3DMLA

Crystal structure of the periplasmic thioredoxin soxs from paracoccus pantotrophus (reduced form)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
ELRLLMFEQPGCLYCARWDAEIAPQYPLTDEGRAAPVQRLQMRDPLPPGLELARPVTFTPTFVLMAGDVESGRLEGYPGEDFFWPMLARLIGQAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the periplasmic thioredoxin SoxS from Paracoccus pantotrophus indicates a dual Trx/Grx functionality for activation of chemotrophic sulfur oxidation in vivo
rcsb
molecule keywords Putative uncharacterized protein
molecule tags Oxidoreductase
source organism Paracoccus denitrificans
total genus 22
structure length 95
sequence length 95
ec nomenclature ec 1.8.4.-:
pdb deposition date 2008-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dmlA00
3HJPA 1VGLA 1ON4A 5ABRA 4TR3A 1EV9A 2IL3A 3HVSA 5DAKA 5G30A 2L4QA 5F05A 4HS1A 2DMLA 3VI5A 1WE0A 2FWEA 1ZYEA 1Z6MA 5DJLA 4OMVA 3TOTA 1GNWA 2H0GA 5DCGA 4KX4A 2P31A 1OVNA 4PX1A 1EOHA 4NV5A 5DVBA 3EC3A 3H93A 1T8EB 4HU7A 1V9WA 2E0QA 4IBPA 1GNEA 5ECPB 3P8WA 3PGTA 6GSVA 2E7PA 2OBKA 3LG6A 3H4KA 4YAVA 3FY7A 4LMVA 3LXZA 2NBSA 4PQ1A 1WJKA 4HDEA 5HR3A 1ILOA 3IA1A 5J41A 2P0GA 3TJGA 2FD3A 5JWRB 2PU9C 2HZFA 4POBA 3QMXA 4POLA 2R5GA 3W8SA 2MMZA 3UARA 3CYNA 2KP2A 1YKAA 2PPTA 3NIVA 1T7PB 2B7JA 2CT6A 5DCHA 3QAWA 4MABA 2X8CA 1EGRA 4G9HA 1XWCA 4J57E 1O8WA 1XOAA 5CYYA 3D4TA 1ERWA 1F3AA 4WETA 4F03A 3GRXA 2G2QA 3JCML 2YZHA 3A2WA 4JBBA 4MH2A 6GSYA 1GLPA 2GSRA 4XS6A 2C0FA 3EVIA 2I1UA 2H75A 3FEUA 1GWCA 2CAQA 3EE2A 1SJIA 4YQMA 5ECLB 1KNGA 4AGSA 5AIXA 5LCZA 1X9WB 4XHMA 1R5AA 3GL3A 1OE7A 1PL1A 3DVWA 2YWIA 1PL2A 2H1BA 5A4WA 1K0BA 2PVOC 5D9TA 5LD0A 3VLNA 4TW5A 1ZYQB 4WF4A 2NDOA 1IYIA 2H72A 3UAPA 4ULXA 2DSAA 2LTKA 4JU5A 2H6XA 2E2MA 1H4OA 4KSMA 1VF4A 2LRNA 4IP6A 4DEJA 1R5PA 2VCQA 4MJEA 3M9KA 4BA7A 1U88A 2CX4A 4WR5A 1T4ZA 4TR1B 4AJ6A 1M7TA 4MLYA 5A4VA 1A2LA 4MPGA 2EC4A 2H01A 1V57A 1H75A 4KB3A 1GSFA 3C7MA 4XRDA 5FHIA 2JU5A 2HE3A 5ECRB 1XIYA 2I9HA 1B9XC 2B5YA 2K8VA 1O7UA 3WGXA 2VOCA 4ISDA 1HNCA 1YDKA 3QR6A 5ELGA 3HVXA 1LBKA 1WIKA 4HUAA 4LL4B 1K3LA 2VD1A 3DIEA 3LGCA 4PGTA 2VLVA 3GYKA 1TI3A 3EMPA 5IM9A 4K0NA 3DKSA 1SL1B 1F37A 1FB0A 1B4QA 5HR2A 3RHCA 4F2IA 5ECNB 1F3BA 3N9JA 2JADA 3NOFA 4TR1A 5D9XA 2H19A 2YWMA 2FLSA 5G31A 3BCKA 2YOIA 3TJBA 2GZZA 3VWVA 3EYTA 4FYBA 2PN8A 2DLXA 2IN3A 4LLRA 1SJ6A 3US3A 4MMMA 5AIVA 3ED3A 3BCIA 1TOFA 2FNOA 1ZCPA 5DALA 1GUKA 4HZ4A 1XXUA 5B6NA 11GSA 5L71A 2B7KA 1Z7PA 4AJ7A 2O85A 2LJAA 4NHWA 2H71A 2OE3A 4K7NA 1U6TA 2H70A 4IN0A 5IQYA 3E0UA 2E2GA 2AV4A 3PH9A 1WOUA 2FHEA 1GSSA 2DJJA 1OC8A 3FYGA 2VCTA 3DRNA 4POMA 2XPDA 1SYXA 4O5RA 2HRFA 1R7HA 2LUSA 5EL8A 3ERWA 1TK0B 4YH2A 20GSA 2DJ0A 2KOKA 4ZBAA 1PRXA 2YWOA 3TGZA 4P3YB 4JZQA 3K8NA 1JZOA 4KDXA 4KAEA 3GKXA 4TR4A 3APSA 1K0DA 3TJFA 4OO4A 1GSQA 4DSSB 2H6YA 2I4AA 4RQXA 5H5QA 5CRWA 2B1KA 5D73A 3LWAA 1B9YC 1MEKA 3C8EA 1M9BA 2H0IA 2CVBA 1I5GA 2AAWA 3TKSA 1YZXA 5EY6A 3FZ9A 1B4PA 3F8UA 1X5CA 4KUNA 3HVVA 2EIQA 3UBKA 2YV7A 3UIWA 1SKWB 5HFGA 3F4TA 1UC7A 4GLTA 4IP1A 4IVFA 1SD9A 2K6VA 2M72A 1E6BA 1SK1A 3WD6A 2IJYA 2EIOA 3GL5A 3P90A 3IRAA 1SL0B 2LRTA 2R3XA 3OR5A 1GLQA 4J56E 4K6XA 2GT5A 5B8AA 1GTAA 3KEBA 2F8AA 1ERTA 3L4NA 1GRXA 2YANA 1EEJA 14GSA 1YEPA 2WZ9A 2N5AA 3M9JA 2LQOA 5AN1A 2LJKA 5HR0A 1A2JA 5HFKA 1K0AA 4EDYA 3Q19A 4PQIA 5INYA 5IMAA 1PD21 3WGDA 2CQ9A 2HT9A 5DQSA 4RQRA 4Q5QA 4HQZA 3D6IA 1GL8A 4X0XA 3HD5A 1T1VA 2GGTA 5COHA 4NAXA 1VRSD 3Q18A 4KW6A 1XVQA 1OC3A 2IIYA 4IGJA 1TU8A 4NXIA 4E8EA 4EKZA 1GUHA 2ZNMA 3MDKA 1FAAA 3LYPA 4OD7A 2GQMA 4L0UA 3MWHA 2OBIA 4NHZA 3NZNA 1OAZA 1SJZA 2YJHA 22GSA 1JFUA 3HZ8A 2R4VA 4WXTA 2V1MA 2HSYA 4MF6A 4IELA 2EIRA 2LS5A 5F07A 2VM2A 1USBA 1DE2A 4K7OA 1AAZA 4NV2A 1SD8A 1GSDA 3G7JA 3EMXA 5J9CA 1XPVA 1HNAA 1YEXA 3QFAC 3GMFA 1N8JA 5KN0A 3DEXA 3TRPA 2LKUA 4GQCA 5CNWA 3KP8A 1SENA 4WF5A 3VWUA 2Z9SA 4OO5A 3V1WA 2OACA 2YV9A 2FWGA 2L4CA 2TIRA 1SK0A 1V98A 5IMDA 12GSA 1OE8A 1EP7A 2PGTA 4FIWA 1GSEA 2C0EA 1X9SB 4MA9A 1AUCA 1R4WA 4KH7A 1O85A 2DBCA 2R37A 5JCGA 1S3CA 4I97A 1JLVA 4QQ7A 5GZZB 4LMWA 4KE3A 1VF1A 3ME8A 2CZ2A 2H6ZA 2M80A 1K0OA 1CQHA 3KMNA 5DQYA 4OFNA 3LXTA 4F82A 2DJ1A 4ZIJA 2LNTA 3WYWA 4V1Ag 2OE0A 2R2JA 1LJRA 3KP9A 5JCWA 1GUMA 1J08A 1SK2A 2FCHA 5IMCA 1KBNA 3UL3A 1SL2B 4PUFC 2L6CA 1W89A 4RI7A 2B1LA 1V58A 4GSNA 2WULA 2C8UA 3FRCA 3WT1A 3CSIA 2CVDA 10GSA 2LV3A 4BWSA 2FWFA 4JE1A 4GWRA 4V2MA 3D21A 4POKA 2DJ3A 4AF2A 3A5WA 2GT6A 2NTOA 5KN1A 2JZSA 5IO2A 5FWGA 3F9UA 1XWAA 2YWNA 4MH3A 1AW9A 4WEYA 3VI7A 2GTUA 4HI7A 4PXOA 2WDUA 3BOAA 1DE1A 5CREA 1EP8A 1A24A 5KEJA 3CMIA 1QMVA 2L5OA 1TXXA 4V2NA 5IPHA 3PINA 5KN3A 3HXSA 5B6MA 19GSA 4MZWA 3W8JA 1G7OA 1U3IA 1WRYA 5ENUA 4PQHA 5B7CA 2JZRA 4FYCA 1BG5A 3ZL5A 5B8BA 2H1AA 4RUVA 2I3YA 3LFLA 3O6TA 5G1LA 3AY8A 2V2GA 1QFNA 2CA8A 3M3MA 1JZRA 1TRVA 1Z6NA 1QUWA 4PUAA 2KLXA 3QPMA 3HJOA 3DMLA 1Z7RA 1G6WA 3CBUA 4JEDA 1KEBA 3VFIA 2GSTA 3MSZA 3ZFBA 3RDWA 3Q74A 5J9BA 4N11A 2O8VB 3TOUA 2VCWA 5ECOB 4OFMA 4HQSA 4ZILA 1X5DA 2D2ZA 3FK8A 4GTUA 5CRDA 2RIIA 1PKWA 2GSSA 4G2EA 2HRNA 5EPFA 2N5FA 2IFQB 4MJAA 5J4UA 4HJMA 2OJLA 2B6MA 1NW2A 1PQNA 4G19A 5G5EA 5DALB 2WS2A 5ECHB 2H73A 1MDKA 5CP1A 3O3TA 3FR3A 3GA4A 1F6MC 2ALBA 1EOGA 1J0FA 4N0VA 2PERA 1FVJA 3HHVA 3UJ1A 3WT2A 3I69A 3ZREA 1BAYA 4TOPA 1ST9A 3CTFA 1R26A 3U6VA 3ZIJA 3IK7A 2C4JA 4MP4A 1TJDA 4I6XA 1E2YA 3F0IA 1JHBA 2G0FA 1MD4A 2JSZA 4WKWA 3GKMA 3TKSE 1GULA 2IFQA 2K18A 2B5XA 2V6OA 1M99A 1IYHA 2ES7A 3TKQA 4EUYA 2O7KA 3C73A 4N0ZA 1AXDA 2A4VA 1XOBA 1TTZA 4CW9A 2VL2A 3CXGA 4IQ1A 6GSUA 2RM5A 3I6AA 3QCPA 2IPAA 3KIJA 1O8XA 3ERGA 4GXZA 1FO5A 2C0DA 2XPEA 4KCEA 3MNGA 1BEDA 4G10A 2ON5A 5G1KA 3F3RA 4D73B 5DDLA 3RPNA 4OWYA 2FUG2 1WWJA 1PX7A 3ISOA 2VL2C 2YPMA 1OYJA 3ZRDA 1WP0A 2HZEB 4ZBBA 1QK8A 2HSHA 5IIZA 5H5RA 4YAPA 2TRCP 2FWHA 13GSA 5AISA 4OFTA 1RW1A 1F9MA 1X9MB 1THOA 2KUCA 2L5LA 5HQPA 2VIMA 5F06A 1TP9A 2AHEA 3IAM2 5C00A 4EVMA 2H66A 2C3QA 2JZTA 1U3AA 1GTBA 4XTSA 3G7YA 1PGTA 4MPFA 3HCZA 1M0UA 3RBTA 3CSHA 3GN3A 2MBSA 3RAZA 3L9UA 5GAPD 4I8BA 5C04A 5IOXA 3VPTA 1ZL9A 4ECJA 1K0NA 1TK5B 4D73A 4MCUA 1MDJA 3TRQA 1ZZYA 2F51A 2NPBA 2V6KA 3GSTA 5H5SA 4IKHA 1O81A 2IMEA 2HZEA 2AUVA 5ECMB 1XW5A 2JSYA 4DSRA 1G0TA 2K8SA 4O7HA 5E4WA 3EINA 4TXOB 3EU4A 4XCSA 3UBLA 3S9FA 1SU9A 5JWOB 2VAFA 1M2BA 2KP1A 5A5KA 3IE3A 2B3SA 3VPQA 2FA8A 5DJMA 8GSSA 5GSSA 3CSJA 1ZMAA 2VUPA 4NWYA 2WGRA 4ZBDA 2FGXA 1FG4A 3L0HA 1Z3EA 3I43A 3U5RE 4O92A 1T3BA 1FHEA 2PVQA 3FR9A 3UVHA 3PR8A 2H8LA 3L78A 1TU7A 3GURA 1BYEA 1GP1A 3VWXA 1O73A 2QKEA 1YY7A 2L57A 3LJRA 2GVPA 1I9DA 1ABAA 3F4RA 1GH2A 1Z9HA 1X5EA 1ZOFA 4ML1A 4TN8A 1XWGA 4V2LA 4PNFA 4LA1A 3SBCA 3IDVA 4TXOA 2JACA 4GSSA 1PKZA 4KNDA 2YN1A 4IS0A 1QGVA 2RM6A 3GX0A 3ERFA 3RHBA 4CDOA 1A2MA 4IJIA 4PURA 3P2AA 4F0CA 1A0RP 2YNXA 2O89A 3DWVA 4XIHA 1NHYA 1GTUA 2B5EA 2IMFA 4BVYA 2PWJA 3A2XA 1OKDA 4NPBA 2MBTA 2VCVA 3TKRA 1W4VA 2WFCA 5JWQB 1TDIA 3ZTLA 2YZUA 4MF7A 1TK8B 4EC0A 4JR4A 5D8IA 2L59A 1THXA 4IQAA 2DC5A 3L9SA 1DUGA 1X0RA 3FZ4A 4O32A 4HU9A 5ECQB 4L5OA 3IV4A 4J2FA 3UVTA 2HXKA 2X8HA 1Q4JA 1F2EA 3VWWA 3EU3A 4ZL7A 1XZOA 2LEGA 2XC2A 1TRSA 1VF3A 6GSSA 2GQLA 3M1GA 1K0CA 4JR6A 1V40A 3ZZXA 2K9FA 5CRGA 4BL7A 3DGQA 4I2UA 3UMAA 1UA5A 3ZIVA 2BJXA 2MZCA 1AQWA 17GSA 2RUFA 2F8FA 3FZ5A 2VL3A 1OC9B 1XBSA 2PMTA 3VK9A 2H74A 1GSUA 4ZB8A 4XS1A 2GZYA 2R6KA 3KMOA 3GV1A 3C1RA 5LNKe 3R2QA 3KM6A 3BD2A 3CTGA 3LQ7A 2H0HA 5IO0A 1QXHA 1Q98A 3IPZA 2WB9A 1B48A 3E3EA 3CRTA 2MYGA 3ZMKA 1RK4A 2OA7A 3IOSA 1YKCA 4KCAA 3IR4A 1JZDA 2P5QA 4ECBA 2DJKA 1CQGA 2DIZA 5D96A 4KDUA 4ECIA 6GSWA 2OADA 1OC9A 4GCIA 5ELAA 2TRXA 3QOUA 3DXBA 5F0GA 1MDIA 1WMJA 5IMVA 2WCIA 1EWXA 3LORA 2A2RA 3IC4A 4Q5RA 3GUSA 3CRUA 1A0FA 2C0GA 4GF0A 2FY6A 5CRHA 2HYXA 4BVXA 4EXJA 1C72A 2PUKC 2X64A 2GSQA 5IMFA 2GS3A 5J3RA 3GFKA 2AB6A 2KHPA 1B8XA 4GRFA 3FKFA 4ZB9A 3Q6OA 4TRXA 1S3AA 1TKDB 2YP6A 4X43A 5G5FA 3GH6A 2LNSA 5GAND 3J7Yb 2VL9A 3LEFA 4Q5NA 3APQA 2LRCA 1PN9A 5GSTA 2H1GA 4ML6A 4EO3A 1XWBA 2O87A 4HEA2 1FVKA 3I9V2 5D93A 4ZXGA 2FA4A 2IMKA 3TJJA 2GLRA 1K3OA 2V32A 3KD0A 1UVZA 3FW2A 1SKRB 1TRUA 4IHUA 1BJXA 4NMUA 3FZAA 1ERUA 1TRWA 4L8EA 2QC7A 4WBJA 4H86A 4K2DA 4K9ZA 2VLTA 1TI1A 3M8NA 1GTIA 3GX8A 3F4SA 3P7XA 4CHSA 4ZL9A 2F9SA 4MDCA 3D5JA 1S3DA 2X99A 3UEMA 4HJ2A 2H30A 1PA3A 3QFBC 3QAVA 3GH9A 3DVXA 2GZPA 3KH7A 1WPIA 1SKSB 4QL9A 2VLUA 1JZWA 4XRAA 1T00A 2C3NA 1KTEA 3KGKA 3ME7A 5CAXA 4FH8A 5ID2B 4BPYA 3TCOA 2RUEA 1AC1A 1MTCA 5HR1A 2ZUPA 1ACVA 3TDGA 3GIXA 3TB2A 4N10A 1EZKA 4X1UA 1PMTA 2LJRA 3KCMA 5ECIB 2X8GA 9GSSA 4QL7A 2H76A 2VO4A 4Z7XA 1GSYA 3A3TA 4HOJA 5A4UA 1XCCA 1U87A 4FO5A 2H1DA 4K0GA 7GSSA 1VF2A 3C71A 5G2ZA 2WJUA 2MMAA 5JCUA 1LU4A 3D22A 3H79A 4TXVA 4E8HA 1XVWA 2L6DA 4XS4B 1K0MA 4DSQA 2YJ7A 1TW9A 3MAKA 2WRTA 3HKRA 2VCZA 1G7EA 1MD3A 1Y6EA 3BJ5A 5IOWA 5CO3A 3LSZA 3HJMA 3DD3A 1NM3A 5ID2A 3GTUB 4K8MA 3GNJA 1XWKA 3L9VA 2RLIA 1SYRA 1G6YA 2CV4A 3KTLA 1FOVA 3GKKA 3WGEA 2IMIA 18GSA 4ECCA 2IWTA 4HZ2A 4YQVA 3HZ4A 1V2AA 1YQ1A 2J9HA 1QQ2A 1OKTA 5HFIA 5DBQA 5IMZA 4Q5FA 2NVLA 5ECSA 1UN2A 1BQ7A 4LL1B 3G9BA 3H8QA 2AJQB 1HD2A 3ZMLA 1YF1A 4WR4A 3HYPA 4XS4A 3HDCA 3FHKA 3APOA 1NHOA 4KGIA 4L0WA 2GQKA 2XBQA 3QD9A 4IW9A 3KJYA 1FB6A 4AJ8A 3GTUA 5AGYA 1M2AA 2OE1A 4KA0A 3ZYWA 1AIUA 1HYUA 4MZBA 3ZITA 2VD0A 3IXRA 3EWLA 5FT3A 2N5BA 4MK3A 4MZCA 3G7IA 4ZL8A 2JL4A 3BBYA 4ZB6A 3TRXA 2HI7A 3RPPA 3TJKA 3KTBA 2HFDA 3KZQA 4OCEA 2C1YA 1YJ6A 4TR0A 4F9ZA 3GHAA 5IPGA 3GSSA 3VURA 2LSTA 4IJ3A 3UOMA 4EL1A 4RI6A 4TVEA 2CX3A 2CAIA 3N5OA 3M0FA 3TKPA 2VM1A 3C1SA 1N2AA 3GKNA 2CVKA 4KDYA 1A8YA 3ZVJA 4KSOA 4L5LA 2C80A 5E59A 3TKSC 3IHQA 1ZGNA 1O6JA 4DSSA 1A8LA 4JRRA 4FYUA 3F3QA 4EE0A 3ZVJD 1RQMA 2DJ2A 2DMMA 2VCXA 1URMA 3KH9A 1AQXA 1PX6A 1EV4A 3D4MA 2GDRA 3DYRA 2XBIA 3FR6A 3ZFLA 1EGOA 4WBRD 4GSTA 4OCFA 1DSBA 1HQOA 4I5QA 2MMOA 1A23A 4GQFA 2QSIA 1ERVA 1XW6A 1J9BA 1T4YA 3D0ZA 3QDNA 2V41A 1Y25A 3QAGA 2AYTA 5D9WA 4MJBA 4V1Ap 3O76A 4ID0A 3F63A 1XFLA 1XW9A 1AQVA 2DIYA 2MMNA 4MJCA 3E9JB 1PSQA 3F6FA 2QGVA 2PBJA 4TKYA 4EDZA 5J5NA 3SWLA 3A2VA 3F6DA 1M2DA 3LYKA 4YQUA 4K1FA 3H1NA 5ECKB 2HNLA 5DAKB 4N30A 1DBYA 5F8BA 2M46A 4PNGA 4MF5A 2A2SA 2IMDA 1JLWA 2CZ3A 2YCDA 6GSXA 3HA9A 3W6GA 2OKAA 1BX9A 3KXOA 1NSWA 1K3YA 1ML6A 5EVOA 2P5RA 16GSA 2I81A 6GSTA 1Z5YE 2F3MA 2BMXA 2REMA 1YF0A 2ON7A 3TUEA 4BWQA 4EF0A 4ACSA 3J7Yk 2BTOT 5KN2A 1FW1A 4K7IA 1EEMA 2HLSA 2XHFA 1M9AA 2LQQA 3IAS2 3ZLPA 2J23A 2C3TA 3IK9A 4I2TA 2ZCTA 1HNBA 3IBHA 3EURA 5D9VA 4ILFA 4DVCA 3HY2A 4F0BA
