3DMNA

The crystal structure of the c-terminal domain of a possilbe dna helicase from lactobacillus plantarun wcfs1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
170
structure length
161
Chain Sequence
ASYRSTQQITDFTKEILVNRQGDLPNVVVTPNFEAGVDQVVDQLAMNDSERDTTAIIGKSLAECEALTKALKARGEQVTLIQTENRLAPGVIVVPSFLAKGLEFDAVIVWNANQENYQREDERQLLYTICSRAMHELTLVAVGSLSPLLARVNHALYTLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the C-terminal domain of a possilbe DNA helicase from Lactobacillus plantarun WCFS1
rcsb
source organism Lactobacillus plantarum
molecule tags Structural genomics, unknown function
molecule keywords Putative DNA helicase
total genus 55
structure length 161
sequence length 170
ec nomenclature
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13538 UvrD_C_2 UvrD-like helicase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dmnA00
4M9SA 2O8BA 4TN1A 4A4DA 4MGKR 4UNNA 1VHTA 3U5ZB 2KBEA 3A37A 4GP6A 4TWZA 3VNUA 4C2UA 2ZSBA 1GFIA 1OFHA 2BOVA 2JGNA 2QTHA 2FEMA 3RSLA 1N0WA 3THYA 2B7CA 1VIYA 2Z6VA 1HA3A 2GCOB 1XEFA 3K0CA 2HJVA 4Q7JB 4BZQA 2X77A 4JSTA 3TAHA 3MFYA 5FTKA 4A92A 2OAP1 1R0ZA 4US2R 4C7OB 4N3NA 2QAGC 3W3AA 3RHFA 1EX7A 1CU1A 4DIDA 1FOEB 4LJ7A 2QE7D 2JJ1D 2OBLA 3QQ5A 1E4YA 1G41A 1ZM7A 5L3QA 2EFEB 5J40A 1RRGA 1W49A 1U8ZA 1NI3A 2R6AA 2GBLA 1Z2AA 2ZS7A 1JR3D 4ZDWA 3BH0A 1KI6B 4MRNA 2FF7A 3IPXA 4M22A 4RJLA 3GLGB 3H84A 5E95A 1CEEA 3DKVA 3IBGA 4JKYA 4AURA 3GEEA 1SGWA 1XJQA 3LBIA 1RE0A 4PTLA 3WNCA 1SXJE 1XP8A 5B58C 4NYIQ 5C4GB 2HCJB 3KJIA 1E3MA 4Y0AA 4I81A 2G1JA 3U7FB 2KE5A 4LPSA 4HLDA 4WZAE 5DSZA 1KO5A 1KSFX 2ZRAA 2OFXA 3TRFA 1TUEA 1BO6A 2R65A 4PC7A 1IN4A 2RGXA 5JWRA 4JBXA 5IF9A 3BB3A 3AF3A 3W8RA 2OZEA 2E1RA 3IUYA 1PJRA 3AEZA 3ECCA 2D74A 5IDVA 2JLUA 1II0A 3K0FB 5BW8A 4MRRA 2W83A 4EPTA 2JASA 3WNBA 4QOSA 2XAUA 5J47A 5HCNA 4RZUA 3EW9A 4BEBA 1E0JA 2ZANA 2VP5A 1KJYA 3KXLA 2AN9A 2ZITA 3A36A 4QBGB 2IEYA 2YOHA 4IXMA 3SOPA 1XTJA 3HYRA 4EPRA 1E32A 1W4AA 1ZVQA 1VG0B 2Z4SA 3BK7A 2BBWA 3TR0A 2ASEA 1ZNXA 1YQTA 3DZ8A 3VR1A 4Q4JB 1KSHA 2QPTA 2QTFA 3NBXX 1OYWA 2P3SA 3AVVA 1XCPA 1CXZA 2AR7A 1OIXA 2REBA 2CK3A 3RABA 1MO5A 2QT0A 1KI2A 2ZYTX 2IXEA 2TMKA 1N6PA 2CVFA 4PXAA 4YMWA 4TLCA 5KDLA 4WAUA 2KB0A 