3TUJC 3DZ8A 2ZRNA 2ORWA 1NRJB 3U4QB 3SN6A 3B78A 1CXZA 4G5GA 2J41A 3CR8A 2B6HA 4A0HA 1NN3A 2ZJ5A 2FH5B 4H1UA 3C5HA 4RZUA 4BWYA 4LSGA 3BAFA 5KUTA 4MKFA 2ERXA 4Q1FA 4OQMA 4N3NA 3W9YA 3BK7A 3HWSA 3M0EA 3WRYC 1IJEA 2V9PA 3I8XA 2FJUA 1MO5A 1N6LA 4MUAA 3RNLA 4UNSA 4HAWA 1U94A 3RHFA 4KYUA 1OFIA 3B1VA 1ZCAA 3KB1A 4C0QC 4EPRA 1YR6A 2UZIR 4BGDA 3QXHA 2NGRA 4HAUA 1AK2A 3I5YA 1XZPA 4BRWA 3MD0A 4DEYA 3KQUA 1SXJA 1CIPA 4RFSB 2GETA 2J3EA 4X8OA 3I1FA 2WWFA 2PL3A 1XD8A 1MH1A 3IIJA 3HR7A 3WP1B 3N2EA 1XU4A 4URYR 2C2HA 5BWMA 1FUKA 2IWRA 1G5TA 5GJBA 1P2VA 2KBFA 1GNQA 4L5BA 1H8EA 1G3RA 2WWXA 1X3SA 2HUPA 5H8WA 4B2LA 2ZI5A 1COWA 1NVVQ 4P4SA 4A0FA 1Z08A 2WOJA 4XTCS 3EC2A 1QRAA 3KTAA 2C99A 1ZM7A 1YRAA 4B35A 2GEDA 4EKDA 3VKGA 3THWA 3A8TA 3LBHA 4AI6A 1EGAA 1ZJ6A 4WIAA 2OLJA 1P75A 2QM8A 4TL7A 3BD9A 4DLVA 3PEWA 3KDSE 1JR3A 3IBYA 1R0WA 4XVRA 1KJYA 3AVUA 4FN5A 3K9LA 3B85A 2KI5A 4ACBA 3B6EA 1NMYA 2G3YA 5JZVA 1UKYA 2FA9A 3I32A 3B60A 5DNYB 1N6IA 1DBSA 1Z6XA 4TZ6A 2J7PA 1PLJA 2BJVA 4FMDB 2OXCA 5KNBA 4TYNA 2PEYA 4BQSA 2JLQA 3FKSA 3IO3A 1NY6A 4RKEA 3I61A 1W1WA 1RRGA 2GKSA 1GRNA 1S3GA 4JBWA 4RCZA 5GJCA 2G88A 1DG3A 4D2IA 4RD2A 1KO1A 4MKHA 3LX8A 4AYXA 1UBGA 1HQYE 1A7JA 2YINC 4PANA 4TQUS 1L8QA 1A5TA 2CCKA 2V7QD 1VKJA 1ZD9A 2GCOA 1N5LA 2WSMA 1KO4A 3E2IA 2ZJZA 2PZEA 1E2NA 4MITA 1OH5A 4JLMA 3CH5A 4E22A 5DGXA 4LI0A 4JL6A 2VRWA 1W4CA 4ASUA 2QI9C 2JLWA 1HE8B 2WMNB 2ZUCA 5EP1A 4XD7D 1R2QA 3U3MA 4JZKA 1RYHA 3A4LA 4LWZA 4Q4AB 4US0R 1QHHB 2EWWA 2XAUA 1CEEA 3VU9A 3HDTA 1KO7A 1A2KC 2D7CA 2FGKA 2WSSD 1KTVA 1NIPA 2QPOA 3L82B 5JSZA 4PQRA 2BV3A 2EWVA 4II7A 2Z4RA 3GLIE 4OHZA 1YR7A 3IILA 2GHIA 3B1ZA 1DAHA 3ADDA 1ZM4A 1ZIPA 1QHXA 3WHKA 1E79A 1X1RA 1US8A 2GAOA 4DLYA 2IUTA 2P65A 3H86A 5JJLA 2R2AA 1NSTA 2FF7A 3EAQA 2QBYA 3WYFA 3Q85A 3RRYA 1VPLA 2IEYA 2ZS8A 5J4VA 2Y8EA 4KCGA 4PSAA 2QRNA 2CVHA 2FU5C 3AH8A 5JHHB 4LJ9A 1HTWA 2N1BA 4OI1A 4K46A 1P72A 2OUKA 1GOTA 2O52A 2VHJA 3CZPA 4L9WA 2AFIE 1G6OA 1NJFA 5BN4A 1H8HA 2QMHA 1SXJB 1KO5A 1DAKA 1AGRA 5LB4A 4C30A 2GDJA 1RRCA 3U3OA 3T61A 3QXCA 1SGWA 5JEEA 4JLVA 1SKYB 5DO9A 1D9XA 2O0JA 2HT1A 4IVRA 1UEJA 3WHLA 4RD1A 4FWIB 3RS5A 3QPUA 2YHSA 3A1VA 5DYGA 2QY9A 3NC1C 1G3QA 4UNPA 4WBSA 2CE7A 3LVQE 4H9GA 5SZIA 3SYNA 3D7MA 3GJ5A 3VQTA 1KIMA 3QF4A 2JEOA 2C5LA 4CF7A 5FOTA 4UXJA 2W0SA 3J81k 1HV8A 5DLQC 3QE0A 3SDZA 2QM7A 1E2MA 3CKLA 4MGIR 3AVQA 4BLSA 5JI3E 1F6BA 3AP1A 1R5OA 3U44A 1FW6A 5JRZA 2DB3A 1Z0JA 1AN0A 2GJAA 2QAJA 4D0GA 2HLDD 2RGCA 2W2XA 5DI3A 1R0ZA 2LKCA 4HZIA 5FTMA 2CHQA 4K8OA 2RGEA 4WAUA 3ZVNA 2OESA 4D81A 1ODFA 4MRPA 4EQ6B 1GZSA 2H57A 3NEJA 3B8HA 4ARZB 1ZUNB 4Z1MD 3WMFA 1G3UA 2V6JA 4DB4A 5L3SA 4JVMA 1XJCA 1Z6YA 3DOEA 