chains in the Genus database with same CATH superfamily
3HJPA 1VGLA 1ON4A 5ABRA 4TR3A 1EV9A 2IL3A 3HVSA 5DAKA 5G30A 2L4QA 5F05A 4HS1A 2DMLA 3VI5A 1WE0A 2FWEA 1ZYEA 1Z6MA 2X49A 5DJLA 4OMVA 3TOTA 1GNWA 2H0GA 5DCGA 4KX4A 2P31A 1OVNA 4PX1A 1EOHA 4NV5A 5DVBA 3EC3A 3H93A 1T8EB 4HU7A 1V9WA 2E0QA 4IBPA 1GNEA 5ECPB 3P8WA 3PGTA 6GSVA 2E7PA 2OBKA 3IC8A 3LG6A 3H4KA 4YAVA 3FY7A 4LMVA 3LXZA 2NBSA 4PQ1A 1WJKA 4HDEA 5HR3A 4BIKA 1ILOA 3IA1A 5J41A 2P0GA 3TJGA 2FD3A 5JWRB 2PU9C 2HZFA 4POBA 3QMXA 4X4JA 4POLA 2R5GA 3W8SA 2MMZA 3UARA 3CYNA 2KP2A 1YKAA 2PPTA 3NIVA 1T7PB 2B7JA 2CT6A 5DCHA 3QAWA 5KOWA 4MABA 2X8CA 1EGRA 4G9HA 1XWCA 4J57E 1O8WA 1XOAA 5CYYA 4EIQA 3D4TA 1ERWA 1F3AA 4WETA 4F03A 3GRXA 2G2QA 3JCML 2YZHA 3A2WA 4JBBA 4MH2A 6GSYA 1GLPA 2GSRA 4XS6A 2C0FA 3EVIA 2I1UA 2H75A 3FEUA 1GWCA 2CAQA 3EE2A 1SJIA 4YQMA 4O5UA 5ECLB 1KNGA 4AGSA 5AIXA 5LCZA 1X9WB 4XHMA 1R5AA 3GL3A 1OE7A 1PL1A 3DVWA 2YWIA 1PL2A 2H1BA 5A4WA 1K0BA 2PVOC 5D9TA 5LD0A 3VLNA 4TW5A 1ZYQB 4WF4A 2NDOA 1IYIA 2H72A 3UAPA 4ULXA 2DSAA 2LTKA 4JU5A 2H6XA 2E2MA 1H4OA 4KSMA 1VF4A 2LRNA 4IP6A 4DEJA 1R5PA 2VCQA 4MJEA 3M9KA 4BA7A 3IHGA 1U88A 2CX4A 4WR5A 1T4ZA 4TR1B 4AJ6A 1M7TA 4MLYA 5A4VA 1A2LA 4MPGA 2EC4A 2H01A 1V57A 1H75A 4KB3A 1GSFA 3C7MA 4XRDA 5FHIA 2JU5A 2HE3A 5ECRB 1XIYA 2I9HA 1B9XC 2B5YA 2K8VA 1O7UA 3WGXA 2VOCA 4ISDA 1HNCA 1YDKA 3QR6A 5ELGA 3HVXA 1LBKA 1M3JA 1WIKA 4G0LA 4HUAA 4LL4B 1K3LA 2VD1A 3DIEA 3LGCA 4PGTA 2VLVA 3GYKA 1TI3A 3EMPA 5IM9A 4K0NA 3DKSA 1SL1B 1F37A 1FB0A 1B4QA 5HR2A 3RHCA 4F2IA 5ECNB 1F3BA 3N9JA 2JADA 3NOFA 4TR1A 5D9XA 2H19A 2YWMA 2FLSA 5G31A 3BCKA 2YOIA 3TJBA 2GZZA 3VWVA 3EYTA 4FYBA 2PN8A 2DLXA 2IN3A 4LLRA 1SJ6A 3US3A 4MMMA 5AIVA 3ED3A 3BCIA 1TOFA 2FNOA 1M3IA 1ZCPA 5DALA 1GUKA 4HZ4A 1XXUA 5B6NA 11GSA 5L71A 2B7KA 1Z7PA 4AJ7A 2O85A 2LJAA 4NHWA 2H71A 2OE3A 4K7NA 1U6TA 2H70A 3EPTA 4IN0A 5IQYA 3E0UA 2X4AA 2E2GA 2AV4A 3PH9A 1WOUA 2FHEA 1GSSA 2DJJA 1OC8A 3FYGA 2VCTA 3DRNA 4POMA 2XPDA 1SYXA 4O5RA 2HRFA 1R7HA 2LUSA 5EL8A 3ERWA 1TK0B 4YH2A 20GSA 2DJ0A 2KOKA 4ZBAA 1PRXA 2YWOA 3TGZA 4P3YB 4JZQA 3K8NA 1JZOA 4KDXA 4KAEA 3GKXA 4TR4A 3APSA 1K0DA 3TJFA 4OO4A 3A5IA 1GSQA 4DSSB 1ZYNA 2H6YA 4YKGA 2I4AA 4RQXA 5H5QA 5CRWA 2B1KA 5D73A 3LWAA 1B9YC 1MEKA 3C8EA 1M9BA 2H0IA 2CVBA 1I5GA 2AAWA 3TKSA 1YZXA 1PN0A 5EY6A 3FZ9A 1B4PA 3F8UA 1X5CA 4KUNA 3HVVA 2EIQA 3UBKA 2YV7A 3UIWA 1SKWB 5HFGA 3F4TA 1UC7A 4GLTA 4IP1A 4IVFA 1SD9A 2K6VA 2M72A 1E6BA 1SK1A 3WD6A 2IJYA 2EIOA 3GL5A 3P90A 3IRAA 1SL0B 2LRTA 2R3XA 3OR5A 1GLQA 4J56E 4K6XA 2GT5A 5B8AA 1GTAA 3HVNA 3KEBA 2F8AA 1ERTA 3L4NA 1GRXA 2YANA 1EEJA 14GSA 1YEPA 2WZ9A 2N5AA 3M9JA 2LQOA 5AN1A 2LJKA 5HR0A 1A2JA 5HFKA 1K0AA 4EDYA 3Q19A 4PQIA 5INYA 5IMAA 1PD21 4EIPA 3WGDA 2CQ9A 2HT9A 5DQSA 4RQRA 4Q5QA 4HQZA 3D6IA 1GL8A 4X0XA 3HD5A 4MNNA 1T1VA 2GGTA 5COHA 4NAXA 1VRSD 3Q18A 4KW6A 1XVQA 1OC3A 2IIYA 4IGJA 1TU8A 4NXIA 4E8EA 4EKZA 1GUHA 2ZNMA 3MDKA 1FAAA 3LYPA 4OD7A 2GQMA 4L0UA 3MWHA 2OBIA 4NHZA 3NZNA 1OAZA 1SJZA 2YJHA 22GSA 2A4HA 1JFUA 3HZ8A 2R4VA 4WXTA 2V1MA 2HSYA 4MF6A 4IELA 2EIRA 4USSA 2LS5A 5F07A 2VM2A 1USBA 1DE2A 4K7OA 1AAZA 4NV2A 1SD8A 1GSDA 3G7JA 3EMXA 5J9CA 1XPVA 1HNAA 1YEXA 3QFAC 3GMFA 1N8JA 5KN0A 3DEXA 3TRPA 2LKUA 4GQCA 5CNWA 3KP8A 1SENA 4WF5A 3VWUA 2Z9SA 4OO5A 3V1WA 2OACA 2YV9A 2FWGA 2L4CA 2TIRA 1SK0A 1V98A 5IMDA 12GSA 1OE8A 1EP7A 2PGTA 4FIWA 1GSEA 2C0EA 2R0PA 1X9SB 4MA9A 1AUCA 1R4WA 4KH7A 1O85A 2DBCA 2R37A 5JCGA 1S3CA 4I97A 1JLVA 4QQ7A 5GZZB 4LMWA 4G0IA 4KE3A 1VF1A 3ME8A 2CZ2A 2H6ZA 2M80A 1K0OA 1CQHA 3KMNA 5DQYA 4OFNA 3LXTA 4F82A 2DJ1A 4ZIJA 2LNTA 3WYWA 4V1Ag 2OE0A 2R2JA 1LJRA 3KP9A 5JCWA 1GUMA 1J08A 1SK2A 2FCHA 5IMCA 1KBNA 3UL3A 1SL2B 4PUFC 2L6CA 1W89A 4RI7A 2B1LA 1V58A 4O5QA 4GSNA 5BMUA 4FQUA 2WULA 2C8UA 3FRCA 3WT1A 3CSIA 2CVDA 10GSA 2LV3A 4BWSA 2FWFA 4JE1A 4GWRA 4V2MA 3D21A 4POKA 2DJ3A 4AF2A 3A5WA 2GT6A 2NTOA 5KN1A 2JZSA 5IO2A 5FWGA 3F9UA 1XWAA 2YWNA 4MH3A 1AW9A 4WEYA 3VI7A 2R0CA 2GTUA 4HI7A 4PXOA 2WDUA 3BOAA 1DE1A 5CREA 1EP8A 1A24A 5KEJA 3CMIA 1QMVA 2L5OA 1TXXA 4V2NA 5IPHA 3PINA 5KN3A 3HXSA 5B6MA 19GSA 4MZWA 3W8JA 2QA2A 1G7OA 1U3IA 1WRYA 5ENUA 4PQHA 5B7CA 2JZRA 4FYCA 1BG5A 3ZL5A 5B8BA 2H1AA 4RUVA 2I3YA 3LFLA 3O6TA 5G1LA 3AY8A 2V2GA 1QFNA 2CA8A 3M3MA 1JZRA 1TRVA 1Z6NA 1QUWA 4PUAA 2KLXA 3QPMA 3HJOA 3DMLA 1Z7RA 1G6WA 3CBUA 4JEDA 1KEBA 4PTSA 3VFIA 2GSTA 3MSZA 3ZFBA 3RDWA 3Q74A 5J9BA 4N11A 2O8VB 3TOUA 2VCWA 5ECOB 4OFMA 4HQSA 4G0KA 2HSMA 4ZILA 2HRAA 1X5DA 2D2ZA 3FK8A 4GTUA 4CY6A 5CRDA 2RIIA 1PKWA 2GSSA 4G2EA 4Z2RA 2HRNA 5EPFA 2N5FA 2IFQB 4MJAA 5J4UA 4HJMA 2OJLA 2B6MA 1NW2A 1PQNA 4G19A 2QA1A 5G5EA 5DALB 2WS2A 5BRTA 4Z2UA 5ECHB 2H73A 1MDKA 5CP1A 3O3TA 3PPUA 3FR3A 3GA4A 1F6MC 2ALBA 1EOGA 1J0FA 4N0VA 2PERA 1FVJA 3HHVA 3UJ1A 3WT2A 3I69A 3ZREA 1BAYA 4TOPA 1ST9A 3CTFA 1R26A 3U6VA 3ZIJA 3IK7A 2C4JA 4MP4A 1TJDA 3FMWA 4HSCX 4I6XA 1E2YA 3F0IA 1JHBA 2G0FA 1MD4A 2JSZA 4WKWA 3GKMA 3TKSE 1GULA 2IFQA 4KF9A 2K18A 2B5XA 2V6OA 1M99A 1IYHA 2ES7A 3TKQA 4EUYA 2O7KA 3C73A 4N0ZA 1AXDA 2A4VA 1XOBA 1TTZA 4CW9A 2VL2A 3CXGA 4IQ1A 6GSUA 2RM5A 3I6AA 3QCPA 2IPAA 3KIJA 1O8XA 3ERGA 4GXZA 1FO5A 2C0DA 2XPEA 4KCEA 3MNGA 1BEDA 4G10A 2ON5A 5G1KA 3F3RA 4D73B 2A2PA 5DDLA 3RPNA 4OWYA 4YKFA 2FUG2 1WWJA 1PX7A 3ISOA 2VL2C 2YPMA 1OYJA 3ZRDA 1WP0A 2HZEB 4ZBBA 1QK8A 2HSHA 5IIZA 5H5RA 4YAPA 2TRCP 2FWHA 13GSA 5AISA 4OFTA 1RW1A 1F9MA 1X9MB 1THOA 2KUCA 2L5LA 5HQPA 2VIMA 5F06A 1TP9A 2AHEA 3IAM2 5C00A 4EVMA 2H66A 2C3QA 2JZTA 1U3AA 1GTBA 4XTSA 3G7YA 1PGTA 4MPFA 3HCZA 1M0UA 3RBTA 3CSHA 3GN3A 2MBSA 3RAZA 3L9UA 5GAPD 4I8BA 5C04A 5IOXA 3VPTA 1ZL9A 4ECJA 1K0NA 1TK5B 4D73A 4MCUA 1MDJA 2R0GA 3TRQA 1ZZYA 2F51A 2NPBA 2V6KA 3GSTA 5H5SA 4IKHA 1O81A 2IMEA 2HZEA 2AUVA 5ECMB 1XW5A 2JSYA 4DSRA 1G0TA 2K8SA 4O7HA 5E4WA 3EINA 4TXOB 3EU4A 4XCSA 3UBLA 3S9FA 1SU9A 5JWOB 2VAFA 1M2BA 2KP1A 5A5KA 3IE3A 2B3SA 3VPQA 2FA8A 5DJMA 8GSSA 5GSSA 3CSJA 1ZMAA 2VUPA 4NWYA 2WGRA 4ZBDA 2FGXA 1FG4A 3L0HA 1Z3EA 3I43A 3U5RE 4O92A 1T3BA 4BVYB 1FHEA 2PVQA 3FR9A 3UVHA 3PR8A 2H8LA 3L78A 1TU7A 3GURA 1BYEA 1GP1A 3VWXA 1O73A 2QKEA 1YY7A 2L57A 3LJRA 4Z2TA 2GVPA 1I9DA 1ABAA 3F4RA 1GH2A 1Z9HA 1X5EA 1ZOFA 4ML1A 4TN8A 1XWGA 4V2LA 4PNFA 4LA1A 3SBCA 3IDVA 4TXOA 2JACA 4GSSA 1PKZA 4KNDA 2YN1A 4IS0A 1QGVA 2RM6A 1FOHA 3GX0A 3ERFA 3RHBA 4CDOA 1A2MA 4IJIA 4PURA 3P2AA 4F0CA 1A0RP 2YNXA 2O89A 3DWVA 4XIHA 1NHYA 1GTUA 2B5EA 2IMFA 4BVYA 2PWJA 3A2XA 4BL7B 1OKDA 4NPBA 2MBTA 2VCVA 3TKRA 1W4VA 2WFCA 5JWQB 1TDIA 3ZTLA 2YZUA 4MF7A 1TK8B 1S3RA 4JR4A 5D8IA 4EC0A 2L59A 1THXA 4IQAA 2DC5A 3L9SA 1DUGA 1X0RA 3FZ4A 4O32A 3LW9A 4HU9A 5ECQB 4L5OA 3IV4A 4J2FA 3UVTA 2HXKA 2X8HA 1Q4JA 1F2EA 3VWWA 3EU3A 4ZL7A 1XZOA 2LEGA 2XC2A 1TRSA 1VF3A 6GSSA 2GQLA 3M1GA 1K0CA 4JR6A 1V40A 3ZZXA 2K9FA 5CRGA 4BL7A 3DGQA 4I2UA 3UMAA 1UA5A 3ZIVA 2BJXA 2MZCA 1AQWA 17GSA 2RUFA 2F8FA 3FZ5A 2VL3A 1OC9B 1XBSA 2PMTA 3VK9A 2H74A 1GSUA 4ZB8A 4XS1A 2GZYA 2R6KA 3KMOA 3GV1A 3C1RA 5LNKe 3R2QA 3KM6A 3BD2A 3CTGA 3LQ7A 4BVXB 2H0HA 5IO0A 1QXHA 1Q98A 3IPZA 2WB9A 1B48A 3E3EA 3CRTA 2MYGA 3ZMKA 1RK4A 2OA7A 3IOSA 1YKCA 4KCAA 3IR4A 1JZDA 2P5QA 4ECBA 2DJKA 1CQGA 2DIZA 5D96A 3MIXA 4KDUA 4ECIA 6GSWA 3R3EA 2OADA 1OC9A 1XG8A 4GCIA 5ELAA 2TRXA 3QOUA 3DXBA 5F0GA 1MDIA 1WMJA 5IMVA 2WCIA 1EWXA 3LORA 2A2RA 4Q5RA 3IC4A 3GUSA 3CRUA 4K5SA 1A0FA 2C0GA 4GF0A 2FY6A 5CRHA 2HYXA 4BVXA 4EXJA 1C72A 2PUKC 2X64A 2GSQA 5IMFA 2GS3A 5J3RA 3GFKA 2AB6A 2KHPA 1B8XA 4GRFA 3FKFA 4ZB9A 3Q6OA 4TRXA 1S3AA 2HRKA 1TKDB 2YP6A 4X43A 5G5FA 3GH6A 2LNSA 5GAND 3J7Yb 2VL9A 1PFOA 3LEFA 4Q5NA 3APQA 2LRCA 1PN9A 5GSTA 2H1GA 2DKIA 4ML6A 4EO3A 1XWBA 2O87A 4HEA2 1FVKA 3I9V2 5D93A 4ZXGA 2FA4A 2IMKA 3TJJA 2GLRA 3CQFA 1K3OA 2V32A 3KD0A 1UVZA 3FW2A 1SKRB 1TRUA 4IHUA 1BJXA 4NMUA 3FZAA 1ERUA 1TRWA 4L8EA 2QC7A 4WBJA 4H86A 4K2DA 4K9ZA 2VLTA 1TI1A 3M8NA 1GTIA 3GX8A 3F4SA 3P7XA 4CHSA 4ZL9A 2F9SA 4MDCA 3D5JA 1S3DA 2X99A 3UEMA 4HJ2A 2H30A 1PA3A 3QFBC 3QAVA 3GH9A 3DVXA 2GZPA 3KH7A 1WPIA 1SKSB 4QL9A 2VLUA 1JZWA 4XRAA 1T00A 2C3NA 1KTEA 3KGKA 3ME7A 5CAXA 4FH8A 5ID2B 4BPYA 3TCOA 2RUEA 1AC1A 1MTCA 5HR1A 2ZUPA 4ICYA 1ACVA 3TDGA 3GIXA 3TB2A 4N10A 1EZKA 4X1UA 1PMTA 2LJRA 3KCMA 5ECIB 2X8GA 9GSSA 4QL7A 2H76A 2VO4A 4Z7XA 1GSYA 3A3TA 4HOJA 5A4UA 1XCCA 1U87A 4FO5A 2H1DA 4K0GA 7GSSA 4K5RA 1VF2A 3C71A 5G2ZA 2WJUA 2MMAA 5JCUA 1LU4A 3D22A 3H79A 4TXVA 4E8HA 1XVWA 2L6DA 4XS4B 1K0MA 4DSQA 2YJ7A 1TW9A 3MAKA 2WRTA 3HKRA 2VCZA 1G7EA 1MD3A 1Y6EA 3BJ5A 5IOWA 5CO3A 3LSZA 