3DMLA

Crystal structure of the periplasmic thioredoxin soxs from paracoccus pantotrophus (reduced form)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
ELRLLMFEQPGCLYCARWDAEIAPQYPLTDEGRAAPVQRLQMRDPLPPGLELARPVTFTPTFVLMAGDVESGRLEGYPGEDFFWPMLARLIGQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of the periplasmic thioredoxin SoxS from Paracoccus pantotrophus indicates a dual Trx/Grx functionality for activation of chemotrophic sulfur oxidation in vivo
rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 22
structure length 95
sequence length 95
ec nomenclature ec 1.8.4.-:
pdb deposition date 2008-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dmlA00
4MZCA 4PX1A 2VO4A 1XXUA 1C72A 2FLSA 3IR4A 3HZ8A 1MD4A 2LTKA 1F2EA 2CX3A 2QGVA 4K7OA 1I9DA 4GF0A 5DJMA 4GSTA 2NDOA 3P7XA 2FGXA 4MA9A 3IPZA 2TRCP 1XVQA 4ZIJA 5LNKe 2GQMA 2LRNA 1BAYA 2OE3A 2GVPA 2B1KA 3F6DA 2HE3A 5B7CA 3FZ4A 6GSSA 3EMXA 22GSA 1JLWA 4PUAA 3KP8A 3HYPA 2HXKA 3FKFA 1S3CA 5HFKA 4IQAA 1E2YA 2C8UA 4OO5A 3MWHA 3IXRA 3ZMKA 4HOJA 3L9VA 3QFBC 4IJ3A 1JZWA 3PGTA 2ZNMA 3GUSA 3GMFA 2M46A 2DJ3A 4MP4A 5GZZB 4ZBDA 3EC3A 1TXXA 3GX8A 1ZCPA 3RAZA 4WXTA 4TR4A 2LQOA 5DCHA 6GSUA 3O6TA 4POLA 4NWYA 3IC4A 2LEGA 2H1BA 1PRXA 4Q5RA 5ECPB 3QAVA 1AQVA 4ML6A 2YWIA 3QDNA 4IGJA 2IMKA 5JCWA 5H5RA 2DBCA 5IO0A 3VI7A 3G7YA 1DE2A 2WJUA 2NVLA 2NTOA 1A8YA 1K0MA 4K0NA 4J56E 1SD9A 2GS3A 3KCMA 5IMZA 1GL8A 2CQ9A 5CNWA 1PSQA 1VGLA 4GSSA 5E4WA 4BPYA 2CT6A 2XHFA 1F3BA 3IHQA 5HR0A 2L4QA 1UC7A 1GSQA 5CREA 3CRUA 1XBSA 2VL2A 1V58A 2RUFA 4KA0A 3GTUB 17GSA 4HZ2A 2H6ZA 2OKAA 4NV5A 1R5PA 1GP1A 4TXOA 4YQVA 4WF4A 4ISDA 1S3AA 3IE3A 4OFMA 2IMDA 2GT5A 2XPDA 1TRWA 1JZRA 4OFNA 4XS4A 2CVBA 3VURA 3HJMA 1ML6A 1VRSD 2HNLA 3KTBA 1EWXA 4F0BA 4EO3A 1UN2A 5INYA 2O85A 1B9XC 5CRDA 2H8LA 3DMLA 1VF4A 4GQCA 1SKSB 3H1NA 4ID0A 4ZBBA 2I9HA 4NMUA 4PUFC 4EKZA 1GWCA 4EL1A 3FW2A 2OJLA 1GH2A 3F4SA 5GSSA 1LU4A 3IAM2 2FA4A 3L4NA 3EMPA 4RUVA 1EV4A 2YPMA 3W8SA 1TDIA 1F3AA 2WRTA 4NXIA 1A2MA 1VF2A 4DSRA 3CTGA 1XWCA 2FWFA 3BCIA 2M72A 1T4ZA 4N30A 1GSFA 3IA1A 5FHIA 4AF2A 4G19A 4YH2A 4BWSA 1W89A 1VF3A 1EV9A 4IHUA 1SK0A 4GQFA 2LJAA 1F6MC 1AW9A 2QC7A 1TI3A 3BJ5A 3UVHA 3FK8A 3DGQA 1GUKA 3GKKA 3PH9A 3FEUA 1EOGA 1MTCA 1GSEA 3ZIJA 4KCAA 1U3AA 2JZRA 5ELAA 1ZZYA 3E3EA 3D22A 2HSHA 1F9MA 12GSA 3EINA 2HRNA 4K7NA 1GUMA 5IMCA 3VK9A 4K7IA 3WGDA 1GTBA 1EZKA 4LA1A 3LYKA 3QD9A 1ZMAA 1TU8A 2VL9A 2C0FA 4FO5A 4AJ6A 1ERTA 3IK7A 3Q6OA 1T1VA 1PMTA 4KSOA 1G6YA 4K1FA 1S3DA 2IMFA 2BMXA 3GTUA 1N8JA 3ZFLA 1OE8A 2TIRA 1SK1A 1TRSA 4PNFA 1M9AA 2YWMA 1PA3A 5IPHA 2IN3A 2PBJA 2OACA 4I5QA 1KBNA 1WIKA 3IV4A 2GSSA 3F4TA 3U5RE 1Y6EA 2PU9C 1QMVA 3I43A 1Q98A 1GTIA 1WJKA 4J2FA 3TRQA 3ZMLA 4HDEA 1SU9A 3DD3A 3LWAA 4ACSA 1PQNA 2P31A 2H0HA 2AJQB 2KLXA 3TKSC 2VCZA 3S9FA 5DAKA 1FAAA 1NHOA 1E6BA 4ZB6A 2CZ2A 2V2GA 1J9BA 3GV1A 1CQHA 2VLUA 4TR1A 2C1YA 2OBKA 2DMLA 2HFDA 1QXHA 5F05A 1EEMA 3EE2A 4JR4A 1PL2A 4EE0A 1IYHA 3UBKA 4KSMA 5CAXA 1ZL9A 1VF1A 2VL3A 3G9BA 5F8BA 2E2GA 1TU7A 3ZRDA 1GSUA 3L0HA 4KCEA 5H5SA 5J4UA 1Z7RA 2CAIA 1R26A 3GL5A 3GA4A 5ENUA 2FY6A 4N0VA 2LSTA 3HJOA 4HS1A 1R5AA 3F0IA 4MPFA 2H75A 4TXVA 1V57A 13GSA 1ERUA 3C71A 1JZOA 2GT6A 1ZYQB 5AN1A 5IOWA 1YF0A 2VCTA 1M9BA 3CRTA 4GTUA 2AUVA 3CSJA 2PPTA 3MNGA 4MZBA 2J23A 3KEBA 2JZSA 3QAWA 2FNOA 1KEBA 2PN8A 1ERWA 4JEDA 2DJ0A 4TVEA 2X99A 3J7Yk 4ILFA 3D4MA 2C3QA 3HZ4A 3GIXA 2MMOA 2WFCA 4HI7A 3C8EA 1SJ6A 4NHZA 5G5EA 4TRXA 2YWNA 1N2AA 5D9VA 3UEMA 3RHBA 2LRCA 2H01A 1Z3EA 3KMNA 4RI7A 4HJMA 2GSRA 5J9BA 2L59A 4BL7A 2V6OA 4MABA 3LORA 1FO5A 1XZOA 1X9SB 3KH7A 5EL8A 3AY8A 4MK3A 1TK0B 4LLRA 1K3OA 5JWRB 4Z7XA 2E0QA 4X1UA 3A5WA 2HRFA 4AJ7A 1NHYA 1OC9A 1J08A 1ST9A 5DVBA 3TJFA 1GSDA 3IBHA 4WBJA 1XCCA 1YY7A 5J41A 1PKWA 5B8AA 3F3QA 2R37A 1K0OA 5G5FA 1XWGA 2V6KA 3M3MA 4X0XA 3CTFA 2PVQA 4V2MA 1AQXA 2PGTA 2ON5A 1XWAA 2GZZA 3TJJA 2V1MA 4F0CA 2H72A 3LSZA 3BOAA 2DIYA 2VCQA 4OMVA 4TR3A 4K9ZA 19GSA 2AB6A 1OKTA 3KZQA 4KDYA 4V1Ag 5A4WA 2MBSA 5CO3A 1G7EA 1HNAA 3WGXA 1F37A 4FYBA 3R2QA 5IMVA 2YANA 1NSWA 4F2IA 4DSSB 4HEA2 2EIOA 4KE3A 2PERA 4POBA 4O7HA 4GXZA 4HQZA 1BYEA 3ERGA 5IOXA 2L6DA 3ZL5A 5GAND 5HR3A 1M99A 2N5AA 1B4PA 4PXOA 4IN0A 4G10A 1A2JA 3WT2A 1PX6A 3M0FA 4CHSA 1HNCA 2VLTA 1Z7PA 1Z6MA 1FVJA 2HLSA 2HZEB 2I81A 4L5LA 4MZWA 1FOVA 5D9XA 2GLRA 3GHAA 4G2EA 1MDJA 1MEKA 3WD6A 2DJ2A 5F07A 5ECMB 3CYNA 4MH3A 1X5CA 2OA7A 2FCHA 1M7TA 1TOFA 5G30A 3GH6A 4I97A 1EGOA 4OD7A 4MJEA 2N5BA 3NIVA 3QAGA 2KOKA 3H93A 4TR0A 1SJZA 3RPPA 4G9HA 18GSA 2YWOA 2IJYA 2IPAA 3MSZA 2L57A 3C7MA 4K2DA 4K0GA 4V2LA 2GDRA 1SKRB 1WP0A 4N0ZA 3TUEA 2VLVA 3HVXA 2GQKA 3HY2A 3RPNA 1ERVA 4F03A 1U88A 2ZCTA 4PQHA 1PL1A 2Z9SA 3LEFA 4I8BA 4LL1B 2PVOC 1MDKA 3BCKA 4K8MA 2VD0A 4JU5A 3GSSA 3FR9A 3ZTLA 6GSYA 1BG5A 1AQWA 5DBQA 1DSBA 4EUYA 1J0FA 1O7UA 2HSYA 3UBLA 3NOFA 3VPTA 4Q5FA 3FHKA 3PR8A 4PQ1A 4PURA 3FZ9A 5D96A 4EVMA 3M9KA 4ZXGA 2C3TA 3M1GA 3GX0A 1JLVA 3F4RA 3H4KA 5KEJA 5IPGA 4PGTA 1B48A 4OFTA 1QUWA 14GSA 1BEDA 4HQSA 2WS2A 1XPVA 1PKZA 2CA8A 3H79A 5ECSA 2WCIA 4MF6A 2IMEA 2LUSA 2K9FA 2C0EA 2MYGA 2HZEA 4MF7A 4IKHA 6GSVA 4AGSA 4XCSA 1T00A 2VUPA 3D6IA 5DQYA 1FW1A 3V1WA 4BWQA 3CBUA 2AHEA 2H1DA 4I6XA 1TRUA 5HFIA 8GSSA 2PMTA 4KNDA 1X5EA 2CVDA 1O8XA 2YCDA 4IELA 4MJCA 2VL2C 3GRXA 2NPBA 2MZCA 3VWWA 3NZNA 1K0DA 4D73B 2KUCA 2C0GA 1TKDB 2ON7A 2IWTA 4GSNA 3O3TA 3P8WA 2KHPA 3Q74A 2NBSA 4N10A 5H5QA 4KX4A 2EC4A 3Q19A 1ILOA 3IOSA 4LMVA 3ZVJD 3LJRA 1K3YA 1ON4A 2IFQB 4KDUA 2RM5A 5AGYA 2DC5A 1H4OA 2DLXA 2O7KA 1Y25A 4PNGA 2TRXA 1UVZA 3TKPA 1FVKA 5ECIB 3N9JA 1ZGNA 3TKSA 4DSQA 2VOCA 3VWUA 20GSA 5IM9A 4K6XA 4MH2A 4IS0A 2GZYA 2H6XA 16GSA 2P0GA 2F51A 1A0FA 4OCEA 5GAPD 2B6MA 2YZHA 2XBQA 1XIYA 1T7PB 1YZXA 4GLTA 1OC8A 1THXA 5JWQB 2KP1A 1TK5B 2R5GA 1O85A 4IP6A 1QQ2A 1ZYEA 2OBIA 1XOAA 1PX7A 4BVYA 2B1LA 2I4AA 2C4JA 3UAPA 4JE1A 1XWBA 5AISA 4F9ZA 1NM3A 4NPBA 2X8CA 2YJ7A 5GSTA 4L0WA 5ELGA 2A2RA 1JFUA 3DYRA 6GSXA 2QKEA 4MCUA 3VWXA 1A23A 4EC0A 4GWRA 2BJXA 2RM6A 4V1Ap 3SBCA 3HA9A 3GN3A 1WRYA 1FB0A 3ISOA 4BA7A 4ECIA 1SD8A 2K8SA 4TOPA 2JZTA 4RI6A 1G6WA 1GUHA 5HFGA 1WE0A 3GURA 6GSWA 5ID2B 3FR6A 2VIMA 3ED3A 4ZBAA 2FWHA 4WR4A 3TGZA 4POMA 3HVSA 5G1LA 4MDCA 4QQ7A 3BD2A 3TDGA 3ZITA 1CQGA 1OKDA 1SL2B 4WETA 4JBBA 1BQ7A 1YKCA 1SJIA 1WOUA 1PD21 2C3NA 3J7Yb 2LJKA 4RQXA 5KN0A 2LJRA 3TRPA 3I69A 1GLPA 1PN9A 4FYUA 3F63A 1WMJA 1PGTA 3GYKA 1K0CA 5D9TA 1K0BA 2I3YA 5HR1A 2B7JA 2F9SA 2LNSA 2R2JA 3TKRA 3LYPA 4PQIA 4NV2A 3D4TA 3P2AA 1QFNA 1X9WB 1THOA 2B7KA 2VM1A 1DUGA 4F82A 3L78A 2YOIA 1QK8A 4N11A 3VLNA 2JACA 3HXSA 3KD0A 5C00A 2RIIA 4J57E 4JR6A 4DEJA 4ECJA 3GKXA 3OR5A 2XC2A 4P3YB 2V32A 3FZ5A 3ZIVA 1TJDA 5C04A 4LL4B 5KN2A 4L0UA 4HU9A 2B5EA 1X5DA 2LNTA 1ACVA 3LG6A 1K0AA 1GRXA 3JCML 3A3TA 3HKRA 3UMAA 2MMAA 3DKSA 5DDLA 2ES7A 1AAZA 1QGVA 2PUKC 1YKAA 4TN8A 5ECQB 4Q5QA 4TW5A 3BBYA 5ID2A 3IK9A 3ERWA 4IJIA 5D93A 1V98A 1XWKA 4WKWA 3GFKA 3DRNA 5IQYA 1ABAA 2CAQA 4LMWA 3IDVA 3TKQA 4I2UA 1MDIA 2X8HA 2H0IA 3EU4A 3KMOA 1K0NA 2WZ9A 1RW1A 2VCVA 3GH9A 3QCPA 4EDZA 2EIQA 4KDXA 2LRTA 2ALBA 3D0ZA 3D5JA 5ECOB 4WF5A 4ZL9A 3KXOA 4ZB9A 1HYUA 4X43A 3IAS2 5JWOB 4V2NA 4IW9A 5J9CA 2FD3A 2VCXA 3RDWA 4E8HA 2GSQA 3FRCA 2K8VA 3ZVJA 3EURA 4WR5A 1SYXA 4GCIA 3TCOA 4KB3A 1KTEA 5AIVA 3M9JA 1M2DA 3F8UA 5B8BA 1URMA 4XS6A 4TXOB 3VFIA 3A2WA 3QR6A 7GSSA 2H30A 2QSIA 3UL3A 1WPIA 1V40A 2O87A 2X64A 3K8NA 3LGCA 5CRWA 1TK8B 4MPGA 3RHCA 2FWEA 4XS4B 2F8AA 2CV4A 1B9YC 2L5OA 5F06A 5CP1A 2KP2A 1Z6NA 5ECKB 3UARA 1BJXA 4XRDA 2M80A 2VAFA 3FY7A 1A24A 1T8EB 3H8QA 1SKWB 3GKMA 1Q4JA 1SYRA 4NAXA 5AIXA 5ECNB 3VWVA 3FYGA 3I6AA 1LJRA 3M8NA 1IYIA 3CMIA 1SL0B 2YNXA 3FR3A 2GSTA 1A2LA 1M2BA 3D21A 2GTUA 2MMNA 2YV9A 3CSHA 5HR2A 1G0TA 4YQMA 3CXGA 4QL7A 1JZDA 4TKYA 2VD1A 5FT3A 3ZZXA 3MDKA 2D2ZA 3A2VA 3F6FA 1RQMA 4XRAA 5ECRB 1R7HA 2VM2A 2H6YA 4HZ4A 5EY6A 2P5RA 1TW9A 5J3RA 3ME8A 2OE1A 4I2TA 2CZ3A 4HJ2A 4XTSA 1A8LA 2BTOT 2J9HA 5CYYA 3P90A 4JRRA 4KAEA 4HU7A 5DALB 2RUEA 4H86A 3G7IA 1NW2A 10GSA 2R4VA 3US3A 2FUG2 4WBRD 2XBIA 3C1RA 3DWVA 2FA8A 1WWJA 2B5YA 3KH9A 3QFAC 5IIZA 2OE0A 2F3MA 2IIYA 3U6VA 3UIWA 3APSA 3UOMA 3LXTA 2IL3A 1X0RA 1XFLA 5HQPA 5COHA 4DSSA 1HNBA 1UA5A 2L5LA 2WGRA 4IP1A 1EP8A 1XW6A 2MMZA 1U87A 5DCGA 3APQA 5DJLA 3TOTA 2O8VB 11GSA 2DMMA 3W6GA 1GTAA 1HD2A 3VI5A 1JHBA 2H19A 3DXBA 4O32A 1ZOFA 5KN1A 2C0DA 2WULA 3N5OA 4MMMA 4OWYA 5DQSA 4IBPA 1GLQA 5DAKB 2DJ1A 1AIUA 2V41A 2O89A 1G7OA 3KGKA 4L5OA 4TR1B 2L4CA 3WGEA 3HVVA 4IQ1A 1OAZA 2E2MA 4YAPA 3WYWA 3APOA 2DJJA 3ZLPA 2H74A 2YV7A 4Q5NA 4XIHA 4KH7A 1OC3A 5IO2A 1LBKA 2RLIA 2R6KA 5ABRA 2GQLA 3MAKA 5FWGA 2H71A 4CW9A 3TRXA 3L9UA 2K18A 1Z5YE 4O92A 2YZUA 2H73A 4EF0A 1T3BA 1H75A 3GNJA 4L8EA 3HJPA 4XS1A 5IMDA 5A4UA 3F3RA 1YF1A 4CDOA 5DALA 1EGRA 1A0RP 4YQUA 2A2SA 2E7PA 4HUAA 3KP9A 1KNGA 5EPFA 1O73A 3DVWA 2DIZA 3TB2A 1FHEA 4MJAA 1TRVA 3WT1A 3F9UA 4O5RA 3KM6A 5G31A 4FIWA 5J5NA 4QL9A 2ZUPA 2PWJA 1O6JA 2DJKA 1AXDA 1O8WA 4POKA 2I1UA 5CRHA 3HDCA 1YQ1A 1X9MB 1HQOA 2YP6A 1GNEA 4IVFA 1GNWA 1YEXA 2JL4A 5ECLB 1TTZA 5B6MA 1SK2A 2LQQA 4FYCA 4DVCA 1XW9A 2JSZA 4OO4A 4FH8A 3UVTA 5A5KA 3HD5A 2F8FA 3TOUA 5LCZA 3LXZA 5IMFA 2H66A 3C73A 3HHVA 4EDYA 2LS5A 3DEXA 3L9SA 2G0FA 2JADA 1W4VA 3RBTA 2AV4A 2GGTA 5ECHB 3EWLA 4BVXA 5D8IA 1B4QA 3DVXA 2X8GA 1T4YA 3W8JA 1U6TA 2CX4A 2XPEA 1OC9B 3KTLA 1V2AA 5E59A 2WB9A 2B3SA 4ZL8A 1FB6A 2L6CA 3TJKA 4D73A 1M2AA 5L71A 2G2QA 3PINA 3ZYWA 1XOBA 4ML1A 1U3IA 2HYXA 4WEYA 1DE1A 2LKUA 3ERFA 3QOUA 3UJ1A 2H70A 2H1AA 2WDUA 1EOHA 2IFQA 3VPQA 1Z9HA 1AUCA 2VCWA 1BX9A 3KJYA 1RK4A 1TP9A 3IRAA 2GZPA 3ZFBA 3C1SA 4ECCA 2YJHA 4KGIA 1K3LA 1EP7A 2YN1A 1EEJA 4KW6A 4KUNA 1YJ6A 1GTUA 3GKNA 1GSYA 3EU3A 2IMIA 2MBTA 5JCUA 1GULA 2C80A 3G7JA 4OCFA 2FHEA 2JSYA 1R4WA 2FWGA 3E9JB 1SL1B 6GSTA 1USBA 1M0UA 3SWLA 1FG4A 2B5XA 3TJBA 4GRFA 2K6VA 1O81A 9GSSA 3LQ7A 2DSAA 4EXJA 3GL3A 3LFLA 2LV3A 1V9WA 5B6NA 4JZQA 5KN3A 4RQRA 1XVWA 1SENA 1TI1A 5D73A 1I5GA 3FZAA 3QPMA 2H0GA 3QMXA 2AYTA 2HZFA 4NHWA 4MF5A 3O76A 2REMA 3KIJA 1DBYA 5D9WA 3I9V2 1XW5A 5G1KA 2R3XA 3E0UA 3TKSE 3GSTA 2P5QA 2H76A 5A4VA 3DIEA 2H1GA 4ECBA 5F0GA 1OVNA 3ZREA 1AC1A 4XHMA 5EVOA 4MLYA 1OE7A 3HCZA 2OADA 4ULXA 2JU5A 5JCGA 2HT9A 4MJBA 4AJ8A 1YDKA 2CVKA 2AAWA 5G2ZA 1YEPA 1GSSA 3ME7A 2HI7A 3EVIA 1B8XA 1OYJA 1MD3A 4YAVA 3TJGA 4E8EA 5CRGA 4ZB8A 2A4VA 2N5FA 4ZILA 2EIRA 3CSIA 3A2XA 3EYTA 4ZL7A 3Q18A 5LD0A 5IMAA