5HTKA 3AP3A 1HH4A 1S1MA 4EFLA 2IS6A 2WV9A 3FHOA 4EJSA 1KI4A 5JJLA 2ZJ8A 3T1OA 2QQEA 1VG1A 4H9GA 1RKBA 1HTWA 1NLFA 2VHTA 3IDQA 3PFIA 5F2EA 4OBEA 2MSCB 2G0NA 2NG1A 1C4OA 4HSEA 2GEDA 5AK0A 1E9BA 2WTUA 1TQDA 1T5LA 4LHYA 4PHTA 2BMEA 2ZU0C 4TYYA 1YZTA 3CRVA 2DY1A 1NBME 1IONA 3LXRA 4EQ6B 5JS7A 5HCIA 5LPNA 3OFND 4URYR 1ZUNB 2BKUA 2IYSA 4RD6A 4JLVA 4TLDA 5CLQA 3RS4A 1Z06A 2JDID 2EWVA 1RPZA 1KJZA 3KB2A 4DLUA 1AZTA 4GT1A 4IXNA 1GP2A 2PLRA 3ZJYA 1GRRA 1QG4A 1L2TA 2XSZA 4JL5A 1N6LA 5CM8B 3LXXA 3QNUA 4Q4AA 1GILA 4XTRA 3DO6A 1S4QA 3LWNA 4PZYA 3W8NA 4TT3A 4ZDKA 1BH2A 1VTKA 4JKIA 4FCWA 3ZVMA 5FBVB 5KSYA 4A8JB 3M0EA 1LB1B 1K5GA 5BYJA 2FZ4A 3CX7A 1AQUA 1UM8A 4I99A 2ATXA 2P65A 1Z63A 3EIQA 1QHGA 4P4SB 3THWA 4A8JC 3L0OA 5JSZA 1NBMD 3ZVRA 3U4QB 2KI5A 2NPFA 1CJUC 3HR7A 4GOXA 3TK1A 1XPRA 1ZU4A 1J99A 1RC8A 4KFUA 3V4FA 2QMOA 3P4YA 4FMDF 4EDHA 3BC1A 2ZJOA 3GLIB 4F92B 1QDEA 2XZLA 1GM5A 2JJ8A 3A1SA 3U3RA 4W5WA 4NDZA 3AVPA 3R9XA 1G5TA 4PPNA 3BAFA 3T61A 2YHSA 4QFMA 1ODFA 5G3ZA 3RS2A 2F1RA 5FPKA 4MYCA 3W3ZB 5K8LA 4N0EA 4QGHA 1J70A 1JQLB 3I8SA 5DYGA 1NNEA 4MKFA 4KFTA 3DM9B 4LDJA 3CWZA 2WWHA 4TLBA 3I72A 2RGGA 1G6OA 1SXJA 3MRSA 5EZ5A 3EZ2A 3QKSA 2IXFA 1QHNA 2F3RA 2DR3A 2BM1A 1ZD8A 1SKYB 1E2JA 1V43A 4HI0E 3UK6A 4BFSA 2JLVA 3EPHA 3GLHE 1D9XA 5FI1B 2PX3A 1IJEA 3GMTA 4E5UA 4HUQB 4BFXA 1E96A 2YNMA 1Q1BA 3AKCA 1Q44A 1W47A 1VECA 1U94A 1WMSA 1VCNA 1UFQA 2CBZA 5FBRB 4Q18A 4O0MA 4M1MA 4Q01A 1KOFA 1KKLA 4M9QA 1TQ2A 3BIFA 5IT5A 4M9ZA 1CR4A 2PEYA 1NIJA 4GSYA 5JWHA 4D4LA 4DCVA 3TNFA 5DN6D 4ZKDA 3RRNA 1G8FA 2PT7A 3KUDA 4RFSB 3AB3A 2GCPA 2IW3A 4Y0VA 2YZ2A 3TW8B 4UNPA 1OJLA 2ZU6A 5TB5A 4PHHA 2IYQA 4K8OA 4GOKA 5JS8A 2AD1A 1ZAKA 1GKYA 4R71A 3QF4B 4DBLC 4YQFA 1CKEA 1R5OA 1NY5A 2QP4A 2IYWA 1DPFA 1S3SA 2CXXA 3QXJA 2PH1A 1E1RA 4NPHA 1DVRA 3LY5A 2NZJA 2W00A 3EZ9A 3FMOB 5DE3A 3U44A 3QG5A 1E9FA 5JJIA 2AL7A 1PZNA 1YKSA 5FL7D 3B5JA 2ZM5A 4BECA 4OQLA 1W7AA 2WVJA 5FOVA 3KTAA 4LV6A 4QJ5A 1Q3TA 2Q9AA 5C4MA 1OYYA 1OE0A 2C9OA 4CVNA 1AA9A 1IOZA 4AYXA 1UF9A 1N3BA 4A0HA 3DOEA 3FOZA 2WIAA 4LV5B 3GJ6A 4IEEA 4ITRC 2HF8A 2REOA 3S1AB 1FQJA 4GOJA 4Q5IA 1TUIA 1IBRA 2YWGA 3BJIC 1TU4A 4U7DA 3NHBA 1COWA 1HE8B 1LW7A 421PA 1F3OA 3PUZA 3LV8A 4NONA 4QL3A 1Q1ZA 1AKYA 4UKDA 4I1SA 