2UZ8A 3HJMA 3DD3A 1NM3A 5ID2A 3GTUB 4K8MA 3GNJA 1XWKA 3L9VA 2RLIA 1SYRA 1G6YA 2CV4A 3KTLA 1FOVA 3GKKA 3WGEA 2IMIA 18GSA 4ECCA 2IWTA 4HZ2A 4YQVA 3HZ4A 1V2AA 1YQ1A 2J9HA 1QQ2A 1OKTA 5HFIA 5DBQA 5IMZA 4Q5FA 2NVLA 5ECSA 1UN2A 1BQ7A 4LL1B 3G9BA 3H8QA 2AJQB 1HD2A 3ZMLA 1YF1A 4WR4A 3HYPA 4XS4A 3HDCA 3FHKA 3APOA 1NHOA 4KGIA 4L0WA 2GQKA 2XBQA 3QD9A 4IW9A 3KJYA 1FB6A 4AJ8A 3GTUA 5AGYA 1M2AA 2OE1A 4KA0A 3ZYWA 1AIUA 1HYUA 4MZBA 3ZITA 2VD0A 3IXRA 3EWLA 5FT3A 2N5BA 4MK3A 4K2XA 4MZCA 3G7IA 4ZL8A 1ZYPA 2JL4A 3BBYA 4ZB6A 3TRXA 2HI7A 3RPPA 3TJKA 3KTBA 2HFDA 3KZQA 4OCEA 2C1YA 1YJ6A 4TR0A 4F9ZA 3GHAA 5IPGA 3GSSA 3VURA 2LSTA 4IJ3A 3UOMA 4EL1A 4RI6A 4TVEA 2CX3A 2CAIA 3N5OA 3M0FA 3TKPA 2VM1A 3C1SA 1N2AA 4CY8A 3GKNA 2CVKA 4KDYA 1A8YA 3ZVJA 4KSOA 4L5LA 2C80A 5E59A 3TKSC 3IHQA 1ZGNA 1O6JA 4DSSA 1A8LA 4JRRA 4FYUA 3F3QA 4EE0A 3ZVJD 1RQMA 2DJ2A 2DMMA 4A5PA 2VCXA 5KOXA 1URMA 3KH9A 1AQXA 1PX6A 1EV4A 3D4MA 2GDRA 3DYRA 2XBIA 3FR6A 3ZFLA 1EGOA 4WBRD 4GSTA 4OCFA 1DSBA 1HQOA 4I5QA 2MMOA 1A23A 4GQFA 2QSIA 1ERVA 1XW6A 1J9BA 1T4YA 2DKHA 3D0ZA 3QDNA 2V41A 1Y25A 3QAGA 2AYTA 5D9WA 4MJBA 4V1Ap 3O76A 4ID0A 3F63A 1XFLA 1XW9A 1AQVA 2DIYA 2MMNA 4MJCA 3E9JB 1PSQA 3F6FA 2QGVA 2PBJA 4TKYA 4EDZA 5J5NA 3SWLA 3A2VA 3F6DA 1M2DA 3LYKA 4YQUA 4K1FA 3H1NA 5ECKB 3MYDA 2HNLA 5DAKB 4N30A 1DBYA 5F8BA 2M46A 4PNGA 4MF5A 2A2SA 2IMDA 1JLWA 2CZ3A 2YCDA 6GSXA 3HA9A 3W6GA 2OKAA 1BX9A 3KXOA 1NSWA 1K3YA 1ML6A 5EVOA 2P5RA 16GSA 2I81A 6GSTA 1Z5YE 2F3MA 2BMXA 2REMA 1YF0A 2ON7A 3TUEA 4BWQA 4EF0A 4ACSA 3J7Yk 2BTOT 5KN2A 1FW1A 4K7IA 1EEMA 2HLSA 2XHFA 1M9AA 2LQQA 3IAS2 3ZLPA 2J23A 2C3TA 3IK9A 4I2TA 2ZCTA 1HNBA 3IBHA 3EURA 5D9VA 4ILFA 4DVCA 3HY2A 4F0BA
chains in the Genus database with same CATH topology
3HJPA 1VGLA 1ON4A 5ABRA 4TR3A 1EV9A 2IL3A 3HVSA 5DAKA 5G30A 2L4QA 5F05A 4HS1A 2DMLA 3VI5A 1WE0A 2FWEA 1ZYEA 1Z6MA 2X49A 5DJLA 4OMVA 3TOTA 1GNWA 2H0GA 5DCGA 4KX4A 2P31A 1OVNA 4PX1A 1EOHA 4NV5A 5DVBA 3EC3A 3H93A 1T8EB 4HU7A 1V9WA 2E0QA 4IBPA 1GNEA 5ECPB 3P8WA 3PGTA 6GSVA 2E7PA 2OBKA 3IC8A 3LG6A 3H4KA 4YAVA 3FY7A 4LMVA 3LXZA 2NBSA 4PQ1A 1WJKA 4HDEA 5HR3A 1ILOA 3IA1A 5J41A 2P0GA 3TJGA 2FD3A 5JWRB 2PU9C 2HZFA 4POBA 3QMXA 4X4JA 4POLA 2R5GA 3W8SA 2MMZA 3UARA 3CYNA 2KP2A 1YKAA 2PPTA 3NIVA 1T7PB 2B7JA 2CT6A 5DCHA 3QAWA 5KOWA 4MABA 2X8CA 1EGRA 4G9HA 1XWCA 4J57E 1O8WA 1XOAA 5CYYA 4EIQA 3D4TA 1ERWA 1F3AA 4WETA 4F03A 3GRXA 2G2QA 3JCML 2YZHA 3A2WA 4JBBA 4MH2A 6GSYA 1GLPA 2GSRA 4XS6A 2C0FA 3EVIA 2I1UA 2H75A 3FEUA 1GWCA 2CAQA 3EE2A 1SJIA 4YQMA 4O5UA 5ECLB 1KNGA 4AGSA 5AIXA 5LCZA 1X9WB 4XHMA 1R5AA 3GL3A 1OE7A 1PL1A 3DVWA 2YWIA 1PL2A 2H1BA 5A4WA 1K0BA 2PVOC 5D9TA 5LD0A 3VLNA 4TW5A 1ZYQB 4WF4A 2NDOA 1IYIA 2H72A 3UAPA 4ULXA 2DSAA 2LTKA 4JU5A 2H6XA 2E2MA 1H4OA 4KSMA 1VF4A 2LRNA 4IP6A 4DEJA 1R5PA 2VCQA 4MJEA 3M9KA 4BA7A 3IHGA 1U88A 2CX4A 4WR5A 1T4ZA 4TR1B 4AJ6A 1M7TA 4MLYA 5A4VA 1A2LA 4MPGA 2EC4A 2H01A 1V57A 1H75A 4KB3A 1GSFA 3C7MA 4XRDA 5FHIA 2JU5A 2HE3A 5ECRB 1XIYA 2I9HA 1B9XC 2B5YA 2K8VA 1O7UA 3WGXA 2VOCA 4ISDA 1HNCA 1YDKA 3QR6A 5ELGA 3HVXA 1LBKA 1WIKA 4G0LA 4HUAA 4LL4B 1K3LA 2VD1A 3DIEA 3LGCA 4PGTA 2VLVA 3GYKA 1TI3A 3EMPA 5IM9A 4K0NA 3DKSA 1SL1B 1F37A 1FB0A 1B4QA 5HR2A 3RHCA 4F2IA 5ECNB 1F3BA 3N9JA 2JADA 3NOFA 4TR1A 5D9XA 2H19A 2YWMA 2FLSA 5G31A 3BCKA 2YOIA 3TJBA 2GZZA 3VWVA 3EYTA 4FYBA 2PN8A 2DLXA 2IN3A 4LLRA 1SJ6A 3US3A 4MMMA 5AIVA 3ED3A 3BCIA 1TOFA 2FNOA 1ZCPA 5DALA 1GUKA 4HZ4A 1XXUA 5B6NA 11GSA 5L71A 2B7KA 1Z7PA 4AJ7A 2O85A 2LJAA 4NHWA 2H71A 2OE3A 4K7NA 1U6TA 2H70A 3EPTA 4IN0A 5IQYA 3E0UA 2X4AA 2E2GA 2AV4A 3PH9A 1WOUA 2FHEA 1GSSA 2DJJA 1OC8A 3FYGA 2VCTA 3DRNA 4POMA 2XPDA 1SYXA 4O5RA 2HRFA 1R7HA 2LUSA 5EL8A 3ERWA 1TK0B 4YH2A 20GSA 2DJ0A 2KOKA 4ZBAA 1PRXA 2YWOA 3TGZA 4P3YB 4JZQA 3K8NA 1JZOA 4KDXA 4KAEA 3GKXA 4TR4A 3APSA 1K0DA 3TJFA 4OO4A 3A5IA 1GSQA 4DSSB 1ZYNA 2H6YA 4YKGA 2I4AA 4RQXA 5H5QA 5CRWA 2B1KA 5D73A 3LWAA 1B9YC 1MEKA 3C8EA 1M9BA 2H0IA 2CVBA 1I5GA 2AAWA 3TKSA 1YZXA 1PN0A 5EY6A 3FZ9A 1B4PA 3F8UA 1X5CA 4KUNA 3HVVA 2EIQA 3UBKA 2YV7A 3UIWA 1SKWB 5HFGA 3F4TA 1UC7A 4GLTA 4IP1A 4IVFA 1SD9A 2K6VA 2M72A 1E6BA 1SK1A 3WD6A 2IJYA 2EIOA 3GL5A 3P90A 3IRAA 1SL0B 2LRTA 2R3XA 3OR5A 1GLQA 4J56E 4K6XA 2GT5A 5B8AA 1GTAA 3KEBA 2F8AA 1ERTA 3L4NA 1GRXA 2YANA 1EEJA 14GSA 1YEPA 2WZ9A 2N5AA 3M9JA 2LQOA 5AN1A 2LJKA 5HR0A 1A2JA 5HFKA 1K0AA 4EDYA 3Q19A 4PQIA 5INYA 5IMAA 1PD21 4EIPA 3WGDA 2CQ9A 2HT9A 5DQSA 4RQRA 4Q5QA 4HQZA 3D6IA 1GL8A 4X0XA 3HD5A 4MNNA 1T1VA 2GGTA 5COHA 4NAXA 1VRSD 3Q18A 4KW6A 1XVQA 1OC3A 2IIYA 4IGJA 1TU8A 4NXIA 4E8EA 4EKZA 1GUHA 2ZNMA 3MDKA 1FAAA 3LYPA 4OD7A 2GQMA 4L0UA 3MWHA 2OBIA 4NHZA 3NZNA 1OAZA 1SJZA 2YJHA 22GSA 2A4HA 1JFUA 3HZ8A 2R4VA 4WXTA 2V1MA 2HSYA 4MF6A 4IELA 2EIRA 4USSA 2LS5A 5F07A 2VM2A 1USBA 1DE2A 4K7OA 1AAZA 4NV2A 1SD8A 1GSDA 3G7JA 3EMXA 5J9CA 1XPVA 1HNAA 1YEXA 3QFAC 3GMFA 1N8JA 5KN0A 3DEXA 3TRPA 2LKUA 4GQCA 5CNWA 3KP8A 1SENA 4WF5A 3VWUA 2Z9SA 4OO5A 3V1WA 2OACA 2YV9A 2FWGA 2L4CA 2TIRA 1SK0A 1V98A 5IMDA 12GSA 1OE8A 1EP7A 2PGTA 4FIWA 1GSEA 2C0EA 2R0PA 1X9SB 4MA9A 1AUCA 1R4WA 4KH7A 1O85A 2DBCA 2R37A 5JCGA 1S3CA 4I97A 1JLVA 4QQ7A 5GZZB 4LMWA 4G0IA 4KE3A 1VF1A 3ME8A 2CZ2A 2H6ZA 2M80A 1K0OA 1CQHA 3KMNA 5DQYA 4OFNA 3LXTA 4F82A 2DJ1A 4ZIJA 2LNTA 3WYWA 4V1Ag 2OE0A 2R2JA 1LJRA 3KP9A 5JCWA 1GUMA 1J08A 1SK2A 2FCHA 5IMCA 1KBNA 3UL3A 1SL2B 4PUFC 2L6CA 1W89A 4RI7A 2B1LA 1V58A 4O5QA 4GSNA 5BMUA 4FQUA 2WULA 2C8UA 3FRCA 3WT1A 3CSIA 2CVDA 10GSA 2LV3A 4BWSA 2FWFA 4JE1A 4GWRA 4V2MA 3D21A 4POKA 2DJ3A 4AF2A 3A5WA 2GT6A 2NTOA 5KN1A 2JZSA 5IO2A 5FWGA 3F9UA 1XWAA 2YWNA 4MH3A 1AW9A 4WEYA 3VI7A 2R0CA 2GTUA 4HI7A 4PXOA 2WDUA 3BOAA 1DE1A 5CREA 1EP8A 1A24A 5KEJA 3CMIA 1QMVA 2L5OA 1TXXA 4V2NA 5IPHA 3PINA 5KN3A 3HXSA 5B6MA 19GSA 4MZWA 3W8JA 2QA2A 1G7OA 1U3IA 1WRYA 5ENUA 4PQHA 5B7CA 2JZRA 4FYCA 1BG5A 3ZL5A 5B8BA 2H1AA 4RUVA 2I3YA 3LFLA 3O6TA 5G1LA 3AY8A 2V2GA 1QFNA 2CA8A 3M3MA 1JZRA 1TRVA 1Z6NA 1QUWA 4PUAA 2KLXA 3QPMA 3HJOA 3DMLA 1Z7RA 1G6WA 3CBUA 4JEDA 1KEBA 4PTSA 3VFIA 2GSTA 3MSZA 3ZFBA 3RDWA 3Q74A 5J9BA 4N11A 2O8VB 3TOUA 2VCWA 5ECOB 4OFMA 4HQSA 4G0KA 2HSMA 4ZILA 2HRAA 1X5DA 2D2ZA 3FK8A 4GTUA 4CY6A 5CRDA 2RIIA 1PKWA 2GSSA 4G2EA 4Z2RA 2HRNA 5EPFA 2N5FA 2IFQB 4MJAA 5J4UA 4HJMA 2OJLA 2B6MA 1NW2A 1PQNA 4G19A 2QA1A 5G5EA 5DALB 2WS2A 5BRTA 4Z2UA 5ECHB 2H73A 1MDKA 5CP1A 3O3TA 3PPUA 3FR3A 3GA4A 1F6MC 2ALBA 1EOGA 1J0FA 4N0VA 2PERA 1FVJA 3HHVA 3UJ1A 3WT2A 3I69A 3ZREA 1BAYA 4TOPA 1ST9A 3CTFA 1R26A 3U6VA 3ZIJA 3IK7A 2C4JA 4MP4A 1TJDA 3FMWA 4I6XA 1E2YA 3F0IA 1JHBA 2G0FA 1MD4A 2JSZA 4WKWA 3GKMA 3TKSE 1GULA 2IFQA 4KF9A 2K18A 2B5XA 2V6OA 1M99A 1IYHA 2ES7A 3TKQA 4EUYA 2O7KA 3C73A 4N0ZA 1AXDA 2A4VA 1XOBA 1TTZA 4CW9A 2VL2A 3CXGA 4IQ1A 6GSUA 2RM5A 3I6AA 3QCPA 2IPAA 3KIJA 1O8XA 3ERGA 4GXZA 1FO5A 2C0DA 2XPEA 4KCEA 3MNGA 1BEDA 4G10A 2ON5A 5G1KA 3F3RA 4D73B 2A2PA 5DDLA 3RPNA 4OWYA 4YKFA 2FUG2 1WWJA 1PX7A 3ISOA 2VL2C 2YPMA 1OYJA 3ZRDA 1WP0A 2HZEB 4ZBBA 1QK8A 2HSHA 5IIZA 5H5RA 4YAPA 2TRCP 2FWHA 13GSA 5AISA 4OFTA 1RW1A 1F9MA 1X9MB 1THOA 2KUCA 2L5LA 5HQPA 2VIMA 5F06A 1TP9A 2AHEA 3IAM2 5C00A 4EVMA 2H66A 2C3QA 2JZTA 1U3AA 1GTBA 4XTSA 3G7YA 1PGTA 4MPFA 3HCZA 1M0UA 3RBTA 3CSHA 3GN3A 2MBSA 3RAZA 3L9UA 5GAPD 4I8BA 5C04A 5IOXA 3VPTA 1ZL9A 4ECJA 1K0NA 1TK5B 4D73A 4MCUA 1MDJA 2R0GA 3TRQA 1ZZYA 2F51A 2NPBA 2V6KA 3GSTA 5H5SA 4IKHA 1O81A 2IMEA 2HZEA 2AUVA 5ECMB 1XW5A 2JSYA 4DSRA 1G0TA 2K8SA 4O7HA 5E4WA 3EINA 4TXOB 3EU4A 4XCSA 3UBLA 3S9FA 1SU9A 5JWOB 2VAFA 1M2BA 2KP1A 5A5KA 3IE3A 2B3SA 3VPQA 2FA8A 5DJMA 8GSSA 5GSSA 3CSJA 1ZMAA 2VUPA 4NWYA 2WGRA 4ZBDA 2FGXA 1FG4A 3L0HA 1Z3EA 3I43A 3U5RE 4O92A 1T3BA 4BVYB 1FHEA 2PVQA 3FR9A 3UVHA 3PR8A 2H8LA 3L78A 1TU7A 3GURA 1BYEA 1GP1A 3VWXA 1O73A 2QKEA 1YY7A 2L57A 3LJRA 4Z2TA 2GVPA 1I9DA 1ABAA 3F4RA 1GH2A 1Z9HA 1X5EA 1ZOFA 4ML1A 4TN8A 1XWGA 4V2LA 4PNFA 4LA1A 3SBCA 3IDVA 4TXOA 2JACA 4GSSA 1PKZA 4KNDA 2YN1A 4IS0A 1QGVA 2RM6A 1FOHA 3GX0A 3ERFA 3RHBA 4CDOA 1A2MA 4IJIA 4PURA 3P2AA 4F0CA 1A0RP 2YNXA 2O89A 3DWVA 4XIHA 1NHYA 1GTUA 2B5EA 2IMFA 4BVYA 2PWJA 3A2XA 4BL7B 1OKDA 4NPBA 2MBTA 2VCVA 3TKRA 1W4VA 2WFCA 5JWQB 1TDIA 3ZTLA 2YZUA 4MF7A 1TK8B 4EC0A 4JR4A 5D8IA 2L59A 1THXA 4IQAA 2DC5A 3L9SA 1DUGA 1X0RA 3FZ4A 4O32A 3LW9A 4HU9A 5ECQB 4L5OA 3IV4A 4J2FA 3UVTA 2HXKA 2X8HA 1Q4JA 1F2EA 3VWWA 3EU3A 4ZL7A 1XZOA 2LEGA 2XC2A 1TRSA 1VF3A 6GSSA 2GQLA 3M1GA 1K0CA 4JR6A 1V40A 3ZZXA 2K9FA 5CRGA 4BL7A 3DGQA 4I2UA 3UMAA 1UA5A 3ZIVA 2BJXA 2MZCA 1AQWA 17GSA 2RUFA 2F8FA 3FZ5A 2VL3A 1OC9B 1XBSA 2PMTA 3VK9A 2H74A 1GSUA 4ZB8A 4XS1A 2GZYA 2R6KA 3KMOA 3GV1A 3C1RA 5LNKe 3R2QA 3KM6A 3BD2A 3CTGA 3LQ7A 4BVXB 2H0HA 5IO0A 1QXHA 1Q98A 3IPZA 2WB9A 1B48A 3E3EA 3CRTA 2MYGA 3ZMKA 1RK4A 2OA7A 3IOSA 1YKCA 4KCAA 3IR4A 1JZDA 2P5QA 4ECBA 2DJKA 1CQGA 2DIZA 5D96A 3MIXA 4KDUA 4ECIA 6GSWA 3R3EA 2OADA 1OC9A 4GCIA 5ELAA 2TRXA 3QOUA 3DXBA 5F0GA 1MDIA 1WMJA 5IMVA 2WCIA 1EWXA 3LORA 2A2RA 4Q5RA 3IC4A 3GUSA 3CRUA 4K5SA 1A0FA 2C0GA 4GF0A 2FY6A 5CRHA 2HYXA 4BVXA 4EXJA 1C72A 2PUKC 2X64A 2GSQA 5IMFA 2GS3A 5J3RA 3GFKA 2AB6A 2KHPA 1B8XA 4GRFA 3FKFA 4ZB9A 3Q6OA 4TRXA 1S3AA 2HRKA 1TKDB 2YP6A 4X43A 5G5FA 3GH6A 2LNSA 5GAND 3J7Yb 2VL9A 3LEFA 4Q5NA 3APQA 2LRCA 1PN9A 5GSTA 2H1GA 2DKIA 4ML6A 4EO3A 1XWBA 2O87A 4HEA2 1FVKA 3I9V2 5D93A 4ZXGA 2FA4A 2IMKA 3TJJA 2GLRA 1K3OA 2V32A 3KD0A 1UVZA 3FW2A 1SKRB 1TRUA 4IHUA 1BJXA 4NMUA 3FZAA 1ERUA 1TRWA 4L8EA 2QC7A 4WBJA 4H86A 4K2DA 4K9ZA 2VLTA 1TI1A 