chains in the Genus database with same CATH superfamily
4MZCA 4PX1A 2VO4A 1XXUA 1C72A 2FLSA 3IR4A 3HZ8A 1MD4A 2LTKA 1F2EA 2CX3A 2QGVA 4K7OA 1I9DA 4GF0A 5DJMA 4GSTA 2NDOA 3P7XA 2FGXA 4MA9A 3IPZA 2TRCP 1XVQA 4ZIJA 5LNKe 2GQMA 2LRNA 1BAYA 2OE3A 2GVPA 2B1KA 3F6DA 2HE3A 5B7CA 3FZ4A 6GSSA 3EMXA 22GSA 1JLWA 4PUAA 3KP8A 3HYPA 2HXKA 3FKFA 1S3CA 5HFKA 4IQAA 1E2YA 2C8UA 4OO5A 3MWHA 3IXRA 3ZMKA 4HOJA 3L9VA 3QFBC 4IJ3A 1JZWA 3PGTA 2ZNMA 3GUSA 3GMFA 2M46A 2DJ3A 4MP4A 5GZZB 4ZBDA 3EC3A 1TXXA 3GX8A 1ZCPA 3RAZA 4WXTA 4TR4A 2LQOA 1XG8A 5DCHA 6GSUA 3O6TA 4POLA 4G0IA 4NWYA 3IC4A 2LEGA 2H1BA 1PRXA 4Q5RA 5ECPB 3QAVA 1AQVA 4ML6A 2YWIA 3QDNA 4IGJA 2IMKA 5JCWA 5H5RA 2DBCA 5IO0A 3VI7A 3G7YA 1DE2A 2WJUA 2NVLA 2NTOA 1A8YA 1K0MA 4K0NA 4J56E 5KOWA 1SD9A 2GS3A 3KCMA 5IMZA 1GL8A 2CQ9A 5CNWA 1PSQA 1VGLA 4GSSA 5E4WA 4BPYA 5BRTA 2CT6A 2XHFA 1F3BA 3IHQA 5HR0A 2L4QA 1UC7A 1GSQA 5CREA 3CRUA 1XBSA 2VL2A 1V58A 2RUFA 4KA0A 3GTUB 17GSA 4HZ2A 2H6ZA 2OKAA 4NV5A 1R5PA 1GP1A 4TXOA 4YQVA 4WF4A 1PFOA 4ISDA 1S3AA 3IE3A 4OFMA 2IMDA 2GT5A 2XPDA 1TRWA 1JZRA 4OFNA 4XS4A 2CVBA 3VURA 3HJMA 1ML6A 1VRSD 2HNLA 3KTBA 1EWXA 4F0BA 4EO3A 1UN2A 5INYA 2O85A 1B9XC 5CRDA 2H8LA 3DMLA 1VF4A 3PPUA 4GQCA 1SKSB 3H1NA 4ID0A 4ZBBA 2I9HA 4NMUA 4PUFC 4EKZA 1GWCA 4EL1A 3FW2A 2OJLA 1GH2A 3F4SA 5GSSA 1LU4A 3IAM2 2FA4A 3L4NA 3EMPA 4RUVA 1EV4A 2YPMA 3W8SA 1TDIA 1F3AA 2WRTA 4NXIA 1A2MA 1VF2A 4DSRA 3CTGA 1XWCA 2FWFA 3BCIA 2M72A 1T4ZA 4N30A 1GSFA 3IA1A 5FHIA 4AF2A 4G19A 4YH2A 4BWSA 1W89A 1VF3A 1EV9A 4IHUA 1SK0A 4GQFA 2LJAA 1F6MC 1AW9A 2QC7A 1TI3A 3BJ5A 3UVHA 3FK8A 3DGQA 1GUKA 3GKKA 3PH9A 3FEUA 1EOGA 1MTCA 1GSEA 3ZIJA 4KCAA 1U3AA 2JZRA 5ELAA 1ZZYA 3E3EA 3D22A 2HSHA 1F9MA 12GSA 3EINA 2HRNA 4K7NA 2HRAA 1GUMA 5IMCA 3VK9A 4K7IA 3WGDA 1GTBA 1EZKA 4LA1A 3LYKA 3QD9A 1ZMAA 1TU8A 2VL9A 2C0FA 4FO5A 4AJ6A 1ERTA 3IK7A 3Q6OA 1T1VA 1PMTA 4KSOA 1G6YA 4K1FA 1S3DA 2IMFA 2BMXA 3GTUA 1N8JA 3ZFLA 1OE8A 2TIRA 1SK1A 1TRSA 4PNFA 4Z2TA 1M9AA 2YWMA 1PA3A 5IPHA 2IN3A 2PBJA 2OACA 4I5QA 3R3EA 1KBNA 1WIKA 3IV4A 2GSSA 3F4TA 3U5RE 1Y6EA 2PU9C 1QMVA 3I43A 1Q98A 1GTIA 1WJKA 4BL7B 4J2FA 3TRQA 3ZMLA 4HDEA 1SU9A 3DD3A 3LWAA 4ACSA 1PQNA 2P31A 2H0HA 2AJQB 2KLXA 3TKSC 2VCZA 3S9FA 5DAKA 1FAAA 1NHOA 1E6BA 4ZB6A 2CZ2A 2V2GA 1J9BA 3GV1A 1CQHA 2VLUA 4TR1A 2C1YA 2OBKA 2R0GA 2DMLA 2HFDA 1QXHA 5F05A 1EEMA 3EE2A 4JR4A 3FMWA 1PL2A 4EE0A 1IYHA 3UBKA 4KSMA 5CAXA 1ZL9A 1VF1A 2VL3A 3G9BA 5F8BA 2E2GA 2X4AA 1TU7A 3ZRDA 1GSUA 3L0HA 4KCEA 5H5SA 5J4UA 1Z7RA 2CAIA 1R26A 3GL5A 3GA4A 5ENUA 2FY6A 4N0VA 2LSTA 3HJOA 4HS1A 1R5AA 3F0IA 4MPFA 2H75A 4TXVA 1V57A 13GSA 1ERUA 3C71A 1JZOA 2GT6A 1ZYQB 5AN1A 5IOWA 1YF0A 2VCTA 1M9BA 3CRTA 4GTUA 2AUVA 3CSJA 2PPTA 3MNGA 4MZBA 2J23A 3KEBA 2JZSA 4K2XA 3QAWA 2FNOA 1KEBA 2PN8A 1ERWA 4JEDA 2DJ0A 4TVEA 2X99A 3J7Yk 4ILFA 3D4MA 2C3QA 3HZ4A 3GIXA 2MMOA 2WFCA 4HI7A 3C8EA 1SJ6A 4NHZA 5G5EA 4TRXA 2YWNA 1N2AA 5D9VA 3UEMA 3RHBA 2LRCA 2H01A 1Z3EA 3KMNA 4RI7A 4HJMA 2GSRA 3CQFA 5J9BA 2L59A 4BL7A 2V6OA 4MABA 3LORA 1FO5A 1XZOA 4KF9A 3LW9A 1X9SB 3KH7A 5EL8A 3AY8A 1M3IA 4MK3A 1TK0B 4LLRA 1K3OA 5JWRB 4Z7XA 2E0QA 3IHGA 4X1UA 3A5WA 2HRFA 4AJ7A 1NHYA 1OC9A 1J08A 1ST9A 5DVBA 3TJFA 1GSDA 3IBHA 4WBJA 1XCCA 1YY7A 5J41A 1PKWA 2HRKA 5B8AA 3F3QA 2R37A 1K0OA 5G5FA 1XWGA 2V6KA 3M3MA 4X0XA 3CTFA 4A5PA 2PVQA 4V2MA 1AQXA 2PGTA 2ON5A 1XWAA 2GZZA 3TJJA 2V1MA 4F0CA 2H72A 3LSZA 4G0KA 3BOAA 2DIYA 2VCQA 4OMVA 4TR3A 4K9ZA 19GSA 2AB6A 1OKTA 3KZQA 4KDYA 4V1Ag 5A4WA 2MBSA 5CO3A 1G7EA 1HNAA 3WGXA 1ZYNA 1F37A 4FYBA 3R2QA 5IMVA 2YANA 1NSWA 4F2IA 4DSSB 4HEA2 2EIOA 4KE3A 2PERA 4POBA 4O7HA 4GXZA 4HQZA 1BYEA 3ERGA 5IOXA 2L6DA 3ZL5A 5GAND 5HR3A 1M99A 2N5AA 1B4PA 4PXOA 4IN0A 4G10A 1A2JA 3WT2A 4EIPA 1PX6A 3M0FA 4CHSA 1HNCA 2VLTA 1Z7PA 1Z6MA 1FVJA 2HLSA 2HZEB 2I81A 4L5LA 4FQUA 4MZWA 1FOVA 5D9XA 2GLRA 3GHAA 4G2EA 1MDJA 1MEKA 3WD6A 2DJ2A 5F07A 5ECMB 3CYNA 4MH3A 1X5CA 2OA7A 2FCHA 1M7TA 1TOFA 5G30A 3GH6A 4I97A 1EGOA 4OD7A 4MJEA 2N5BA 3NIVA 3QAGA 2KOKA 3H93A 4TR0A 1SJZA 3RPPA 4G9HA 18GSA 2YWOA 2IJYA 2IPAA 3MSZA 2L57A 3C7MA 4K2DA 4K0GA 4V2LA 2GDRA 1SKRB 1WP0A 4N0ZA 3TUEA 2VLVA 4Z2UA 3HVXA 2GQKA 3HY2A 3RPNA 1ERVA 4F03A 4G0LA 1U88A 2ZCTA 4PQHA 1PL1A 2Z9SA 3LEFA 4I8BA 4LL1B 2PVOC 1MDKA 3BCKA 4K8MA 2VD0A 4JU5A 3GSSA 3FR9A 3ZTLA 6GSYA 1BG5A 1AQWA 5DBQA 1DSBA 4EUYA 1J0FA 1O7UA 2HSYA 3UBLA 3NOFA 3VPTA 4Q5FA 3FHKA 3PR8A 4PQ1A 4PURA 3FZ9A 5D96A 4EVMA 3M9KA 2R0PA 4ZXGA 2C3TA 3M1GA 3GX0A 1JLVA 3F4RA 3H4KA 4BVYB 5KEJA 5IPGA 4PGTA 1B48A 4OFTA 1QUWA 14GSA 1BEDA 4HQSA 2WS2A 1XPVA 1PKZA 2CA8A 3H79A 5ECSA 2WCIA 4MF6A 2IMEA 2LUSA 2K9FA 2C0EA 2MYGA 2HZEA 4MF7A 4IKHA 6GSVA 4AGSA 4K5RA 4XCSA 1T00A 2VUPA 3D6IA 5DQYA 1FW1A 3V1WA 4BWQA 3CBUA 2AHEA 2H1DA 4BVXB 4I6XA 4O5QA 1TRUA 5HFIA 8GSSA 2PMTA 4KNDA 1X5EA 2CVDA 1O8XA 2YCDA 4IELA 4MJCA 2VL2C 3GRXA 2NPBA 2MZCA 3VWWA 3NZNA 1K0DA 4D73B 2KUCA 2C0GA 1TKDB 2ON7A 2IWTA 4GSNA 3O3TA 3P8WA 2KHPA 3Q74A 2NBSA 4N10A 5H5QA 4KX4A 2EC4A 3Q19A 1ILOA 3IOSA 4LMVA 3ZVJD 3LJRA 1K3YA 1ON4A 2IFQB 4KDUA 2RM5A 5AGYA 2DC5A 1H4OA 2DLXA 2O7KA 1Y25A 4PNGA 2TRXA 1UVZA 3TKPA 1FVKA 5ECIB 3N9JA 1ZGNA 3TKSA 4DSQA 2VOCA 3VWUA 20GSA 5IM9A 4K6XA 4MH2A 4IS0A 2GZYA 2H6XA 16GSA 2P0GA 2F51A 1A0FA 4OCEA 5GAPD 2B6MA 2YZHA 2XBQA 1FOHA 1XIYA 1T7PB 1YZXA 4GLTA 1OC8A 1THXA 5JWQB 2KP1A 1TK5B 2R5GA 1O85A 4IP6A 1QQ2A 1ZYEA 2OBIA 1XOAA 1PX7A 4BVYA 2B1LA 2I4AA 2C4JA 3UAPA 4JE1A 1XWBA 5AISA 4F9ZA 1NM3A 4NPBA 2X8CA 5BMUA 2YJ7A 5GSTA 4L0WA 5ELGA 2A2RA 1JFUA 3DYRA 6GSXA 2QKEA 4MCUA 4EIQA 3VWXA 1A23A 4EC0A 4GWRA 2BJXA 2RM6A 4V1Ap 3SBCA 3HA9A 3GN3A 1WRYA 1FB0A 3ISOA 4BA7A 4ECIA 1SD8A 2K8SA 2DKIA 4TOPA 2JZTA 4RI6A 1G6WA 1GUHA 5HFGA 1WE0A 3GURA 6GSWA 5ID2B 3FR6A 2A2PA 2VIMA 3ED3A 4ZBAA 2FWHA 4WR4A 3TGZA 4POMA 3HVSA 5G1LA 2QA1A 4MDCA 4QQ7A 3BD2A 3TDGA 3ZITA 1CQGA 1OKDA 1SL2B 4WETA 4JBBA 1BQ7A 4O5UA 1YKCA 1SJIA 1WOUA 1PD21 2C3NA 3J7Yb 2LJKA 4RQXA 5KN0A 2LJRA 3TRPA 3I69A 1GLPA 1PN9A 4FYUA 3F63A 1WMJA 1PGTA 3GYKA 1K0CA 5D9TA 1K0BA 2I3YA 5HR1A 2B7JA 2F9SA 4BIKA 2LNSA 2R2JA 3TKRA 3LYPA 4PQIA 4NV2A 3D4TA 4MNNA 3P2AA 1QFNA 1X9WB 1THOA 2B7KA 2VM1A 1DUGA 4F82A 4USSA 3L78A 2R0CA 2YOIA 1QK8A 4N11A 3VLNA 2JACA 3HXSA 3KD0A 5C00A 2RIIA 4J57E 4JR6A 4DEJA 4ECJA 3GKXA 3OR5A 2XC2A 4P3YB 2V32A 3FZ5A 3ZIVA 1TJDA 5C04A 4LL4B 5KN2A 4L0UA 4HU9A 2B5EA 3HVNA 1X5DA 2LNTA 1ACVA 3LG6A 1K0AA 2A4HA 1GRXA 3JCML 3A3TA 3HKRA 3UMAA 4K5SA 2MMAA 3DKSA 5DDLA 2ES7A 1AAZA 1QGVA 2PUKC 1YKAA 4TN8A 5ECQB 4Q5QA 4TW5A 4CY8A 3BBYA 5ID2A 3IK9A 3ERWA 4IJIA 5D93A 1V98A 1XWKA 4WKWA 3GFKA 3DRNA 1M3JA 5IQYA 1ABAA 2CAQA 4LMWA 3IDVA 3TKQA 4I2UA 1MDIA 2X8HA 2H0IA 3EU4A 3KMOA 1K0NA 2WZ9A 1RW1A 2VCVA 3GH9A 3QCPA 4EDZA 2EIQA 4KDXA 2LRTA 2ALBA 3D0ZA 3D5JA 5ECOB 4WF5A 4ZL9A 3KXOA 4ZB9A 1HYUA 4X43A 3IAS2 5JWOB 4V2NA 4IW9A 5J9CA 2FD3A 2VCXA 3RDWA 4E8HA 2GSQA 3FRCA 2K8VA 3ZVJA 3EURA 4WR5A 1SYXA 4GCIA 3TCOA 4KB3A 1KTEA 5AIVA 3M9JA 1M2DA 3F8UA 5B8BA 1URMA 4XS6A 4TXOB 3VFIA 3A2WA 3QR6A 7GSSA 2H30A 2QSIA 3IC8A 3UL3A 1WPIA 1V40A 2O87A 2X64A 3K8NA 3LGCA 5CRWA 1TK8B 4MPGA 3RHCA 2FWEA 4XS4B 2F8AA 2CV4A 1B9YC 2L5OA 5F06A 5CP1A 2KP2A 1Z6NA 5ECKB 3UARA 1BJXA 4XRDA 2M80A 2VAFA 3FY7A 1A24A 1T8EB 3H8QA 1SKWB 3GKMA 1Q4JA 1SYRA 4NAXA 5AIXA 5ECNB 3VWVA 3FYGA 3I6AA 1S3RA 1LJRA 3M8NA 1IYIA 3CMIA 1SL0B 2YNXA 3FR3A 2GSTA 1A2LA 1M2BA 3D21A 2GTUA 2MMNA 2YV9A 3CSHA 5HR2A 1G0TA 4YQMA 3CXGA 4QL7A 1JZDA 4TKYA 2VD1A 5FT3A 3ZZXA 3MDKA 2D2ZA 3A2VA 3F6FA 1RQMA 4XRAA 5ECRB 1R7HA 2VM2A 2H6YA 4HZ4A 5EY6A 2P5RA 1TW9A 5J3RA 3ME8A 2OE1A 4I2TA 2CZ3A 4HJ2A 4XTSA 1A8LA 2BTOT 2J9HA 5CYYA 3P90A 4JRRA 4KAEA 4HU7A 5DALB 2RUEA 4H86A 2X49A 3G7IA 1NW2A 10GSA 2R4VA 3US3A 2FUG2 4WBRD 2XBIA 3C1RA 3DWVA 4ICYA 2FA8A 1WWJA 2B5YA 3KH9A 3QFAC 5IIZA 2OE0A 2F3MA 2IIYA 3U6VA 3UIWA 3APSA 3UOMA 3LXTA 2IL3A 1X0RA 1XFLA 5HQPA 5COHA 4PTSA 4DSSA 1HNBA 1UA5A 2L5LA 2WGRA 4IP1A 1EP8A 1XW6A 2MMZA 1U87A 5DCGA 3APQA 5DJLA 3TOTA 2O8VB 11GSA 2DMMA 3W6GA 1GTAA 1HD2A 3VI5A 1JHBA 2H19A 3DXBA 3A5IA 4O32A 1ZOFA 5KN1A 2C0DA 2WULA 3N5OA 4MMMA 5KOXA 4OWYA 5DQSA 4IBPA 1GLQA 5DAKB 2DJ1A 1AIUA 2V41A 2O89A 1G7OA 3KGKA 4L5OA 4TR1B 2L4CA 3WGEA 3HVVA 4IQ1A 1OAZA 2E2MA 4YAPA 3WYWA 3APOA 2DJJA 3ZLPA 2H74A 2YV7A 4Q5NA 4XIHA 4KH7A 1OC3A 5IO2A 1LBKA 2RLIA 4CY6A 2R6KA 5ABRA 2GQLA 3MAKA 5FWGA 2H71A 4CW9A 3TRXA 3L9UA 2K18A 1Z5YE 4O92A 2YZUA 2H73A 4EF0A 1T3BA 1H75A 3GNJA 4L8EA 3HJPA 4XS1A 5IMDA 5A4UA 3F3RA 1YF1A 4CDOA 5DALA 1EGRA 1A0RP 4YQUA 2A2SA 2E7PA 4HUAA 3KP9A 1KNGA 4YKGA 5EPFA 1O73A 