1D2NA 3SN6A 3WBJA 3VR2A 4BFTA 5JWOA 3IPYA 1KK2A 2BCJQ 3TSZA 4ASUA 2ZR9A 2GJAA 2ZRIA 4DC9A 1EFHA 1HUQA 2EFGA 1WE2A 4MH0R 4P33A 2WWXA 4RZXA 3Q9LA 3FMIA 3Q85A 1W36C 4LHWA 4Q9KA 4M1YA 4PAMA 4DCNA 2OG2A 3LVQE 1D5CA 1AGPA 1FUUA 1TMKA 3OIWA 4B47A 1QRAA 3VTKA 3B7GA 3B1WA 3UG6A 2ZJYA 3QJYA 3X1ZA 2J0UA 2FSIA 2VLIA 4MGZR 4ZCLA 5CB8A 3VKHA 2XX3A 5BQ5A 1XZPA 1EGAA 2ZUDA 3AKDA 3ZIAA 1F2TB 4B2PA 3NWJA 5KDOA 2XNDA 2V7QA 3FVQA 2V54A 4U5XA 1J8MF 2ORIA 3HU1A 3UPUA 1YZNA 1WF3A 2ZRBA 1OFUX 1QHIA 4L5BA 3AVOA 4IVPA 2XOKA 1II8B 4B73A 2VA8A 4DUGD 1G18A 1A82A 1Z0KA 4IOLA 2NPIA 1KTVA 3EC1A 3MJHA 2IC5A 2GEUA 2ODEA 4LPKA 1Z5ZA 2BMDA 4C4PA 4Z8YA 2DWQA 1GNPA 3EXAA 4R7ZA 4A6XA 4B48A 4DDVA 1E4VA 2J46A 3PV0A 2WJIA 4MDFA 4HB4A 2I1QA 1ZNZA 2IYRA 3MMPA 4U02A 3TIFA 3A6PC 2ZPTX 3KX2A 3GLHA 1IY2A 3KQNA 2O8FA 3BBPA 2WWGA 1AKEA 4Q66C 1H8HA 2PMKA 3BS4A 2ZXUA 3K0AA 4KHZA 3EX7C 5F9HA 4G1UC 2ODBA 1DO0A 4BLSA 3OHMA 1SKQA 2HDNB 2EWWA 1QHHB 2NQ2C 1CRQA 3FE2A 4PX9A 4AK9A 1AJEA 3UATA 5CYPA 1W36D 4CEJA 4LY6A 1FTNA 3ZQJA 2VP6A 3SU8A 2O52A 5AUPB 2O0KA 3L2OB 3I5XA 1EX6A 4YLGA 3K70D 2JLYA 3H1TA 5FPHA 2NTYC 1KSJA 1JXMA 2BMFA 2NO7A 1P2VA 4ARZB 2JLZA 4BQSA 1XEXB 3BD9A 1SVIA 2XB2A 4NKRA 1HQYE 3AV0B 1I4LD 2CL7X 1NBMA 3B9QA 5JBQA 2BC9A 1GL7A 1P6XA 1XCMA 4LK2A 2R6DA 3TSWA 1NL3A 2OXRA 2CK3D 2RKOA 2QAGA 1G3QA 3GJ7A 3ND8A 5FPTA 3RRMA 2QMEA 2W2TA 2WSSA 1Q22A 1DAFA 5FOSA 2FZLA 1M1YE 1ZNYA 5JFGA 1UBGA 1KY3A 3GFPA 4F4IA 3NDPA 5JJKA 1P75A 1MRNA 121PA 2ZRPA 3E70C 4NMMA 3F3YA 4DLVA 2P6NA 1HYQA 3QIAA 3JVVA 4GZLA 4EFMA 2IS1A 3QKRB 1R7RA 4HB2A 4Q9LA 2RGNA 4QXAA 1ZM2A 4L4UA 3X1YA 1E69A 2P5TB 4JLKA 4PPGA 4IDHA 4ZDIA 4X8OA 5EP2A 3W6OA 2GAOA 4I1VA 2YYZA 3CH4B 1VYTA 1KDOA 2QN6A 1UKZA 2ZJAA 1E9SA 3K0CC 2CHQA 2CLDX 4DT1B 1FUKA 5FBQB 3BGWA 2O8CA 4JLOA 3THXA 1YZUA 1ZUHA 2DFLA 5J4VA 1ONBA 3NBFA 1EWRA 3NBYC 3VQTA 4YMUA 1DTSA 4TMZA 4K81B 4G5QA 4HDOB 4A36A 1CR2A 4W5JA 3A4LA 2WMOB 1S1CA 3EPJA 1T3SA 2OLJA 1OPXA 4RD1A 4PPFA 4HAXA 3ETLA 5TMPA 2O5VA 1Z0DA 2GETA 3LW8A 1XJ0A 1N25A 3FFBA 4OQNA 2ZRFA 1IY0A 2QG6A 3KJHA 1G17A 2OM2A 2HF9A 3IO5A 3IGFA 3OIUA 4OI2A 2VSOA 1XXHB 2R9VA 3FTQA 3ICEA 3PUVA 4JT4A 2W6IA 3MAAC 3K0SA 3BWDD 5JCPA 4TTPA 621PA 3SS8A 1G3IA 2FGJA 1CIPA 5FPYA 3RC8A 5G41A 4GPTA 