3M8NA 1GTIA 3GX8A 3F4SA 3P7XA 4CHSA 4ZL9A 2F9SA 4MDCA 3D5JA 1S3DA 2X99A 3UEMA 4HJ2A 2H30A 1PA3A 3QFBC 3QAVA 3GH9A 3DVXA 2GZPA 3KH7A 1WPIA 1SKSB 4QL9A 2VLUA 1JZWA 4XRAA 1T00A 2C3NA 1KTEA 3KGKA 3ME7A 5CAXA 4FH8A 5ID2B 4BPYA 3TCOA 2RUEA 1AC1A 1MTCA 5HR1A 2ZUPA 4ICYA 1ACVA 3TDGA 3GIXA 3TB2A 4N10A 1EZKA 4X1UA 1PMTA 2LJRA 3KCMA 5ECIB 2X8GA 9GSSA 4QL7A 2H76A 2VO4A 4Z7XA 1GSYA 3A3TA 4HOJA 5A4UA 1XCCA 1U87A 4FO5A 2H1DA 4K0GA 7GSSA 4K5RA 1VF2A 3C71A 5G2ZA 2WJUA 2MMAA 5JCUA 1LU4A 3D22A 3H79A 4TXVA 4E8HA 1XVWA 2L6DA 4XS4B 1K0MA 4DSQA 2YJ7A 1TW9A 3MAKA 2WRTA 3HKRA 2VCZA 1G7EA 1MD3A 1Y6EA 3BJ5A 5IOWA 5CO3A 3LSZA 2UZ8A 3HJMA 3DD3A 1NM3A 5ID2A 3GTUB 4K8MA 3GNJA 1XWKA 3L9VA 2RLIA 1SYRA 1G6YA 2CV4A 3KTLA 1FOVA 3GKKA 3WGEA 2IMIA 18GSA 4ECCA 2IWTA 4HZ2A 4YQVA 3HZ4A 1V2AA 1YQ1A 2J9HA 1QQ2A 1OKTA 5HFIA 5DBQA 5IMZA 4Q5FA 2NVLA 5ECSA 1UN2A 1BQ7A 4LL1B 3G9BA 3H8QA 2AJQB 1HD2A 3ZMLA 1YF1A 4WR4A 3HYPA 4XS4A 3HDCA 3FHKA 3APOA 1NHOA 4KGIA 4L0WA 2GQKA 2XBQA 3QD9A 4IW9A 3KJYA 1FB6A 4AJ8A 3GTUA 5AGYA 1M2AA 2OE1A 4KA0A 3ZYWA 1AIUA 1HYUA 4MZBA 3ZITA 2VD0A 3IXRA 3EWLA 5FT3A 2N5BA 4MK3A 4K2XA 4MZCA 3G7IA 4ZL8A 1ZYPA 2JL4A 3BBYA 4ZB6A 3TRXA 2HI7A 3RPPA 3TJKA 3KTBA 2HFDA 3KZQA 4OCEA 2C1YA 1YJ6A 4TR0A 4F9ZA 3GHAA 5IPGA 3GSSA 3VURA 2LSTA 4IJ3A 3UOMA 4EL1A 4RI6A 4TVEA 2CX3A 2CAIA 3N5OA 3M0FA 3TKPA 2VM1A 3C1SA 1N2AA 4CY8A 3GKNA 2CVKA 4KDYA 1A8YA 3ZVJA 4KSOA 4L5LA 2C80A 5E59A 3TKSC 3IHQA 1ZGNA 1O6JA 4DSSA 1A8LA 4JRRA 4FYUA 3F3QA 4EE0A 3ZVJD 1RQMA 2DJ2A 2DMMA 4A5PA 2VCXA 5KOXA 1URMA 3KH9A 1AQXA 1PX6A 1EV4A 3D4MA 2GDRA 3DYRA 2XBIA 3FR6A 3ZFLA 1EGOA 4WBRD 4GSTA 4OCFA 1DSBA 1HQOA 4I5QA 2MMOA 1A23A 4GQFA 2QSIA 1ERVA 1XW6A 1J9BA 1T4YA 2DKHA 3D0ZA 3QDNA 2V41A 1Y25A 3QAGA 2AYTA 5D9WA 4MJBA 4V1Ap 3O76A 4ID0A 3F63A 1XFLA 1XW9A 1AQVA 2DIYA 2MMNA 4MJCA 3E9JB 1PSQA 3F6FA 2QGVA 2PBJA 4TKYA 4EDZA 5J5NA 3SWLA 3A2VA 3F6DA 1M2DA 3LYKA 4YQUA 4K1FA 3H1NA 5ECKB 3MYDA 2HNLA 5DAKB 4N30A 1DBYA 5F8BA 2M46A 4PNGA 4MF5A 2A2SA 2IMDA 1JLWA 2CZ3A 2YCDA 6GSXA 3HA9A 3W6GA 2OKAA 1BX9A 3KXOA 1NSWA 1K3YA 1ML6A 5EVOA 2P5RA 16GSA 2I81A 6GSTA 1Z5YE 2F3MA 2BMXA 2REMA 1YF0A 2ON7A 3TUEA 4BWQA 4EF0A 4ACSA 3J7Yk 2BTOT 5KN2A 1FW1A 4K7IA 1EEMA 2HLSA 2XHFA 1M9AA 2LQQA 3IAS2 3ZLPA 2J23A 2C3TA 3IK9A 4I2TA 2ZCTA 1HNBA 3IBHA 3EURA 5D9VA 4ILFA 4DVCA 3HY2A 4F0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJP A;  1VGL A;  1ON4 A;  5ABR A;  4TR3 A;  1EV9 A;  2IL3 A;  3HVS A;  5DAK A;  5G30 A;  2L4Q A;  5F05 A;  4HS1 A;  2DML A;  3VI5 A;  1WE0 A;  2FWE A;  1ZYE A;  1Z6M A;  5DJL A;  4OMV A;  3TOT A;  1GNW A;  2H0G A;  5DCG A;  4KX4 A;  2P31 A;  1OVN A;  4PX1 A;  1EOH A;  4NV5 A;  5DVB A;  3EC3 A;  3H93 A;  1T8E B;  4HU7 A;  1V9W A;  2E0Q A;  4IBP A;  1GNE A;  5ECP B;  3P8W A;  3PGT A;  6GSV A;  2E7P A;  2OBK A;  3LG6 A;  3H4K A;  4YAV A;  3FY7 A;  4LMV A;  3LXZ A;  2NBS A;  4PQ1 A;  1WJK A;  4HDE A;  5HR3 A;  1ILO A;  3IA1 A;  5J41 A;  2P0G A;  3TJG A;  2FD3 A;  5JWR B;  2PU9 C;  2HZF A;  4POB A;  3QMX A;  4POL A;  2R5G A;  3W8S A;  2MMZ A;  3UAR A;  3CYN A;  2KP2 A;  1YKA A;  2PPT A;  3NIV A;  1T7P B;  2B7J A;  2CT6 A;  5DCH A;  3QAW A;  4MAB A;  2X8C A;  1EGR A;  4G9H A;  1XWC A;  4J57 E;  1O8W A;  1XOA A;  5CYY A;  3D4T A;  1ERW A;  1F3A A;  4WET A;  4F03 A;  3GRX A;  2G2Q A;  3JCM L;  2YZH A;  3A2W A;  4JBB A;  4MH2 A;  6GSY A;  1GLP A;  2GSR A;  4XS6 A;  2C0F A;  3EVI A;  2I1U A;  2H75 A;  3FEU A;  1GWC A;  2CAQ A;  3EE2 A;  1SJI A;  4YQM A;  5ECL B;  1KNG A;  4AGS A;  5AIX A;  5LCZ A;  1X9W B;  4XHM A;  1R5A A;  3GL3 A;  1OE7 A;  1PL1 A;  3DVW A;  2YWI A;  1PL2 A;  2H1B A;  5A4W A;  1K0B A;  2PVO C;  5D9T A;  5LD0 A;  3VLN A;  4TW5 A;  1ZYQ B;  4WF4 A;  2NDO A;  1IYI A;  2H72 A;  3UAP A;  4ULX A;  2DSA A;  2LTK A;  4JU5 A;  2H6X A;  2E2M A;  1H4O A;  4KSM A;  1VF4 A;  2LRN A;  4IP6 A;  4DEJ A;  1R5P A;  2VCQ A;  4MJE A;  3M9K A;  4BA7 A;  1U88 A;  2CX4 A;  4WR5 A;  1T4Z A;  4TR1 B;  4AJ6 A;  1M7T A;  4MLY A;  5A4V A;  1A2L A;  4MPG A;  2EC4 A;  2H01 A;  1V57 A;  1H75 A;  4KB3 A;  1GSF A;  3C7M A;  4XRD A;  5FHI A;  2JU5 A;  2HE3 A;  5ECR B;  1XIY A;  2I9H A;  1B9X C;  2B5Y A;  2K8V A;  1O7U A;  3WGX A;  2VOC A;  4ISD A;  1HNC A;  1YDK A;  3QR6 A;  5ELG A;  3HVX A;  1LBK A;  1WIK A;  4HUA A;  4LL4 B;  1K3L A;  2VD1 A;  3DIE A;  3LGC A;  4PGT A;  2VLV A;  3GYK A;  1TI3 A;  3EMP A;  5IM9 A;  4K0N A;  3DKS A;  1SL1 B;  1F37 A;  1FB0 A;  1B4Q A;  5HR2 A;  3RHC A;  4F2I A;  5ECN B;  1F3B A;  3N9J A;  2JAD A;  3NOF A;  4TR1 A;  5D9X A;  2H19 A;  2YWM A;  2FLS A;  5G31 A;  3BCK A;  2YOI A;  3TJB A;  2GZZ A;  3VWV A;  3EYT A;  4FYB A;  2PN8 A;  2DLX A;  2IN3 A;  4LLR A;  1SJ6 A;  3US3 A;  4MMM A;  5AIV A;  3ED3 A;  3BCI A;  1TOF A;  2FNO A;  1ZCP A;  5DAL A;  1GUK A;  4HZ4 A;  1XXU A;  5B6N A;  11GS A;  5L71 A;  2B7K A;  1Z7P A;  4AJ7 A;  2O85 A;  2LJA A;  4NHW A;  2H71 A;  2OE3 A;  4K7N A;  1U6T A;  2H70 A;  4IN0 A;  5IQY A;  3E0U A;  2E2G A;  2AV4 A;  3PH9 A;  1WOU A;  2FHE A;  1GSS A;  2DJJ A;  1OC8 A;  3FYG A;  2VCT A;  3DRN A;  4POM A;  2XPD A;  1SYX A;  4O5R A;  2HRF A;  1R7H A;  2LUS A;  5EL8 A;  3ERW A;  1TK0 B;  4YH2 A;  20GS A;  2DJ0 A;  2KOK A;  4ZBA A;  1PRX A;  2YWO A;  3TGZ A;  4P3Y B;  4JZQ A;  3K8N A;  1JZO A;  4KDX A;  4KAE A;  3GKX A;  4TR4 A;  3APS A;  1K0D A;  3TJF A;  4OO4 A;  1GSQ A;  4DSS B;  2H6Y A;  2I4A A;  4RQX A;  5H5Q A;  5CRW A;  2B1K A;  5D73 A;  3LWA A;  1B9Y C;  1MEK A;  3C8E A;  1M9B A;  2H0I A;  2CVB A;  1I5G A;  2AAW A;  3TKS A;  1YZX A;  5EY6 A;  3FZ9 A;  1B4P A;  3F8U A;  1X5C A;  4KUN A;  3HVV A;  2EIQ A;  3UBK A;  2YV7 A;  3UIW A;  1SKW B;  5HFG A;  3F4T A;  1UC7 A;  4GLT A;  4IP1 A;  4IVF A;  1SD9 A;  2K6V A;  2M72 A;  1E6B A;  1SK1 A;  3WD6 A;  2IJY A;  2EIO A;  3GL5 A;  3P90 A;  3IRA A;  1SL0 B;  2LRT A;  2R3X A;  3OR5 A;  1GLQ A;  4J56 E;  4K6X A;  2GT5 A;  5B8A A;  1GTA A;  3KEB A;  2F8A A;  1ERT A;  3L4N A;  1GRX A;  2YAN A;  1EEJ A;  14GS A;  1YEP A;  2WZ9 A;  2N5A A;  3M9J A;  2LQO A;  5AN1 A;  2LJK A;  5HR0 A;  1A2J A;  5HFK A;  1K0A A;  4EDY A;  3Q19 A;  4PQI A;  5INY A;  5IMA A;  1PD2 1;  3WGD A;  2CQ9 A;  2HT9 A;  5DQS A;  4RQR A;  4Q5Q A;  4HQZ A;  3D6I A;  1GL8 A;  4X0X A;  3HD5 A;  1T1V A;  2GGT A;  5COH A;  4NAX A;  1VRS D;  3Q18 A;  4KW6 A;  1XVQ A;  1OC3 A;  2IIY A;  4IGJ A;  1TU8 A;  4NXI A;  4E8E A;  4EKZ A;  1GUH A;  2ZNM A;  3MDK A;  1FAA A;  3LYP A;  4OD7 A;  2GQM A;  4L0U A;  3MWH A;  2OBI A;  4NHZ A;  3NZN A;  1OAZ A;  1SJZ A;  2YJH A;  22GS A;  1JFU A;  3HZ8 A;  2R4V A;  4WXT A;  2V1M A;  2HSY A;  4MF6 A;  4IEL A;  2EIR A;  2LS5 A;  5F07 A;  2VM2 A;  1USB A;  1DE2 A;  4K7O A;  1AAZ A;  4NV2 A;  1SD8 A;  1GSD A;  3G7J A;  3EMX A;  5J9C A;  1XPV A;  1HNA A;  1YEX A;  3QFA C;  3GMF A;  1N8J A;  5KN0 A;  3DEX A;  3TRP A;  2LKU A;  4GQC A;  5CNW A;  3KP8 A;  1SEN A;  4WF5 A;  3VWU A;  2Z9S A;  4OO5 A;  3V1W A;  2OAC A;  2YV9 A;  2FWG A;  2L4C A;  2TIR A;  1SK0 A;  1V98 A;  5IMD A;  12GS A;  1OE8 A;  1EP7 A;  2PGT A;  4FIW A;  1GSE A;  2C0E A;  1X9S B;  4MA9 A;  1AUC A;  1R4W A;  4KH7 A;  1O85 A;  2DBC A;  2R37 A;  5JCG A;  1S3C A;  4I97 A;  1JLV A;  4QQ7 A;  5GZZ B;  4LMW A;  4KE3 A;  1VF1 A;  3ME8 A;  2CZ2 A;  2H6Z A;  2M80 A;  1K0O A;  1CQH A;  3KMN A;  5DQY A;  4OFN A;  3LXT A;  4F82 A;  2DJ1 A;  4ZIJ A;  2LNT A;  3WYW A;  4V1A g;  2OE0 A;  2R2J A;  1LJR A;  3KP9 A;  5JCW A;  1GUM A;  1J08 A;  1SK2 A;  2FCH A;  5IMC A;  1KBN A;  3UL3 A;  1SL2 B;  4PUF C;  2L6C A;  1W89 A;  4RI7 A;  2B1L A;  1V58 A;  4GSN A;  2WUL A;  2C8U A;  3FRC A;  3WT1 A;  3CSI A;  2CVD A;  10GS A;  2LV3 A;  4BWS A;  2FWF A;  4JE1 A;  4GWR A;  4V2M A;  3D21 A;  4POK A;  2DJ3 A;  4AF2 A;  3A5W A;  2GT6 A;  2NTO A;  5KN1 A;  2JZS A;  5IO2 A;  5FWG A;  3F9U A;  1XWA A;  2YWN A;  4MH3 A;  1AW9 A;  4WEY A;  3VI7 A;  2GTU A;  4HI7 A;  4PXO A;  2WDU A;  3BOA A;  1DE1 A;  5CRE A;  1EP8 A;  1A24 A;  5KEJ A;  3CMI A;  1QMV A;  2L5O A;  1TXX A;  4V2N A;  5IPH A;  3PIN A;  5KN3 A;  3HXS A;  5B6M A;  19GS A;  4MZW A;  3W8J A;  1G7O A;  1U3I A;  1WRY A;  5ENU A;  4PQH A;  5B7C A;  2JZR A;  4FYC A;  1BG5 A;  3ZL5 A;  5B8B A;  2H1A A;  4RUV A;  2I3Y A;  3LFL A;  3O6T A;  5G1L A;  3AY8 A;  2V2G A;  1QFN A;  2CA8 A;  3M3M A;  1JZR A;  1TRV A;  1Z6N A;  1QUW A;  4PUA A;  2KLX A;  3QPM A;  3HJO A;  3DML A;  1Z7R A;  1G6W A;  3CBU A;  4JED A;  1KEB A;  3VFI A;  2GST A;  3MSZ A;  3ZFB A;  3RDW A;  3Q74 A;  5J9B A;  4N11 A;  2O8V B;  3TOU A;  2VCW A;  5ECO B;  4OFM A;  4HQS A;  4ZIL A;  1X5D A;  2D2Z A;  3FK8 A;  4GTU A;  5CRD A;  2RII A;  1PKW A;  2GSS A;  4G2E A;  2HRN A;  5EPF A;  2N5F A;  2IFQ B;  4MJA A;  5J4U A;  4HJM A;  2OJL A;  2B6M A;  1NW2 A;  1PQN A;  4G19 A;  5G5E A;  5DAL B;  2WS2 A;  5ECH B;  2H73 A;  1MDK A;  5CP1 A;  3O3T A;  3FR3 A;  3GA4 A;  1F6M C;  2ALB A;  1EOG A;  1J0F A;  4N0V A;  2PER A;  1FVJ A;  3HHV A;  3UJ1 A;  3WT2 A;  3I69 A;  3ZRE A;  1BAY A;  4TOP A;  1ST9 A;  3CTF A;  1R26 A;  3U6V A;  3ZIJ A;  3IK7 A;  2C4J A;  4MP4 A;  1TJD A;  4I6X A;  1E2Y A;  3F0I A;  1JHB A;  2G0F A;  1MD4 A;  2JSZ A;  4WKW A;  3GKM A;  3TKS E;  1GUL A;  2IFQ A;  2K18 A;  2B5X A;  2V6O A;  1M99 A;  1IYH A;  2ES7 A;  3TKQ A;  4EUY A;  2O7K A;  3C73 A;  4N0Z A;  1AXD A;  