3DVWA 2DIZA 3TB2A 1FHEA 4MJAA 3MYDA 1TRVA 3WT1A 3F9UA 4O5RA 3KM6A 5G31A 4FIWA 5J5NA 4QL9A 2ZUPA 4YKFA 2PWJA 1O6JA 2DJKA 1AXDA 1O8WA 4POKA 2I1UA 5CRHA 3HDCA 1YQ1A 1X9MB 1HQOA 2YP6A 1GNEA 4IVFA 1GNWA 1YEXA 2JL4A 5ECLB 4HSCX 1TTZA 5B6MA 1SK2A 2LQQA 4FYCA 4DVCA 1XW9A 2JSZA 4OO4A 4FH8A 2DKHA 3UVTA 5A5KA 3HD5A 2F8FA 3TOUA 5LCZA 3LXZA 5IMFA 2H66A 3C73A 3HHVA 4EDYA 2LS5A 3DEXA 3L9SA 4Z2RA 2G0FA 2JADA 1W4VA 3RBTA 2AV4A 2GGTA 5ECHB 3EWLA 4BVXA 5D8IA 1B4QA 3DVXA 2X8GA 1T4YA 1PN0A 3W8JA 1U6TA 2CX4A 2XPEA 1OC9B 3KTLA 1V2AA 5E59A 2WB9A 2B3SA 4ZL8A 1FB6A 2L6CA 3TJKA 4D73A 1M2AA 5L71A 2G2QA 3PINA 3ZYWA 1XOBA 4ML1A 1U3IA 2HYXA 4WEYA 1DE1A 2LKUA 3ERFA 3QOUA 3UJ1A 2H70A 2H1AA 2WDUA 1EOHA 2IFQA 3VPQA 1Z9HA 1AUCA 2VCWA 1BX9A 3KJYA 1RK4A 1TP9A 3IRAA 2GZPA 3ZFBA 3C1SA 4ECCA 2YJHA 4KGIA 1K3LA 1EP7A 2YN1A 1ZYPA 1EEJA 4KW6A 4KUNA 1YJ6A 1GTUA 3GKNA 1GSYA 3EU3A 2IMIA 2MBTA 5JCUA 1GULA 2C80A 3G7JA 4OCFA 2FHEA 2JSYA 1R4WA 2FWGA 2UZ8A 3E9JB 1SL1B 6GSTA 1USBA 1M0UA 3SWLA 1FG4A 2B5XA 3TJBA 4GRFA 2K6VA 1O81A 9GSSA 3LQ7A 2DSAA 4EXJA 3GL3A 3LFLA 2LV3A 1V9WA 5B6NA 4JZQA 5KN3A 4RQRA 2QA2A 1XVWA 1SENA 1TI1A 5D73A 1I5GA 3FZAA 3QPMA 2H0GA 3QMXA 2AYTA 2HZFA 4NHWA 4MF5A 3O76A 2REMA 3KIJA 1DBYA 5D9WA 3I9V2 1XW5A 5G1KA 2R3XA 3E0UA 3TKSE 3GSTA 2P5QA 3MIXA 2HSMA 2H76A 5A4VA 3DIEA 2H1GA 4ECBA 5F0GA 1OVNA 3ZREA 1AC1A 4XHMA 5EVOA 4MLYA 1OE7A 3HCZA 2OADA 4ULXA 2JU5A 5JCGA 2HT9A 4MJBA 4AJ8A 1YDKA 2CVKA 2AAWA 5G2ZA 1YEPA 1GSSA 3ME7A 2HI7A 3EVIA 1B8XA 1OYJA 1MD3A 4YAVA 3TJGA 4E8EA 5CRGA 4ZB8A 2A4VA 2N5FA 4ZILA 2EIRA 3CSIA 4X4JA 3A2XA 3EYTA 4ZL7A 3Q18A 3EPTA 5LD0A 5IMAA
chains in the Genus database with same CATH topology
4MZCA 4PX1A 2VO4A 1XXUA 1C72A 2FLSA 3IR4A 3HZ8A 1MD4A 2LTKA 1F2EA 2CX3A 2QGVA 4K7OA 1I9DA 4GF0A 5DJMA 4GSTA 2NDOA 3P7XA 2FGXA 4MA9A 3IPZA 2TRCP 1XVQA 4ZIJA 5LNKe 2GQMA 2LRNA 1BAYA 2OE3A 2GVPA 2B1KA 3F6DA 2HE3A 5B7CA 3FZ4A 6GSSA 3EMXA 22GSA 1JLWA 4PUAA 3KP8A 3HYPA 2HXKA 3FKFA 1S3CA 5HFKA 4IQAA 1E2YA 2C8UA 4OO5A 3MWHA 3IXRA 3ZMKA 4HOJA 3L9VA 3QFBC 4IJ3A 1JZWA 3PGTA 2ZNMA 3GUSA 3GMFA 2M46A 2DJ3A 4MP4A 5GZZB 4ZBDA 3EC3A 1TXXA 3GX8A 1ZCPA 3RAZA 4WXTA 4TR4A 2LQOA 5DCHA 6GSUA 3O6TA 4POLA 4G0IA 4NWYA 3IC4A 2LEGA 2H1BA 1PRXA 4Q5RA 5ECPB 3QAVA 1AQVA 4ML6A 2YWIA 3QDNA 4IGJA 2IMKA 5JCWA 5H5RA 2DBCA 5IO0A 3VI7A 3G7YA 1DE2A 2WJUA 2NVLA 2NTOA 1A8YA 1K0MA 4K0NA 4J56E 5KOWA 1SD9A 2GS3A 3KCMA 5IMZA 1GL8A 2CQ9A 5CNWA 1PSQA 1VGLA 4GSSA 5E4WA 4BPYA 5BRTA 2CT6A 2XHFA 1F3BA 3IHQA 5HR0A 2L4QA 1UC7A 1GSQA 5CREA 3CRUA 1XBSA 2VL2A 1V58A 2RUFA 4KA0A 3GTUB 17GSA 4HZ2A 2H6ZA 2OKAA 4NV5A 1R5PA 1GP1A 4TXOA 4YQVA 4WF4A 4ISDA 1S3AA 3IE3A 4OFMA 2IMDA 2GT5A 2XPDA 1TRWA 1JZRA 4OFNA 4XS4A 2CVBA 3VURA 3HJMA 1ML6A 1VRSD 2HNLA 3KTBA 1EWXA 4F0BA 4EO3A 1UN2A 5INYA 2O85A 1B9XC 5CRDA 2H8LA 3DMLA 1VF4A 3PPUA 4GQCA 1SKSB 3H1NA 4ID0A 4ZBBA 2I9HA 4NMUA 4PUFC 4EKZA 1GWCA 4EL1A 3FW2A 2OJLA 1GH2A 3F4SA 5GSSA 1LU4A 3IAM2 2FA4A 3L4NA 3EMPA 4RUVA 1EV4A 2YPMA 3W8SA 1TDIA 1F3AA 2WRTA 4NXIA 1A2MA 1VF2A 4DSRA 3CTGA 1XWCA 2FWFA 3BCIA 2M72A 1T4ZA 4N30A 1GSFA 3IA1A 5FHIA 4AF2A 4G19A 4YH2A 4BWSA 1W89A 1VF3A 1EV9A 4IHUA 1SK0A 4GQFA 2LJAA 1F6MC 1AW9A 2QC7A 1TI3A 3BJ5A 3UVHA 3FK8A 3DGQA 1GUKA 3GKKA 3PH9A 3FEUA 1EOGA 1MTCA 1GSEA 3ZIJA 4KCAA 1U3AA 2JZRA 5ELAA 1ZZYA 3E3EA 3D22A 2HSHA 1F9MA 12GSA 3EINA 2HRNA 4K7NA 2HRAA 1GUMA 5IMCA 3VK9A 4K7IA 3WGDA 1GTBA 1EZKA 4LA1A 3LYKA 3QD9A 1ZMAA 1TU8A 2VL9A 2C0FA 4FO5A 4AJ6A 1ERTA 3IK7A 3Q6OA 1T1VA 1PMTA 4KSOA 1G6YA 4K1FA 1S3DA 2IMFA 2BMXA 3GTUA 1N8JA 3ZFLA 1OE8A 2TIRA 1SK1A 1TRSA 4PNFA 4Z2TA 1M9AA 2YWMA 1PA3A 5IPHA 2IN3A 2PBJA 2OACA 4I5QA 3R3EA 1KBNA 1WIKA 3IV4A 2GSSA 3F4TA 3U5RE 1Y6EA 2PU9C 1QMVA 3I43A 1Q98A 1GTIA 1WJKA 4BL7B 4J2FA 3TRQA 3ZMLA 4HDEA 1SU9A 3DD3A 3LWAA 4ACSA 1PQNA 2P31A 2H0HA 2AJQB 2KLXA 3TKSC 2VCZA 3S9FA 5DAKA 1FAAA 1NHOA 1E6BA 4ZB6A 2CZ2A 2V2GA 1J9BA 3GV1A 1CQHA 2VLUA 4TR1A 2C1YA 2OBKA 2R0GA 2DMLA 2HFDA 1QXHA 5F05A 1EEMA 3EE2A 4JR4A 3FMWA 1PL2A 4EE0A 1IYHA 3UBKA 4KSMA 5CAXA 1ZL9A 1VF1A 2VL3A 3G9BA 5F8BA 2E2GA 2X4AA 1TU7A 3ZRDA 1GSUA 3L0HA 4KCEA 5H5SA 5J4UA 1Z7RA 2CAIA 1R26A 3GL5A 3GA4A 5ENUA 2FY6A 4N0VA 2LSTA 3HJOA 4HS1A 1R5AA 3F0IA 4MPFA 2H75A 4TXVA 1V57A 13GSA 1ERUA 3C71A 1JZOA 2GT6A 1ZYQB 5AN1A 5IOWA 1YF0A 2VCTA 1M9BA 3CRTA 4GTUA 2AUVA 3CSJA 2PPTA 3MNGA 4MZBA 2J23A 3KEBA 2JZSA 4K2XA 3QAWA 2FNOA 1KEBA 2PN8A 1ERWA 4JEDA 2DJ0A 4TVEA 2X99A 3J7Yk 4ILFA 3D4MA 2C3QA 3HZ4A 3GIXA 2MMOA 2WFCA 4HI7A 3C8EA 1SJ6A 4NHZA 5G5EA 4TRXA 2YWNA 1N2AA 5D9VA 3UEMA 3RHBA 2LRCA 2H01A 1Z3EA 3KMNA 4RI7A 4HJMA 2GSRA 5J9BA 2L59A 4BL7A 2V6OA 4MABA 3LORA 1FO5A 1XZOA 4KF9A 3LW9A 1X9SB 3KH7A 5EL8A 3AY8A 4MK3A 1TK0B 4LLRA 1K3OA 5JWRB 4Z7XA 2E0QA 3IHGA 4X1UA 3A5WA 2HRFA 4AJ7A 1NHYA 1OC9A 1J08A 1ST9A 5DVBA 3TJFA 1GSDA 3IBHA 4WBJA 1XCCA 1YY7A 5J41A 1PKWA 2HRKA 5B8AA 3F3QA 2R37A 1K0OA 5G5FA 1XWGA 2V6KA 3M3MA 4X0XA 3CTFA 4A5PA 2PVQA 4V2MA 1AQXA 2PGTA 2ON5A 1XWAA 2GZZA 3TJJA 2V1MA 4F0CA 2H72A 3LSZA 4G0KA 3BOAA 2DIYA 2VCQA 4OMVA 4TR3A 4K9ZA 19GSA 2AB6A 1OKTA 3KZQA 4KDYA 4V1Ag 5A4WA 2MBSA 5CO3A 1G7EA 1HNAA 3WGXA 1ZYNA 1F37A 4FYBA 3R2QA 5IMVA 2YANA 1NSWA 4F2IA 4DSSB 4HEA2 2EIOA 4KE3A 2PERA 4POBA 4O7HA 4GXZA 4HQZA 1BYEA 3ERGA 5IOXA 2L6DA 3ZL5A 5GAND 5HR3A 1M99A 2N5AA 1B4PA 4PXOA 4IN0A 4G10A 1A2JA 3WT2A 4EIPA 1PX6A 3M0FA 4CHSA 1HNCA 2VLTA 1Z7PA 1Z6MA 1FVJA 2HLSA 2HZEB 2I81A 4L5LA 4FQUA 4MZWA 1FOVA 5D9XA 2GLRA 3GHAA 4G2EA 1MDJA 1MEKA 3WD6A 2DJ2A 5F07A 5ECMB 3CYNA 4MH3A 1X5CA 2OA7A 2FCHA 1M7TA 1TOFA 5G30A 3GH6A 4I97A 1EGOA 4OD7A 4MJEA 2N5BA 3NIVA 3QAGA 2KOKA 3H93A 4TR0A 1SJZA 3RPPA 4G9HA 18GSA 2YWOA 2IJYA 2IPAA 3MSZA 2L57A 3C7MA 4K2DA 4K0GA 4V2LA 2GDRA 1SKRB 1WP0A 4N0ZA 3TUEA 2VLVA 4Z2UA 3HVXA 2GQKA 3HY2A 3RPNA 1ERVA 4F03A 4G0LA 1U88A 2ZCTA 4PQHA 1PL1A 2Z9SA 3LEFA 4I8BA 4LL1B 2PVOC 1MDKA 3BCKA 4K8MA 2VD0A 4JU5A 3GSSA 3FR9A 3ZTLA 6GSYA 1BG5A 1AQWA 5DBQA 1DSBA 4EUYA 1J0FA 1O7UA 2HSYA 3UBLA 3NOFA 3VPTA 4Q5FA 3FHKA 3PR8A 4PQ1A 4PURA 3FZ9A 5D96A 4EVMA 3M9KA 2R0PA 4ZXGA 2C3TA 3M1GA 3GX0A 1JLVA 3F4RA 3H4KA 4BVYB 5KEJA 5IPGA 4PGTA 1B48A 4OFTA 1QUWA 14GSA 1BEDA 4HQSA 2WS2A 1XPVA 1PKZA 2CA8A 3H79A 5ECSA 2WCIA 4MF6A 2IMEA 2LUSA 2K9FA 2C0EA 2MYGA 2HZEA 4MF7A 4IKHA 6GSVA 4AGSA 4K5RA 4XCSA 1T00A 2VUPA 3D6IA 5DQYA 1FW1A 3V1WA 4BWQA 3CBUA 2AHEA 2H1DA 4BVXB 4I6XA 4O5QA 1TRUA 5HFIA 8GSSA 2PMTA 4KNDA 1X5EA 2CVDA 1O8XA 2YCDA 4IELA 4MJCA 2VL2C 3GRXA 2NPBA 2MZCA 3VWWA 3NZNA 1K0DA 4D73B 2KUCA 2C0GA 1TKDB 2ON7A 2IWTA 4GSNA 3O3TA 3P8WA 2KHPA 3Q74A 2NBSA 4N10A 5H5QA 4KX4A 2EC4A 3Q19A 1ILOA 3IOSA 4LMVA 3ZVJD 3LJRA 1K3YA 1ON4A 2IFQB 4KDUA 2RM5A 5AGYA 2DC5A 1H4OA 2DLXA 2O7KA 1Y25A 4PNGA 2TRXA 1UVZA 3TKPA 1FVKA 5ECIB 3N9JA 1ZGNA 3TKSA 4DSQA 2VOCA 3VWUA 20GSA 5IM9A 4K6XA 4MH2A 4IS0A 2GZYA 2H6XA 16GSA 2P0GA 2F51A 1A0FA 4OCEA 5GAPD 2B6MA 2YZHA 2XBQA 1FOHA 1XIYA 1T7PB 1YZXA 4GLTA 1OC8A 1THXA 5JWQB 2KP1A 1TK5B 2R5GA 1O85A 4IP6A 1QQ2A 1ZYEA 2OBIA 1XOAA 1PX7A 4BVYA 2B1LA 2I4AA 2C4JA 3UAPA 4JE1A 1XWBA 5AISA 4F9ZA 1NM3A 4NPBA 2X8CA 5BMUA 2YJ7A 5GSTA 4L0WA 5ELGA 2A2RA 1JFUA 3DYRA 6GSXA 2QKEA 4MCUA 4EIQA 3VWXA 1A23A 4EC0A 4GWRA 2BJXA 2RM6A 4V1Ap 3SBCA 3HA9A 3GN3A 1WRYA 1FB0A 3ISOA 4BA7A 4ECIA 1SD8A 2K8SA 2DKIA 4TOPA 2JZTA 4RI6A 1G6WA 1GUHA 5HFGA 1WE0A 3GURA 6GSWA 5ID2B 3FR6A 2A2PA 2VIMA 3ED3A 4ZBAA 2FWHA 4WR4A 3TGZA 4POMA 3HVSA 5G1LA 2QA1A 4MDCA 4QQ7A 3BD2A 3TDGA 3ZITA 1CQGA 1OKDA 1SL2B 4WETA 4JBBA 1BQ7A 4O5UA 1YKCA 1SJIA 1WOUA 1PD21 2C3NA 3J7Yb 2LJKA 4RQXA 5KN0A 2LJRA 3TRPA 3I69A 1GLPA 1PN9A 4FYUA 3F63A 1WMJA 1PGTA 3GYKA 1K0CA 5D9TA 1K0BA 2I3YA 5HR1A 2B7JA 2F9SA 2LNSA 2R2JA 3TKRA 3LYPA 4PQIA 4NV2A 3D4TA 4MNNA 3P2AA 1QFNA 1X9WB 1THOA 2B7KA 2VM1A 1DUGA 4F82A 4USSA 3L78A 2R0CA 2YOIA 1QK8A 4N11A 3VLNA 2JACA 3HXSA 3KD0A 5C00A 2RIIA 4J57E 4JR6A 4DEJA 4ECJA 3GKXA 3OR5A 2XC2A 4P3YB 2V32A 3FZ5A 3ZIVA 1TJDA 5C04A 4LL4B 5KN2A 4L0UA 4HU9A 2B5EA 1X5DA 2LNTA 1ACVA 3LG6A 1K0AA 2A4HA 1GRXA 3JCML 3A3TA 3HKRA 3UMAA 4K5SA 2MMAA 3DKSA 5DDLA 2ES7A 1AAZA 1QGVA 2PUKC 1YKAA 4TN8A 5ECQB 4Q5QA 4TW5A 4CY8A 3BBYA 5ID2A 3IK9A 3ERWA 4IJIA 5D93A 1V98A 1XWKA 4WKWA 3GFKA 3DRNA 5IQYA 1ABAA 2CAQA 4LMWA 3IDVA 3TKQA 4I2UA 1MDIA 2X8HA 2H0IA 3EU4A 3KMOA 1K0NA 2WZ9A 1RW1A 2VCVA 3GH9A 3QCPA 4EDZA 2EIQA 4KDXA 2LRTA 2ALBA 3D0ZA 3D5JA 5ECOB 4WF5A 4ZL9A 3KXOA 4ZB9A 1HYUA 4X43A 3IAS2 5JWOB 4V2NA 4IW9A 5J9CA 2FD3A 2VCXA 3RDWA 4E8HA 2GSQA 3FRCA 2K8VA 3ZVJA 3EURA 4WR5A 1SYXA 4GCIA 3TCOA 4KB3A 1KTEA 5AIVA 3M9JA 1M2DA 3F8UA 5B8BA 1URMA 4XS6A 4TXOB 3VFIA 3A2WA 3QR6A 7GSSA 2H30A 2QSIA 3IC8A 3UL3A 1WPIA 1V40A 2O87A 2X64A 3K8NA 3LGCA 5CRWA 1TK8B 4MPGA 3RHCA 2FWEA 4XS4B 2F8AA 2CV4A 1B9YC 2L5OA 5F06A 5CP1A 2KP2A 1Z6NA 5ECKB 3UARA 1BJXA 4XRDA 2M80A 2VAFA 3FY7A 1A24A 1T8EB 3H8QA 1SKWB 3GKMA 1Q4JA 1SYRA 4NAXA 5AIXA 5ECNB 3VWVA 3FYGA 3I6AA 1LJRA 3M8NA 1IYIA 3CMIA 1SL0B 2YNXA 3FR3A 2GSTA 1A2LA 1M2BA 3D21A 2GTUA 2MMNA 2YV9A 3CSHA 5HR2A 1G0TA 4YQMA 3CXGA 4QL7A 1JZDA 4TKYA 2VD1A 5FT3A 3ZZXA 3MDKA 2D2ZA 3A2VA 3F6FA 1RQMA 4XRAA 5ECRB 1R7HA 2VM2A 2H6YA 4HZ4A 5EY6A 2P5RA 1TW9A 5J3RA 3ME8A 2OE1A 4I2TA 2CZ3A 4HJ2A 4XTSA 1A8LA 2BTOT 2J9HA 5CYYA 3P90A 4JRRA 4KAEA 4HU7A 5DALB 2RUEA 4H86A 2X49A 3G7IA 1NW2A 10GSA 2R4VA 3US3A 2FUG2 4WBRD 2XBIA 3C1RA 3DWVA 4ICYA 2FA8A 1WWJA 2B5YA 3KH9A 3QFAC 5IIZA 2OE0A 2F3MA 2IIYA 3U6VA 3UIWA 3APSA 3UOMA 3LXTA 2IL3A 1X0RA 1XFLA 5HQPA 5COHA 4PTSA 4DSSA 