4KYIB 3A36A 1HT1E 2R44A 4LGMA 1RJ9A 1ANKA 1GL9B 2JAQA 3OFNA 5E7JA 3FHTA 2BDTA 1G8GA 4WOPA 1W44A 2QT0A 4R2HA 4Q4HB 2QGZA 1N0UA 1L2TA 2RHDA 4Q1CA 4GOXA 1FPMA 2ZYUX 4EFLA 4GMDA 3CH4B 4L15A 1OXUA 5FI1B 2JIZA 1G5RA 4F91B 4YLGA 4BFWA 4KODA 1KI7A 2ONKA 3OIUA 3DDCA 5FUYA 1P6XA 1LVGA 1P2SA 1WXQA 1ZYUA 4KFSA 2J7KA 4U7DA 2BMDA 2O0HA 1W36C 1OFTA 1YR8A 2EFGA 1KO8A 2DPXA 2Z4SA 1DG1G 1PJRA 3ZZUA 4URXR 3GLGE 2XB4A 1G41A 2QZ4A 1XEWX 1AKYA 2A7QA 1P60A 4B34A 4P0TA 2W00A 4URWR 1HE1C 1G8YA 1E9CA 4EPXA 3C4JA 5CYOA 2XZPA 1BOFA 3I3SR 3PV0A 5CJ2A 3TUIC 4MGZR 1SVKA 3RWMB 3GJ3A 1W2HA 2D74A 2ODEA 1P5ZB 3MG9A 3RABA 2ZEJA 3W8NA 4BEBA 4XWKA 721PA 3BE4A 4QHYA 2B8TA 4B3XA 2VEDA 4HLCA 2F9MA 3KB2A 5D3QA 4PPGA 3G0HA 4DZZA 2F3RA 4LJ7A 4DCTA 1CJKC 2IS6A 5J4LA 1J70A 2YYZA 1XPOA 1A1VA 3RANA 4XVUA 3LVRE 4JVLA 4Y0VA 4UNQA 1J8MF 4US2R 2ZU0C 5EE3A 2ZUDA 4FMBB 2XITA 3TMKA 4RSGA 4TT3D 1E1QD 4U00A 3T5DA 3QKTA 5EXPA 1ZD1A 4RCYA
chains in the Genus database with same CATH superfamily
1S2NA 4OEHA 2HZ8A 1E5QA 4MAAA 3ZWMA 3ZBPA 1NJ6A 2W2TA 1KMMA 3FPJA 4IIJF 5GV8A 1G1AA 1N77A 4IEFB 4JFRA 3MERA 1CZKA 1UMDB 1ZJ4A 3ZV7A 3U7RA 4QTYA 5BYKA 3OU7A 4Q03A 2GZHA 2PUVA 3CONA 3LLMA 2O19A 2LRHA 5CB4A 2GO1A 3TNFA 1RSZA 3T4UA 4MVSA 1NN1A 1L7EA 2SHKA 3GJYA 2G9VA 3GRRA 1WMBA 2RFLA 2W98A 5HDBB 3KAPA 3TKYA 2GEVA 1Z9BA 3NAZA 3V3TA 1MABA 1KEUA 2WPNA 3OQHA 5E3HA 2V7QA 3Q0IA 1NVFA 2O8DA 1TKCA 4RBNA 2PZMA 2TRSB 3H99A 4HN2A 2DR2A 4QJIA 1PJAA 1DSSG 5F73A 3EG5A 1EZ4A 4MQBA 3WY9A 1MOPA 3BQ9A 2YYAA 1PHRA 1T36A 4UBKA 3IJPA 2ZIUB 5KQLA 1XZBA 3CJQA 5FF9A 2QQ0A 5LA6B 1S2MA 5L0GA 3GUHA 4MROA 1RRCA 4E03A 3UMFA 4PE5B 2Z2ZA 4TL8A 3QPVA 1QE3A 2HBQA 5DTQA 2ON6A 3CBQA 1V9LA 3K9NA 3DAHA 1ENPA 1S8NA 4TVOA 5FOUA 2NT4A 1G64A 4IDHA 2FMKA 2OO5A 4BEWA 3BKWA 4L8WB 4I6EA 5AI9A 1TQ4A 1TJ3A 5DM2A 4OINF 2PPVA 4L76A 3I23A 3OKPA 3MCWA 3TTWA 1W5SA 3GEEA 2V7UA 4HADA 3WLLA 4HI0E 1EBBA 3PHHA 3KYJB 3PX3A 3GLFA 4YYZA 2FGYA 3QBVA 1QQBA 5DGTA 1E7RA 2IQ5A 2O3UA 1KK2A 3MBIA 5ALMA 3V6MA 1SXHA 3BFPA 2F48A 3CO0S 3R2JA 4OIOF 1JFSA 4OD5A 3PGXA 4ESHA 1EVKA 4IHKA 2Y69C 3NR2A 2OD7A 3AVVA 3NOOA 4PZUA 1CUIA 5I7EA 2O2IA 2CLFB 4MV8A 3H75A 3UXYA 1GKYA 1O5IA 1N7JA 3PKJA 1NSGB 4FSDA 1E1KA 3VHLB 3T1QA 4LNUB 4QM7A 1ILWA 3JQAA 4G4GA 2WZQA 1T6YA 1T15A 2Y1EA 2PNFA 3NHYA 4GUDA 4AU1A 5DNDA 3KQVA 3SXPA 2HIHA 3T1OA 2P6NA 3LBYA 1RWWA 3OTHA 4C0WA 4G9BA 5IKMA 4PO3X 1GQYA 3NW9A 1L9KA 4LV5B 1B3BA 3DT6A 4D8VA 4L7QA 4MH0R 2O8VA 1BE8A 2IHYA 5JP7A 1B68A 1Q0QA 4HDRB 4U3JB 4CM8B 1F5SA 4Q00A 4ZAVA 1HMYA 2FUNB 4LS3A 3KEMA 3SM9A 4FC7A 3KPVA 2NSJA 2EX4A 3ADPA 1YZ3A 2CBZA 4HQOA 4PYQA 1GPKA 1WUKS 4HGRA 1L8OA 1OBCA 2YWJA 3QKSA 2C5SA 2VAPA 4KZKA 