4CYMA 1JPNA 2DPXA 5KUTA 4BEJA 3MCAA 2ZETA 1U8YA 4UXIA 3CX8A 5C2JB 2C5LA 1DBSA 4DB4A 3B13B 3LO5A 3T12A 4ESVA 2PBRA 1XNJA 4LJ9A 4QHTA 1E2MA 3CB4A 3K9GA 1G3RA 5D3MA 2ZE7A 2ZS9A 5FBWB 1IJFA 3Q5DA 1XTRA 1ZMXA 2WMNB 2IUTA 1ZC3A 1YZGA 1CR1A 1GITA 4LYAA 2A30A 3VX3A 1J90A 1LS1A 4QGAA 1R4AA 1Q21A 2ZR0A 3CZPA 3CPHA 2ECKA 4AKIA 3ZVLA 2ATVA 4FWIB 2RGAA 2YOGA 1XTQA 4LGMA 3VR6A 4KODA 3GP8A 2NO9A 3EA0A 3KFVA 4DLSA 2ZREA 4ASUD 3H2YA 2FOLA 2H16A 2NIPA 3G82C 4QM6A 2ZJBA 1JAHA 4UNSA 1NSFA 5BN3A 2BDTA 4PSKA 2GCNA 2ZUBA 4TL7A 2XNSA 1IQPA 1HURA 3NXSA 3KKMA 4O2LA 5IK2A 4AD8A 4A2PA 3ZD7A 1T3HA 2A5JA 1UKYA 2OE2A 4JVSB 4LUCA 5UKDA 5J4KA 4OI0A 4CGZA 3HYTA 4GMXA 1TNDA 2JDIA 4XSHA 3FMPB 4QBHA 1IAQA 3M6AA 4ERNA 5HZKA 1ZYUA 2WWIA 3KKOA 3S1AA 3T5GA 3EZ6A 3CR7A 1GAJA 1KO4A 1E1QA 2N1BA 4FW9A 4P3YA 5KYKA 4HAWA 1XTIA 1E2FA 2BKEA 2NGRA 4BE7B 1C1YA 4DSUA 3UWKA 1ZC4A 2AD5A 4EIWA 1NJGA 4XVUA 5JZVA 2XITA 4R9UC 2F1HA 3MWYW 2OLKA 1RYFA 1KDPA 1MABA 1JQJC 3THXB 2D7DA 3F0TA 4B6EA 5JECA 4KXFB 4P31A 3RS5A 1ETUA 3HU3A 4Q4AB 2YJTD 1EFUA 3WP0A 3V4RA 2D3WA 4JVLA 2QPOA 2V8OA 4KITB 4KI0A 3SE0A 3WP1B 1XMSA 2IT1A 1ZIOA 5SZHB 2IBMA 4BLPA 1E0AA 1OXXK 3IILA 4UQOA 5CM9C 4LYJA 3CH5A 3B78A 3LLUA 1AQYA 4PAQA 3FPAA 2OBMA 5CJPA 3AVWA 3P1JA 2OAQ1 3CUEF 2P5SA 3U7HB 3TLXA 2Q21A 2F9MA 3SJBA 4GL2A 4DB2A 4B2LA 2RGDA 3PEVA 3U61B 1ZCAA 3TVDA 4HZUB 1FP7A 1XMIA 2EFHB 2Z5FA 2IYUA 2KBFA 4OK6A 3IIJA 2HT1A 5JRZA 3QPVA 4QHSA 3VMFA 5JEDA 4S35A 4MUBA 1NSTA 4LBYA 2G88A 3B1VA 4B74A 3VFDA 4NCJA 2W6ID 2P6RA 2C77A 4QHYA 4BLOA 4HLUA 4NCIA 3QI2A 4LCBA 3OEED 5EJEA 2YWEA 3IKJA 2V1UA 3SC3A 1AK2A 2AX4A 2QQ0A 2GDJA 2Q6TA 1NJFA 2VEDA 3LA6A 2AHOA 2VYFA 5KO2A 1OFTA 1ESMA 1SULA 1SVOA 4L8GA 3I92A 4B34A 3OEHA 4GZMA 3ZD6A 4KBFA 1DG3A 1SXJB 5FUXA 3BE4A 3O8CA 1IXRC 1QHYA 1HT1E 4E07A 3AF2A 2GJSA 4JLPA 5F3WB 1RRFA 2CMKA 2IWHA 3G0HA 3RRZA 4Q1BA 3X1XA 4BUJA 2VP2A 3OF5A 3GLGE 1GL6A 4AC9A 5CIWA 1RRPA 3ZZ0A 4JMPA 1FX0A 2GESA 1I4TD 1IN6A 3OAAD 2OV2A 4C30A 4OKSA 4EAQA 1ZRHA 4IDNA 3GLIA 1OHHA 1YR8A 4HB0A 2AXPA 4N1AA 5FL7A 4JL6A 5FR1A 2FH5B 5J4LA 4POAA 3F5FA 4A15A 4KFSA 4ZI3A 1ZW6A 4AKEA 4JT2A 2NOAA 1JXOA 3WHKA 1WQ1R 3CIOA 1D6JA 3B1YA 3T15A 3CPJB 3LQQA 3ADKA 2ZYUX 1JEEA 5FFMA 2V1XA 4DZZA 4A1FA 3SFZA 