1HNBA 1UA5A 2L5LA 2WGRA 4IP1A 1EP8A 1XW6A 2MMZA 1U87A 5DCGA 3APQA 5DJLA 3TOTA 2O8VB 11GSA 2DMMA 3W6GA 1GTAA 1HD2A 3VI5A 1JHBA 2H19A 3DXBA 3A5IA 4O32A 1ZOFA 5KN1A 2C0DA 2WULA 3N5OA 4MMMA 5KOXA 4OWYA 5DQSA 4IBPA 1GLQA 5DAKB 2DJ1A 1AIUA 2V41A 2O89A 1G7OA 3KGKA 4L5OA 4TR1B 2L4CA 3WGEA 3HVVA 4IQ1A 1OAZA 2E2MA 4YAPA 3WYWA 3APOA 2DJJA 3ZLPA 2H74A 2YV7A 4Q5NA 4XIHA 4KH7A 1OC3A 5IO2A 1LBKA 2RLIA 4CY6A 2R6KA 5ABRA 2GQLA 3MAKA 5FWGA 2H71A 4CW9A 3TRXA 3L9UA 2K18A 1Z5YE 4O92A 2YZUA 2H73A 4EF0A 1T3BA 1H75A 3GNJA 4L8EA 3HJPA 4XS1A 5IMDA 5A4UA 3F3RA 1YF1A 4CDOA 5DALA 1EGRA 1A0RP 4YQUA 2A2SA 2E7PA 4HUAA 3KP9A 1KNGA 4YKGA 5EPFA 1O73A 3DVWA 2DIZA 3TB2A 1FHEA 4MJAA 3MYDA 1TRVA 3WT1A 3F9UA 4O5RA 3KM6A 5G31A 4FIWA 5J5NA 4QL9A 2ZUPA 4YKFA 2PWJA 1O6JA 2DJKA 1AXDA 1O8WA 4POKA 2I1UA 5CRHA 3HDCA 1YQ1A 1X9MB 1HQOA 2YP6A 1GNEA 4IVFA 1GNWA 1YEXA 2JL4A 5ECLB 1TTZA 5B6MA 1SK2A 2LQQA 4FYCA 4DVCA 1XW9A 2JSZA 4OO4A 4FH8A 2DKHA 3UVTA 5A5KA 3HD5A 2F8FA 3TOUA 5LCZA 3LXZA 5IMFA 2H66A 3C73A 3HHVA 4EDYA 2LS5A 3DEXA 3L9SA 4Z2RA 2G0FA 2JADA 1W4VA 3RBTA 2AV4A 2GGTA 5ECHB 3EWLA 4BVXA 5D8IA 1B4QA 3DVXA 2X8GA 1T4YA 1PN0A 3W8JA 1U6TA 2CX4A 2XPEA 1OC9B 3KTLA 1V2AA 5E59A 2WB9A 2B3SA 4ZL8A 1FB6A 2L6CA 3TJKA 4D73A 1M2AA 5L71A 2G2QA 3PINA 3ZYWA 1XOBA 4ML1A 1U3IA 2HYXA 4WEYA 1DE1A 2LKUA 3ERFA 3QOUA 3UJ1A 2H70A 2H1AA 2WDUA 1EOHA 2IFQA 3VPQA 1Z9HA 1AUCA 2VCWA 1BX9A 3KJYA 1RK4A 1TP9A 3IRAA 2GZPA 3ZFBA 3C1SA 4ECCA 2YJHA 4KGIA 1K3LA 1EP7A 2YN1A 1ZYPA 1EEJA 4KW6A 4KUNA 1YJ6A 1GTUA 3GKNA 1GSYA 3EU3A 2IMIA 2MBTA 5JCUA 1GULA 2C80A 3G7JA 4OCFA 2FHEA 2JSYA 1R4WA 2FWGA 2UZ8A 3E9JB 1SL1B 6GSTA 1USBA 1M0UA 3SWLA 1FG4A 2B5XA 3TJBA 4GRFA 2K6VA 1O81A 9GSSA 3LQ7A 2DSAA 4EXJA 3GL3A 3LFLA 2LV3A 1V9WA 5B6NA 4JZQA 5KN3A 4RQRA 2QA2A 1XVWA 1SENA 1TI1A 5D73A 1I5GA 3FZAA 3QPMA 2H0GA 3QMXA 2AYTA 2HZFA 4NHWA 4MF5A 3O76A 2REMA 3KIJA 1DBYA 5D9WA 3I9V2 1XW5A 5G1KA 2R3XA 3E0UA 3TKSE 3GSTA 2P5QA 3MIXA 2HSMA 2H76A 5A4VA 3DIEA 2H1GA 4ECBA 5F0GA 1OVNA 3ZREA 1AC1A 4XHMA 5EVOA 4MLYA 1OE7A 3HCZA 2OADA 4ULXA 2JU5A 5JCGA 2HT9A 4MJBA 4AJ8A 1YDKA 2CVKA 2AAWA 5G2ZA 1YEPA 1GSSA 3ME7A 2HI7A 3EVIA 1B8XA 1OYJA 1MD3A 4YAVA 3TJGA 4E8EA 5CRGA 4ZB8A 2A4VA 2N5FA 4ZILA 2EIRA 3CSIA 4X4JA 3A2XA 3EYTA 4ZL7A 3Q18A 3EPTA 5LD0A 5IMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZC A;  4PX1 A;  2VO4 A;  1XXU A;  1C72 A;  2FLS A;  3IR4 A;  3HZ8 A;  1MD4 A;  2LTK A;  1F2E A;  2CX3 A;  2QGV A;  4K7O A;  1I9D A;  4GF0 A;  5DJM A;  4GST A;  2NDO A;  3P7X A;  2FGX A;  4MA9 A;  3IPZ A;  2TRC P;  1XVQ A;  4ZIJ A;  5LNK e;  2GQM A;  2LRN A;  1BAY A;  2OE3 A;  2GVP A;  2B1K A;  3F6D A;  2HE3 A;  5B7C A;  3FZ4 A;  6GSS A;  3EMX A;  22GS A;  1JLW A;  4PUA A;  3KP8 A;  3HYP A;  2HXK A;  3FKF A;  1S3C A;  5HFK A;  4IQA A;  1E2Y A;  2C8U A;  4OO5 A;  3MWH A;  3IXR A;  3ZMK A;  4HOJ A;  3L9V A;  3QFB C;  4IJ3 A;  1JZW A;  3PGT A;  2ZNM A;  3GUS A;  3GMF A;  2M46 A;  2DJ3 A;  4MP4 A;  5GZZ B;  4ZBD A;  3EC3 A;  1TXX A;  3GX8 A;  1ZCP A;  3RAZ A;  4WXT A;  4TR4 A;  2LQO A;  5DCH A;  6GSU A;  3O6T A;  4POL A;  4NWY A;  3IC4 A;  2LEG A;  2H1B A;  1PRX A;  4Q5R A;  5ECP B;  3QAV A;  1AQV A;  4ML6 A;  2YWI A;  3QDN A;  4IGJ A;  2IMK A;  5JCW A;  5H5R A;  2DBC A;  5IO0 A;  3VI7 A;  3G7Y A;  1DE2 A;  2WJU A;  2NVL A;  2NTO A;  1A8Y A;  1K0M A;  4K0N A;  4J56 E;  1SD9 A;  2GS3 A;  3KCM A;  5IMZ A;  1GL8 A;  2CQ9 A;  5CNW A;  1PSQ A;  1VGL A;  4GSS A;  5E4W A;  4BPY A;  2CT6 A;  2XHF A;  1F3B A;  3IHQ A;  5HR0 A;  2L4Q A;  1UC7 A;  1GSQ A;  5CRE A;  3CRU A;  1XBS A;  2VL2 A;  1V58 A;  2RUF A;  4KA0 A;  3GTU B;  17GS A;  4HZ2 A;  2H6Z A;  2OKA A;  4NV5 A;  1R5P A;  1GP1 A;  4TXO A;  4YQV A;  4WF4 A;  4ISD A;  1S3A A;  3IE3 A;  4OFM A;  2IMD A;  2GT5 A;  2XPD A;  1TRW A;  1JZR A;  4OFN A;  4XS4 A;  2CVB A;  3VUR A;  3HJM A;  1ML6 A;  1VRS D;  2HNL A;  3KTB A;  1EWX A;  4F0B A;  4EO3 A;  1UN2 A;  5INY A;  2O85 A;  1B9X C;  5CRD A;  2H8L A;  3DML A;  1VF4 A;  4GQC A;  1SKS B;  3H1N A;  4ID0 A;  4ZBB A;  2I9H A;  4NMU A;  4PUF C;  4EKZ A;  1GWC A;  4EL1 A;  3FW2 A;  2OJL A;  1GH2 A;  3F4S A;  5GSS A;  1LU4 A;  3IAM 2;  2FA4 A;  3L4N A;  3EMP A;  4RUV A;  1EV4 A;  2YPM A;  3W8S A;  1TDI A;  1F3A A;  2WRT A;  4NXI A;  1A2M A;  1VF2 A;  4DSR A;  3CTG A;  1XWC A;  2FWF A;  3BCI A;  2M72 A;  1T4Z A;  4N30 A;  1GSF A;  3IA1 A;  5FHI A;  4AF2 A;  4G19 A;  4YH2 A;  4BWS A;  1W89 A;  1VF3 A;  1EV9 A;  4IHU A;  1SK0 A;  4GQF A;  2LJA A;  1F6M C;  1AW9 A;  2QC7 A;  1TI3 A;  3BJ5 A;  3UVH A;  3FK8 A;  3DGQ A;  1GUK A;  3GKK A;  3PH9 A;  3FEU A;  1EOG A;  1MTC A;  1GSE A;  3ZIJ A;  4KCA A;  1U3A A;  2JZR A;  5ELA A;  1ZZY A;  3E3E A;  3D22 A;  2HSH A;  1F9M A;  12GS A;  3EIN A;  2HRN A;  4K7N A;  1GUM A;  5IMC A;  3VK9 A;  4K7I A;  3WGD A;  1GTB A;  1EZK A;  4LA1 A;  3LYK A;  3QD9 A;  1ZMA A;  1TU8 A;  2VL9 A;  2C0F A;  4FO5 A;  4AJ6 A;  1ERT A;  3IK7 A;  3Q6O A;  1T1V A;  1PMT A;  4KSO A;  1G6Y A;  4K1F A;  1S3D A;  2IMF A;  2BMX A;  3GTU A;  1N8J A;  3ZFL A;  1OE8 A;  2TIR A;  1SK1 A;  1TRS A;  4PNF A;  1M9A A;  2YWM A;  1PA3 A;  5IPH A;  2IN3 A;  2PBJ A;  2OAC A;  4I5Q A;  1KBN A;  1WIK A;  3IV4 A;  2GSS A;  3F4T A;  3U5R E;  1Y6E A;  2PU9 C;  1QMV A;  3I43 A;  1Q98 A;  1GTI A;  1WJK A;  4J2F A;  3TRQ A;  3ZML A;  4HDE A;  1SU9 A;  3DD3 A;  3LWA A;  4ACS A;  1PQN A;  2P31 A;  2H0H A;  2AJQ B;  2KLX A;  3TKS C;  2VCZ A;  3S9F A;  5DAK A;  1FAA A;  1NHO A;  1E6B A;  4ZB6 A;  2CZ2 A;  2V2G A;  1J9B A;  3GV1 A;  1CQH A;  2VLU A;  4TR1 A;  2C1Y A;  2OBK A;  2DML A;  2HFD A;  1QXH A;  5F05 A;  1EEM A;  3EE2 A;  4JR4 A;  1PL2 A;  4EE0 A;  1IYH A;  3UBK A;  4KSM A;  5CAX A;  1ZL9 A;  1VF1 A;  2VL3 A;  3G9B A;  5F8B A;  2E2G A;  1TU7 A;  3ZRD A;  1GSU A;  3L0H A;  4KCE A;  5H5S A;  5J4U A;  1Z7R A;  2CAI A;  1R26 A;  3GL5 A;  3GA4 A;  5ENU A;  2FY6 A;  4N0V A;  2LST A;  3HJO A;  4HS1 A;  1R5A A;  3F0I A;  4MPF A;  2H75 A;  4TXV A;  1V57 A;  13GS A;  1ERU A;  3C71 A;  1JZO A;  2GT6 A;  1ZYQ B;  5AN1 A;  5IOW A;  1YF0 A;  2VCT A;  1M9B A;  3CRT A;  4GTU A;  2AUV A;  3CSJ A;  2PPT A;  3MNG A;  4MZB A;  2J23 A;  3KEB A;  2JZS A;  3QAW A;  2FNO A;  1KEB A;  2PN8 A;  1ERW A;  4JED A;  2DJ0 A;  4TVE A;  2X99 A;  3J7Y k;  4ILF A;  3D4M A;  2C3Q A;  3HZ4 A;  3GIX A;  2MMO A;  2WFC A;  4HI7 A;  3C8E A;  1SJ6 A;  4NHZ A;  5G5E A;  4TRX A;  2YWN A;  1N2A A;  5D9V A;  3UEM A;  3RHB A;  2LRC A;  2H01 A;  1Z3E A;  3KMN A;  4RI7 A;  4HJM A;  2GSR A;  5J9B A;  2L59 A;  4BL7 A;  2V6O A;  4MAB A;  3LOR A;  1FO5 A;  1XZO A;  1X9S B;  3KH7 A;  5EL8 A;  3AY8 A;  4MK3 A;  1TK0 B;  4LLR A;  1K3O A;  5JWR B;  4Z7X A;  2E0Q A;  4X1U A;  3A5W A;  2HRF A;  4AJ7 A;  1NHY A;  1OC9 A;  1J08 A;  1ST9 A;  5DVB A;  3TJF A;  1GSD A;  3IBH A;  4WBJ A;  1XCC A;  1YY7 A;  5J41 A;  1PKW A;  5B8A A;  3F3Q A;  2R37 A;  1K0O A;  5G5F A;  1XWG A;  2V6K A;  3M3M A;  4X0X A;  3CTF A;  2PVQ A;  4V2M A;  1AQX A;  2PGT A;  2ON5 A;  1XWA A;  2GZZ A;  3TJJ A;  2V1M A;  4F0C A;  2H72 A;  3LSZ A;  3BOA A;  2DIY A;  2VCQ A;  4OMV A;  4TR3 A;  4K9Z A;  19GS A;  2AB6 A;  1OKT A;  3KZQ A;  4KDY A;  4V1A g;  5A4W A;  2MBS A;  5CO3 A;  1G7E A;  1HNA A;  3WGX A;  1F37 A;  4FYB A;  3R2Q A;  5IMV A;  2YAN A;  1NSW A;  4F2I A;  4DSS B;  4HEA 2;  2EIO A;  4KE3 A;  2PER A;  4POB A;  4O7H A;  4GXZ A;  4HQZ A;  1BYE A;  3ERG A;  5IOX A;  2L6D A;  3ZL5 A;  5GAN D;  5HR3 A;  1M99 A;  2N5A A;  1B4P A;  4PXO A;  4IN0 A;  4G10 A;  1A2J A;  3WT2 A;  1PX6 A;  3M0F A;  4CHS A;  1HNC A;  2VLT A;  1Z7P A;  1Z6M A;  1FVJ A;  2HLS A;  2HZE B;  2I81 A;  4L5L A;  4MZW A;  1FOV A;  5D9X A;  2GLR A;  3GHA A;  4G2E A;  1MDJ A;  1MEK A;  3WD6 A;  2DJ2 A;  5F07 A;  5ECM B;  3CYN A;  4MH3 A;  1X5C A;  2OA7 A;  2FCH A;  1M7T A;  1TOF A;  5G30 A;  3GH6 A;  4I97 A;  1EGO A;  4OD7 A;  4MJE A;  2N5B A;  3NIV A;  3QAG A;  2KOK A;  3H93 A;  4TR0 A;  1SJZ A;  3RPP A;  4G9H A;  18GS A;  2YWO A;  2IJY A;  2IPA A;  3MSZ A;  2L57 A;  3C7M A;  4K2D A;  4K0G A;  4V2L A;  2GDR A;  1SKR B;  1WP0 A;  4N0Z A;  3TUE A;  2VLV A;  3HVX A;  2GQK A;  3HY2 A;  3RPN A;  1ERV A;  4F03 A;  1U88 A;  2ZCT A;  4PQH A;  1PL1 A;  2Z9S A;  3LEF A;  4I8B A;  4LL1 B;  2PVO C;  1MDK A;  3BCK A;  4K8M A;  2VD0 A;  4JU5 A;  3GSS A;  3FR9 A;  3ZTL A;  6GSY A;  1BG5 A;  1AQW A;  5DBQ A;  1DSB A;  4EUY A;  1J0F A;  1O7U A;  2HSY A;  3UBL A;  3NOF A;  3VPT A;  4Q5F A;  3FHK A;  3PR8 A;  4PQ1 A;  4PUR A;  3FZ9 A;  5D96 A;  4EVM A;  3M9K A;  4ZXG A;  2C3T A;  3M1G A;  3GX0 A;  1JLV A;  3F4R A;  3H4K A;  5KEJ A;  5IPG A;  4PGT A;  1B48 A;  4OFT A;  1QUW A;  14GS A;  1BED A;  4HQS A;  2WS2 A;  1XPV A;  1PKZ A;  2CA8 A;  3H79 A;  5ECS A;  2WCI A;  4MF6 A;  2IME A;  2LUS A;  2K9F A;  2C0E A;  2MYG A;  2HZE A;  4MF7 A;  4IKH A;  6GSV A;  4AGS A;  4XCS A;  1T00 A;  2VUP A;  3D6I A;  5DQY A;  1FW1 A;  3V1W A;  4BWQ A;  3CBU A;  2AHE A;  2H1D A;  4I6X A;  1TRU A;  5HFI A;  8GSS A;  2PMT A;  4KND A;  1X5E A;  2CVD A;  1O8X A;  2YCD A;  4IEL A;  4MJC A;  2VL2 C;  3GRX A;  2NPB A;  2MZC A;  3VWW A;  3NZN A;  1K0D A;  4D73 B;  2KUC A;  2C0G A;  1TKD B;  2ON7 A;  2IWT A;  4GSN A;  3O3T A;  3P8W A;  2KHP A;  3Q74 A;  2NBS A;  4N10 A;  5H5Q A;  4KX4 A;  2EC4 A;  3Q19 A;  1ILO A;  3IOS