2A4V A;  1XOB A;  1TTZ A;  4CW9 A;  2VL2 A;  3CXG A;  4IQ1 A;  6GSU A;  2RM5 A;  3I6A A;  3QCP A;  2IPA A;  3KIJ A;  1O8X A;  3ERG A;  4GXZ A;  1FO5 A;  2C0D A;  2XPE A;  4KCE A;  3MNG A;  1BED A;  4G10 A;  2ON5 A;  5G1K A;  3F3R A;  4D73 B;  5DDL A;  3RPN A;  4OWY A;  2FUG 2;  1WWJ A;  1PX7 A;  3ISO A;  2VL2 C;  2YPM A;  1OYJ A;  3ZRD A;  1WP0 A;  2HZE B;  4ZBB A;  1QK8 A;  2HSH A;  5IIZ A;  5H5R A;  4YAP A;  2TRC P;  2FWH A;  13GS A;  5AIS A;  4OFT A;  1RW1 A;  1F9M A;  1X9M B;  1THO A;  2KUC A;  2L5L A;  5HQP A;  2VIM A;  5F06 A;  1TP9 A;  2AHE A;  3IAM 2;  5C00 A;  4EVM A;  2H66 A;  2C3Q A;  2JZT A;  1U3A A;  1GTB A;  4XTS A;  3G7Y A;  1PGT A;  4MPF A;  3HCZ A;  1M0U A;  3RBT A;  3CSH A;  3GN3 A;  2MBS A;  3RAZ A;  3L9U A;  5GAP D;  4I8B A;  5C04 A;  5IOX A;  3VPT A;  1ZL9 A;  4ECJ A;  1K0N A;  1TK5 B;  4D73 A;  4MCU A;  1MDJ A;  3TRQ A;  1ZZY A;  2F51 A;  2NPB A;  2V6K A;  3GST A;  5H5S A;  4IKH A;  1O81 A;  2IME A;  2HZE A;  2AUV A;  5ECM B;  1XW5 A;  2JSY A;  4DSR A;  1G0T A;  2K8S A;  4O7H A;  5E4W A;  3EIN A;  4TXO B;  3EU4 A;  4XCS A;  3UBL A;  3S9F A;  1SU9 A;  5JWO B;  2VAF A;  1M2B A;  2KP1 A;  5A5K A;  3IE3 A;  2B3S A;  3VPQ A;  2FA8 A;  5DJM A;  8GSS A;  5GSS A;  3CSJ A;  1ZMA A;  2VUP A;  4NWY A;  2WGR A;  4ZBD A;  2FGX A;  1FG4 A;  3L0H A;  1Z3E A;  3I43 A;  3U5R E;  4O92 A;  1T3B A;  1FHE A;  2PVQ A;  3FR9 A;  3UVH A;  3PR8 A;  2H8L A;  3L78 A;  1TU7 A;  3GUR A;  1BYE A;  1GP1 A;  3VWX A;  1O73 A;  2QKE A;  1YY7 A;  2L57 A;  3LJR A;  2GVP A;  1I9D A;  1ABA A;  3F4R A;  1GH2 A;  1Z9H A;  1X5E A;  1ZOF A;  4ML1 A;  4TN8 A;  1XWG A;  4V2L A;  4PNF A;  4LA1 A;  3SBC A;  3IDV A;  4TXO A;  2JAC A;  4GSS A;  1PKZ A;  4KND A;  2YN1 A;  4IS0 A;  1QGV A;  2RM6 A;  3GX0 A;  3ERF A;  3RHB A;  4CDO A;  1A2M A;  4IJI A;  4PUR A;  3P2A A;  4F0C A;  1A0R P;  2YNX A;  2O89 A;  3DWV A;  4XIH A;  1NHY A;  1GTU A;  2B5E A;  2IMF A;  4BVY A;  2PWJ A;  3A2X A;  1OKD A;  4NPB A;  2MBT A;  2VCV A;  3TKR A;  1W4V A;  2WFC A;  5JWQ B;  1TDI A;  3ZTL A;  2YZU A;  4MF7 A;  1TK8 B;  4EC0 A;  4JR4 A;  5D8I A;  2L59 A;  1THX A;  4IQA A;  2DC5 A;  3L9S A;  1DUG A;  1X0R A;  3FZ4 A;  4O32 A;  4HU9 A;  5ECQ B;  4L5O A;  3IV4 A;  4J2F A;  3UVT A;  2HXK A;  2X8H A;  1Q4J A;  1F2E A;  3VWW A;  3EU3 A;  4ZL7 A;  1XZO A;  2LEG A;  2XC2 A;  1TRS A;  1VF3 A;  6GSS A;  2GQL A;  3M1G A;  1K0C A;  4JR6 A;  1V40 A;  3ZZX A;  2K9F A;  5CRG A;  4BL7 A;  3DGQ A;  4I2U A;  3UMA A;  1UA5 A;  3ZIV A;  2BJX A;  2MZC A;  1AQW A;  17GS A;  2RUF A;  2F8F A;  3FZ5 A;  2VL3 A;  1OC9 B;  1XBS A;  2PMT A;  3VK9 A;  2H74 A;  1GSU A;  4ZB8 A;  4XS1 A;  2GZY A;  2R6K A;  3KMO A;  3GV1 A;  3C1R A;  5LNK e;  3R2Q A;  3KM6 A;  3BD2 A;  3CTG A;  3LQ7 A;  2H0H A;  5IO0 A;  1QXH A;  1Q98 A;  3IPZ A;  2WB9 A;  1B48 A;  3E3E A;  3CRT A;  2MYG A;  3ZMK A;  1RK4 A;  2OA7 A;  3IOS A;  1YKC A;  4KCA A;  3IR4 A;  1JZD A;  2P5Q A;  4ECB A;  2DJK A;  1CQG A;  2DIZ A;  5D96 A;  4KDU A;  4ECI A;  6GSW A;  2OAD A;  1OC9 A;  4GCI A;  5ELA A;  2TRX A;  3QOU A;  3DXB A;  5F0G A;  1MDI A;  1WMJ A;  5IMV A;  2WCI A;  1EWX A;  3LOR A;  2A2R A;  3IC4 A;  4Q5R A;  3GUS A;  3CRU A;  1A0F A;  2C0G A;  4GF0 A;  2FY6 A;  5CRH A;  2HYX A;  4BVX A;  4EXJ A;  1C72 A;  2PUK C;  2X64 A;  2GSQ A;  5IMF A;  2GS3 A;  5J3R A;  3GFK A;  2AB6 A;  2KHP A;  1B8X A;  4GRF A;  3FKF A;  4ZB9 A;  3Q6O A;  4TRX A;  1S3A A;  1TKD B;  2YP6 A;  4X43 A;  5G5F A;  3GH6 A;  2LNS A;  5GAN D;  3J7Y b;  2VL9 A;  3LEF A;  4Q5N A;  3APQ A;  2LRC A;  1PN9 A;  5GST A;  2H1G A;  4ML6 A;  4EO3 A;  1XWB A;  2O87 A;  4HEA 2;  1FVK A;  3I9V 2;  5D93 A;  4ZXG A;  2FA4 A;  2IMK A;  3TJJ A;  2GLR A;  1K3O A;  2V32 A;  3KD0 A;  1UVZ A;  3FW2 A;  1SKR B;  1TRU A;  4IHU A;  1BJX A;  4NMU A;  3FZA A;  1ERU A;  1TRW A;  4L8E A;  2QC7 A;  4WBJ A;  4H86 A;  4K2D A;  4K9Z A;  2VLT A;  1TI1 A;  3M8N A;  1GTI A;  3GX8 A;  3F4S A;  3P7X A;  4CHS A;  4ZL9 A;  2F9S A;  4MDC A;  3D5J A;  1S3D A;  2X99 A;  3UEM A;  4HJ2 A;  2H30 A;  1PA3 A;  3QFB C;  3QAV A;  3GH9 A;  3DVX A;  2GZP A;  3KH7 A;  1WPI A;  1SKS B;  4QL9 A;  2VLU A;  1JZW A;  4XRA A;  1T00 A;  2C3N A;  1KTE A;  3KGK A;  3ME7 A;  5CAX A;  4FH8 A;  5ID2 B;  4BPY A;  3TCO A;  2RUE A;  1AC1 A;  1MTC A;  5HR1 A;  2ZUP A;  1ACV A;  3TDG A;  3GIX A;  3TB2 A;  4N10 A;  1EZK A;  4X1U A;  1PMT A;  2LJR A;  3KCM A;  5ECI B;  2X8G A;  9GSS A;  4QL7 A;  2H76 A;  2VO4 A;  4Z7X A;  1GSY A;  3A3T A;  4HOJ A;  5A4U A;  1XCC A;  1U87 A;  4FO5 A;  2H1D A;  4K0G A;  7GSS A;  1VF2 A;  3C71 A;  5G2Z A;  2WJU A;  2MMA A;  5JCU A;  1LU4 A;  3D22 A;  3H79 A;  4TXV A;  4E8H A;  1XVW A;  2L6D A;  4XS4 B;  1K0M A;  4DSQ A;  2YJ7 A;  1TW9 A;  3MAK A;  2WRT A;  3HKR A;  2VCZ A;  1G7E A;  1MD3 A;  1Y6E A;  3BJ5 A;  5IOW A;  5CO3 A;  3LSZ A;  3HJM A;  3DD3 A;  1NM3 A;  5ID2 A;  3GTU B;  4K8M A;  3GNJ A;  1XWK A;  3L9V A;  2RLI A;  1SYR A;  1G6Y A;  2CV4 A;  3KTL A;  1FOV A;  3GKK A;  3WGE A;  2IMI A;  18GS A;  4ECC A;  2IWT A;  4HZ2 A;  4YQV A;  3HZ4 A;  1V2A A;  1YQ1 A;  2J9H A;  1QQ2 A;  1OKT A;  5HFI A;  5DBQ A;  5IMZ A;  4Q5F A;  2NVL A;  5ECS A;  1UN2 A;  1BQ7 A;  4LL1 B;  3G9B A;  3H8Q A;  2AJQ B;  1HD2 A;  3ZML A;  1YF1 A;  4WR4 A;  3HYP A;  4XS4 A;  3HDC A;  3FHK A;  3APO A;  1NHO A;  4KGI A;  4L0W A;  2GQK A;  2XBQ A;  3QD9 A;  4IW9 A;  3KJY A;  1FB6 A;  4AJ8 A;  3GTU A;  5AGY A;  1M2A A;  2OE1 A;  4KA0 A;  3ZYW A;  1AIU A;  1HYU A;  4MZB A;  3ZIT A;  2VD0 A;  3IXR A;  3EWL A;  5FT3 A;  2N5B A;  4MK3 A;  4MZC A;  3G7I A;  4ZL8 A;  2JL4 A;  3BBY A;  4ZB6 A;  3TRX A;  2HI7 A;  3RPP A;  3TJK A;  3KTB A;  2HFD A;  3KZQ A;  4OCE A;  2C1Y A;  1YJ6 A;  4TR0 A;  4F9Z A;  3GHA A;  5IPG A;  3GSS A;  3VUR A;  2LST A;  4IJ3 A;  3UOM A;  4EL1 A;  4RI6 A;  4TVE A;  2CX3 A;  2CAI A;  3N5O A;  3M0F A;  3TKP A;  2VM1 A;  3C1S A;  1N2A A;  3GKN A;  2CVK A;  4KDY A;  1A8Y A;  3ZVJ A;  4KSO A;  4L5L A;  2C80 A;  5E59 A;  3TKS C;  3IHQ A;  1ZGN A;  1O6J A;  4DSS A;  1A8L A;  4JRR A;  4FYU A;  3F3Q A;  4EE0 A;  3ZVJ D;  1RQM A;  2DJ2 A;  2DMM A;  2VCX A;  1URM A;  3KH9 A;  1AQX A;  1PX6 A;  1EV4 A;  3D4M A;  2GDR A;  3DYR A;  2XBI A;  3FR6 A;  3ZFL A;  1EGO A;  4WBR D;  4GST A;  4OCF A;  1DSB A;  1HQO A;  4I5Q A;  2MMO A;  1A23 A;  4GQF A;  2QSI A;  1ERV A;  1XW6 A;  1J9B A;  1T4Y A;  3D0Z A;  3QDN A;  2V41 A;  1Y25 A;  3QAG A;  2AYT A;  5D9W A;  4MJB A;  4V1A p;  3O76 A;  4ID0 A;  3F63 A;  1XFL A;  1XW9 A;  1AQV A;  2DIY A;  2MMN A;  4MJC A;  3E9J B;  1PSQ A;  3F6F A;  2QGV A;  2PBJ A;  4TKY A;  4EDZ A;  5J5N A;  3SWL A;  3A2V A;  3F6D A;  1M2D A;  3LYK A;  4YQU A;  4K1F A;  3H1N A;  5ECK B;  2HNL A;  5DAK B;  4N30 A;  1DBY A;  5F8B A;  2M46 A;  4PNG A;  4MF5 A;  2A2S A;  2IMD A;  1JLW A;  2CZ3 A;  2YCD A;  6GSX A;  3HA9 A;  3W6G A;  2OKA A;  1BX9 A;  3KXO A;  1NSW A;  1K3Y A;  1ML6 A;  5EVO A;  2P5R A;  16GS A;  2I81 A;  6GST A;  1Z5Y E;  2F3M A;  2BMX A;  2REM A;  1YF0 A;  2ON7 A;  3TUE A;  4BWQ A;  4EF0 A;  4ACS A;  3J7Y k;  2BTO T;  5KN2 A;  1FW1 A;  4K7I A;  1EEM A;  2HLS A;  2XHF A;  1M9A A;  2LQQ A;  3IAS 2;  3ZLP A;  2J23 A;  2C3T A;  3IK9 A;  4I2T A;  2ZCT A;  1HNB A;  3IBH A;  3EUR A;  5D9V A;  4ILF A;  4DVC A;  3HY2 A;  4F0B A; 
#chains in the Genus database with same CATH topology
 3HJP A;  1VGL A;  1ON4 A;  5ABR A;  4TR3 A;  1EV9 A;  2IL3 A;  3HVS A;  5DAK A;  5G30 A;  2L4Q A;  5F05 A;  4HS1 A;  2DML A;  3VI5 A;  1WE0 A;  2FWE A;  1ZYE A;  1Z6M A;  2X49 A;  5DJL A;  4OMV A;  3TOT A;  1GNW A;  2H0G A;  5DCG A;  4KX4 A;  2P31 A;  1OVN A;  4PX1 A;  1EOH A;  4NV5 A;  5DVB A;  3EC3 A;  3H93 A;  1T8E B;  4HU7 A;  1V9W A;  2E0Q A;  4IBP A;  1GNE A;  5ECP B;  3P8W A;  3PGT A;  6GSV A;  2E7P A;  2OBK A;  3IC8 A;  3LG6 A;  3H4K A;  4YAV A;  3FY7 A;  4LMV A;  3LXZ A;  2NBS A;  4PQ1 A;  1WJK A;  4HDE A;  5HR3 A;  4BIK A;  1ILO A;  3IA1 A;  5J41 A;  2P0G A;  3TJG A;  2FD3 A;  5JWR B;  2PU9 C;  2HZF A;  4POB A;  3QMX A;  4X4J A;  4POL A;  2R5G A;  3W8S A;  2MMZ A;  3UAR A;  3CYN A;  2KP2 A;  1YKA A;  2PPT A;  3NIV A;  1T7P B;  2B7J A;  2CT6 A;  5DCH A;  3QAW A;  5KOW A;  4MAB A;  2X8C A;  1EGR A;  4G9H A;  1XWC A;  4J57 E;  1O8W A;  1XOA A;  5CYY A;  4EIQ A;  3D4T A;  1ERW A;  1F3A A;  4WET A;  4F03 A;  3GRX A;  2G2Q A;  3JCM L;  2YZH A;  3A2W A;  4JBB A;  4MH2 A;  6GSY A;  1GLP A;  2GSR A;  4XS6 A;  2C0F A;  3EVI A;  2I1U A;  2H75 A;  3FEU A;  1GWC A;  2CAQ A;  3EE2 A;  1SJI A;  4YQM A;  4O5U A;  5ECL B;  1KNG A;  4AGS A;  5AIX A;  5LCZ A;  1X9W B;  4XHM A;  1R5A A;  3GL3 A;  1OE7 A;  1PL1 A;  3DVW A;  2YWI A;  1PL2 A;  2H1B A;  5A4W A;  1K0B A;  2PVO C;  5D9T A;  5LD0 A;  3VLN A;  4TW5 A;  1ZYQ B;  4WF4 A;  2NDO A;  1IYI A;  2H72 A;  3UAP A;  4ULX A;  2DSA A;  2LTK A;  4JU5 A;  2H6X A;  2E2M A;  1H4O A;  4KSM A;  1VF4 A;  2LRN A;  4IP6 A;  4DEJ A;  1R5P A;  2VCQ A;  4MJE A;  3M9K A;  4BA7 A;  3IHG A;  1U88 A;  2CX4 A;  4WR5 A;  1T4Z A;  4TR1 B;  4AJ6 A;  1M7T A;  4MLY A;  5A4V A;  1A2L A;  4MPG A;  2EC4 A;  2H01 A;  1V57 A;  1H75 A;  4KB3 A;  1GSF A;  3C7M A;  4XRD A;  5FHI A;  2JU5 A;  2HE3 A;  5ECR B;  1XIY A;  2I9H A;  1B9X C;  2B5Y A;  2K8V A;  1O7U A;  3WGX A;  2VOC A;  4ISD A;  1HNC A;  1YDK