4UHCA 4EA9A 1K6JA 2QKYA 4BFZA 4U3JA 4DCGA 1IN1A 4HLNA 1EEXB 1YI8A 3VOAA 3SSAA 4RA9B 3W5AA 2WV9A 1P7CA 2IOYA 4JENA 1WUTA 4PLGA 4R2WA 2L69A 4AKTA 4MCHA 5C18A 4RFVA 1GA1A 4MJLA 3HJFA 3B6IA 3CB2A 1VDMA 1HNWB 3BJRA 3FOEC 4Q4ZF 4OHUA 3JYOA 4RTSA 4O4IA 3WGLA 2Y66A 4HEHA 4J03A 1NNUA 4OMFG 1MVOA 2XRYA 4V0QA 2FZCA 4FR0A 4M8NE 2J59A 2ZE8A 3F78A 4XPIA 5IYZA 2ZJ6A 4QUIA 1W36D 2CF6A 3DKPA 1JDNA 1PEYA 4G01B 4IIFA 3SCZA 1E2XA 1HQKA 4ZVSA 2AJBA 1YDFA 4MW7A 2IKQA 5M34A 1I7NA 1IOWA 1Z75A 4G3XA 4RTOA 3UY4A 4N3BA 2DTDA 3H2BA 3CEXA 2HFJA 4L7VA 4BIMA 3QVWA 3K6SA 3CX7A 4GYWA 4F3YA 2J0WA 4RSMA 1NG9A 3O1IC 1XUOA 4KWHA 2OYSA 2QUBA 1WB9A 2FDCA 1YVUA 2QGNA 4LPSA 2W8ZA 1EDDA 3IKLA 1L4GA 1LQUA 1JPNA 2VDNB 2ZB4A 5D3MA 3A06A 1NJSA 4O02B 2IDZA 1QPGA 3DHNA 4XWOA 1NRXA 1SC6A 1JDBC 4N47A 3CKYA 4LDQA 1QNLA 1GO2A 5ENZA 5EA2A 2MYUA 1N2EA 1RABA 2R96A 3FPBA 3OJCA 1FTSA 3AHCA 4BCBA 3RAFC 1M2VB 1ISGA 1WABA 2GA0A 1BS1A 3BE6A 3KSUA 4MA5A 5IK2A 4QUKA 3RRXA 3W04A 2ZCUA 1GTRA 2HU8A 5JT4A 1COZA 1FUYB 3HCAA 4X6UA 1VMKA 3MCZA 3CSSA 1XNJA 4GQAA 1QLWA 1LPNA 4Y9SA 1KGDA 1D3AA 3BILA 1QONA 1MNQA 2DI3A 4DREA 5C53B 2Y4NA 5REQA 1RRMA 2GLUA 1H2AS 1LF5A 1GR0A 2HSGA 3OT5A 3MTBA 4ODIA 4RWEA 1D2MA 2ZRJA 4NTZA 4UMFA 5EGSA 3RAPR 3S44A 1CV2A 4Z2AA 1E85A 3EF3A 3TVYA 1QCCA 1L0BA 1M8KA 1UBLS 1XGKA 3AOEC 4YMWA 4D4IA 3L8DA 4LHWA 2EBWA 2OP1A 4D9IA 2J3QA 1PX0A 1SZCA 3L18A 5PNTA 1CB0A 4EI7A 1C9YA 1C4KA 2BTOA 2FW6A 2Q5FA 4LXIA 1PSDA 1XIVA 1TI7A 2N46A 4OHYA 1VGQA 5ALUA 1Z37A 5F76A 1KKUA 3Q0EA 2OC9A 3AQBA 1K04A 1OLUB 3G4ZA 3GOHA 4R7GA 4NARA 2V4MA 2GCEA 2JH8A 4F9FA 1NJ1A 2JK0A 5CK4A 2QIOA 2ZJ0A 5KNLA 4J6EA 2ETXA 3QVZA 3QWIA 4ZJUA 1Y8CA 5HQTA 1WNFA 3CMCO 4Y2TA 5ESWA 3GARA 4G89A 1J7JA 4FNAA 1GKKA 3PU6A 4R5MA 5KNDH 3H83A 3IJ5A 1ZK4A 1C9NA 1IEXA 2NSYA 1MO2A 4F4CA 4RK1A 3DLHA 3JZMA 3EUEA 5CDFA 1QFMA 1NRIA 2XD9A 2EU8A 4LIPD 2Q0HA 2QU8A 5FHRA 5C8YB 2R86A 2XZTA 2IV7A 1T4CB 4R1TA 3VR5H 1Y1PA 1VJ1A 4KHPB 1K05A 1O6FA 1I80A 3A4TA 1ECLA 3PNLA 1W4ZA 4YRJA 2UUBB 1K86A 4AK9A 2VLIA 3OIYA 2NG1A 1T9DA 4II3A 3ZQKA 4BPBA 2J3DA 3OOEA 3OQ1A 1BQEA 1VE6A 1E2KA 1VLZA 2P0AA 5JXGA 3IDSA 5AJTA 1YZNA 2KMLA 2W2MA 2Y6UA 4KXXA 5JFGA 5CW2A 2HSDA 4FI3C 4JJAA 4QFDA 2Q5HA 1ZHOA 5E9JA 1AMOA 1WUHS 2Y3DA 1M10A 2IL1A 5C52B 1JAHA 4FHGA 2W6NA 3L9XA 5U4XA 2BE5F 4L75A 3LP6A 2AZTA 5JTUA 4FJ2A 2Q4BA 4ZOLF 4NMLA 3KOWA 5KI6A 5A4AA 3AJRA 4YV2A 1TM5E 5KX5F 3UV3A 3AVYA 2QAIA 4A82A 1HY3A 2AEEA 1T4GA 1QB7A 2XOKD 1LBTA 2WKRA 3FNFA 4RK4A 3S7TA 2Q6OA 2L2QA 1JHRA 4I9UA 4MAMA 2OXIA 5FPKA 4OIFA 3IQ5A 2IXAA 2JLCA 4KFUA 1JQ3A 3F74A 4RAQA 4MW6A 4EIYA 1FTYA 3HCOA 3OZXA 2IBMA 2ZI6A 2O48X 3L6EA 1C1XA 3EG9A 4QBIA 4MQ5A 1Z5OA 3N05A 