A;  4LMV A;  3ZVJ D;  3LJR A;  1K3Y A;  1ON4 A;  2IFQ B;  4KDU A;  2RM5 A;  5AGY A;  2DC5 A;  1H4O A;  2DLX A;  2O7K A;  1Y25 A;  4PNG A;  2TRX A;  1UVZ A;  3TKP A;  1FVK A;  5ECI B;  3N9J A;  1ZGN A;  3TKS A;  4DSQ A;  2VOC A;  3VWU A;  20GS A;  5IM9 A;  4K6X A;  4MH2 A;  4IS0 A;  2GZY A;  2H6X A;  16GS A;  2P0G A;  2F51 A;  1A0F A;  4OCE A;  5GAP D;  2B6M A;  2YZH A;  2XBQ A;  1XIY A;  1T7P B;  1YZX A;  4GLT A;  1OC8 A;  1THX A;  5JWQ B;  2KP1 A;  1TK5 B;  2R5G A;  1O85 A;  4IP6 A;  1QQ2 A;  1ZYE A;  2OBI A;  1XOA A;  1PX7 A;  4BVY A;  2B1L A;  2I4A A;  2C4J A;  3UAP A;  4JE1 A;  1XWB A;  5AIS A;  4F9Z A;  1NM3 A;  4NPB A;  2X8C A;  2YJ7 A;  5GST A;  4L0W A;  5ELG A;  2A2R A;  1JFU A;  3DYR A;  6GSX A;  2QKE A;  4MCU A;  3VWX A;  1A23 A;  4EC0 A;  4GWR A;  2BJX A;  2RM6 A;  4V1A p;  3SBC A;  3HA9 A;  3GN3 A;  1WRY A;  1FB0 A;  3ISO A;  4BA7 A;  4ECI A;  1SD8 A;  2K8S A;  4TOP A;  2JZT A;  4RI6 A;  1G6W A;  1GUH A;  5HFG A;  1WE0 A;  3GUR A;  6GSW A;  5ID2 B;  3FR6 A;  2VIM A;  3ED3 A;  4ZBA A;  2FWH A;  4WR4 A;  3TGZ A;  4POM A;  3HVS A;  5G1L A;  4MDC A;  4QQ7 A;  3BD2 A;  3TDG A;  3ZIT A;  1CQG A;  1OKD A;  1SL2 B;  4WET A;  4JBB A;  1BQ7 A;  1YKC A;  1SJI A;  1WOU A;  1PD2 1;  2C3N A;  3J7Y b;  2LJK A;  4RQX A;  5KN0 A;  2LJR A;  3TRP A;  3I69 A;  1GLP A;  1PN9 A;  4FYU A;  3F63 A;  1WMJ A;  1PGT A;  3GYK A;  1K0C A;  5D9T A;  1K0B A;  2I3Y A;  5HR1 A;  2B7J A;  2F9S A;  2LNS A;  2R2J A;  3TKR A;  3LYP A;  4PQI A;  4NV2 A;  3D4T A;  3P2A A;  1QFN A;  1X9W B;  1THO A;  2B7K A;  2VM1 A;  1DUG A;  4F82 A;  3L78 A;  2YOI A;  1QK8 A;  4N11 A;  3VLN A;  2JAC A;  3HXS A;  3KD0 A;  5C00 A;  2RII A;  4J57 E;  4JR6 A;  4DEJ A;  4ECJ A;  3GKX A;  3OR5 A;  2XC2 A;  4P3Y B;  2V32 A;  3FZ5 A;  3ZIV A;  1TJD A;  5C04 A;  4LL4 B;  5KN2 A;  4L0U A;  4HU9 A;  2B5E A;  1X5D A;  2LNT A;  1ACV A;  3LG6 A;  1K0A A;  1GRX A;  3JCM L;  3A3T A;  3HKR A;  3UMA A;  2MMA A;  3DKS A;  5DDL A;  2ES7 A;  1AAZ A;  1QGV A;  2PUK C;  1YKA A;  4TN8 A;  5ECQ B;  4Q5Q A;  4TW5 A;  3BBY A;  5ID2 A;  3IK9 A;  3ERW A;  4IJI A;  5D93 A;  1V98 A;  1XWK A;  4WKW A;  3GFK A;  3DRN A;  5IQY A;  1ABA A;  2CAQ A;  4LMW A;  3IDV A;  3TKQ A;  4I2U A;  1MDI A;  2X8H A;  2H0I A;  3EU4 A;  3KMO A;  1K0N A;  2WZ9 A;  1RW1 A;  2VCV A;  3GH9 A;  3QCP A;  4EDZ A;  2EIQ A;  4KDX A;  2LRT A;  2ALB A;  3D0Z A;  3D5J A;  5ECO B;  4WF5 A;  4ZL9 A;  3KXO A;  4ZB9 A;  1HYU A;  4X43 A;  3IAS 2;  5JWO B;  4V2N A;  4IW9 A;  5J9C A;  2FD3 A;  2VCX A;  3RDW A;  4E8H A;  2GSQ A;  3FRC A;  2K8V A;  3ZVJ A;  3EUR A;  4WR5 A;  1SYX A;  4GCI A;  3TCO A;  4KB3 A;  1KTE A;  5AIV A;  3M9J A;  1M2D A;  3F8U A;  5B8B A;  1URM A;  4XS6 A;  4TXO B;  3VFI A;  3A2W A;  3QR6 A;  7GSS A;  2H30 A;  2QSI A;  3UL3 A;  1WPI A;  1V40 A;  2O87 A;  2X64 A;  3K8N A;  3LGC A;  5CRW A;  1TK8 B;  4MPG A;  3RHC A;  2FWE A;  4XS4 B;  2F8A A;  2CV4 A;  1B9Y C;  2L5O A;  5F06 A;  5CP1 A;  2KP2 A;  1Z6N A;  5ECK B;  3UAR A;  1BJX A;  4XRD A;  2M80 A;  2VAF A;  3FY7 A;  1A24 A;  1T8E B;  3H8Q A;  1SKW B;  3GKM A;  1Q4J A;  1SYR A;  4NAX A;  5AIX A;  5ECN B;  3VWV A;  3FYG A;  3I6A A;  1LJR A;  3M8N A;  1IYI A;  3CMI A;  1SL0 B;  2YNX A;  3FR3 A;  2GST A;  1A2L A;  1M2B A;  3D21 A;  2GTU A;  2MMN A;  2YV9 A;  3CSH A;  5HR2 A;  1G0T A;  4YQM A;  3CXG A;  4QL7 A;  1JZD A;  4TKY A;  2VD1 A;  5FT3 A;  3ZZX A;  3MDK A;  2D2Z A;  3A2V A;  3F6F A;  1RQM A;  4XRA A;  5ECR B;  1R7H A;  2VM2 A;  2H6Y A;  4HZ4 A;  5EY6 A;  2P5R A;  1TW9 A;  5J3R A;  3ME8 A;  2OE1 A;  4I2T A;  2CZ3 A;  4HJ2 A;  4XTS A;  1A8L A;  2BTO T;  2J9H A;  5CYY A;  3P90 A;  4JRR A;  4KAE A;  4HU7 A;  5DAL B;  2RUE A;  4H86 A;  3G7I A;  1NW2 A;  10GS A;  2R4V A;  3US3 A;  2FUG 2;  4WBR D;  2XBI A;  3C1R A;  3DWV A;  2FA8 A;  1WWJ A;  2B5Y A;  3KH9 A;  3QFA C;  5IIZ A;  2OE0 A;  2F3M A;  2IIY A;  3U6V A;  3UIW A;  3APS A;  3UOM A;  3LXT A;  2IL3 A;  1X0R A;  1XFL A;  5HQP A;  5COH A;  4DSS A;  1HNB A;  1UA5 A;  2L5L A;  2WGR A;  4IP1 A;  1EP8 A;  1XW6 A;  2MMZ A;  1U87 A;  5DCG A;  3APQ A;  5DJL A;  3TOT A;  2O8V B;  11GS A;  2DMM A;  3W6G A;  1GTA A;  1HD2 A;  3VI5 A;  1JHB A;  2H19 A;  3DXB A;  4O32 A;  1ZOF A;  5KN1 A;  2C0D A;  2WUL A;  3N5O A;  4MMM A;  4OWY A;  5DQS A;  4IBP A;  1GLQ A;  5DAK B;  2DJ1 A;  1AIU A;  2V41 A;  2O89 A;  1G7O A;  3KGK A;  4L5O A;  4TR1 B;  2L4C A;  3WGE A;  3HVV A;  4IQ1 A;  1OAZ A;  2E2M A;  4YAP A;  3WYW A;  3APO A;  2DJJ A;  3ZLP A;  2H74 A;  2YV7 A;  4Q5N A;  4XIH A;  4KH7 A;  1OC3 A;  5IO2 A;  1LBK A;  2RLI A;  2R6K A;  5ABR A;  2GQL A;  3MAK A;  5FWG A;  2H71 A;  4CW9 A;  3TRX A;  3L9U A;  2K18 A;  1Z5Y E;  4O92 A;  2YZU A;  2H73 A;  4EF0 A;  1T3B A;  1H75 A;  3GNJ A;  4L8E A;  3HJP A;  4XS1 A;  5IMD A;  5A4U A;  3F3R A;  1YF1 A;  4CDO A;  5DAL A;  1EGR A;  1A0R P;  4YQU A;  2A2S A;  2E7P A;  4HUA A;  3KP9 A;  1KNG A;  5EPF A;  1O73 A;  3DVW A;  2DIZ A;  3TB2 A;  1FHE A;  4MJA A;  1TRV A;  3WT1 A;  3F9U A;  4O5R A;  3KM6 A;  5G31 A;  4FIW A;  5J5N A;  4QL9 A;  2ZUP A;  2PWJ A;  1O6J A;  2DJK A;  1AXD A;  1O8W A;  4POK A;  2I1U A;  5CRH A;  3HDC A;  1YQ1 A;  1X9M B;  1HQO A;  2YP6 A;  1GNE A;  4IVF A;  1GNW A;  1YEX A;  2JL4 A;  5ECL B;  1TTZ A;  5B6M A;  1SK2 A;  2LQQ A;  4FYC A;  4DVC A;  1XW9 A;  2JSZ A;  4OO4 A;  4FH8 A;  3UVT A;  5A5K A;  3HD5 A;  2F8F A;  3TOU A;  5LCZ A;  3LXZ A;  5IMF A;  2H66 A;  3C73 A;  3HHV A;  4EDY A;  2LS5 A;  3DEX A;  3L9S A;  2G0F A;  2JAD A;  1W4V A;  3RBT A;  2AV4 A;  2GGT A;  5ECH B;  3EWL A;  4BVX A;  5D8I A;  1B4Q A;  3DVX A;  2X8G A;  1T4Y A;  3W8J A;  1U6T A;  2CX4 A;  2XPE A;  1OC9 B;  3KTL A;  1V2A A;  5E59 A;  2WB9 A;  2B3S A;  4ZL8 A;  1FB6 A;  2L6C A;  3TJK A;  4D73 A;  1M2A A;  5L71 A;  2G2Q A;  3PIN A;  3ZYW A;  1XOB A;  4ML1 A;  1U3I A;  2HYX A;  4WEY A;  1DE1 A;  2LKU A;  3ERF A;  3QOU A;  3UJ1 A;  2H70 A;  2H1A A;  2WDU A;  1EOH A;  2IFQ A;  3VPQ A;  1Z9H A;  1AUC A;  2VCW A;  1BX9 A;  3KJY A;  1RK4 A;  1TP9 A;  3IRA A;  2GZP A;  3ZFB A;  3C1S A;  4ECC A;  2YJH A;  4KGI A;  1K3L A;  1EP7 A;  2YN1 A;  1EEJ A;  4KW6 A;  4KUN A;  1YJ6 A;  1GTU A;  3GKN A;  1GSY A;  3EU3 A;  2IMI A;  2MBT A;  5JCU A;  1GUL A;  2C80 A;  3G7J A;  4OCF A;  2FHE A;  2JSY A;  1R4W A;  2FWG A;  3E9J B;  1SL1 B;  6GST A;  1USB A;  1M0U A;  3SWL A;  1FG4 A;  2B5X A;  3TJB A;  4GRF A;  2K6V A;  1O81 A;  9GSS A;  3LQ7 A;  2DSA A;  4EXJ A;  3GL3 A;  3LFL A;  2LV3 A;  1V9W A;  5B6N A;  4JZQ A;  5KN3 A;  4RQR A;  1XVW A;  1SEN A;  1TI1 A;  5D73 A;  1I5G A;  3FZA A;  3QPM A;  2H0G A;  3QMX A;  2AYT A;  2HZF A;  4NHW A;  4MF5 A;  3O76 A;  2REM A;  3KIJ A;  1DBY A;  5D9W A;  3I9V 2;  1XW5 A;  5G1K A;  2R3X A;  3E0U A;  3TKS E;  3GST A;  2P5Q A;  2H76 A;  5A4V A;  3DIE A;  2H1G A;  4ECB A;  5F0G A;  1OVN A;  3ZRE A;  1AC1 A;  4XHM A;  5EVO A;  4MLY A;  1OE7 A;  3HCZ A;  2OAD A;  4ULX A;  2JU5 A;  5JCG A;  2HT9 A;  4MJB A;  4AJ8 A;  1YDK A;  2CVK A;  2AAW A;  5G2Z A;  1YEP A;  1GSS A;  3ME7 A;  2HI7 A;  3EVI A;  1B8X A;  1OYJ A;  1MD3 A;  4YAV A;  3TJG A;  4E8E A;  5CRG A;  4ZB8 A;  2A4V A;  2N5F A;  4ZIL A;  2EIR A;  3CSI A;  3A2X A;  3EYT A;  4ZL7 A;  3Q18 A;  5LD0 A;  5IMA A; 
#chains in the Genus database with same CATH topology
 4MZC A;  4PX1 A;  2VO4 A;  1XXU A;  1C72 A;  2FLS A;  3IR4 A;  3HZ8 A;  1MD4 A;  2LTK A;  1F2E A;  2CX3 A;  2QGV A;  4K7O A;  1I9D A;  4GF0 A;  5DJM A;  4GST A;  2NDO A;  3P7X A;  2FGX A;  4MA9 A;  3IPZ A;  2TRC P;  1XVQ A;  4ZIJ A;  5LNK e;  2GQM A;  2LRN A;  1BAY A;  2OE3 A;  2GVP A;  2B1K A;  3F6D A;  2HE3 A;  5B7C A;  3FZ4 A;  6GSS A;  3EMX A;  22GS A;  1JLW A;  4PUA A;  3KP8 A;  3HYP A;  2HXK A;  3FKF A;  1S3C A;  5HFK A;  4IQA A;  1E2Y A;  2C8U A;  4OO5 A;  3MWH A;  3IXR A;  3ZMK A;  4HOJ A;  3L9V A;  3QFB C;  4IJ3 A;  1JZW A;  3PGT A;  2ZNM A;  3GUS A;  3GMF A;  2M46 A;  2DJ3 A;  4MP4 A;  5GZZ B;  4ZBD A;  3EC3 A;  1TXX A;  3GX8 A;  1ZCP A;  3RAZ A;  4WXT A;  4TR4 A;  2LQO A;  1XG8 A;  5DCH A;  6GSU A;  3O6T A;  4POL A;  4G0I A;  4NWY A;  3IC4 A;  2LEG A;  2H1B A;  1PRX A;  4Q5R A;  5ECP B;  3QAV A;  1AQV A;  4ML6 A;  2YWI A;  3QDN A;  4IGJ A;  2IMK A;  5JCW A;  5H5R A;  2DBC A;  5IO0 A;  3VI7 A;  3G7Y A;  1DE2 A;  2WJU A;  2NVL A;  2NTO A;  1A8Y A;  1K0M A;  4K0N A;  4J56 E;  5KOW A;  1SD9 A;  2GS3 A;  3KCM A;  5IMZ A;  1GL8 A;  2CQ9 A;  5CNW A;  1PSQ A;  1VGL A;  4GSS A;  5E4W A;  4BPY A;  5BRT A;  2CT6 A;  2XHF A;  1F3B A;  3IHQ A;  5HR0 A;  2L4Q A;  1UC7 A;  1GSQ A;  5CRE A;  3CRU A;  1XBS A;  2VL2 A;  1V58 A;  2RUF A;  4KA0 A;  3GTU B;  17GS A;  4HZ2 A;  2H6Z A;  2OKA A;  4NV5 A;  1R5P A;  1GP1 A;  4TXO A;  4YQV A;  4WF4 A;  1PFO A;  4ISD A;  1S3A A;  3IE3 A;  4OFM A;  2IMD A;  2GT5 A;  2XPD A;  1TRW A;  1JZR A;  4OFN A;  4XS4 A;  2CVB A;  3VUR A;  3HJM A;  1ML6 A;  1VRS D;  2HNL A;  3KTB A;  1EWX A;  4F0B A;  4EO3 A;  1UN2 A;  5INY A;  2O85 A;  1B9X C;  5CRD A;  2H8L A;  3DML A;  1VF4 A;  3PPU A;  4GQC A;  1SKS B;  3H1N A;  4ID0 A;  4ZBB A;  2I9H A;  4NMU A;  4PUF C;  4EKZ A;  1GWC A;  4EL1 A;  3FW2 A;  2OJL A;  1GH2 A;  3F4S A;  5GSS A;  1LU4 A;  3IAM 2;  2FA4 A;  3L4N A;  3EMP A;  4RUV A;  1EV4 A;  2YPM A;  3W8S A;  1TDI A;  