A;  3QR6 A;  5ELG A;  3HVX A;  1LBK A;  1M3J A;  1WIK A;  4G0L A;  4HUA A;  4LL4 B;  1K3L A;  2VD1 A;  3DIE A;  3LGC A;  4PGT A;  2VLV A;  3GYK A;  1TI3 A;  3EMP A;  5IM9 A;  4K0N A;  3DKS A;  1SL1 B;  1F37 A;  1FB0 A;  1B4Q A;  5HR2 A;  3RHC A;  4F2I A;  5ECN B;  1F3B A;  3N9J A;  2JAD A;  3NOF A;  4TR1 A;  5D9X A;  2H19 A;  2YWM A;  2FLS A;  5G31 A;  3BCK A;  2YOI A;  3TJB A;  2GZZ A;  3VWV A;  3EYT A;  4FYB A;  2PN8 A;  2DLX A;  2IN3 A;  4LLR A;  1SJ6 A;  3US3 A;  4MMM A;  5AIV A;  3ED3 A;  3BCI A;  1TOF A;  2FNO A;  1M3I A;  1ZCP A;  5DAL A;  1GUK A;  4HZ4 A;  1XXU A;  5B6N A;  11GS A;  5L71 A;  2B7K A;  1Z7P A;  4AJ7 A;  2O85 A;  2LJA A;  4NHW A;  2H71 A;  2OE3 A;  4K7N A;  1U6T A;  2H70 A;  3EPT A;  4IN0 A;  5IQY A;  3E0U A;  2X4A A;  2E2G A;  2AV4 A;  3PH9 A;  1WOU A;  2FHE A;  1GSS A;  2DJJ A;  1OC8 A;  3FYG A;  2VCT A;  3DRN A;  4POM A;  2XPD A;  1SYX A;  4O5R A;  2HRF A;  1R7H A;  2LUS A;  5EL8 A;  3ERW A;  1TK0 B;  4YH2 A;  20GS A;  2DJ0 A;  2KOK A;  4ZBA A;  1PRX A;  2YWO A;  3TGZ A;  4P3Y B;  4JZQ A;  3K8N A;  1JZO A;  4KDX A;  4KAE A;  3GKX A;  4TR4 A;  3APS A;  1K0D A;  3TJF A;  4OO4 A;  3A5I A;  1GSQ A;  4DSS B;  1ZYN A;  2H6Y A;  4YKG A;  2I4A A;  4RQX A;  5H5Q A;  5CRW A;  2B1K A;  5D73 A;  3LWA A;  1B9Y C;  1MEK A;  3C8E A;  1M9B A;  2H0I A;  2CVB A;  1I5G A;  2AAW A;  3TKS A;  1YZX A;  1PN0 A;  5EY6 A;  3FZ9 A;  1B4P A;  3F8U A;  1X5C A;  4KUN A;  3HVV A;  2EIQ A;  3UBK A;  2YV7 A;  3UIW A;  1SKW B;  5HFG A;  3F4T A;  1UC7 A;  4GLT A;  4IP1 A;  4IVF A;  1SD9 A;  2K6V A;  2M72 A;  1E6B A;  1SK1 A;  3WD6 A;  2IJY A;  2EIO A;  3GL5 A;  3P90 A;  3IRA A;  1SL0 B;  2LRT A;  2R3X A;  3OR5 A;  1GLQ A;  4J56 E;  4K6X A;  2GT5 A;  5B8A A;  1GTA A;  3HVN A;  3KEB A;  2F8A A;  1ERT A;  3L4N A;  1GRX A;  2YAN A;  1EEJ A;  14GS A;  1YEP A;  2WZ9 A;  2N5A A;  3M9J A;  2LQO A;  5AN1 A;  2LJK A;  5HR0 A;  1A2J A;  5HFK A;  1K0A A;  4EDY A;  3Q19 A;  4PQI A;  5INY A;  5IMA A;  1PD2 1;  4EIP A;  3WGD A;  2CQ9 A;  2HT9 A;  5DQS A;  4RQR A;  4Q5Q A;  4HQZ A;  3D6I A;  1GL8 A;  4X0X A;  3HD5 A;  4MNN A;  1T1V A;  2GGT A;  5COH A;  4NAX A;  1VRS D;  3Q18 A;  4KW6 A;  1XVQ A;  1OC3 A;  2IIY A;  4IGJ A;  1TU8 A;  4NXI A;  4E8E A;  4EKZ A;  1GUH A;  2ZNM A;  3MDK A;  1FAA A;  3LYP A;  4OD7 A;  2GQM A;  4L0U A;  3MWH A;  2OBI A;  4NHZ A;  3NZN A;  1OAZ A;  1SJZ A;  2YJH A;  22GS A;  2A4H A;  1JFU A;  3HZ8 A;  2R4V A;  4WXT A;  2V1M A;  2HSY A;  4MF6 A;  4IEL A;  2EIR A;  4USS A;  2LS5 A;  5F07 A;  2VM2 A;  1USB A;  1DE2 A;  4K7O A;  1AAZ A;  4NV2 A;  1SD8 A;  1GSD A;  3G7J A;  3EMX A;  5J9C A;  1XPV A;  1HNA A;  1YEX A;  3QFA C;  3GMF A;  1N8J A;  5KN0 A;  3DEX A;  3TRP A;  2LKU A;  4GQC A;  5CNW A;  3KP8 A;  1SEN A;  4WF5 A;  3VWU A;  2Z9S A;  4OO5 A;  3V1W A;  2OAC A;  2YV9 A;  2FWG A;  2L4C A;  2TIR A;  1SK0 A;  1V98 A;  5IMD A;  12GS A;  1OE8 A;  1EP7 A;  2PGT A;  4FIW A;  1GSE A;  2C0E A;  2R0P A;  1X9S B;  4MA9 A;  1AUC A;  1R4W A;  4KH7 A;  1O85 A;  2DBC A;  2R37 A;  5JCG A;  1S3C A;  4I97 A;  1JLV A;  4QQ7 A;  5GZZ B;  4LMW A;  4G0I A;  4KE3 A;  1VF1 A;  3ME8 A;  2CZ2 A;  2H6Z A;  2M80 A;  1K0O A;  1CQH A;  3KMN A;  5DQY A;  4OFN A;  3LXT A;  4F82 A;  2DJ1 A;  4ZIJ A;  2LNT A;  3WYW A;  4V1A g;  2OE0 A;  2R2J A;  1LJR A;  3KP9 A;  5JCW A;  1GUM A;  1J08 A;  1SK2 A;  2FCH A;  5IMC A;  1KBN A;  3UL3 A;  1SL2 B;  4PUF C;  2L6C A;  1W89 A;  4RI7 A;  2B1L A;  1V58 A;  4O5Q A;  4GSN A;  5BMU A;  4FQU A;  2WUL A;  2C8U A;  3FRC A;  3WT1 A;  3CSI A;  2CVD A;  10GS A;  2LV3 A;  4BWS A;  2FWF A;  4JE1 A;  4GWR A;  4V2M A;  3D21 A;  4POK A;  2DJ3 A;  4AF2 A;  3A5W A;  2GT6 A;  2NTO A;  5KN1 A;  2JZS A;  5IO2 A;  5FWG A;  3F9U A;  1XWA A;  2YWN A;  4MH3 A;  1AW9 A;  4WEY A;  3VI7 A;  2R0C A;  2GTU A;  4HI7 A;  4PXO A;  2WDU A;  3BOA A;  1DE1 A;  5CRE A;  1EP8 A;  1A24 A;  5KEJ A;  3CMI A;  1QMV A;  2L5O A;  1TXX A;  4V2N A;  5IPH A;  3PIN A;  5KN3 A;  3HXS A;  5B6M A;  19GS A;  4MZW A;  3W8J A;  2QA2 A;  1G7O A;  1U3I A;  1WRY A;  5ENU A;  4PQH A;  5B7C A;  2JZR A;  4FYC A;  1BG5 A;  3ZL5 A;  5B8B A;  2H1A A;  4RUV A;  2I3Y A;  3LFL A;  3O6T A;  5G1L A;  3AY8 A;  2V2G A;  1QFN A;  2CA8 A;  3M3M A;  1JZR A;  1TRV A;  1Z6N A;  1QUW A;  4PUA A;  2KLX A;  3QPM A;  3HJO A;  3DML A;  1Z7R A;  1G6W A;  3CBU A;  4JED A;  1KEB A;  4PTS A;  3VFI A;  2GST A;  3MSZ A;  3ZFB A;  3RDW A;  3Q74 A;  5J9B A;  4N11 A;  2O8V B;  3TOU A;  2VCW A;  5ECO B;  4OFM A;  4HQS A;  4G0K A;  2HSM A;  4ZIL A;  2HRA A;  1X5D A;  2D2Z A;  3FK8 A;  4GTU A;  4CY6 A;  5CRD A;  2RII A;  1PKW A;  2GSS A;  4G2E A;  4Z2R A;  2HRN A;  5EPF A;  2N5F A;  2IFQ B;  4MJA A;  5J4U A;  4HJM A;  2OJL A;  2B6M A;  1NW2 A;  1PQN A;  4G19 A;  2QA1 A;  5G5E A;  5DAL B;  2WS2 A;  5BRT A;  4Z2U A;  5ECH B;  2H73 A;  1MDK A;  5CP1 A;  3O3T A;  3PPU A;  3FR3 A;  3GA4 A;  1F6M C;  2ALB A;  1EOG A;  1J0F A;  4N0V A;  2PER A;  1FVJ A;  3HHV A;  3UJ1 A;  3WT2 A;  3I69 A;  3ZRE A;  1BAY A;  4TOP A;  1ST9 A;  3CTF A;  1R26 A;  3U6V A;  3ZIJ A;  3IK7 A;  2C4J A;  4MP4 A;  1TJD A;  3FMW A;  4HSC X;  4I6X A;  1E2Y A;  3F0I A;  1JHB A;  2G0F A;  1MD4 A;  2JSZ A;  4WKW A;  3GKM A;  3TKS E;  1GUL A;  2IFQ A;  4KF9 A;  2K18 A;  2B5X A;  2V6O A;  1M99 A;  1IYH A;  2ES7 A;  3TKQ A;  4EUY A;  2O7K A;  3C73 A;  4N0Z A;  1AXD A;  2A4V A;  1XOB A;  1TTZ A;  4CW9 A;  2VL2 A;  3CXG A;  4IQ1 A;  6GSU A;  2RM5 A;  3I6A A;  3QCP A;  2IPA A;  3KIJ A;  1O8X A;  3ERG A;  4GXZ A;  1FO5 A;  2C0D A;  2XPE A;  4KCE A;  3MNG A;  1BED A;  4G10 A;  2ON5 A;  5G1K A;  3F3R A;  4D73 B;  2A2P A;  5DDL A;  3RPN A;  4OWY A;  4YKF A;  2FUG 2;  1WWJ A;  1PX7 A;  3ISO A;  2VL2 C;  2YPM A;  1OYJ A;  3ZRD A;  1WP0 A;  2HZE B;  4ZBB A;  1QK8 A;  2HSH A;  5IIZ A;  5H5R A;  4YAP A;  2TRC P;  2FWH A;  13GS A;  5AIS A;  4OFT A;  1RW1 A;  1F9M A;  1X9M B;  1THO A;  2KUC A;  2L5L A;  5HQP A;  2VIM A;  5F06 A;  1TP9 A;  2AHE A;  3IAM 2;  5C00 A;  4EVM A;  2H66 A;  2C3Q A;  2JZT A;  1U3A A;  1GTB A;  4XTS A;  3G7Y A;  1PGT A;  4MPF A;  3HCZ A;  1M0U A;  3RBT A;  3CSH A;  3GN3 A;  2MBS A;  3RAZ A;  3L9U A;  5GAP D;  4I8B A;  5C04 A;  5IOX A;  3VPT A;  1ZL9 A;  4ECJ A;  1K0N A;  1TK5 B;  4D73 A;  4MCU A;  1MDJ A;  2R0G A;  3TRQ A;  1ZZY A;  2F51 A;  2NPB A;  2V6K A;  3GST A;  5H5S A;  4IKH A;  1O81 A;  2IME A;  2HZE A;  2AUV A;  5ECM B;  1XW5 A;  2JSY A;  4DSR A;  1G0T A;  2K8S A;  4O7H A;  5E4W A;  3EIN A;  4TXO B;  3EU4 A;  4XCS A;  3UBL A;  3S9F A;  1SU9 A;  5JWO B;  2VAF A;  1M2B A;  2KP1 A;  5A5K A;  3IE3 A;  2B3S A;  3VPQ A;  2FA8 A;  5DJM A;  8GSS A;  5GSS A;  3CSJ A;  1ZMA A;  2VUP A;  4NWY A;  2WGR A;  4ZBD A;  2FGX A;  1FG4 A;  3L0H A;  1Z3E A;  3I43 A;  3U5R E;  4O92 A;  1T3B A;  4BVY B;  1FHE A;  2PVQ A;  3FR9 A;  3UVH A;  3PR8 A;  2H8L A;  3L78 A;  1TU7 A;  3GUR A;  1BYE A;  1GP1 A;  3VWX A;  1O73 A;  2QKE A;  1YY7 A;  2L57 A;  3LJR A;  4Z2T A;  2GVP A;  1I9D A;  1ABA A;  3F4R A;  1GH2 A;  1Z9H A;  1X5E A;  1ZOF A;  4ML1 A;  4TN8 A;  1XWG A;  4V2L A;  4PNF A;  4LA1 A;  3SBC A;  3IDV A;  4TXO A;  2JAC A;  4GSS A;  1PKZ A;  4KND A;  2YN1 A;  4IS0 A;  1QGV A;  2RM6 A;  1FOH A;  3GX0 A;  3ERF A;  3RHB A;  4CDO A;  1A2M A;  4IJI A;  4PUR A;  3P2A A;  4F0C A;  1A0R P;  2YNX A;  2O89 A;  3DWV A;  4XIH A;  1NHY A;  1GTU A;  2B5E A;  2IMF A;  4BVY A;  2PWJ A;  3A2X A;  4BL7 B;  1OKD A;  4NPB A;  2MBT A;  2VCV A;  3TKR A;  1W4V A;  2WFC A;  5JWQ B;  1TDI A;  3ZTL A;  2YZU A;  4MF7 A;  1TK8 B;  1S3R A;  4JR4 A;  5D8I A;  4EC0 A;  2L59 A;  1THX A;  4IQA A;  2DC5 A;  3L9S A;  1DUG A;  1X0R A;  3FZ4 A;  4O32 A;  3LW9 A;  4HU9 A;  5ECQ B;  4L5O A;  3IV4 A;  4J2F A;  3UVT A;  2HXK A;  2X8H A;  1Q4J A;  1F2E A;  3VWW A;  3EU3 A;  4ZL7 A;  1XZO A;  2LEG A;  2XC2 A;  1TRS A;  1VF3 A;  6GSS A;  2GQL A;  3M1G A;  1K0C A;  4JR6 A;  1V40 A;  3ZZX A;  2K9F A;  5CRG A;  4BL7 A;  3DGQ A;  4I2U A;  3UMA A;  1UA5 A;  3ZIV A;  2BJX A;  2MZC A;  1AQW A;  17GS A;  2RUF A;  2F8F A;  3FZ5 A;  2VL3 A;  1OC9 B;  1XBS A;  2PMT A;  3VK9 A;  2H74 A;  1GSU A;  4ZB8 A;  4XS1 A;  2GZY A;  2R6K A;  3KMO A;  3GV1 A;  3C1R A;  5LNK e;  3R2Q A;  3KM6 A;  3BD2 A;  3CTG A;  3LQ7 A;  4BVX B;  2H0H A;  5IO0 A;  1QXH A;  1Q98 A;  3IPZ A;  2WB9 A;  1B48 A;  3E3E A;  3CRT A;  2MYG A;  3ZMK A;  1RK4 A;  2OA7 A;  3IOS A;  1YKC A;  4KCA A;  3IR4 A;  1JZD A;  2P5Q A;  4ECB A;  2DJK A;  1CQG A;  2DIZ A;  5D96 A;  3MIX A;  4KDU A;  4ECI A;  6GSW A;  3R3E A;  2OAD A;  1OC9 A;  1XG8 A;  4GCI A;  5ELA A;  2TRX A;  3QOU A;  3DXB A;  5F0G A;  1MDI A;  1WMJ A;  5IMV A;  2WCI A;  1EWX A;  3LOR A;  2A2R A;  4Q5R A;  3IC4 A;  3GUS A;  3CRU A;  4K5S A;  1A0F A;  2C0G A;  4GF0 A;  2FY6 A;  5CRH A;  2HYX A;  4BVX A;  4EXJ A;  1C72 A;  2PUK C;  2X64 A;  2GSQ A;  5IMF A;  2GS3 A;  5J3R A;  3GFK A;  2AB6 A;  2KHP A;  1B8X A;  4GRF A;  3FKF A;  4ZB9 A;  3Q6O A;  4TRX A;  1S3A A;  2HRK A;  1TKD B;  2YP6 A;  4X43 A;  5G5F A;  3GH6 A;  2LNS A;  5GAN D;  3J7Y b;  2VL9 A;  1PFO A;  3LEF A;  4Q5N A;  3APQ A;  2LRC A;  1PN9 A;  5GST A;  2H1G A;  2DKI A;  4ML6 A;  4EO3 A;  1XWB A;  2O87 A;  4HEA 2;  1FVK A;  3I9V 2;  5D93 A;  4ZXG A;  2FA4 A;  2IMK A;  3TJJ A;  2GLR A;  3CQF A;  1K3O