2ZRMA 4DCUA 1I4DD 3K09A 5BYKA 2AKYA 1FW6A 1QVAA 2PMDA 1KZGB 2V9PA 2A5DA 2QEQA 4TZ6A 1NVWQ 1Z3IX 4IFEA 5EXXA 2ZAMA 2J0VA 2BEKA 4EPWA 4BPBA 1Z08A 2I3BA 3N70A 3I62A 1NMXA 2VF8A 3C4JA 3FYHA 1ZU5A 3O8DA 5LB2A 4E22A 1R2QA 5L3RA 2ERYA 4D81A 2PZEA 3U7GA 2DBYA 3VR4A 2X19A 1HY3A 3QE0A 4HAUA 3ASZA 3LLMA 2BV3A 3OFNA 2QUZA 1US8A 2OHFA 2QP9X 4NU0A 4NCNA 3SYNA 1OIVA 2AKAB 1US8B 3CF0A 4C0JA 4TYNA 1UKVY 1CJKC 1L4UA 3BORA 3ZLJA 1KI9A 2QPAA 3LBNA 1E9EA 2J45A 4UNRA 4UXJA 2Y8EA 4TQUS 5EE9A 4A0RA 4A2WA 2JIZD 2WJGA 2WSSD 4M9XA 1FFHA 2ZRCA 4URVR 2XTMA 1G3MA 3B6EA 8OHMA 3IIKA 2XJ4A 3KKNA 4PFSA 4F93B 5KU1A 1XD8A 3SQXA 4PC6A 1B0UA 1Z6AA 2ZI3A 1KO1A 2FU5C 4RKFA 2QI9C 4C9BA 3R9WA 3CBQA 1UADA 1OV4A 2A7QA 2ZI4A 3IHLA 2GRJA 1E2LA 1LFDB 4ZPXA 2PJRA 1G8HA 1OKKA 3WHLA 5SZIA 2HV8A 2WWWA 1DELA 3UANA 2CL6X 4D0LB 5KTYA 5FOXA 4KVAA 1Z29A 3KJGA 2IYXA 3CKLA 2OCYC 5JHHB 2IEZA 3B85A 4V0MA 2D7CA 2FGKA 2PZFA 2FFQA 3NBZC 1ZD9A 1U90A 1SVWA 1E2GA 1R5NA 2F3TA 2IL1A 1ZD1A 4WXPA 2CL0X 4NCKA 1E9AA 4OI4A 4DLWA 5HKKD 5EE5B 2IA5A 3E2IA 3GLFB 2RGNC 4KLZA 2SHKA 1AS3A 1SXJD 2RCNA 3ADDA 1G8YA 4L9WA 2C03A 3Q5EA 1EFRD 2AFIE 2H1LA 4IVQA 4CRWB 2JATA 4O2RA 4CEIB 4TYPA 5JI2E 1H8HD 3WMEA 1GL9B 1Q12A 1Z0FA 1PVOA 1HQCA 1KDTA 3AUYA 3K53A 4RD3A 2AK3A 4D80A 3FFAA 4ZO4A 3KFXA 3PQCA 1WA5A 3PUWA 5TVKA 4US1R 3ADBA 4Q21A 2REXB 1D8TA 1QBKC 4RSGA 5B30A 3T35A 1LVGA 1WCV1 1TQ6A 4NHOA 5ELXA 2PCLA 4B3CA 4TZ0A 1ELOA 1ESNA 4KFRA 5H8WA 4GNKA 1DADA 1OHHD 2E87A 3X1WA 3RS0A 1WRBA 2VSFA 1PUIA 1N6KA 4LHVA 1NIPA 4WZBE 4A82A 5K8IA 3I3SR 5DO9A 4FCTA 4TLAA 2ZI6A 1G1MA 3RWMB 3U6BA 3AH8A 4Q4LA 2QMUA 1E2PA 5AWFC 1XXHE 4A0GA 3HPRA 4M1TA 1NP6A 3GLGA 4CEJB 2JJ2A 1FTSA 4HAVA 1M34E 1UPTA 3B8HA 1FL9A 2QENA 1QHHA 2GXSA 4OK3A 1VG9B 3VKWA 2NO0A 2IS2A 2EFCB 3T06B 1G7TA 2GJKA 4DSNA 4NYJR 1TL7C 4JBYA 3CNOA 5EE3A 4H1VA 4CEIA 1I2DA 3GJ8A 2WZQA 3EAQA 4M4SA 1VCIA 4TMVA 1VCMA 1JNYA 3HP1A 4BFUA 1M7HA 3HPQA 3MGCA 3I73A 2OILA 4IDPA 3THYB 2WM9B 1GUAA 1VPLA 3A4MA 3PENA 1TTTA 2GHIA 4TMKA 1MRSA 2VP9A 1N6IA 2FFHA 3DKPA 3X1DA 3TVTA 4X8HA 4YMVA 3PXGA 2C9YA 2FWRA 4ZCMA 1X86B 1DEKA 1W46A 2WIBA 4Q00A 1SXJC 3A1WA 1NVXQ 1TU3A 4URZR 3SZRA 3PEYA 3GJ3A 5AJYA 5KSOA 3JZAA 1MABB 3P4XA 3U2QA 3AVYA 3TJZA 4JBWA 2MMGA 1KNQA 2F9LA 