1F3A A;  2WRT A;  4NXI A;  1A2M A;  1VF2 A;  4DSR A;  3CTG A;  1XWC A;  2FWF A;  3BCI A;  2M72 A;  1T4Z A;  4N30 A;  1GSF A;  3IA1 A;  5FHI A;  4AF2 A;  4G19 A;  4YH2 A;  4BWS A;  1W89 A;  1VF3 A;  1EV9 A;  4IHU A;  1SK0 A;  4GQF A;  2LJA A;  1F6M C;  1AW9 A;  2QC7 A;  1TI3 A;  3BJ5 A;  3UVH A;  3FK8 A;  3DGQ A;  1GUK A;  3GKK A;  3PH9 A;  3FEU A;  1EOG A;  1MTC A;  1GSE A;  3ZIJ A;  4KCA A;  1U3A A;  2JZR A;  5ELA A;  1ZZY A;  3E3E A;  3D22 A;  2HSH A;  1F9M A;  12GS A;  3EIN A;  2HRN A;  4K7N A;  2HRA A;  1GUM A;  5IMC A;  3VK9 A;  4K7I A;  3WGD A;  1GTB A;  1EZK A;  4LA1 A;  3LYK A;  3QD9 A;  1ZMA A;  1TU8 A;  2VL9 A;  2C0F A;  4FO5 A;  4AJ6 A;  1ERT A;  3IK7 A;  3Q6O A;  1T1V A;  1PMT A;  4KSO A;  1G6Y A;  4K1F A;  1S3D A;  2IMF A;  2BMX A;  3GTU A;  1N8J A;  3ZFL A;  1OE8 A;  2TIR A;  1SK1 A;  1TRS A;  4PNF A;  4Z2T A;  1M9A A;  2YWM A;  1PA3 A;  5IPH A;  2IN3 A;  2PBJ A;  2OAC A;  4I5Q A;  3R3E A;  1KBN A;  1WIK A;  3IV4 A;  2GSS A;  3F4T A;  3U5R E;  1Y6E A;  2PU9 C;  1QMV A;  3I43 A;  1Q98 A;  1GTI A;  1WJK A;  4BL7 B;  4J2F A;  3TRQ A;  3ZML A;  4HDE A;  1SU9 A;  3DD3 A;  3LWA A;  4ACS A;  1PQN A;  2P31 A;  2H0H A;  2AJQ B;  2KLX A;  3TKS C;  2VCZ A;  3S9F A;  5DAK A;  1FAA A;  1NHO A;  1E6B A;  4ZB6 A;  2CZ2 A;  2V2G A;  1J9B A;  3GV1 A;  1CQH A;  2VLU A;  4TR1 A;  2C1Y A;  2OBK A;  2R0G A;  2DML A;  2HFD A;  1QXH A;  5F05 A;  1EEM A;  3EE2 A;  4JR4 A;  3FMW A;  1PL2 A;  4EE0 A;  1IYH A;  3UBK A;  4KSM A;  5CAX A;  1ZL9 A;  1VF1 A;  2VL3 A;  3G9B A;  5F8B A;  2E2G A;  2X4A A;  1TU7 A;  3ZRD A;  1GSU A;  3L0H A;  4KCE A;  5H5S A;  5J4U A;  1Z7R A;  2CAI A;  1R26 A;  3GL5 A;  3GA4 A;  5ENU A;  2FY6 A;  4N0V A;  2LST A;  3HJO A;  4HS1 A;  1R5A A;  3F0I A;  4MPF A;  2H75 A;  4TXV A;  1V57 A;  13GS A;  1ERU A;  3C71 A;  1JZO A;  2GT6 A;  1ZYQ B;  5AN1 A;  5IOW A;  1YF0 A;  2VCT A;  1M9B A;  3CRT A;  4GTU A;  2AUV A;  3CSJ A;  2PPT A;  3MNG A;  4MZB A;  2J23 A;  3KEB A;  2JZS A;  4K2X A;  3QAW A;  2FNO A;  1KEB A;  2PN8 A;  1ERW A;  4JED A;  2DJ0 A;  4TVE A;  2X99 A;  3J7Y k;  4ILF A;  3D4M A;  2C3Q A;  3HZ4 A;  3GIX A;  2MMO A;  2WFC A;  4HI7 A;  3C8E A;  1SJ6 A;  4NHZ A;  5G5E A;  4TRX A;  2YWN A;  1N2A A;  5D9V A;  3UEM A;  3RHB A;  2LRC A;  2H01 A;  1Z3E A;  3KMN A;  4RI7 A;  4HJM A;  2GSR A;  3CQF A;  5J9B A;  2L59 A;  4BL7 A;  2V6O A;  4MAB A;  3LOR A;  1FO5 A;  1XZO A;  4KF9 A;  3LW9 A;  1X9S B;  3KH7 A;  5EL8 A;  3AY8 A;  1M3I A;  4MK3 A;  1TK0 B;  4LLR A;  1K3O A;  5JWR B;  4Z7X A;  2E0Q A;  3IHG A;  4X1U A;  3A5W A;  2HRF A;  4AJ7 A;  1NHY A;  1OC9 A;  1J08 A;  1ST9 A;  5DVB A;  3TJF A;  1GSD A;  3IBH A;  4WBJ A;  1XCC A;  1YY7 A;  5J41 A;  1PKW A;  2HRK A;  5B8A A;  3F3Q A;  2R37 A;  1K0O A;  5G5F A;  1XWG A;  2V6K A;  3M3M A;  4X0X A;  3CTF A;  4A5P A;  2PVQ A;  4V2M A;  1AQX A;  2PGT A;  2ON5 A;  1XWA A;  2GZZ A;  3TJJ A;  2V1M A;  4F0C A;  2H72 A;  3LSZ A;  4G0K A;  3BOA A;  2DIY A;  2VCQ A;  4OMV A;  4TR3 A;  4K9Z A;  19GS A;  2AB6 A;  1OKT A;  3KZQ A;  4KDY A;  4V1A g;  5A4W A;  2MBS A;  5CO3 A;  1G7E A;  1HNA A;  3WGX A;  1ZYN A;  1F37 A;  4FYB A;  3R2Q A;  5IMV A;  2YAN A;  1NSW A;  4F2I A;  4DSS B;  4HEA 2;  2EIO A;  4KE3 A;  2PER A;  4POB A;  4O7H A;  4GXZ A;  4HQZ A;  1BYE A;  3ERG A;  5IOX A;  2L6D A;  3ZL5 A;  5GAN D;  5HR3 A;  1M99 A;  2N5A A;  1B4P A;  4PXO A;  4IN0 A;  4G10 A;  1A2J A;  3WT2 A;  4EIP A;  1PX6 A;  3M0F A;  4CHS A;  1HNC A;  2VLT A;  1Z7P A;  1Z6M A;  1FVJ A;  2HLS A;  2HZE B;  2I81 A;  4L5L A;  4FQU A;  4MZW A;  1FOV A;  5D9X A;  2GLR A;  3GHA A;  4G2E A;  1MDJ A;  1MEK A;  3WD6 A;  2DJ2 A;  5F07 A;  5ECM B;  3CYN A;  4MH3 A;  1X5C A;  2OA7 A;  2FCH A;  1M7T A;  1TOF A;  5G30 A;  3GH6 A;  4I97 A;  1EGO A;  4OD7 A;  4MJE A;  2N5B A;  3NIV A;  3QAG A;  2KOK A;  3H93 A;  4TR0 A;  1SJZ A;  3RPP A;  4G9H A;  18GS A;  2YWO A;  2IJY A;  2IPA A;  3MSZ A;  2L57 A;  3C7M A;  4K2D A;  4K0G A;  4V2L A;  2GDR A;  1SKR B;  1WP0 A;  4N0Z A;  3TUE A;  2VLV A;  4Z2U A;  3HVX A;  2GQK A;  3HY2 A;  3RPN A;  1ERV A;  4F03 A;  4G0L A;  1U88 A;  2ZCT A;  4PQH A;  1PL1 A;  2Z9S A;  3LEF A;  4I8B A;  4LL1 B;  2PVO C;  1MDK A;  3BCK A;  4K8M A;  2VD0 A;  4JU5 A;  3GSS A;  3FR9 A;  3ZTL A;  6GSY A;  1BG5 A;  1AQW A;  5DBQ A;  1DSB A;  4EUY A;  1J0F A;  1O7U A;  2HSY A;  3UBL A;  3NOF A;  3VPT A;  4Q5F A;  3FHK A;  3PR8 A;  4PQ1 A;  4PUR A;  3FZ9 A;  5D96 A;  4EVM A;  3M9K A;  2R0P A;  4ZXG A;  2C3T A;  3M1G A;  3GX0 A;  1JLV A;  3F4R A;  3H4K A;  4BVY B;  5KEJ A;  5IPG A;  4PGT A;  1B48 A;  4OFT A;  1QUW A;  14GS A;  1BED A;  4HQS A;  2WS2 A;  1XPV A;  1PKZ A;  2CA8 A;  3H79 A;  5ECS A;  2WCI A;  4MF6 A;  2IME A;  2LUS A;  2K9F A;  2C0E A;  2MYG A;  2HZE A;  4MF7 A;  4IKH A;  6GSV A;  4AGS A;  4K5R A;  4XCS A;  1T00 A;  2VUP A;  3D6I A;  5DQY A;  1FW1 A;  3V1W A;  4BWQ A;  3CBU A;  2AHE A;  2H1D A;  4BVX B;  4I6X A;  4O5Q A;  1TRU A;  5HFI A;  8GSS A;  2PMT A;  4KND A;  1X5E A;  2CVD A;  1O8X A;  2YCD A;  4IEL A;  4MJC A;  2VL2 C;  3GRX A;  2NPB A;  2MZC A;  3VWW A;  3NZN A;  1K0D A;  4D73 B;  2KUC A;  2C0G A;  1TKD B;  2ON7 A;  2IWT A;  4GSN A;  3O3T A;  3P8W A;  2KHP A;  3Q74 A;  2NBS A;  4N10 A;  5H5Q A;  4KX4 A;  2EC4 A;  3Q19 A;  1ILO A;  3IOS A;  4LMV A;  3ZVJ D;  3LJR A;  1K3Y A;  1ON4 A;  2IFQ B;  4KDU A;  2RM5 A;  5AGY A;  2DC5 A;  1H4O A;  2DLX A;  2O7K A;  1Y25 A;  4PNG A;  2TRX A;  1UVZ A;  3TKP A;  1FVK A;  5ECI B;  3N9J A;  1ZGN A;  3TKS A;  4DSQ A;  2VOC A;  3VWU A;  20GS A;  5IM9 A;  4K6X A;  4MH2 A;  4IS0 A;  2GZY A;  2H6X A;  16GS A;  2P0G A;  2F51 A;  1A0F A;  4OCE A;  5GAP D;  2B6M A;  2YZH A;  2XBQ A;  1FOH A;  1XIY A;  1T7P B;  1YZX A;  4GLT A;  1OC8 A;  1THX A;  5JWQ B;  2KP1 A;  1TK5 B;  2R5G A;  1O85 A;  4IP6 A;  1QQ2 A;  1ZYE A;  2OBI A;  1XOA A;  1PX7 A;  4BVY A;  2B1L A;  2I4A A;  2C4J A;  3UAP A;  4JE1 A;  1XWB A;  5AIS A;  4F9Z A;  1NM3 A;  4NPB A;  2X8C A;  5BMU A;  2YJ7 A;  5GST A;  4L0W A;  5ELG A;  2A2R A;  1JFU A;  3DYR A;  6GSX A;  2QKE A;  4MCU A;  4EIQ A;  3VWX A;  1A23 A;  4EC0 A;  4GWR A;  2BJX A;  2RM6 A;  4V1A p;  3SBC A;  3HA9 A;  3GN3 A;  1WRY A;  1FB0 A;  3ISO A;  4BA7 A;  4ECI A;  1SD8 A;  2K8S A;  2DKI A;  4TOP A;  2JZT A;  4RI6 A;  1G6W A;  1GUH A;  5HFG A;  1WE0 A;  3GUR A;  6GSW A;  5ID2 B;  3FR6 A;  2A2P A;  2VIM A;  3ED3 A;  4ZBA A;  2FWH A;  4WR4 A;  3TGZ A;  4POM A;  3HVS A;  5G1L A;  2QA1 A;  4MDC A;  4QQ7 A;  3BD2 A;  3TDG A;  3ZIT A;  1CQG A;  1OKD A;  1SL2 B;  4WET A;  4JBB A;  1BQ7 A;  4O5U A;  1YKC A;  1SJI A;  1WOU A;  1PD2 1;  2C3N A;  3J7Y b;  2LJK A;  4RQX A;  5KN0 A;  2LJR A;  3TRP A;  3I69 A;  1GLP A;  1PN9 A;  4FYU A;  3F63 A;  1WMJ A;  1PGT A;  3GYK A;  1K0C A;  5D9T A;  1K0B A;  2I3Y A;  5HR1 A;  2B7J A;  2F9S A;  4BIK A;  2LNS A;  2R2J A;  3TKR A;  3LYP A;  4PQI A;  4NV2 A;  3D4T A;  4MNN A;  3P2A A;  1QFN A;  1X9W B;  1THO A;  2B7K A;  2VM1 A;  1DUG A;  4F82 A;  4USS A;  3L78 A;  2R0C A;  2YOI A;  1QK8 A;  4N11 A;  3VLN A;  2JAC A;  3HXS A;  3KD0 A;  5C00 A;  2RII A;  4J57 E;  4JR6 A;  4DEJ A;  4ECJ A;  3GKX A;  3OR5 A;  2XC2 A;  4P3Y B;  2V32 A;  3FZ5 A;  3ZIV A;  1TJD A;  5C04 A;  4LL4 B;  5KN2 A;  4L0U A;  4HU9 A;  2B5E A;  3HVN A;  1X5D A;  2LNT A;  1ACV A;  3LG6 A;  1K0A A;  2A4H A;  1GRX A;  3JCM L;  3A3T A;  3HKR A;  3UMA A;  4K5S A;  2MMA A;  3DKS A;  5DDL A;  2ES7 A;  1AAZ A;  1QGV A;  2PUK C;  1YKA A;  4TN8 A;  5ECQ B;  4Q5Q A;  4TW5 A;  4CY8 A;  3BBY A;  5ID2 A;  3IK9 A;  3ERW A;  4IJI A;  5D93 A;  1V98 A;  1XWK A;  4WKW A;  3GFK A;  3DRN A;  1M3J A;  5IQY A;  1ABA A;  2CAQ A;  4LMW A;  3IDV A;  3TKQ A;  4I2U A;  1MDI A;  2X8H A;  2H0I A;  3EU4 A;  3KMO A;  1K0N A;  2WZ9 A;  1RW1 A;  2VCV A;  3GH9 A;  3QCP A;  4EDZ A;  2EIQ A;  4KDX A;  2LRT A;  2ALB A;  3D0Z A;  3D5J A;  5ECO B;  4WF5 A;  4ZL9 A;  3KXO A;  4ZB9 A;  1HYU A;  4X43 A;  3IAS 2;  5JWO B;  4V2N A;  4IW9 A;  5J9C A;  2FD3 A;  2VCX A;  3RDW A;  4E8H A;  2GSQ A;  3FRC A;  2K8V A;  3ZVJ A;  3EUR A;  4WR5 A;  1SYX A;  4GCI A;  3TCO A;  4KB3 A;  1KTE A;  5AIV A;  3M9J A;  1M2D A;  3F8U A;  5B8B A;  1URM A;  4XS6 A;  4TXO B;  3VFI A;  3A2W A;  3QR6 A;  7GSS A;  2H30 A;  2QSI A;  3IC8 A;  3UL3 A;  1WPI A;  1V40 A;  2O87 A;  2X64 A;  3K8N A;  3LGC A;  5CRW A;  1TK8 B;  4MPG A;  3RHC A;  2FWE A;  4XS4 B;  2F8A A;  2CV4 A;  1B9Y C;  2L5O A;  5F06 A;  5CP1 A;  2KP2 A;  1Z6N A;  5ECK B;  3UAR A;  1BJX A;  4XRD A;  2M80 A;  2VAF A;  3FY7 A;  1A24 A;  1T8E B;  3H8Q A;  1SKW B;  3GKM A;  1Q4J A;  1SYR A;  4NAX A;  5AIX A;  5ECN B;  3VWV A;  3FYG A;  3I6A A;  1S3R A;  1LJR A;  3M8N A;  1IYI A;  3CMI A;  1SL0 B;  2YNX A;  3FR3 A;  2GST A;  1A2L A;  1M2B A;  3D21 A;  2GTU A;  2MMN A;  2YV9 A;  3CSH A;  5HR2 A;  1G0T A;  4YQM A;  3CXG A;  4QL7 A;  1JZD A;  4TKY A;  2VD1 A;  5FT3 A;  3ZZX A;  3MDK A;  2D2Z A;  3A2V A;  3F6F A;  1RQM A;  4XRA A;  5ECR B;  1R7H A;  2VM2 A;  2H6Y A;  4HZ4 A;  5EY6 A;  2P5R A;  1TW9 A;  5J3R A;  3ME8 A;  2OE1 A;  4I2T A;  2CZ3 A;  4HJ2 A;  4XTS A;  1A8L A;  2BTO T;  2J9H A;  5CYY A;  3P90 A;  4JRR A;  4KAE A;  4HU7 A;  5DAL B;  2RUE A;  4H86 A;  2X49 A;  3G7I A;  1NW2 A;  10GS A;  2R4V A;  3US3 A;  2FUG 2;  4WBR