5TS3A 3VAAA 5AVQA 1ZCFA 1XXHA 2MU1A 3KCQA 2GK3A 3ML1A 2GN6A 3IHTA 3HRHA 3AF4A 3VU9B 3VYTB 1XZDA 2VYCA 3C2QA 4GPEA 5D92A 1OA0A 3DLAA 3MWLA 4GM0A 3WKBA 3EFEA 3OAAD 1UWCA 1YQUA 1B8VA 5JNWA 5JRAA 4D6PA 4DMFA 5A5GA 4XUDA 2EFDB 4G6ZA 2XNSA 3TL3A 5JS6A 1XU7A 1KAGA 3C8GD 1KARA 2CZQA 4PLPA 4TRJA 4UFOA 3AG4C 1RMTA 1FXWA 1XTVA 2FFBA 4D99A 5JBNA 1M1NB 2DFTA 4QOEA 3Q88A 2GYVA 2V6FA 5FEMA 2XMPA 3FDZA 1U9CA 3SPXA 2W4IA 2C7BA 3U17A 4WINA 5JMOA 2E21A 3F6BX 1XEAA 1GQAA 1ARZA 1E1MA 2PTGA 3V7FA 3G1UA 5KVVA 4D9JA 3R3SA 3A9VA 3CRVA 1JRAA 2F7SA 3AUFA 3K20A 2Z6VA 1Q19A 3M6MD 4N3GA 3SIWA 5BSRA 5KYUA 2ADMA 4YMVA 1ISJA 2FKNA 2RHTA 2WTNA 5KO2A 3SQWA 3LAYA 3B6JA 4M1YA 2EFCB 2RH8A 1F6WA 1NLZA 3IPCA 1JXOA 3GLHB 4I4LA 2QD5A 4RLSA 1MIOA 4FMCB 1TB4A 1WDMA 1CUEA 4YMIA 1RBYA 1HMOA 4A1FA 3RARA 2E85A 3LUTB 3OZSA 3JALB 5AVJA 3U7JA 1ECGA 1Y4DE 3W2EA 1FX0B 1V55C 1TAQA 2Y1WA 2IYOA 4DDTA 3SVLA 5GINE 1O95A 3WL6A 1J99A 2ZI4A 4HWGA 3IP8A 3O31A 3I30X 3W2TA 2ENWA 5CH8A 1WU8A 1RXIA 1T5TA 4YAOA 1C3OB 2BMFA 3OUTA 5T1DB 3TTXA 4ETNA 4LF7B 4ZK6A 4A36A 1LVHA 2B30A 3RKSA 2GCNA 2J9FB 2Z1DA 3L0BA 3RF7A 3VUEA 4LECA 3N2KA 4EJFA 4P4NA 2R8YA 3JQGB 2X9VA 3I42A 5DLJA 4G7HF 2GLXA 4IVPA 3UAWA 1TPYA 5DULA 1Z5VA 3HP1A 4OSPA 1T1JA 2QJFA 4W99A 1MMDA 1GYRA 1U8XX 2R87A 3PLNA 4HXYA 4QNNA 4FBGA 1OXBA 3TMYA 2R1UA 2BZ1A 3CQZA 3NH9A 1TYZA 5F4ZA 3WDSA 1XEFA 3IT1A 4H31A 3LVBA 3LBFA 3DL0A 2XRHA 4CLRB 3QKWA 4KBFA 5DS6A 3MSCA 2WA2A 1VBNA 4WOBA 1HDIA 1Q1BA 3A0RB 5EIBD 3TE7A 2QL9A 3PT5A 1C81A 1G9SA 1LDGA 2I1VB 2RAVA 3P32A 2IF2A 3AEUB 2ZJ4A 1HDGO 1LSSA 4MIYA 4H08A 4NNJA 3PJRA 1IY8A 1Z34A 3WXBA 1RZ3A 3D6AA 1HRDA 5ES3A 4F21A 3FOZA 3TKAA 4P8RA 4REQA 3EQ7A 2BFCB 4MWSA 5I7RA 3IE1A 4AWAA 1ZH2A 1E5XA 3CTMA 3GGOA 1RBQA 3N5KA 1R4ZA 3QUCA 4N6GA 1N34B 1P2GA 2EGGA 4N4AA 1BXGB 1MB9A 2D5IA 1Y8QB 1VYHA 2AJDA 3BSWA 3EGOA 3OY2A 4CF5A 1XFAA 2CWDA 4BNIA 4UPDA 1H2ZA 2O23A 5AOBA 5AK5A 5IHPA 1H2RS 1R50A 4C87A 3ABZA 1JEJA 1UF9A 2KLBA 3DCJA 5BV7A 1CFZA 4YV0A 4P5DA 3U7QA 3KOUA 4YAEA 4E1VA 1ZD5A 4XQCA 3H8WA 3JRNA 1ISIA 2WUGA 3JR3A 4JA2A 4LYHA 4R2JA 4YIKA 1RAGA 1U0FA 4QBTA 4B32A 3FE2A 3QOFA 3RYHB 3WIVA 3PEEA 1GQFA 5CI9A 1BZYA 4AXXA 5IDYA 3D3WA 3DTYA 3V4RA 4FC6A 5ESXA 3CSUA 5JLAA 1P5JA 2J0VA 3OQNA 2QTHA 5DGIA 3JD3A 1GXSA 1FB5A 1PWZA 3SDSA 2XRZA 2JG3A 1JI3A 3IVCA 1A7VA 2A1IA 2JI4A 2FPIA 3HS3A 1L8LA 1RCUA 3R0VA 4PG7A 5F5NA 3ZG6A 2O8CA 4HUQA 5TPWA 1MEOA 2AMJA 4E4YA 4GL4A 1SCUB 4LYYA 1K9VF 2HM7A 3IP1A 5MFZA 1QTIA 4DWWA 5BXYA 1X77A 5SZHB 2NU8B 3DPUA 1A9TA 1TWCA 2AR0A 1Z0FA 2SCUB 3QJGA 2NT3A 4BLTA 1H9GA 4B1FA 2OFXA 4W9NA 2WP8J 5IFLA 4XEKA 4NVRA 2MCFA 3WX0A 1V71A 4EG7A 1YL6A 2DEUA 3LT0A 3PR3A 2BFWA 4BZPA 3HNIA 