4KAXA 3NTUA 1Q1EA 5EE0A 1EFTA 4IKEA 1XPUA 2Q3MA 2R62A 2RGCA 4XOIA 2VHUA 3SJZA 1TADA 4HLUC 1G19A 1NF3A 2J9RA 1GKIA 2GJ8A 1XJCA 1OLOA 2EQBA 1E2QA 3NKVA 4AY2A 3I61A 2ZS8A 1GKUB 2WJJA 3T1QA 2QY9A 1BS1A 1R8QA 2C78A 3NVAA 2H7VA 1S2MA 4LJYA 4XWOA 4HYYA 1KDRA 4D4MA 1OT3A 2IUUA 4PQYA 3ONWA 2FFAA 3LFUA 1IN8A 3RWOA 2Z0MA 1P5ZB 4KO8A 5A0FA 2IYLD 1E9DA 3DMDA 2DFKB 4PANA 4XJXA 4TQAA 3WY9A 2Q9CA 2JA1A 3BB1A 2KJQA 2FX3A 2NZ8A 2LKDA 1EESA 1T4GA 5FBLB 4NE2A 4DDTA 4W5HA 1X8LA 2GK6A 3GPLA 1W36B 1R8SA 3IQXA 2KWIA 2OESA 4AIIA 1AZSC 4YDHB 3THOA 5GADl 4FMCF 2C96A 1F2UB 4TTRA 1UEJA 3OIYA 1FMJA 4M2LA 2FE4A 4B3FX 1W4CA 3AVTA 1XBTA 1IY1A 4C0HA 3AF0A 4XD7D 4ARZA 4UXHA 2EFDB 5DI9A 4B33A 3PEUA 4TL9A 2VIIA 1NRJB 1E2EA 1M8PA 3L8YA 1N0UA 4HLQB 1KO8A 1KMHA 3WNDA 1XPOA 3MD0A 1AN0A 1O3YA 1SVSA 1MT0A 2RB4A 3GLIE 1I2MA 4HEJA 4KBGA 1DAHA 3OE7A 1Z22A 2WJYA 4BFYA 2QZ4A 4TT3D 1YVDA 2ZE5A 2EU8A 4FMCB 1RYHA 1U81A 2UKDA 3AVUA 1EWQA 2IS4A 4XWKA 1X1RA 2VP4A 3WYAA 3DZDA 3A1VA 4QNMA 1NLZA 3QF4A 1FX0B 2A5YB 4G5RA 4OI1A 4KU4A 4HZIA 3K9HA 1OH8A 2WKRA 4BLQA 1OXUA 4Z1MD 1N5JA 3FMFA 1XTSA 4FD2A 3PITA 3ZYCA 3K0FA 3K9LA 1XDBA 1BOFA 1JALA 2FG5A 2GWHA 5JLJA 2J59A 4QC2A 4DWJA 3J81k 5HZHA 4MKGA 1HV8A 2ZJ2A 3KQHA 4E09A 1YZLA 3E1SA 4DDWA 4ACAA 1RW4A 4S2EA 4YXWD 1K8RA 1XD9A 2ANCA 4JL8A 4PPQA 2VHQA 721PA 2O8CB 1H8ED 1M7BA 4JLMA 1PLKA 4XVQA 5B64A 5HE9A 1GRNA 4DLRA 2CE7A 3RNLA 2RGBA 2V6IA 2FSGA 4TLEA 4WW0A 3W6PA 3L8ZA 1N6RA 2F43A 4EUNA 1XD2A 1P9NA 4HZUA 1ZM3A 2OXCA 1MR3F 1JJ7A 1YE8A 5BN5A 2Z4RA 4Q03A 4Q9HA 5L3QB 1G291 1MO4A 2XXAA 2ORWA 3BFXA 4FI3C 4Q02A 4D82A 2ZSDA 4P4TA 1FQKA 2WKQA 2O8FB 1EFRA 3GLHB 6Q21A 5G53C 1CF4A 1NN5A 1E6CA 4MYUA 4QBFA 1XRJA 1WP9A 1WB9A 4PO8A 4HLCA 2QT1A 3GEIA 1OF1A 1RIFA 4Q9IA 4UJ5A 4IVRA 5KHOC 3TH5A 2HXYA 3A58B 4G5SA 2GBLC 5CK5A 1AS2A 2BBTA 2ZI5A 3VX4A 2W2VA 3H86A 5JSZB 4WOPA 1P60A 2IXGA 2YINC 3UKDA 4IW3B 4HUTA 5K8TA 3L0PA 5DI3B 3NHAA 1DO2A 4URUR 1JECA 3ZQ6A 4ZCIA 3DVLA 3KTAB 2GK7A 2WOJA 3W90A 4ESHA 4TMWA 3RYTC 3R7WB 1KO7A 2G6BA 3ND9A 4DT1A 4F4JA 2CNWD 1YRBA 3FHTA 2W6JA 5FUVA 3K0AB 2BJVA 4PO9A 2GF9A 3EIHA 3BERA 4Q4JA 5H68A 2DHRA 1Z8FA 2J0UB 3HWSA 1E0KA 1DAGA 2WWFA 1U0LA 2WJVA 2R6CA 4HATA 4NL4H 5EP1A 1BKDR 2H18A 1X1SA 1CBUA 4Q47A 4IEIA 