D;  2XBI A;  3C1R A;  3DWV A;  4ICY A;  2FA8 A;  1WWJ A;  2B5Y A;  3KH9 A;  3QFA C;  5IIZ A;  2OE0 A;  2F3M A;  2IIY A;  3U6V A;  3UIW A;  3APS A;  3UOM A;  3LXT A;  2IL3 A;  1X0R A;  1XFL A;  5HQP A;  5COH A;  4PTS A;  4DSS A;  1HNB A;  1UA5 A;  2L5L A;  2WGR A;  4IP1 A;  1EP8 A;  1XW6 A;  2MMZ A;  1U87 A;  5DCG A;  3APQ A;  5DJL A;  3TOT A;  2O8V B;  11GS A;  2DMM A;  3W6G A;  1GTA A;  1HD2 A;  3VI5 A;  1JHB A;  2H19 A;  3DXB A;  3A5I A;  4O32 A;  1ZOF A;  5KN1 A;  2C0D A;  2WUL A;  3N5O A;  4MMM A;  5KOX A;  4OWY A;  5DQS A;  4IBP A;  1GLQ A;  5DAK B;  2DJ1 A;  1AIU A;  2V41 A;  2O89 A;  1G7O A;  3KGK A;  4L5O A;  4TR1 B;  2L4C A;  3WGE A;  3HVV A;  4IQ1 A;  1OAZ A;  2E2M A;  4YAP A;  3WYW A;  3APO A;  2DJJ A;  3ZLP A;  2H74 A;  2YV7 A;  4Q5N A;  4XIH A;  4KH7 A;  1OC3 A;  5IO2 A;  1LBK A;  2RLI A;  4CY6 A;  2R6K A;  5ABR A;  2GQL A;  3MAK A;  5FWG A;  2H71 A;  4CW9 A;  3TRX A;  3L9U A;  2K18 A;  1Z5Y E;  4O92 A;  2YZU A;  2H73 A;  4EF0 A;  1T3B A;  1H75 A;  3GNJ A;  4L8E A;  3HJP A;  4XS1 A;  5IMD A;  5A4U A;  3F3R A;  1YF1 A;  4CDO A;  5DAL A;  1EGR A;  1A0R P;  4YQU A;  2A2S A;  2E7P A;  4HUA A;  3KP9 A;  1KNG A;  4YKG A;  5EPF A;  1O73 A;  3DVW A;  2DIZ A;  3TB2 A;  1FHE A;  4MJA A;  3MYD A;  1TRV A;  3WT1 A;  3F9U A;  4O5R A;  3KM6 A;  5G31 A;  4FIW A;  5J5N A;  4QL9 A;  2ZUP A;  4YKF A;  2PWJ A;  1O6J A;  2DJK A;  1AXD A;  1O8W A;  4POK A;  2I1U A;  5CRH A;  3HDC A;  1YQ1 A;  1X9M B;  1HQO A;  2YP6 A;  1GNE A;  4IVF A;  1GNW A;  1YEX A;  2JL4 A;  5ECL B;  4HSC X;  1TTZ A;  5B6M A;  1SK2 A;  2LQQ A;  4FYC A;  4DVC A;  1XW9 A;  2JSZ A;  4OO4 A;  4FH8 A;  2DKH A;  3UVT A;  5A5K A;  3HD5 A;  2F8F A;  3TOU A;  5LCZ A;  3LXZ A;  5IMF A;  2H66 A;  3C73 A;  3HHV A;  4EDY A;  2LS5 A;  3DEX A;  3L9S A;  4Z2R A;  2G0F A;  2JAD A;  1W4V A;  3RBT A;  2AV4 A;  2GGT A;  5ECH B;  3EWL A;  4BVX A;  5D8I A;  1B4Q A;  3DVX A;  2X8G A;  1T4Y A;  1PN0 A;  3W8J A;  1U6T A;  2CX4 A;  2XPE A;  1OC9 B;  3KTL A;  1V2A A;  5E59 A;  2WB9 A;  2B3S A;  4ZL8 A;  1FB6 A;  2L6C A;  3TJK A;  4D73 A;  1M2A A;  5L71 A;  2G2Q A;  3PIN A;  3ZYW A;  1XOB A;  4ML1 A;  1U3I A;  2HYX A;  4WEY A;  1DE1 A;  2LKU A;  3ERF A;  3QOU A;  3UJ1 A;  2H70 A;  2H1A A;  2WDU A;  1EOH A;  2IFQ A;  3VPQ A;  1Z9H A;  1AUC A;  2VCW A;  1BX9 A;  3KJY A;  1RK4 A;  1TP9 A;  3IRA A;  2GZP A;  3ZFB A;  3C1S A;  4ECC A;  2YJH A;  4KGI A;  1K3L A;  1EP7 A;  2YN1 A;  1ZYP A;  1EEJ A;  4KW6 A;  4KUN A;  1YJ6 A;  1GTU A;  3GKN A;  1GSY A;  3EU3 A;  2IMI A;  2MBT A;  5JCU A;  1GUL A;  2C80 A;  3G7J A;  4OCF A;  2FHE A;  2JSY A;  1R4W A;  2FWG A;  2UZ8 A;  3E9J B;  1SL1 B;  6GST A;  1USB A;  1M0U A;  3SWL A;  1FG4 A;  2B5X A;  3TJB A;  4GRF A;  2K6V A;  1O81 A;  9GSS A;  3LQ7 A;  2DSA A;  4EXJ A;  3GL3 A;  3LFL A;  2LV3 A;  1V9W A;  5B6N A;  4JZQ A;  5KN3 A;  4RQR A;  2QA2 A;  1XVW A;  1SEN A;  1TI1 A;  5D73 A;  1I5G A;  3FZA A;  3QPM A;  2H0G A;  3QMX A;  2AYT A;  2HZF A;  4NHW A;  4MF5 A;  3O76 A;  2REM A;  3KIJ A;  1DBY A;  5D9W A;  3I9V 2;  1XW5 A;  5G1K A;  2R3X A;  3E0U A;  3TKS E;  3GST A;  2P5Q A;  3MIX A;  2HSM A;  2H76 A;  5A4V A;  3DIE A;  2H1G A;  4ECB A;  5F0G A;  1OVN A;  3ZRE A;  1AC1 A;  4XHM A;  5EVO A;  4MLY A;  1OE7 A;  3HCZ A;  2OAD A;  4ULX A;  2JU5 A;  5JCG A;  2HT9 A;  4MJB A;  4AJ8 A;  1YDK A;  2CVK A;  2AAW A;  5G2Z A;  1YEP A;  1GSS A;  3ME7 A;  2HI7 A;  3EVI A;  1B8X A;  1OYJ A;  1MD3 A;  4YAV A;  3TJG A;  4E8E A;  5CRG A;  4ZB8 A;  2A4V A;  2N5F A;  4ZIL A;  2EIR A;  3CSI A;  4X4J A;  3A2X A;  3EYT A;  4ZL7 A;  3Q18 A;  3EPT A;  5LD0 A;  5IMA A; 
#chains in the Genus database with same CATH homology
 4MZC A;  4PX1 A;  2VO4 A;  1XXU A;  1C72 A;  2FLS A;  3IR4 A;  3HZ8 A;  1MD4 A;  2LTK A;  1F2E A;  2CX3 A;  2QGV A;  4K7O A;  1I9D A;  4GF0 A;  5DJM A;  4GST A;  2NDO A;  3P7X A;  2FGX A;  4MA9 A;  3IPZ A;  2TRC P;  1XVQ A;  4ZIJ A;  5LNK e;  2GQM A;  2LRN A;  1BAY A;  2OE3 A;  2GVP A;  2B1K A;  3F6D A;  2HE3 A;  5B7C A;  3FZ4 A;  6GSS A;  3EMX A;  22GS A;  1JLW A;  4PUA A;  3KP8 A;  3HYP A;  2HXK A;  3FKF A;  1S3C A;  5HFK A;  4IQA A;  1E2Y A;  2C8U A;  4OO5 A;  3MWH A;  3IXR A;  3ZMK A;  4HOJ A;  3L9V A;  3QFB C;  4IJ3 A;  1JZW A;  3PGT A;  2ZNM A;  3GUS A;  3GMF A;  2M46 A;  2DJ3 A;  4MP4 A;  5GZZ B;  4ZBD A;  3EC3 A;  1TXX A;  3GX8 A;  1ZCP A;  3RAZ A;  4WXT A;  4TR4 A;  2LQO A;  5DCH A;  6GSU A;  3O6T A;  4POL A;  4G0I A;  4NWY A;  3IC4 A;  2LEG A;  2H1B A;  1PRX A;  4Q5R A;  5ECP B;  3QAV A;  1AQV A;  4ML6 A;  2YWI A;  3QDN A;  4IGJ A;  2IMK A;  5JCW A;  5H5R A;  2DBC A;  5IO0 A;  3VI7 A;  3G7Y A;  1DE2 A;  2WJU A;  2NVL A;  2NTO A;  1A8Y A;  1K0M A;  4K0N A;  4J56 E;  5KOW A;  1SD9 A;  2GS3 A;  3KCM A;  5IMZ A;  1GL8 A;  2CQ9 A;  5CNW A;  1PSQ A;  1VGL A;  4GSS A;  5E4W A;  4BPY A;  5BRT A;  2CT6 A;  2XHF A;  1F3B A;  3IHQ A;  5HR0 A;  2L4Q A;  1UC7 A;  1GSQ A;  5CRE A;  3CRU A;  1XBS A;  2VL2 A;  1V58 A;  2RUF A;  4KA0 A;  3GTU B;  17GS A;  4HZ2 A;  2H6Z A;  2OKA A;  4NV5 A;  1R5P A;  1GP1 A;  4TXO A;  4YQV A;  4WF4 A;  4ISD A;  1S3A A;  3IE3 A;  4OFM A;  2IMD A;  2GT5 A;  2XPD A;  1TRW A;  1JZR A;  4OFN A;  4XS4 A;  2CVB A;  3VUR A;  3HJM A;  1ML6 A;  1VRS D;  2HNL A;  3KTB A;  1EWX A;  4F0B A;  4EO3 A;  1UN2 A;  5INY A;  2O85 A;  1B9X C;  5CRD A;  2H8L A;  3DML A;  1VF4 A;  3PPU A;  4GQC A;  1SKS B;  3H1N A;  4ID0 A;  4ZBB A;  2I9H A;  4NMU A;  4PUF C;  4EKZ A;  1GWC A;  4EL1 A;  3FW2 A;  2OJL A;  1GH2 A;  3F4S A;  5GSS A;  1LU4 A;  3IAM 2;  2FA4 A;  3L4N A;  3EMP A;  4RUV A;  1EV4 A;  2YPM A;  3W8S A;  1TDI A;  1F3A A;  2WRT A;  4NXI A;  1A2M A;  1VF2 A;  4DSR A;  3CTG A;  1XWC A;  2FWF A;  3BCI A;  2M72 A;  1T4Z A;  4N30 A;  1GSF A;  3IA1 A;  5FHI A;  4AF2 A;  4G19 A;  4YH2 A;  4BWS A;  1W89 A;  1VF3 A;  1EV9 A;  4IHU A;  1SK0 A;  4GQF A;  2LJA A;  1F6M C;  1AW9 A;  2QC7 A;  1TI3 A;  3BJ5 A;  3UVH A;  3FK8 A;  3DGQ A;  1GUK A;  3GKK A;  3PH9 A;  3FEU A;  1EOG A;  1MTC A;  1GSE A;  3ZIJ A;  4KCA A;  1U3A A;  2JZR A;  5ELA A;  1ZZY A;  3E3E A;  3D22 A;  2HSH A;  1F9M A;  12GS A;  3EIN A;  2HRN A;  4K7N A;  2HRA A;  1GUM A;  5IMC A;  3VK9 A;  4K7I A;  3WGD A;  1GTB A;  1EZK A;  4LA1 A;  3LYK A;  3QD9 A;  1ZMA A;  1TU8 A;  2VL9 A;  2C0F A;  4FO5 A;  4AJ6 A;  1ERT A;  3IK7 A;  3Q6O A;  1T1V A;  1PMT A;  4KSO A;  1G6Y A;  4K1F A;  1S3D A;  2IMF A;  2BMX A;  3GTU A;  1N8J A;  3ZFL A;  1OE8 A;  2TIR A;  1SK1 A;  1TRS A;  4PNF A;  4Z2T A;  1M9A A;  2YWM A;  1PA3 A;  5IPH A;  2IN3 A;  2PBJ A;  2OAC A;  4I5Q A;  3R3E A;  1KBN A;  1WIK A;  3IV4 A;  2GSS A;  3F4T A;  3U5R E;  1Y6E A;  2PU9 C;  1QMV A;  3I43 A;  1Q98 A;  1GTI A;  1WJK A;  4BL7 B;  4J2F A;  3TRQ A;  3ZML A;  4HDE A;  1SU9 A;  3DD3 A;  3LWA A;  4ACS A;  1PQN A;  2P31 A;  2H0H A;  2AJQ B;  2KLX A;  3TKS C;  2VCZ A;  3S9F A;  5DAK A;  1FAA A;  1NHO A;  1E6B A;  4ZB6 A;  2CZ2 A;  2V2G A;  1J9B A;  3GV1 A;  1CQH A;  2VLU A;  4TR1 A;  2C1Y A;  2OBK A;  2R0G A;  2DML A;  2HFD A;  1QXH A;  5F05 A;  1EEM A;  3EE2 A;  4JR4 A;  3FMW A;  1PL2 A;  4EE0 A;  1IYH A;  3UBK A;  4KSM A;  5CAX A;  1ZL9 A;  1VF1 A;  2VL3 A;  3G9B A;  5F8B A;  2E2G A;  2X4A A;  1TU7 A;  3ZRD A;  1GSU A;  3L0H A;  4KCE A;  5H5S A;  5J4U A;  1Z7R A;  2CAI A;  1R26 A;  3GL5 A;  3GA4 A;  5ENU A;  2FY6 A;  4N0V A;  2LST A;  3HJO A;  4HS1 A;  1R5A A;  3F0I A;  4MPF A;  2H75 A;  4TXV A;  1V57 A;  13GS A;  1ERU A;  3C71 A;  1JZO A;  2GT6 A;  1ZYQ B;  5AN1 A;  5IOW A;  1YF0 A;  2VCT A;  1M9B A;  3CRT A;  4GTU A;  2AUV A;  3CSJ A;  2PPT A;  3MNG A;  4MZB A;  2J23 A;  3KEB A;  2JZS A;  4K2X A;  3QAW A;  2FNO A;  1KEB A;  2PN8 A;  1ERW A;  4JED A;  2DJ0 A;  4TVE A;  2X99 A;  3J7Y k;  4ILF A;  3D4M A;  2C3Q A;  3HZ4 A;  3GIX A;  2MMO A;  2WFC A;  4HI7 A;  3C8E A;  1SJ6 A;  4NHZ A;  5G5E A;  4TRX A;  2YWN A;  1N2A A;  5D9V A;  3UEM A;  3RHB A;  2LRC A;  2H01 A;  1Z3E A;  3KMN A;  4RI7 A;  4HJM A;  2GSR A;  5J9B A;  2L59 A;  4BL7 A;  2V6O A;  4MAB A;  3LOR A;  1FO5 A;  1XZO A;  4KF9 A;  3LW9 A;  1X9S B;  3KH7 A;  5EL8 A;  3AY8 A;  4MK3 A;  1TK0 B;  4LLR A;  1K3O A;  5JWR B;  4Z7X A;  2E0Q A;  3IHG A;  4X1U A;  3A5W A;  2HRF A;  4AJ7 A;  1NHY A;  1OC9 A;  1J08 A;  1ST9 A;  5DVB A;  3TJF A;  1GSD A;  3IBH A;  4WBJ A;  1XCC A;  1YY7 A;  5J41 A;  1PKW A;  2HRK A;  5B8A A;  3F3Q A;  2R37 A;  1K0O A;  5G5F A;  1XWG A;  2V6K A;  3M3M A;  4X0X A;  3CTF A;  4A5P A;  2PVQ A;  4V2M A;  1AQX A;  2PGT A;  2ON5 A;  1XWA A;  2GZZ A;  3TJJ A;  2V1M A;  4F0C A;  2H72 A;  3LSZ A;  4G0K A;  3BOA A;  2DIY A;  2VCQ A;  4OMV A;  4TR3 A;  4K9Z A;  19GS A;  2AB6 A;  1OKT A;  3KZQ A;  4KDY A;  4V1A g;  5A4W A;  2MBS A;  5CO3 A;  1G7E A;  1HNA A;  3WGX A;  1ZYN A;  1F37 A;  4FYB A;  3R2Q A;  5IMV A;  2YAN A;  1NSW A;  4F2I A;  4DSS B;  4HEA 2;  2EIO A;  4KE3 A;  2PER A;  4POB A;  4O7H A;  4GXZ A;  4HQZ A;  1BYE A;  3ERG A;  5IOX A;  2L6D A;  3ZL5 A;  5GAN D;  5HR3 A;  1M99 A;  2N5A A;  1B4P A;  4PXO A;  4IN0 A;  4G10 A;  1A2J A;  3WT2 A;  4EIP A;  1PX6 A;  3M0F A;  4CHS A;  1HNC A;  2VLT A;  1Z7P A;  1Z6M A;  1FVJ A;  2HLS A;  2HZE B;  2I81 A;  4L5L A;  4FQU A;  4MZW A;  1FOV A;  5D9X A;  2GLR A;  3GHA A;  4G2E A;  1MDJ A;  1MEK A;  