2ZXPA 1CHDA 1GTZA 3B9PA 4YMSA 3BKXA 3U3ZA 1RPNA 5DTJA 2BW0A 2YJ6A 4MULA 1KMQA 1QYVA 1X7DA 1G42A 2GBLC 3B20A 3A9CA 3H17A 3FGOA 4G56A 1IY2A 1LNSA 2GGSA 1Z8FA 2ZYVX 1FMJA 4WFIA 5JY1A 1TZCA 3UGKA 1UBTS 3A1FA 2H1OA 5FBHA 3O39A 3OZWA 4HQFA 3WSVA 1FJ2A 4X1IA 1F0PA 3L5KA 3DDZX 4YMHA 1GTJ1 4TV8B 4I3HA 3OIGA 2QM0A 1F38A 4BEMJ 1O95C 1AU9A 1YO6A 2H0RA 2ZG6A 3IDZA 1S7GA 4N0DA 1E2DA 4N8EA 4D45A 2GTIA 2YZ2A 1VJ5A 3I9V1 2VJOA 3MIIA 4HZGA 4YI3A 4E70A 4V0RA 1P0PA 2EW2A 3ZDRA 3A14A 4W5RA 3A10A 4GMGA 4X45A 2ZVDA 4ZO4A 5F51A 2HPHA 3OZ7A 4B3JA 1Z5WA 1B3RA 3PC8A 4WK0B 2VJYA 4IIJA 2P7HA 1COWD 1KSJA 2K5UA 2GNAA 2HRCA 1PW7A 1YRLA 1VLLA 4ZPXA 1U9JA 5TT1A 3VI4B 3WLRA 3CO5A 2I03A 5B37A 2I67A 4ASUD 2YLIA 5KQRA 3CCBA 5JC8A 3W2VA 1EFLA 2IYXA 5K4GA 1NUSA 3WLHA 4GKBA 2HAEA 4R1LA 1Y9JA 3E0QA 1E2LA 2JI6A 1TFKB 4E0HA 4MUHA 1PL0A 4XFKA 1ZXLA 5JAHA 5KYXA 3G2HA 2FUG6 3AEYA 4TZTA 1N5JA 3I05A 3FZNA 4AP9A 1E7WA 3I2IA 3K0SA 5C7IO 2XLOA 4P34A 2I6GA 1JZSA 4RETA 3AEXA 4XWAA 5BNIA 3GLIB 1Q12A 4DILA 2FR8C 3HC7A 4QQFA 5G0TA 1VA4A 1YV9A 4GIBA 2WOOA 4LCBA 1XMSA 256BA 1ESMA 1GTSA 3HFSA 1CY4A 1KDPA 1M6WA 2WJYA 5FUWA 1TXGA 2H9YA 3M4YA 1TAGA 2G0TA 2JFBA 4ZQGA 4Y1RB 3L40A 3THYA 2WHPB 1LZKA 1BMFA 3IAAA 4TV8F 4ZQFA 4JBHA 5AKLA 1V5IA 4F72A 1YZVA 4UTNA 4GQIA 4MVUA 4DCMA 1OH8A 3SFTA 2H1LA 2EPNA 1CQWA 2GBIA 1CERA 2XUKA 1CW2B 2W70A 1GDTA 5H5JA 3O55A 3MX3A 1MZVA 3KLNA 1MC5A 4G1FA 4LHSA 1GLNA 1QIJA 4BO2A 2XV1A 4MPDA 3L3BA 2QV0A 3RC7A 2Q9CA 4ER0A 3D2LA 3TQHA 5IVHA 5LMCA 2G3KA 3QV2A 4BNKA 4NIMA 4KR7A 3ZDZB 2H3EA 1W8IA 1I24A 3LYHA 3UPDA 4D4JA 3ESCA 4NCHA 3ELYA 3Q87B 1PN3A 2Z2JA 5EPEA 2NO5A 1ZM3A 3BWBA 3P9RA 4WABA 1BXGA 3INGA 3NRJA 3P71T 5GOZA 4ZGGA 3LA6A 2OCBA 5DGHA 4V0SA 3QFHA 2VI5A 1U7PA 2NZ8A 3KJGA 4FT4A 4X60A 4L95C 4RZHA 4XQ9A 4GXRA 1S89A 3SHTA 3HXOA 5ED4A 3BQNB 3R6LA 1E3MA 1LW7A 2XM4A 2P9YA 4AMBA 3BSSA 2D5BA 2Q9UA 1NVDA 1BKSB 1N6KA 1Z4OA 3R4CA 3T7CA 3WZLA 4JOBA 1RC1A 2Q9AA 2ZBVA 3ELDA 2GAQA 3RUHA 2OQRA 4QVKA 3GLQA 1VYUA 2QNLA 1A9PA 1KXZA 4DSZA 5E4TA 4P3NA 4AWBA 3VPBA 1UJNA 1LJUA 1F3LA 5FADA 2XMQA 2AJTA 1CRQA 1VIMA 4GZLA 4DT1B 4B4WA 1XMQB 2AD5A 1D0VA 4I66A 3JD2A 5IW8A 4P9NA 1EBUA 2QM3A 4OHBA 3W2HA 5AQEA 3KPHA 4PN3A 4LF5B 1FMWA 3KZCA 1H6BA 1LE4A 2RHWA 3I4CA 1JQDA 1C3EA 1U2ZA 2OLKA 2WIBA 3FYDA 4YAUA 4BV3A 3D3JA 1EVIA 4R9SA 4IVQA 1G60A 3TLYA 3ZD9A 4YJ2F 4DV2B 2HU5A 1YBFA 3E3AA 5EWLB 5IKXA 2ZQYA 3E9EA 4J0JA 3DXJF 4MI6A 1QPUA 1EH5A 5T3YA 1T2EA 3M1LA 4HNVA 5A05A 2DPLA 3K7EA 5B1HA 4BQPA 1OZ0A 3GDFA 1C7FA 3W4IA 4K81B 3PRJA 5CLLA 1P74A 1PTKA 1U8TA 2VBCA 2OA0A 4XXHA 4RFLA 3VR5A 1SKQA 3DJUB 1T1RA 1Y3HA 4JIGA 5CI8A 5TEWA 3WGYA 4RSRA 2DYSC 1AQUA 3UFBA 5BVGB 2ZZMA 