A;  2V32 A;  3KD0 A;  1UVZ A;  3FW2 A;  1SKR B;  1TRU A;  4IHU A;  1BJX A;  4NMU A;  3FZA A;  1ERU A;  1TRW A;  4L8E A;  2QC7 A;  4WBJ A;  4H86 A;  4K2D A;  4K9Z A;  2VLT A;  1TI1 A;  3M8N A;  1GTI A;  3GX8 A;  3F4S A;  3P7X A;  4CHS A;  4ZL9 A;  2F9S A;  4MDC A;  3D5J A;  1S3D A;  2X99 A;  3UEM A;  4HJ2 A;  2H30 A;  1PA3 A;  3QFB C;  3QAV A;  3GH9 A;  3DVX A;  2GZP A;  3KH7 A;  1WPI A;  1SKS B;  4QL9 A;  2VLU A;  1JZW A;  4XRA A;  1T00 A;  2C3N A;  1KTE A;  3KGK A;  3ME7 A;  5CAX A;  4FH8 A;  5ID2 B;  4BPY A;  3TCO A;  2RUE A;  1AC1 A;  1MTC A;  5HR1 A;  2ZUP A;  4ICY A;  1ACV A;  3TDG A;  3GIX A;  3TB2 A;  4N10 A;  1EZK A;  4X1U A;  1PMT A;  2LJR A;  3KCM A;  5ECI B;  2X8G A;  9GSS A;  4QL7 A;  2H76 A;  2VO4 A;  4Z7X A;  1GSY A;  3A3T A;  4HOJ A;  5A4U A;  1XCC A;  1U87 A;  4FO5 A;  2H1D A;  4K0G A;  7GSS A;  4K5R A;  1VF2 A;  3C71 A;  5G2Z A;  2WJU A;  2MMA A;  5JCU A;  1LU4 A;  3D22 A;  3H79 A;  4TXV A;  4E8H A;  1XVW A;  2L6D A;  4XS4 B;  1K0M A;  4DSQ A;  2YJ7 A;  1TW9 A;  3MAK A;  2WRT A;  3HKR A;  2VCZ A;  1G7E A;  1MD3 A;  1Y6E A;  3BJ5 A;  5IOW A;  5CO3 A;  3LSZ A;  2UZ8 A;  3HJM A;  3DD3 A;  1NM3 A;  5ID2 A;  3GTU B;  4K8M A;  3GNJ A;  1XWK A;  3L9V A;  2RLI A;  1SYR A;  1G6Y A;  2CV4 A;  3KTL A;  1FOV A;  3GKK A;  3WGE A;  2IMI A;  18GS A;  4ECC A;  2IWT A;  4HZ2 A;  4YQV A;  3HZ4 A;  1V2A A;  1YQ1 A;  2J9H A;  1QQ2 A;  1OKT A;  5HFI A;  5DBQ A;  5IMZ A;  4Q5F A;  2NVL A;  5ECS A;  1UN2 A;  1BQ7 A;  4LL1 B;  3G9B A;  3H8Q A;  2AJQ B;  1HD2 A;  3ZML A;  1YF1 A;  4WR4 A;  3HYP A;  4XS4 A;  3HDC A;  3FHK A;  3APO A;  1NHO A;  4KGI A;  4L0W A;  2GQK A;  2XBQ A;  3QD9 A;  4IW9 A;  3KJY A;  1FB6 A;  4AJ8 A;  3GTU A;  5AGY A;  1M2A A;  2OE1 A;  4KA0 A;  3ZYW A;  1AIU A;  1HYU A;  4MZB A;  3ZIT A;  2VD0 A;  3IXR A;  3EWL A;  5FT3 A;  2N5B A;  4MK3 A;  4K2X A;  4MZC A;  3G7I A;  4ZL8 A;  1ZYP A;  2JL4 A;  3BBY A;  4ZB6 A;  3TRX A;  2HI7 A;  3RPP A;  3TJK A;  3KTB A;  2HFD A;  3KZQ A;  4OCE A;  2C1Y A;  1YJ6 A;  4TR0 A;  4F9Z A;  3GHA A;  5IPG A;  3GSS A;  3VUR A;  2LST A;  4IJ3 A;  3UOM A;  4EL1 A;  4RI6 A;  4TVE A;  2CX3 A;  2CAI A;  3N5O A;  3M0F A;  3TKP A;  2VM1 A;  3C1S A;  1N2A A;  4CY8 A;  3GKN A;  2CVK A;  4KDY A;  1A8Y A;  3ZVJ A;  4KSO A;  4L5L A;  2C80 A;  5E59 A;  3TKS C;  3IHQ A;  1ZGN A;  1O6J A;  4DSS A;  1A8L A;  4JRR A;  4FYU A;  3F3Q A;  4EE0 A;  3ZVJ D;  1RQM A;  2DJ2 A;  2DMM A;  4A5P A;  2VCX A;  5KOX A;  1URM A;  3KH9 A;  1AQX A;  1PX6 A;  1EV4 A;  3D4M A;  2GDR A;  3DYR A;  2XBI A;  3FR6 A;  3ZFL A;  1EGO A;  4WBR D;  4GST A;  4OCF A;  1DSB A;  1HQO A;  4I5Q A;  2MMO A;  1A23 A;  4GQF A;  2QSI A;  1ERV A;  1XW6 A;  1J9B A;  1T4Y A;  2DKH A;  3D0Z A;  3QDN A;  2V41 A;  1Y25 A;  3QAG A;  2AYT A;  5D9W A;  4MJB A;  4V1A p;  3O76 A;  4ID0 A;  3F63 A;  1XFL A;  1XW9 A;  1AQV A;  2DIY A;  2MMN A;  4MJC A;  3E9J B;  1PSQ A;  3F6F A;  2QGV A;  2PBJ A;  4TKY A;  4EDZ A;  5J5N A;  3SWL A;  3A2V A;  3F6D A;  1M2D A;  3LYK A;  4YQU A;  4K1F A;  3H1N A;  5ECK B;  3MYD A;  2HNL A;  5DAK B;  4N30 A;  1DBY A;  5F8B A;  2M46 A;  4PNG A;  4MF5 A;  2A2S A;  2IMD A;  1JLW A;  2CZ3 A;  2YCD A;  6GSX A;  3HA9 A;  3W6G A;  2OKA A;  1BX9 A;  3KXO A;  1NSW A;  1K3Y A;  1ML6 A;  5EVO A;  2P5R A;  16GS A;  2I81 A;  6GST A;  1Z5Y E;  2F3M A;  2BMX A;  2REM A;  1YF0 A;  2ON7 A;  3TUE A;  4BWQ A;  4EF0 A;  4ACS A;  3J7Y k;  2BTO T;  5KN2 A;  1FW1 A;  4K7I A;  1EEM A;  2HLS A;  2XHF A;  1M9A A;  2LQQ A;  3IAS 2;  3ZLP A;  2J23 A;  2C3T A;  3IK9 A;  4I2T A;  2ZCT A;  1HNB A;  3IBH A;  3EUR A;  5D9V A;  4ILF A;  4DVC A;  3HY2 A;  4F0B A; 
#chains in the Genus database with same CATH homology
 3HJP A;  1VGL A;  1ON4 A;  5ABR A;  4TR3 A;  1EV9 A;  2IL3 A;  3HVS A;  5DAK A;  5G30 A;  2L4Q A;  5F05 A;  4HS1 A;  2DML A;  3VI5 A;  1WE0 A;  2FWE A;  1ZYE A;  1Z6M A;  2X49 A;  5DJL A;  4OMV A;  3TOT A;  1GNW A;  2H0G A;  5DCG A;  4KX4 A;  2P31 A;  1OVN A;  4PX1 A;  1EOH A;  4NV5 A;  5DVB A;  3EC3 A;  3H93 A;  1T8E B;  4HU7 A;  1V9W A;  2E0Q A;  4IBP A;  1GNE A;  5ECP B;  3P8W A;  3PGT A;  6GSV A;  2E7P A;  2OBK A;  3IC8 A;  3LG6 A;  3H4K A;  4YAV A;  3FY7 A;  4LMV A;  3LXZ A;  2NBS A;  4PQ1 A;  1WJK A;  4HDE A;  5HR3 A;  1ILO A;  3IA1 A;  5J41 A;  2P0G A;  3TJG A;  2FD3 A;  5JWR B;  2PU9 C;  2HZF A;  4POB A;  3QMX A;  4X4J A;  4POL A;  2R5G A;  3W8S A;  2MMZ A;  3UAR A;  3CYN A;  2KP2 A;  1YKA A;  2PPT A;  3NIV A;  1T7P B;  2B7J A;  2CT6 A;  5DCH A;  3QAW A;  5KOW A;  4MAB A;  2X8C A;  1EGR A;  4G9H A;  1XWC A;  4J57 E;  1O8W A;  1XOA A;  5CYY A;  4EIQ A;  3D4T A;  1ERW A;  1F3A A;  4WET A;  4F03 A;  3GRX A;  2G2Q A;  3JCM L;  2YZH A;  3A2W A;  4JBB A;  4MH2 A;  6GSY A;  1GLP A;  2GSR A;  4XS6 A;  2C0F A;  3EVI A;  2I1U A;  2H75 A;  3FEU A;  1GWC A;  2CAQ A;  3EE2 A;  1SJI A;  4YQM A;  4O5U A;  5ECL B;  1KNG A;  4AGS A;  5AIX A;  5LCZ A;  1X9W B;  4XHM A;  1R5A A;  3GL3 A;  1OE7 A;  1PL1 A;  3DVW A;  2YWI A;  1PL2 A;  2H1B A;  5A4W A;  1K0B A;  2PVO C;  5D9T A;  5LD0 A;  3VLN A;  4TW5 A;  1ZYQ B;  4WF4 A;  2NDO A;  1IYI A;  2H72 A;  3UAP A;  4ULX A;  2DSA A;  2LTK A;  4JU5 A;  2H6X A;  2E2M A;  1H4O A;  4KSM A;  1VF4 A;  2LRN A;  4IP6 A;  4DEJ A;  1R5P A;  2VCQ A;  4MJE A;  3M9K A;  4BA7 A;  3IHG A;  1U88 A;  2CX4 A;  4WR5 A;  1T4Z A;  4TR1 B;  4AJ6 A;  1M7T A;  4MLY A;  5A4V A;  1A2L A;  4MPG A;  2EC4 A;  2H01 A;  1V57 A;  1H75 A;  4KB3 A;  1GSF A;  3C7M A;  4XRD A;  5FHI A;  2JU5 A;  2HE3 A;  5ECR B;  1XIY A;  2I9H A;  1B9X C;  2B5Y A;  2K8V A;  1O7U A;  3WGX A;  2VOC A;  4ISD A;  1HNC A;  1YDK A;  3QR6 A;  5ELG A;  3HVX A;  1LBK A;  1WIK A;  4G0L A;  4HUA A;  4LL4 B;  1K3L A;  2VD1 A;  3DIE A;  3LGC A;  4PGT A;  2VLV A;  3GYK A;  1TI3 A;  3EMP A;  5IM9 A;  4K0N A;  3DKS A;  1SL1 B;  1F37 A;  1FB0 A;  1B4Q A;  5HR2 A;  3RHC A;  4F2I A;  5ECN B;  1F3B A;  3N9J A;  2JAD A;  3NOF A;  4TR1 A;  5D9X A;  2H19 A;  2YWM A;  2FLS A;  5G31 A;  3BCK A;  2YOI A;  3TJB A;  2GZZ A;  3VWV A;  3EYT A;  4FYB A;  2PN8 A;  2DLX A;  2IN3 A;  4LLR A;  1SJ6 A;  3US3 A;  4MMM A;  5AIV A;  3ED3 A;  3BCI A;  1TOF A;  2FNO A;  1ZCP A;  5DAL A;  1GUK A;  4HZ4 A;  1XXU A;  5B6N A;  11GS A;  5L71 A;  2B7K A;  1Z7P A;  4AJ7 A;  2O85 A;  2LJA A;  4NHW A;  2H71 A;  2OE3 A;  4K7N A;  1U6T A;  2H70 A;  3EPT A;  4IN0 A;  5IQY A;  3E0U A;  2X4A A;  2E2G A;  2AV4 A;  3PH9 A;  1WOU A;  2FHE A;  1GSS A;  2DJJ A;  1OC8 A;  3FYG A;  2VCT A;  3DRN A;  4POM A;  2XPD A;  1SYX A;  4O5R A;  2HRF A;  1R7H A;  2LUS A;  5EL8 A;  3ERW A;  1TK0 B;  4YH2 A;  20GS A;  2DJ0 A;  2KOK A;  4ZBA A;  1PRX A;  2YWO A;  3TGZ A;  4P3Y B;  4JZQ A;  3K8N A;  1JZO A;  4KDX A;  4KAE A;  3GKX A;  4TR4 A;  3APS A;  1K0D A;  3TJF A;  4OO4 A;  3A5I A;  1GSQ A;  4DSS B;  1ZYN A;  2H6Y A;  4YKG A;  2I4A A;  4RQX A;  5H5Q A;  5CRW A;  2B1K A;  5D73 A;  3LWA A;  1B9Y C;  1MEK A;  3C8E A;  1M9B A;  2H0I A;  2CVB A;  1I5G A;  2AAW A;  3TKS A;  1YZX A;  1PN0 A;  5EY6 A;  3FZ9 A;  1B4P A;  3F8U A;  1X5C A;  4KUN A;  3HVV A;  2EIQ A;  3UBK A;  2YV7 A;  3UIW A;  1SKW B;  5HFG A;  3F4T A;  1UC7 A;  4GLT A;  4IP1 A;  4IVF A;  1SD9 A;  2K6V A;  2M72 A;  1E6B A;  1SK1 A;  3WD6 A;  2IJY A;  2EIO A;  3GL5 A;  3P90 A;  3IRA A;  1SL0 B;  2LRT A;  2R3X A;  3OR5 A;  1GLQ A;  4J56 E;  4K6X A;  2GT5 A;  5B8A A;  1GTA A;  3KEB A;  2F8A A;  1ERT A;  3L4N A;  1GRX A;  2YAN A;  1EEJ A;  14GS A;  1YEP A;  2WZ9 A;  2N5A A;  3M9J A;  2LQO A;  5AN1 A;  2LJK A;  5HR0 A;  1A2J A;  5HFK A;  1K0A A;  4EDY A;  3Q19 A;  4PQI A;  5INY A;  5IMA A;  1PD2 1;  4EIP A;  3WGD A;  2CQ9 A;  2HT9 A;  5DQS A;  4RQR A;  4Q5Q A;  4HQZ A;  3D6I A;  1GL8 A;  4X0X A;  3HD5 A;  4MNN A;  1T1V A;  2GGT A;  5COH A;  4NAX A;  1VRS D;  3Q18 A;  4KW6 A;  1XVQ A;  1OC3 A;  2IIY A;  4IGJ A;  1TU8 A;  4NXI A;  4E8E A;  4EKZ A;  1GUH A;  2ZNM A;  3MDK A;  1FAA A;  3LYP A;  4OD7 A;  2GQM A;  4L0U A;  3MWH A;  2OBI A;  4NHZ A;  3NZN A;  1OAZ A;  1SJZ A;  2YJH A;  22GS A;  2A4H A;  1JFU A;  3HZ8 A;  2R4V A;  4WXT A;  2V1M A;  2HSY A;  4MF6 A;  4IEL A;  2EIR A;  4USS A;  2LS5 A;  5F07 A;  2VM2 A;  1USB A;  1DE2 A;  4K7O A;  1AAZ A;  4NV2 A;  1SD8 A;  1GSD A;  3G7J A;  3EMX A;  5J9C A;  1XPV A;  1HNA A;  1YEX A;  3QFA C;  3GMF A;  1N8J A;  5KN0 A;  3DEX A;  3TRP A;  2LKU A;  4GQC A;  5CNW A;  3KP8 A;  1SEN A;  4WF5 A;  3VWU A;  2Z9S A;  4OO5 A;  3V1W A;  2OAC A;  2YV9 A;  2FWG A;  2L4C A;  2TIR A;  1SK0 A;  1V98 A;  5IMD A;  12GS A;  1OE8 A;  1EP7 A;  2PGT A;  4FIW A;  1GSE A;  2C0E A;  2R0P A;  1X9S B;  4MA9 A;  1AUC A;  1R4W A;  4KH7 A;  1O85 A;  2DBC A;  2R37 A;  5JCG A;  1S3C A;  4I97 A;  1JLV A;  4QQ7 A;  5GZZ B;  4LMW A;  4G0I A;  4KE3 A;  1VF1 A;  3ME8 A;  2CZ2 A;  2H6Z A;  2M80 A;  1K0O A;  1CQH A;  3KMN A;  5DQY A;  4OFN A;  3LXT A;  4F82 A;  2DJ1 A;  4ZIJ A;  2LNT A;  3WYW A;  4V1A g;  2OE0 A;  2R2J A;  1LJR A;  3KP9 A;  5JCW A;  1GUM A;  1J08 A;  1SK2 A;  2FCH A;  5IMC A;  1KBN A;  3UL3 A;  1SL2 B;  4PUF C;  2L6C A;  1W89 A;  4RI7 A;  2B1L A;  1V58 A;  4O5Q A;  4GSN A;  5BMU A;  4FQU A;  2WUL A;  2C8U A;  3FRC A;  3WT1 A;  3CSI A;  2CVD A;  10GS A;  2LV3 A;  4BWS A;  2FWF A;  4JE1 A;  4GWR A;  4V2M A;  3D21 A;  4POK A;  2DJ3 A;  