3ZGXA 3TR5A 2CE2X 2QROA 1NN1A 1ZIPA 2PX0A 4FINA 1YZQA 2GXQA 3TE6A 4JLJA 4BZXA 1KYIA 5DYIA 2WWYA 4QRHA 1E98A 3P32A 4HAZA 4ZI2A 4LJ8A 5AUNB 1YU9A 5G40A 4C2TA 3ASYA 5KPJA 2CLSA 1XZQA 1FPMA 1D9ZA 2BBOA 2CHGA 4F4CA 3QXSA 3WYGA 2A3RA 2CLCX 2FSFA 4BFWA 2QBYA 5IRCD 1A2KC 2UVQA 2VP0A 2WJHA 5GVRA 3RDPA 1MH1A 4QJ3A 1GSIA 4LBWA 2OT3B 1GNRA 3DHWC 3NIBA 1LTQA 3NEYA 3TGPA 1P2UA 2OCBA 2XSZD 3RRYA 3ZZTA 3REGA 2ZRJA 3I1FA 5EUQB 5JCZA 3FGNA 4JJKA 1X8JA 4I1OA 4B3DA 5DGXA 1PV4A 1OH7A 3AM1A 1KI7A 4OQFA 4R98A 1BIFA 2G9NA 2GXAA 2EW1A 3CF2A 3PUYA 2DFNA 3IO3A 3TAUA 2B92A 2UZIR 3U44B 1SHKA 3RLFA 5IK2D 1W0KD 1QHXA 4L16A 5EP4A 2VPPA 4J0QA 3QBTA 4OK5A 1FMLA 1XXHA 2GTPA 3NC0C 4LHZA 3CNLA 1S3GA 5TXGA 1OXSC 2GXUA 1DG1G 2GAAA 5EXPA 5DH9A 1E1QD 2ZUCA 2B8TA 2F6RA 1W2GA 1ZNWA 3WRYC 1ZUIA 1NVUQ 3PUXA 4URWR 3C5CA 1D2MA 1F60A 2J7PD 2ZRLA 2QE7A 3SYLA 4OHVA 2IYTA 1OKKD 3CO5A 5KSZA 1QG2A 1AM4D 3BXZA 4JLNA 4LZZA 2WSMA 2BM0A 3FB4A 4Z8XA 2DFTA 2YV5A 4DJTA 5A5GA 5KNDA 1D2EA 4PC1A 1IN7A 3VHLB 4DRZA 1H65A 3QY0A 4BFZA 3TBKA 2Q3HA 3A1TA 4LI0A 1KMQA 2HCBA 1LNZA 3SDZA 4JVMA 4DIEA 5JRJA 4FCVA 1F2TA 2D62A 4HDQB 5J5CA 2ZRHA 2QGNA 4G3XA 2DWPA 1WDTA 1BMFA 3CR8A 1JB1A 1UDXA 2H92A 3AKYA 3QKRA 1K6MA 1Z6GA 5F98A 4NYIR 3U3MA 2HLDA 3MUFA 4M8NE 4TL8A 5FTLA 2ZSEA 2GZDA 3SEAA 2QGZA 4C0LA 3VHXA 1NG1A 4B3XA 4CW7A 5LB4A 2ONKA 2V3CC 4R2IA 3P26A 4RFSA 2J1LA 2DYKA 3FKQA 3UMSA 1LF5A 2CCKA 3ZDQA 3GLFA 2HYIC 2F1JA 4L9SA 3ZH9B 2QAJA 3ZZUA 1R6BX 3K9NA 1QHSA 4WBSA 2OBNA 5FOTA 4M1OA 4R2HA 3B2EA 3BB4A 3U4QA 3SJAA 4AG5A 3DDCA 2OFOA 1H8EA 4OL0A 1XEXA 4GDFA 1U9IA 1UEIA 1XMJA 4DDUA 1CS4C 2ZE8A 1W5TA 1VIAA 2HYDA 2Z83A 2Q0HA 4OJKA 5B57C 1TF5A 4CF7A 4ZIRA 2NMVA 4RFVA 3PVSA 3KQKA 5DISB 1OH6A 2CEAA 2ZVPX 1UJ2A 3KQLA 2Q3FA 1W0JD 4JJZA 3QKTA 5LDDC 3LAWA 1E94E 5LD2C 4JYCA 1U0JA 4NYMQ 3NDBB 5ANRB 3CZQA 3LX8A 2W0SA 2IWRA 3MWLA 3SBEA 1KK0A 1XEWY 1UDWA 2X2FA 4XD7A 4DLYA 2QM8A 2QTVB 4C0BA 5GJCA 4GI7A 2IK8A 3W5IA 4ZIRB 3QVVA 3T1TA 1G64A 4Z51A 2PLFA 3A1UA 4FN5A 2PCJA 4AYWA 1HEIA 1Z6YA 4B44A 1KAOA 1PLJA 4IDQA 3HJNA 4TMXA 1E9CA 1COWD 1P62B 3T1VA 1TF7A 2GJ9A 4MRVA 2F55A 5FTNA 4DKXA 3CNNA 4D4JA 3IEVA 2P2LA 4WA7A 3AF1A 2G77B 1U2RA 4HB3A 4NBSA 4P4SA 1SZPA 1WBDA 3TUJC 2QAGB 4DVGA 1KK1A 2F7SA 