3B5EA 4EW6A 3GIDA 4PIMA 5TGZA 4DIUA 3IDFA 3O82A 1VSVA 2NTJA 3H2VA 2P1AA 3QXSA 3O9VA 3BFKA 3PJFA 4UARA 4I1YA 2VK8A 5AHOA 3REQB 5AUOB 2O0LA 1E2EA 2VS1A 1YBHA 1FP7A 2VQDA 4HQ0A 2VQEB 4MRMA 1MG5A 4MRVA 5F5FA 1SCKA 5DW0A 3HCDA 3JQQA 4CV0A 1E2HA 3HPQA 4CMGA 1PLKA 1MW9X 3TL6A 3JAMA 2V1XA 3NTOA 3JT1A 1YDIA 1GQSA 1OX4A 1U7TA 4FESA 2FPGB 1S3SA 2B83A 1QLHA 2PBRA 2QAGA 2XTNA 1LS6A 3L8MA 1WUIS 4FOTA 2NIPA 3RGWS 3VKFA 1XE3A 5KYTA 3HFJA 4LSZA 4GZ6A 4B7ZA 4C0LA 3R23A 1SUWA 3LQKA 2VK1A 4ZI7F 2RHOA 2BN4A 1FUIA 4QT0A 2UXCB 3AG1C 1M73E 2OORA 4FGWA 5EXXA 3L7DA 1P61B 4G24A 5EQTA 1QLEC 4UDYX 3M7IA 5J2UA 4B7AA 3SS8A 4I08A 1FYDA 3NU1A 1SF8A 3FX2A 3GBPA 2Q0QA 2IELA 1N57A 3QA9A 4R7TA 3W6OA 1TF7A 4IIHA 3WNQA 4BKMA 4PPFA 3LPLA 3NEYA 1OTXA 4MDFA 1L8AA 1XEWY 4XM1A 2Y2VA 3NVMB 3MFYA 1ATIA 1C7QA 1JL3A 2CFRA 2BGRA 2X23A 5AIAA 4LFAB 1OVMA 3CG0A 4H3KB 3O2SB 1H0KA 2B92A 2RJ3A 2EYUA 4L51A 2WAMA 3PF8A 4QARA 2IGBA 2PAAA 1WOMA 1HG0A 4H1VA 1Z23A 5JWRA 2VWGA 5AK0A 1QP4A 3VJMA 3RKRA 1U3GA 3A37A 4NOJA 1VOTA 4DY4A 4G81A 5LQKA 1C41A 3DOJA 3ZJYA 4KXLA 1FNNA 3P45A 2HQOA 5JS7A 1NHWA 3I01A 1KPIA 1S02A 3NEAA 5FD8A 2P9TA 4QQNA 5CYPA 4KMMA 2HXSA 2W9YA 3H5AA 5EJ8A 3FJYA 1JSRA 2YCLA 4GYJA 2LTAA 2R8OA 4Y2RA 3WSWA 2GDCA 3FWPA 3G2IA 4OJYA 1OQAA 1N9KA 4Q1EA 4RIIA 4UVIA 1D5CA 1JWBB 1QP8A 1GNTA 4WCFC 5DOVA 4CJXA 4LJSA 2GYWA 4M1WA 1S8FA 3PUYA 4PICA 4HQRA 2IWHA 2C82A 2VP3A 1Y1LA 4HUTA 3PFBA 5K5EA 2ZJ7A 3M1IA 4D5EA 1FA9A 1QE0A 3SOPA 4MQFA 4RZQA 1OAKA 3T4EA 2R6GA 3F6CA 3FBTA 2WK1A 4M55A 1TMYA 1I94B 1LNZA 1QYRA 1ORHA 4L0QA 1XV5A 2ZULA 2Q6VA 1YK0A 4LMRA 3INNA 2F1OA 4IFTA 5G0WA 3GFSA 5JSKA 3V4PB 2IPXA 3C7CB 4P82A 5CK5A 2MSLA 4C7KA 4EPYA 1QKRA 4KFCA 4NEQA 3K70B 1WQ4A 1T29A 1NVWQ 4RELA 5L40A 4BHTA 1UJ2A 1OWNA 2JFGA 4ZVRA 2GFQA 4ZEOA 5ICFA 1J2RA 1O89A 3I9V6 3I4UA 2NYRA 4PS1A 5JADA 5LKRA 2VUSA 1UP4A 4ABYA 3D7SA 1H94A 2XX3A 4XIIA 1DINA 3EZ6A 4AQDA 3M5WA 3EDCA 2CL0X 4KGZA 3QKRA 1KYVA 5ALHA 5ER9A 4KVZA 4M0DA 4X41A 3ANXA 3O7MA 1H2BA 3ORHA 4TTQA 4UXIA 1BVRA 1XTSA 3IALA 5H02A 1XMIA 3DZHA 2XOEA 4EPTA 2NAFA 3VZBA 3WIDA 3UMJA 2BLLA 3UAGA 3AEQA 5CA1F 4DVGA 1YJGA 2AFIA 2FUG1 4KE9A 1I32A 4NF2A 4DLTA 1T5DX 2D13A 4I2VA 3L6UA 3WAKA 5LLTA 3HNRA 4Q0MA 3U1TA 4Y6GB 1L4MA 1KS2A 1VJGA 3JAWB 3WL3A 2R751 4R9VA 3ZBQA 3GPDG 4JSRA 1P45A 3GPLA 2POQX 1TLFA 3LCVB 4YO8A 2IUSA 2FLWA 2R60A 4Q7LA 4TWZA 3S2GA 1GILA 3AETB 3ZCVA 1UOEA 3EEBA 2QZ9A 4RQUA 4UUQA 3ZXSA 1R5BA 2IHJA 3A4MA 2GWHA 2ZRBA 1J97A 1P1KA 4JTCB 2ENUA 3K72B 3L5OA 4GI5A 2FOLA 5LBUA 3TLJA 3COSA 2KHZA 1QP7A 4NCJA 3DYVA 1ZEJA 3C45A 3G2OA 2HA6A 4R32A 2Q3HA 3NKLA 2CD7A 2H1SA 2Q49A 1F7UA 4ARSA 4PLYA 4NQZA 5F1PA 3VZPA 5HSGA 1ZIDA 3A2NA 