4AF2 A;  3A5W A;  2GT6 A;  2NTO A;  5KN1 A;  2JZS A;  5IO2 A;  5FWG A;  3F9U A;  1XWA A;  2YWN A;  4MH3 A;  1AW9 A;  4WEY A;  3VI7 A;  2R0C A;  2GTU A;  4HI7 A;  4PXO A;  2WDU A;  3BOA A;  1DE1 A;  5CRE A;  1EP8 A;  1A24 A;  5KEJ A;  3CMI A;  1QMV A;  2L5O A;  1TXX A;  4V2N A;  5IPH A;  3PIN A;  5KN3 A;  3HXS A;  5B6M A;  19GS A;  4MZW A;  3W8J A;  2QA2 A;  1G7O A;  1U3I A;  1WRY A;  5ENU A;  4PQH A;  5B7C A;  2JZR A;  4FYC A;  1BG5 A;  3ZL5 A;  5B8B A;  2H1A A;  4RUV A;  2I3Y A;  3LFL A;  3O6T A;  5G1L A;  3AY8 A;  2V2G A;  1QFN A;  2CA8 A;  3M3M A;  1JZR A;  1TRV A;  1Z6N A;  1QUW A;  4PUA A;  2KLX A;  3QPM A;  3HJO A;  3DML A;  1Z7R A;  1G6W A;  3CBU A;  4JED A;  1KEB A;  4PTS A;  3VFI A;  2GST A;  3MSZ A;  3ZFB A;  3RDW A;  3Q74 A;  5J9B A;  4N11 A;  2O8V B;  3TOU A;  2VCW A;  5ECO B;  4OFM A;  4HQS A;  4G0K A;  2HSM A;  4ZIL A;  2HRA A;  1X5D A;  2D2Z A;  3FK8 A;  4GTU A;  4CY6 A;  5CRD A;  2RII A;  1PKW A;  2GSS A;  4G2E A;  4Z2R A;  2HRN A;  5EPF A;  2N5F A;  2IFQ B;  4MJA A;  5J4U A;  4HJM A;  2OJL A;  2B6M A;  1NW2 A;  1PQN A;  4G19 A;  2QA1 A;  5G5E A;  5DAL B;  2WS2 A;  5BRT A;  4Z2U A;  5ECH B;  2H73 A;  1MDK A;  5CP1 A;  3O3T A;  3PPU A;  3FR3 A;  3GA4 A;  1F6M C;  2ALB A;  1EOG A;  1J0F A;  4N0V A;  2PER A;  1FVJ A;  3HHV A;  3UJ1 A;  3WT2 A;  3I69 A;  3ZRE A;  1BAY A;  4TOP A;  1ST9 A;  3CTF A;  1R26 A;  3U6V A;  3ZIJ A;  3IK7 A;  2C4J A;  4MP4 A;  1TJD A;  3FMW A;  4I6X A;  1E2Y A;  3F0I A;  1JHB A;  2G0F A;  1MD4 A;  2JSZ A;  4WKW A;  3GKM A;  3TKS E;  1GUL A;  2IFQ A;  4KF9 A;  2K18 A;  2B5X A;  2V6O A;  1M99 A;  1IYH A;  2ES7 A;  3TKQ A;  4EUY A;  2O7K A;  3C73 A;  4N0Z A;  1AXD A;  2A4V A;  1XOB A;  1TTZ A;  4CW9 A;  2VL2 A;  3CXG A;  4IQ1 A;  6GSU A;  2RM5 A;  3I6A A;  3QCP A;  2IPA A;  3KIJ A;  1O8X A;  3ERG A;  4GXZ A;  1FO5 A;  2C0D A;  2XPE A;  4KCE A;  3MNG A;  1BED A;  4G10 A;  2ON5 A;  5G1K A;  3F3R A;  4D73 B;  2A2P A;  5DDL A;  3RPN A;  4OWY A;  4YKF A;  2FUG 2;  1WWJ A;  1PX7 A;  3ISO A;  2VL2 C;  2YPM A;  1OYJ A;  3ZRD A;  1WP0 A;  2HZE B;  4ZBB A;  1QK8 A;  2HSH A;  5IIZ A;  5H5R A;  4YAP A;  2TRC P;  2FWH A;  13GS A;  5AIS A;  4OFT A;  1RW1 A;  1F9M A;  1X9M B;  1THO A;  2KUC A;  2L5L A;  5HQP A;  2VIM A;  5F06 A;  1TP9 A;  2AHE A;  3IAM 2;  5C00 A;  4EVM A;  2H66 A;  2C3Q A;  2JZT A;  1U3A A;  1GTB A;  4XTS A;  3G7Y A;  1PGT A;  4MPF A;  3HCZ A;  1M0U A;  3RBT A;  3CSH A;  3GN3 A;  2MBS A;  3RAZ A;  3L9U A;  5GAP D;  4I8B A;  5C04 A;  5IOX A;  3VPT A;  1ZL9 A;  4ECJ A;  1K0N A;  1TK5 B;  4D73 A;  4MCU A;  1MDJ A;  2R0G A;  3TRQ A;  1ZZY A;  2F51 A;  2NPB A;  2V6K A;  3GST A;  5H5S A;  4IKH A;  1O81 A;  2IME A;  2HZE A;  2AUV A;  5ECM B;  1XW5 A;  2JSY A;  4DSR A;  1G0T A;  2K8S A;  4O7H A;  5E4W A;  3EIN A;  4TXO B;  3EU4 A;  4XCS A;  3UBL A;  3S9F A;  1SU9 A;  5JWO B;  2VAF A;  1M2B A;  2KP1 A;  5A5K A;  3IE3 A;  2B3S A;  3VPQ A;  2FA8 A;  5DJM A;  8GSS A;  5GSS A;  3CSJ A;  1ZMA A;  2VUP A;  4NWY A;  2WGR A;  4ZBD A;  2FGX A;  1FG4 A;  3L0H A;  1Z3E A;  3I43 A;  3U5R E;  4O92 A;  1T3B A;  4BVY B;  1FHE A;  2PVQ A;  3FR9 A;  3UVH A;  3PR8 A;  2H8L A;  3L78 A;  1TU7 A;  3GUR A;  1BYE A;  1GP1 A;  3VWX A;  1O73 A;  2QKE A;  1YY7 A;  2L57 A;  3LJR A;  4Z2T A;  2GVP A;  1I9D A;  1ABA A;  3F4R A;  1GH2 A;  1Z9H A;  1X5E A;  1ZOF A;  4ML1 A;  4TN8 A;  1XWG A;  4V2L A;  4PNF A;  4LA1 A;  3SBC A;  3IDV A;  4TXO A;  2JAC A;  4GSS A;  1PKZ A;  4KND A;  2YN1 A;  4IS0 A;  1QGV A;  2RM6 A;  1FOH A;  3GX0 A;  3ERF A;  3RHB A;  4CDO A;  1A2M A;  4IJI A;  4PUR A;  3P2A A;  4F0C A;  1A0R P;  2YNX A;  2O89 A;  3DWV A;  4XIH A;  1NHY A;  1GTU A;  2B5E A;  2IMF A;  4BVY A;  2PWJ A;  3A2X A;  4BL7 B;  1OKD A;  4NPB A;  2MBT A;  2VCV A;  3TKR A;  1W4V A;  2WFC A;  5JWQ B;  1TDI A;  3ZTL A;  2YZU A;  4MF7 A;  1TK8 B;  4EC0 A;  4JR4 A;  5D8I A;  2L59 A;  1THX A;  4IQA A;  2DC5 A;  3L9S A;  1DUG A;  1X0R A;  3FZ4 A;  4O32 A;  3LW9 A;  4HU9 A;  5ECQ B;  4L5O A;  3IV4 A;  4J2F A;  3UVT A;  2HXK A;  2X8H A;  1Q4J A;  1F2E A;  3VWW A;  3EU3 A;  4ZL7 A;  1XZO A;  2LEG A;  2XC2 A;  1TRS A;  1VF3 A;  6GSS A;  2GQL A;  3M1G A;  1K0C A;  4JR6 A;  1V40 A;  3ZZX A;  2K9F A;  5CRG A;  4BL7 A;  3DGQ A;  4I2U A;  3UMA A;  1UA5 A;  3ZIV A;  2BJX A;  2MZC A;  1AQW A;  17GS A;  2RUF A;  2F8F A;  3FZ5 A;  2VL3 A;  1OC9 B;  1XBS A;  2PMT A;  3VK9 A;  2H74 A;  1GSU A;  4ZB8 A;  4XS1 A;  2GZY A;  2R6K A;  3KMO A;  3GV1 A;  3C1R A;  5LNK e;  3R2Q A;  3KM6 A;  3BD2 A;  3CTG A;  3LQ7 A;  4BVX B;  2H0H A;  5IO0 A;  1QXH A;  1Q98 A;  3IPZ A;  2WB9 A;  1B48 A;  3E3E A;  3CRT A;  2MYG A;  3ZMK A;  1RK4 A;  2OA7 A;  3IOS A;  1YKC A;  4KCA A;  3IR4 A;  1JZD A;  2P5Q A;  4ECB A;  2DJK A;  1CQG A;  2DIZ A;  5D96 A;  3MIX A;  4KDU A;  4ECI A;  6GSW A;  3R3E A;  2OAD A;  1OC9 A;  4GCI A;  5ELA A;  2TRX A;  3QOU A;  3DXB A;  5F0G A;  1MDI A;  1WMJ A;  5IMV A;  2WCI A;  1EWX A;  3LOR A;  2A2R A;  4Q5R A;  3IC4 A;  3GUS A;  3CRU A;  4K5S A;  1A0F A;  2C0G A;  4GF0 A;  2FY6 A;  5CRH A;  2HYX A;  4BVX A;  4EXJ A;  1C72 A;  2PUK C;  2X64 A;  2GSQ A;  5IMF A;  2GS3 A;  5J3R A;  3GFK A;  2AB6 A;  2KHP A;  1B8X A;  4GRF A;  3FKF A;  4ZB9 A;  3Q6O A;  4TRX A;  1S3A A;  2HRK A;  1TKD B;  2YP6 A;  4X43 A;  5G5F A;  3GH6 A;  2LNS A;  5GAN D;  3J7Y b;  2VL9 A;  3LEF A;  4Q5N A;  3APQ A;  2LRC A;  1PN9 A;  5GST A;  2H1G A;  2DKI A;  4ML6 A;  4EO3 A;  1XWB A;  2O87 A;  4HEA 2;  1FVK A;  3I9V 2;  5D93 A;  4ZXG A;  2FA4 A;  2IMK A;  3TJJ A;  2GLR A;  1K3O A;  2V32 A;  3KD0 A;  1UVZ A;  3FW2 A;  1SKR B;  1TRU A;  4IHU A;  1BJX A;  4NMU A;  3FZA A;  1ERU A;  1TRW A;  4L8E A;  2QC7 A;  4WBJ A;  4H86 A;  4K2D A;  4K9Z A;  2VLT A;  1TI1 A;  3M8N A;  1GTI A;  3GX8 A;  3F4S A;  3P7X A;  4CHS A;  4ZL9 A;  2F9S A;  4MDC A;  3D5J A;  1S3D A;  2X99 A;  3UEM A;  4HJ2 A;  2H30 A;  1PA3 A;  3QFB C;  3QAV A;  3GH9 A;  3DVX A;  2GZP A;  3KH7 A;  1WPI A;  1SKS B;  4QL9 A;  2VLU A;  1JZW A;  4XRA A;  1T00 A;  2C3N A;  1KTE A;  3KGK A;  3ME7 A;  5CAX A;  4FH8 A;  5ID2 B;  4BPY A;  3TCO A;  2RUE A;  1AC1 A;  1MTC A;  5HR1 A;  2ZUP A;  4ICY A;  1ACV A;  3TDG A;  3GIX A;  3TB2 A;  4N10 A;  1EZK A;  4X1U A;  1PMT A;  2LJR A;  3KCM A;  5ECI B;  2X8G A;  9GSS A;  4QL7 A;  2H76 A;  2VO4 A;  4Z7X A;  1GSY A;  3A3T A;  4HOJ A;  5A4U A;  1XCC A;  1U87 A;  4FO5 A;  2H1D A;  4K0G A;  7GSS A;  4K5R A;  1VF2 A;  3C71 A;  5G2Z A;  2WJU A;  2MMA A;  5JCU A;  1LU4 A;  3D22 A;  3H79 A;  4TXV A;  4E8H A;  1XVW A;  2L6D A;  4XS4 B;  1K0M A;  4DSQ A;  2YJ7 A;  1TW9 A;  3MAK A;  2WRT A;  3HKR A;  2VCZ A;  1G7E A;  1MD3 A;  1Y6E A;  3BJ5 A;  5IOW A;  5CO3 A;  3LSZ A;  2UZ8 A;  3HJM A;  3DD3 A;  1NM3 A;  5ID2 A;  3GTU B;  4K8M A;  3GNJ A;  1XWK A;  3L9V A;  2RLI A;  1SYR A;  1G6Y A;  2CV4 A;  3KTL A;  1FOV A;  3GKK A;  3WGE A;  2IMI A;  18GS A;  4ECC A;  2IWT A;  4HZ2 A;  4YQV A;  3HZ4 A;  1V2A A;  1YQ1 A;  2J9H A;  1QQ2 A;  1OKT A;  5HFI A;  5DBQ A;  5IMZ A;  4Q5F A;  2NVL A;  5ECS A;  1UN2 A;  1BQ7 A;  4LL1 B;  3G9B A;  3H8Q A;  2AJQ B;  1HD2 A;  3ZML A;  1YF1 A;  4WR4 A;  3HYP A;  4XS4 A;  3HDC A;  3FHK A;  3APO A;  1NHO A;  4KGI A;  4L0W A;  2GQK A;  2XBQ A;  3QD9 A;  4IW9 A;  3KJY A;  1FB6 A;  4AJ8 A;  3GTU A;  5AGY A;  1M2A A;  2OE1 A;  4KA0 A;  3ZYW A;  1AIU A;  1HYU A;  4MZB A;  3ZIT A;  2VD0 A;  3IXR A;  3EWL A;  5FT3 A;  2N5B A;  4MK3 A;  4K2X A;  4MZC A;  3G7I A;  4ZL8 A;  1ZYP A;  2JL4 A;  3BBY A;  4ZB6 A;  3TRX A;  2HI7 A;  3RPP A;  3TJK A;  3KTB A;  2HFD A;  3KZQ A;  4OCE A;  2C1Y A;  1YJ6 A;  4TR0 A;  4F9Z A;  3GHA A;  5IPG A;  3GSS A;  3VUR A;  2LST A;  4IJ3 A;  3UOM A;  4EL1 A;  4RI6 A;  4TVE A;  2CX3 A;  2CAI A;  3N5O A;  3M0F A;  3TKP A;  2VM1 A;  3C1S A;  1N2A A;  4CY8 A;  3GKN A;  2CVK A;  4KDY A;  1A8Y A;  3ZVJ A;  4KSO A;  4L5L A;  2C80 A;  5E59 A;  3TKS C;  3IHQ A;  1ZGN A;  1O6J A;  4DSS A;  1A8L A;  4JRR A;  4FYU A;  3F3Q A;  4EE0 A;  3ZVJ D;  1RQM A;  2DJ2 A;  2DMM A;  4A5P A;  2VCX A;  5KOX A;  1URM A;  3KH9 A;  1AQX A;  1PX6 A;  1EV4 A;  3D4M A;  2GDR A;  3DYR A;  2XBI A;  3FR6 A;  3ZFL A;  1EGO A;  4WBR D;  4GST A;  4OCF A;  1DSB A;  1HQO A;  4I5Q A;  2MMO A;  1A23 A;  4GQF A;  2QSI A;  1ERV A;  1XW6 A;  1J9B A;  1T4Y A;  2DKH A;  3D0Z A;  3QDN A;  2V41 A;  1Y25 A;  3QAG A;  2AYT A;  5D9W A;  4MJB A;  4V1A p;  3O76 A;  4ID0 A;  3F63 A;  1XFL A;  1XW9 A;  1AQV A;  2DIY A;  2MMN A;  4MJC A;  3E9J B;  1PSQ A;  3F6F A;  2QGV A;  2PBJ A;  4TKY A;  4EDZ A;  5J5N A;  3SWL A;  3A2V A;  3F6D A;  1M2D A;  3LYK A;  4YQU A;  4K1F A;  3H1N A;  5ECK B;  3MYD A;  2HNL A;  5DAK B;  4N30 A;  1DBY A;  5F8B A;  2M46 A;  4PNG A;  4MF5 A;  2A2S A;  2IMD A;  1JLW A;  2CZ3 A;  2YCD A;  6GSX A;  3HA9 A;  3W6G A;  2OKA A;  1BX9 A;  3KXO A;  1NSW A;  1K3Y A;  1ML6 A;  5EVO A;  2P5R A;  16GS A;  2I81 A;  6GST A;  1Z5Y E;  2F3M A;  2BMX A;  2REM A;  1YF0 A;  2ON7 A;  3TUE A;  4BWQ A;  4EF0 A;  4ACS A;  3J7Y k;  2BTO T;  5KN2 A;  1FW1 A;  4K7I A;  1EEM A;  2HLS A;  2XHF A;  1M9A A;  2LQQ A;  3IAS 2;  3ZLP A;  2J23 A;  2C3T A;  3IK9 A;  4I2T A;  2ZCT A;  1HNB A;  3IBH A;  3EUR A;  5D9V A;  4ILF A;  4DVC A;  3HY2 A;  4F0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...