3WD6 A;  2DJ2 A;  5F07 A;  5ECM B;  3CYN A;  4MH3 A;  1X5C A;  2OA7 A;  2FCH A;  1M7T A;  1TOF A;  5G30 A;  3GH6 A;  4I97 A;  1EGO A;  4OD7 A;  4MJE A;  2N5B A;  3NIV A;  3QAG A;  2KOK A;  3H93 A;  4TR0 A;  1SJZ A;  3RPP A;  4G9H A;  18GS A;  2YWO A;  2IJY A;  2IPA A;  3MSZ A;  2L57 A;  3C7M A;  4K2D A;  4K0G A;  4V2L A;  2GDR A;  1SKR B;  1WP0 A;  4N0Z A;  3TUE A;  2VLV A;  4Z2U A;  3HVX A;  2GQK A;  3HY2 A;  3RPN A;  1ERV A;  4F03 A;  4G0L A;  1U88 A;  2ZCT A;  4PQH A;  1PL1 A;  2Z9S A;  3LEF A;  4I8B A;  4LL1 B;  2PVO C;  1MDK A;  3BCK A;  4K8M A;  2VD0 A;  4JU5 A;  3GSS A;  3FR9 A;  3ZTL A;  6GSY A;  1BG5 A;  1AQW A;  5DBQ A;  1DSB A;  4EUY A;  1J0F A;  1O7U A;  2HSY A;  3UBL A;  3NOF A;  3VPT A;  4Q5F A;  3FHK A;  3PR8 A;  4PQ1 A;  4PUR A;  3FZ9 A;  5D96 A;  4EVM A;  3M9K A;  2R0P A;  4ZXG A;  2C3T A;  3M1G A;  3GX0 A;  1JLV A;  3F4R A;  3H4K A;  4BVY B;  5KEJ A;  5IPG A;  4PGT A;  1B48 A;  4OFT A;  1QUW A;  14GS A;  1BED A;  4HQS A;  2WS2 A;  1XPV A;  1PKZ A;  2CA8 A;  3H79 A;  5ECS A;  2WCI A;  4MF6 A;  2IME A;  2LUS A;  2K9F A;  2C0E A;  2MYG A;  2HZE A;  4MF7 A;  4IKH A;  6GSV A;  4AGS A;  4K5R A;  4XCS A;  1T00 A;  2VUP A;  3D6I A;  5DQY A;  1FW1 A;  3V1W A;  4BWQ A;  3CBU A;  2AHE A;  2H1D A;  4BVX B;  4I6X A;  4O5Q A;  1TRU A;  5HFI A;  8GSS A;  2PMT A;  4KND A;  1X5E A;  2CVD A;  1O8X A;  2YCD A;  4IEL A;  4MJC A;  2VL2 C;  3GRX A;  2NPB A;  2MZC A;  3VWW A;  3NZN A;  1K0D A;  4D73 B;  2KUC A;  2C0G A;  1TKD B;  2ON7 A;  2IWT A;  4GSN A;  3O3T A;  3P8W A;  2KHP A;  3Q74 A;  2NBS A;  4N10 A;  5H5Q A;  4KX4 A;  2EC4 A;  3Q19 A;  1ILO A;  3IOS A;  4LMV A;  3ZVJ D;  3LJR A;  1K3Y A;  1ON4 A;  2IFQ B;  4KDU A;  2RM5 A;  5AGY A;  2DC5 A;  1H4O A;  2DLX A;  2O7K A;  1Y25 A;  4PNG A;  2TRX A;  1UVZ A;  3TKP A;  1FVK A;  5ECI B;  3N9J A;  1ZGN A;  3TKS A;  4DSQ A;  2VOC A;  3VWU A;  20GS A;  5IM9 A;  4K6X A;  4MH2 A;  4IS0 A;  2GZY A;  2H6X A;  16GS A;  2P0G A;  2F51 A;  1A0F A;  4OCE A;  5GAP D;  2B6M A;  2YZH A;  2XBQ A;  1FOH A;  1XIY A;  1T7P B;  1YZX A;  4GLT A;  1OC8 A;  1THX A;  5JWQ B;  2KP1 A;  1TK5 B;  2R5G A;  1O85 A;  4IP6 A;  1QQ2 A;  1ZYE A;  2OBI A;  1XOA A;  1PX7 A;  4BVY A;  2B1L A;  2I4A A;  2C4J A;  3UAP A;  4JE1 A;  1XWB A;  5AIS A;  4F9Z A;  1NM3 A;  4NPB A;  2X8C A;  5BMU A;  2YJ7 A;  5GST A;  4L0W A;  5ELG A;  2A2R A;  1JFU A;  3DYR A;  6GSX A;  2QKE A;  4MCU A;  4EIQ A;  3VWX A;  1A23 A;  4EC0 A;  4GWR A;  2BJX A;  2RM6 A;  4V1A p;  3SBC A;  3HA9 A;  3GN3 A;  1WRY A;  1FB0 A;  3ISO A;  4BA7 A;  4ECI A;  1SD8 A;  2K8S A;  2DKI A;  4TOP A;  2JZT A;  4RI6 A;  1G6W A;  1GUH A;  5HFG A;  1WE0 A;  3GUR A;  6GSW A;  5ID2 B;  3FR6 A;  2A2P A;  2VIM A;  3ED3 A;  4ZBA A;  2FWH A;  4WR4 A;  3TGZ A;  4POM A;  3HVS A;  5G1L A;  2QA1 A;  4MDC A;  4QQ7 A;  3BD2 A;  3TDG A;  3ZIT A;  1CQG A;  1OKD A;  1SL2 B;  4WET A;  4JBB A;  1BQ7 A;  4O5U A;  1YKC A;  1SJI A;  1WOU A;  1PD2 1;  2C3N A;  3J7Y b;  2LJK A;  4RQX A;  5KN0 A;  2LJR A;  3TRP A;  3I69 A;  1GLP A;  1PN9 A;  4FYU A;  3F63 A;  1WMJ A;  1PGT A;  3GYK A;  1K0C A;  5D9T A;  1K0B A;  2I3Y A;  5HR1 A;  2B7J A;  2F9S A;  2LNS A;  2R2J A;  3TKR A;  3LYP A;  4PQI A;  4NV2 A;  3D4T A;  4MNN A;  3P2A A;  1QFN A;  1X9W B;  1THO A;  2B7K A;  2VM1 A;  1DUG A;  4F82 A;  4USS A;  3L78 A;  2R0C A;  2YOI A;  1QK8 A;  4N11 A;  3VLN A;  2JAC A;  3HXS A;  3KD0 A;  5C00 A;  2RII A;  4J57 E;  4JR6 A;  4DEJ A;  4ECJ A;  3GKX A;  3OR5 A;  2XC2 A;  4P3Y B;  2V32 A;  3FZ5 A;  3ZIV A;  1TJD A;  5C04 A;  4LL4 B;  5KN2 A;  4L0U A;  4HU9 A;  2B5E A;  1X5D A;  2LNT A;  1ACV A;  3LG6 A;  1K0A A;  2A4H A;  1GRX A;  3JCM L;  3A3T A;  3HKR A;  3UMA A;  4K5S A;  2MMA A;  3DKS A;  5DDL A;  2ES7 A;  1AAZ A;  1QGV A;  2PUK C;  1YKA A;  4TN8 A;  5ECQ B;  4Q5Q A;  4TW5 A;  4CY8 A;  3BBY A;  5ID2 A;  3IK9 A;  3ERW A;  4IJI A;  5D93 A;  1V98 A;  1XWK A;  4WKW A;  3GFK A;  3DRN A;  5IQY A;  1ABA A;  2CAQ A;  4LMW A;  3IDV A;  3TKQ A;  4I2U A;  1MDI A;  2X8H A;  2H0I A;  3EU4 A;  3KMO A;  1K0N A;  2WZ9 A;  1RW1 A;  2VCV A;  3GH9 A;  3QCP A;  4EDZ A;  2EIQ A;  4KDX A;  2LRT A;  2ALB A;  3D0Z A;  3D5J A;  5ECO B;  4WF5 A;  4ZL9 A;  3KXO A;  4ZB9 A;  1HYU A;  4X43 A;  3IAS 2;  5JWO B;  4V2N A;  4IW9 A;  5J9C A;  2FD3 A;  2VCX A;  3RDW A;  4E8H A;  2GSQ A;  3FRC A;  2K8V A;  3ZVJ A;  3EUR A;  4WR5 A;  1SYX A;  4GCI A;  3TCO A;  4KB3 A;  1KTE A;  5AIV A;  3M9J A;  1M2D A;  3F8U A;  5B8B A;  1URM A;  4XS6 A;  4TXO B;  3VFI A;  3A2W A;  3QR6 A;  7GSS A;  2H30 A;  2QSI A;  3IC8 A;  3UL3 A;  1WPI A;  1V40 A;  2O87 A;  2X64 A;  3K8N A;  3LGC A;  5CRW A;  1TK8 B;  4MPG A;  3RHC A;  2FWE A;  4XS4 B;  2F8A A;  2CV4 A;  1B9Y C;  2L5O A;  5F06 A;  5CP1 A;  2KP2 A;  1Z6N A;  5ECK B;  3UAR A;  1BJX A;  4XRD A;  2M80 A;  2VAF A;  3FY7 A;  1A24 A;  1T8E B;  3H8Q A;  1SKW B;  3GKM A;  1Q4J A;  1SYR A;  4NAX A;  5AIX A;  5ECN B;  3VWV A;  3FYG A;  3I6A A;  1LJR A;  3M8N A;  1IYI A;  3CMI A;  1SL0 B;  2YNX A;  3FR3 A;  2GST A;  1A2L A;  1M2B A;  3D21 A;  2GTU A;  2MMN A;  2YV9 A;  3CSH A;  5HR2 A;  1G0T A;  4YQM A;  3CXG A;  4QL7 A;  1JZD A;  4TKY A;  2VD1 A;  5FT3 A;  3ZZX A;  3MDK A;  2D2Z A;  3A2V A;  3F6F A;  1RQM A;  4XRA A;  5ECR B;  1R7H A;  2VM2 A;  2H6Y A;  4HZ4 A;  5EY6 A;  2P5R A;  1TW9 A;  5J3R A;  3ME8 A;  2OE1 A;  4I2T A;  2CZ3 A;  4HJ2 A;  4XTS A;  1A8L A;  2BTO T;  2J9H A;  5CYY A;  3P90 A;  4JRR A;  4KAE A;  4HU7 A;  5DAL B;  2RUE A;  4H86 A;  2X49 A;  3G7I A;  1NW2 A;  10GS A;  2R4V A;  3US3 A;  2FUG 2;  4WBR D;  2XBI A;  3C1R A;  3DWV A;  4ICY A;  2FA8 A;  1WWJ A;  2B5Y A;  3KH9 A;  3QFA C;  5IIZ A;  2OE0 A;  2F3M A;  2IIY A;  3U6V A;  3UIW A;  3APS A;  3UOM A;  3LXT A;  2IL3 A;  1X0R A;  1XFL A;  5HQP A;  5COH A;  4PTS A;  4DSS A;  1HNB A;  1UA5 A;  2L5L A;  2WGR A;  4IP1 A;  1EP8 A;  1XW6 A;  2MMZ A;  1U87 A;  5DCG A;  3APQ A;  5DJL A;  3TOT A;  2O8V B;  11GS A;  2DMM A;  3W6G A;  1GTA A;  1HD2 A;  3VI5 A;  1JHB A;  2H19 A;  3DXB A;  3A5I A;  4O32 A;  1ZOF A;  5KN1 A;  2C0D A;  2WUL A;  3N5O A;  4MMM A;  5KOX A;  4OWY A;  5DQS A;  4IBP A;  1GLQ A;  5DAK B;  2DJ1 A;  1AIU A;  2V41 A;  2O89 A;  1G7O A;  3KGK A;  4L5O A;  4TR1 B;  2L4C A;  3WGE A;  3HVV A;  4IQ1 A;  1OAZ A;  2E2M A;  4YAP A;  3WYW A;  3APO A;  2DJJ A;  3ZLP A;  2H74 A;  2YV7 A;  4Q5N A;  4XIH A;  4KH7 A;  1OC3 A;  5IO2 A;  1LBK A;  2RLI A;  4CY6 A;  2R6K A;  5ABR A;  2GQL A;  3MAK A;  5FWG A;  2H71 A;  4CW9 A;  3TRX A;  3L9U A;  2K18 A;  1Z5Y E;  4O92 A;  2YZU A;  2H73 A;  4EF0 A;  1T3B A;  1H75 A;  3GNJ A;  4L8E A;  3HJP A;  4XS1 A;  5IMD A;  5A4U A;  3F3R A;  1YF1 A;  4CDO A;  5DAL A;  1EGR A;  1A0R P;  4YQU A;  2A2S A;  2E7P A;  4HUA A;  3KP9 A;  1KNG A;  4YKG A;  5EPF A;  1O73 A;  3DVW A;  2DIZ A;  3TB2 A;  1FHE A;  4MJA A;  3MYD A;  1TRV A;  3WT1 A;  3F9U A;  4O5R A;  3KM6 A;  5G31 A;  4FIW A;  5J5N A;  4QL9 A;  2ZUP A;  4YKF A;  2PWJ A;  1O6J A;  2DJK A;  1AXD A;  1O8W A;  4POK A;  2I1U A;  5CRH A;  3HDC A;  1YQ1 A;  1X9M B;  1HQO A;  2YP6 A;  1GNE A;  4IVF A;  1GNW A;  1YEX A;  2JL4 A;  5ECL B;  1TTZ A;  5B6M A;  1SK2 A;  2LQQ A;  4FYC A;  4DVC A;  1XW9 A;  2JSZ A;  4OO4 A;  4FH8 A;  2DKH A;  3UVT A;  5A5K A;  3HD5 A;  2F8F A;  3TOU A;  5LCZ A;  3LXZ A;  5IMF A;  2H66 A;  3C73 A;  3HHV A;  4EDY A;  2LS5 A;  3DEX A;  3L9S A;  4Z2R A;  2G0F A;  2JAD A;  1W4V A;  3RBT A;  2AV4 A;  2GGT A;  5ECH B;  3EWL A;  4BVX A;  5D8I A;  1B4Q A;  3DVX A;  2X8G A;  1T4Y A;  1PN0 A;  3W8J A;  1U6T A;  2CX4 A;  2XPE A;  1OC9 B;  3KTL A;  1V2A A;  5E59 A;  2WB9 A;  2B3S A;  4ZL8 A;  1FB6 A;  2L6C A;  3TJK A;  4D73 A;  1M2A A;  5L71 A;  2G2Q A;  3PIN A;  3ZYW A;  1XOB A;  4ML1 A;  1U3I A;  2HYX A;  4WEY A;  1DE1 A;  2LKU A;  3ERF A;  3QOU A;  3UJ1 A;  2H70 A;  2H1A A;  2WDU A;  1EOH A;  2IFQ A;  3VPQ A;  1Z9H A;  1AUC A;  2VCW A;  1BX9 A;  3KJY A;  1RK4 A;  1TP9 A;  3IRA A;  2GZP A;  3ZFB A;  3C1S A;  4ECC A;  2YJH A;  4KGI A;  1K3L A;  1EP7 A;  2YN1 A;  1ZYP A;  1EEJ A;  4KW6 A;  4KUN A;  1YJ6 A;  1GTU A;  3GKN A;  1GSY A;  3EU3 A;  2IMI A;  2MBT A;  5JCU A;  1GUL A;  2C80 A;  3G7J A;  4OCF A;  2FHE A;  2JSY A;  1R4W A;  2FWG A;  2UZ8 A;  3E9J B;  1SL1 B;  6GST A;  1USB A;  1M0U A;  3SWL A;  1FG4 A;  2B5X A;  3TJB A;  4GRF A;  2K6V A;  1O81 A;  9GSS A;  3LQ7 A;  2DSA A;  4EXJ A;  3GL3 A;  3LFL A;  2LV3 A;  1V9W A;  5B6N A;  4JZQ A;  5KN3 A;  4RQR A;  2QA2 A;  1XVW A;  1SEN A;  1TI1 A;  5D73 A;  1I5G A;  3FZA A;  3QPM A;  2H0G A;  3QMX A;  2AYT A;  2HZF A;  4NHW A;  4MF5 A;  3O76 A;  2REM A;  3KIJ A;  1DBY A;  5D9W A;  3I9V 2;  1XW5 A;  5G1K A;  2R3X A;  3E0U A;  3TKS E;  3GST A;  2P5Q A;  3MIX A;  2HSM A;  2H76 A;  5A4V A;  3DIE A;  2H1G A;  4ECB A;  5F0G A;  1OVN A;  3ZRE A;  1AC1 A;  4XHM A;  5EVO A;  4MLY A;  1OE7 A;  3HCZ A;  2OAD A;  4ULX A;  2JU5 A;  5JCG A;  2HT9 A;  4MJB A;  4AJ8 A;  1YDK A;  2CVK A;  2AAW A;  5G2Z A;  1YEP A;  1GSS A;  3ME7 A;  2HI7 A;  3EVI A;  1B8X A;  1OYJ A;  1MD3 A;  4YAV A;  3TJG A;  4E8E A;  5CRG A;  4ZB8 A;  2A4V A;  2N5F A;  4ZIL A;  2EIR A;  3CSI A;  4X4J A;  3A2X A;  3EYT A;  4ZL7 A;  3Q18 A;  3EPT A;  5LD0 A;  5IMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...