1G3MA 1WR8A 4GICA 3UH0A 4KR3A 2ACKA 1EFPA 1QQ7A 3D3EA 3ZHZA 4NNPA 4YLEA 4HUJA 4UD6A 4FDAA 5DM70 1YWGO 1ICEA 2ZIFA 2DHQA 2BBSA 3ORRA 2PUGA 4QJ4A 1B26A 1USVA 2HIGA 3DTTA 1YL5A 1TTTA 3EPHA 1KY5A 3TOZA 5FUVA 4Y6OA 1WB4A 1E3EA 1ZIOA 2PX0A 4ESVA 4ZYZA 2CNWD 2D8MA 1U02A 2IXBA 2KBEA 2GD0A 5E2BA 1W88B 3LBIA 5IUKC 3L77A 4L6RA 2OGSA 3E7XA 4JLJA 4YRGA 3N53A 3T38A 3NWEA 1VKHA 3RVDA 4JYZA 2FPXA 1Z0DA 3BGDA 3F4LA 3BERA 3K05A 4LVUA 3UCXA 1LPPA 4C78A 4R0VA 4RESA 3ABIA 2OFWA 1CE8A 4OI0A 5DQZA 4JL5A 5FBVB 5FTJA 4B0PA 3LX6A 1LX6A 1H4SA 1SCAA 2I22A 1GLVA 4MI3A 2BP7A 2W2PA 4YAKA 1ZR2A 2MMGA 2IY8A 2OOSA 4J29A 2EKZA 4YJFA 1J2EA 4PXAA 1GUZA 1TIPA 4TS1A 4KXVA 2IV2X 3O47A 4HRYA 3OJOA 4QODA 2DXIA 5KNCA 1IULA 1RS0A 4XDGA 1YBVA 4PHHA 1A9QA 2RAPA 5E3CA 3NFYA 5FX2A 4B44A 2LDXA 2ZP1A 1TLTA 4PJNA 1TK2A 2QTVB 3CVUA 1MN6A 4F3RA 3DH0A 1SIOA 4GGOA 1RJEA 1FBNA 1N2CB 1ZMXA 1L5ZA 2AGVA 4JH0A 1BDIA 2C42A 1FFCA 5JLIA 3TRFA 3FR7A 4F5ZA 3KJIA 5J2TB 1U1DA 4NS4A 2HCBA 4KJZA 5JSYA 1ACMA 2AOXA 3JYLA 4NBRA 1O5HA 2LSEA 1KQOA 2V8OA 3MW8A 4FD2A 3UUWA 3KYCB 1LCIA 4HNHA 3AY3A 4M0EA 4F04A 1Q0DA 2LR0A 4F5DA 5CEFA 1E62A 1CRLA 3ET5A 3LLCA 4WFKA 3UMCA 1G59A 2C84A 1E92A 1G8PA 5HFJA 3S8EA 1E2BA 1G5HA 2ZIXB 3V55A 4IAOA 1N6NA 3QBTA 4AZ3B 2IPOA 3OP1A 1N0WA 2P3SA 4CT5A 4OP1A 3L0ZA 7ADHA 2H1WA 4Y2HA 3R3VA 3RU2A 3Q72A 1M2FA 2BKEA 5HG0A 1JJFA 2R62A 3II6X 5IEBA 3THRA 4FFLA 5CFRA 3OCYA 2IIPA 4FFPA 3TAXA 4JXJA 3AY6A 3QYAA 7MDHA 3K1IC 1U8EA 1ZJ5A 2J9RA 3O2QB 5JD3A 3RYCB 3A3YA 4Y7DA 3ND5A 1P44A 3EF1A 5BUZA 5I7SA 2PUTA 3ZWDA 4ARBA 3DDNA 1WW3A 3R7CA 4EVSA 3NBMA 2CV0A 5FI0B 4Z54A 1FP6A 1XLVA 2L42A 2BRUA 1ODSA 5HVNA 1UJ5A 4B31A 3OPNA 2GZ1A 4KPGA 4DCOA 3C0KA 3ETGA 2XMBA 3EQLF 1FCJA 3LS2A 3QU4A 4N7RA 5K8UA 2ZRDA 4N18A 4MP8A 2QG6A 4LNUA 2O4UX 2GZAA 5J5AA 1NBME 1UL1X 4L6CA 4YPOA 1DKLA 3QVTA 4MV3A 4G5OA 5LQSA 4H6PA 4OK3A 4M37A 4XYGA 2QNRA 5EHGA 4PFSA 3TK1A 2GJ9A 3S1AA 3RYLA 3O93A 2QX4A 3S0XA 2WHRA 3G1WA 3GRFA 3UTDA 3HXMA 2DETA 4ZU6X 1KSGA 4P3KA 3PJGA 5A6BA 4OF4A 2NSDA 1RKBA 2HRBA 3CLUC 3KKKA 3BRQA 2SECE 1O94C 2IXTA 4R31A 4E5KA 2PT7A 3LI2A 4YTEA 2BGTA 2ZGVA 3AR7A 4L5YA 4EUFA 4EUNA 1F12A 2V9ZA 4P35A 5G40A 2Q3TA 3H2KA 4OX9B 3H8VA 4HB0A 5C3UA 1A9XA 3M5PA 1Z56C 3GRUA 2YJ5A 4HTFB 3R5TA 2HO4A 4I5EA 4NDNE 5EMKA 4CMCA 2VP4A 2QX9A 2FN4A 3I83A 3JTMA 2AOVA 4M1SA 1DMSA 1ZP6A 3UJ9A 5G53C 4BB6A 2GXUA 2GA9A 3F47A 1P5FA 3NGXA 3ZTYA 2GWWA 5D5PA 3O8QA 3I8SA 4Z2YA 4ALMA 2X8JB 3ENNA 2CFTA 3MZ0A 4E15A 4R8LA 1B4DA 4YCCA 5JNRA 2QLNA 2PZJA 2IW3A 5LA6A 1TA0A 3QXGA 1ZI9A 5FR1A 3VVCA 3PA8A 3AP2A 5HKKA 4F3TA 3CM0A 1OREA 4ITVA 1I4OA 2QXYA 4M1KA 3AW8A 1XTRA 1LI5A 1RQGA 2F1IA 4KVAA 1FQJA 1RYDA 5ECGC 3FY4A 3FMIA 1OKKA 4K3UA 1TZ2A 4QEZA 4XGQA 5F35A 4U1RA 4Z8YA 1W1IA 1T6BY 1GTVA 1MHPA 3AKCA 1P19A 2RIRA 4FYIA 1USUA 3RH0A 1V16A 3UMSA 4ZARA 2H3HA 1WM1A 2QYTA 4HAZA 4KRXA 5NULA 2JH9A 4B7XA 4ZXFA 4TN1A 3JTEA 3QOWA 4MS4A 4BU0A 4MHTA 5IBQA 1OWLA 5F2OA 3HBLA 3G2NA 2XGMA 4FJ0A 4R2MA 3WAQA 1T26A 2OCYC 3PCRB 3NJRA 1A7EA 1UJBA 2PZKA 1MGPA 3RSSA 3UJPA 3H9JA 3E4DA 1SR2A 1ZZPA 3Q7EA 4HLDA 5KSYA 5LOVA 4OGKA 4DR2B 1V4AA 1UMDA 3FCXA 2WU4A 3L1UA 3OI7A 4KR2A 1TU3A 2GZRA 1LSOA 1OXKA 2EDAA 1JQJC 4IDFA 3IHLA 3ND7A 3UQZA 3C98A 3C6QA 2J85A 3LUJA 4U5FE 2F90A 1UFRA 4OU4A 2R6CA 4GNKA 3WG9A 4DDMA 2VJLA 5J59A 1LLQA 4KN6A 4MDHA 4YRBA 3FPFA 4O79A 1EJ6A 1AF4A 2XGJA 4FYPA 5J1SB 2VNSA 2O2CA 4ER6A 3FCSB 3UG6A 4HNQA 1I3MA 4M0PA 4NSNA 4Y6QA 3QMVA 2ZT6A 1E60A 3ZE7A 1YFKA 1ZUWA 4QJ5A 3L1HA 1W9HA 2VHQA 2RG7A 3H13A 1FTNA 2FEAA 3CPEA 3STHA 3WLKX 3UHJA 1JHUA 5C7LO 1ILEA 1A7UA 1NVGA 2I9KA 3ZK8A 5JSHA 4L8GA 1FNCA 3S9OA 1UPAA 2CV2A 1JSZA 2AK3A 2XOKA 1IZ9A 4KO2S 3R9IA 3ZCSA 3LECA 2JCYA 1R88A 3ENQA 3JWHA 1QFSA 1CPYA 3RYCA 1QZ3A 2YMLA 1PYOA 3DO8A 5EJ7A 1KFEB 5J2TF 5CT5A 1VPVA 3H1FA 3PD7A 4I5GA 1JHYA 4ZI7A 1U8YA 5F7XA 3VNVA 1JE0A 3Q8LA 4FYVA 4Q4HA 4P58A 4MQFB 4Q5SF 2VUTA 4JBXA 4CQJA 4F7WA 4ZMSA 1HQDA 3COYA 4G86A 5FFFA 4QHTA 3FSGD 4HUQB 5TPWB 3U5TA 2J4FA 3B52X 1BWQA 1Q0ZA 1T35A 4ZTZB 2AL7A 2BGKA 1RI1A 3ZNQA 3L8EA 3LS0A 4MQEA 5BYBA 1HSZA 2G07A 1N2IA 4BWGA 4F4DA 1C1DB 1YVEI 2IYSA 3T7EA 3NVAA 2C2BA 3RHZA 2BY4A 5GIPE 1TIBA 3KLMX 1A9ZA 1O57A 2X8AA 3WAJA 3EJ6A 1RZRD 3I6ZA 4K05A 1M7GA 1R27A 4RX1A 5AVTA 1L3IA 1SMYF 5FUXA 2HRDA 3ESXA 1Z2AA 5D01A 4IZHA 3UAZA 5T67A 1VBFA 1W9MA 4PR9A 3FW1A 1X14A 4XGIA 1A1SA 2G4CA 2XB6A 1RTKA 1APCA 3RTBA 1FU8A 1VLVA 3T12A 3F9IA 1BH2A 2KC3A 3G9TA 3JZFA 1SZJG 1KSHA 1X87A 5KWSA 2R7RA 5CFOA 2HW8A 4B71A 4EFKA 4EPWA 5ADUS 1U1GA 2C3UA 4JBGA 1ZD3A 4JEIA 1Z6AA 1JU9A 3NBAA 1LWNA 4HGQA 4JGIA 3RUCA 1XD2B 3F8TA 2GZSA 4R9NA 4RIFA 4UDXX 4ZYYA 4G5FA 3GX1A 1NDHA 1F4LA 1PQ4A 4FFNA 2X1HA 5AK4A 1OLSB 5AVVA 1USIA 2BH2A 1FVFA 1TQ6A 1ULHA 4L3VA 3M1AA 2JFZA 4PW0A 5I7UA 2O4CA 1QKIA 2RGDA 1MO3A 2C4UA 1Q0PA 3RSGA 2QN1A 4K8RB 3KC2A 2AXQA 1X86B 2Z8ZA 2D2EA 3NBZC 4LY0A 1KDVA 5IAOA 2RAFA 1TWGA 2VQFB 2VH3A 3N7TA 3G23A 4IIVA 4WGZA 4KX3A 3QFCA 3SVZA 5KU1A 1XVUA 1Q0MA 5KYWA 3IUNA 4BAUA 3IEEA 4ED9A 4M0FA 2EINC 2VH1A 1NXWA 5KYGA 1RVDA 3TNJA 1YZAA 2WKSA 3GNLA 4WXYB 1NWCA 2H07A 3ABKC 4U5EE 1FL9A 2D5AA 1J9ZA 4Q1AA 4DOMA 2J9VA 3BWDD 4ZVNA 3HO8A 3LC1O 4H17A 5FIUA 2NUPA 3BWVA 3PXGA 4D82A 2HJVA 3JQRA 3L7CA 3WLQA 4BXOB 3ZHCA 3VF0A 2FQXA 2PYDA 1KJWA 5J40A 4JT8A 4AP6A 4AL1A 1IN5A 3PD1A 3TR6A 1L3BA 1S2LA 3GRPA 1A41A 5KEIA 4HFFB 4WK4B 4XAQA 3W5SA 5JJBA 2IBTA 4K9DA 1E6EA