1SKYE 2QU8A 3NH9A 4ON9A 1G8GA 5DLQC 4IDOA 1N6OA 2JLWA 4EJSC 1P2SA 4Q4HA 2IYYA 3Q8XB 5D3MB 3ZIAD 4DLXA 4KLNA 1TX4B 1OXVA 1U99A 3RS3A 3ZVNA 2I1VB 1SVLA 5AR1A 3UWOA 3PEWA 2HJGA 2H57A 3X2SA 1VDZA 1X8KA 1IM2A 1P72A 1XX6A 3GCGA 1SHZA 1Q57A 1TQ4A 3M4YA 1SQ5A 3SI7A 2B8WA 4NYJQ 5BN4A 3KJEA 1Z0JA 1JJVA 1TPZA 2MSDB 1W5SA 1S9HA 4RKEA 5E7IA 4GP7A 1KSGA 1W1WA 2PEZA 3EPLA 4IHQA 2J41A 3KXIA 2C2HA 1MV5A 5AUQA 1OFIA 3GFTA 2W0MA 2ZJZA 1UBCA 1JAIA 2C99A 3BOSA 4Q48A 1RFLA 3NEJA 1KI3A 2PL3A 3I4LA 4C7OA 4Q1EA 2JAQA 4M1WA 3HU2A 3D7MA 3C8UA 1OB2A 1VHLA 1Z6XA 1DAIA 2ZSFA 1T5IA 1RJ9B 4NYMR 3C7KA 4ZKEA 3C41J 1M74A 2CCJA 3AP1A 2RGEA 3L43A 4TTQA 1YZKA 1OXTA 3AF4A 1GOTA 4UNQA 4AWXA 1Z2CA 5CLLA 1XMVA 3QBVA 4PHFA 4OYHA 4MDEA 4AKGA 4LYHA 1K5DA 2WPDD 3L0SA 4LOAA 4OQXA 4QGFA 4RCYA 4ACBA 4D0GA 2FN4A 3OE7D 4MUAA 4P32A 2VHCA 4LSGA 4WXRA 2EVWX 1NN0A 4MYHA 5EXTA 3KB1A 4B3GA 3E5HA 3P27A 1CJMA 3PG5A 4BFVA 1VYUA 2AK2A 2XTZA 4FMDB 1P4SA 2ZVQX 4MRPA 3ZS8A 2OFWA 1ZP6A 2H5EA 2JJ1A 2W2XA 3TMKA 2ORVA 3A4NA 3EZ7A 2GZAA 4LJ5A 4JLBA 1MO6A 3U3JA 1GNQA 1E79D 2ZEJA 4PO1A 2VSXA 3GLFE 3I8XA 5E7MA 1DAKA 3WMFA 1C9KA 2GF0A 5E7JA 2B7BA 2GVZC 1N5IA 1R0WA 1CLUA 3GJ0A 3PR1A 1W4RA 2J3EA 1KZ7B 2RHDA 2CVHA 2IHBA 4Z1MA 1E2DA 3QENA 4IOMA 3SYKA 3B60A 4BLRA 1Z47A 1L8QA 5AJVB 1M2OB 3HDTA 4C3ZA 2R8RA 1YR6A 2QBYB 4OHWA 1Z0IA 4LX0A 2ZI7A 4FMBB 3U7EB 2OEPA 5KNCA 1OH5A 1NY6A 2QRZA 4MGYR 5TARA 3JVUA 4LWZA 5F9FA 2VO1A 4A2QA 2FMXA 4YXWA 3CONA 2D06A 821PA 4V03A 1Q0UA 1Q20A 4MGIR 3SHWA 4EJSB 2IHYA 2A5GA 4Q7KA 2CCGA 4WVFA 3BRWD 1GVNB 1EFCA 4Q1DA 2VF7A 5J4HA 2ZRGA 4PZZA 1U98A 2QSYA 4MRSA 5FOUA 4D4KA 1UAAA 1TEXA 4B43A 1E2HA 4M21A 4MKHA 4ZDJA 2FJUA 2QMHA 3IHWA 1J2JA 2RAPA 1KI8A 3BFVA 1A2BA 2HXSA 4EFNA 1Q3HA 4QNRA 3C15C 5CITA 4LC1A 1YR7A 3AP2A 3KL4A 2MMCA 3BFKA 4W7SA 2R2AA 3UXMA 1T8TA 4OHYA 2A2ZA 1Z6TA 1FZQA 4LJAA 3N2EA 4F38A 2ONJA 2ZAOA 1AGRA 3MWJA 2JCSA 2D2EA 2OSBA 2N46A 2ZRDA 4LJ4A 3V9PA 2H17A 3THWB 1S9DA 5D3QA 4PC2A 2EYQA 1N0VC 2NO1A 5CB6A 3AVQA 5KNBA 2DCUA 3RVBA 5LBIA 3NH6A 3R20A 1E99A 3CW2A 4RZ2A 5AJWA 5FUWA 4EPYA 1T0JB 3WRXC 3MG9A 4PAOA 2O8DA 2GEVA 2BBSA 2BWJA 4FIDA 1CR0A 3SHFA 4PQRA 2FPLA 2FPKA 1W0JA 3PJRA 2V7QD 5FUYA 2A9KA 2CNWA 2J7PA 2A78A 2ZROA 4I1UA 3CRMA 5CIQA 4W9MC 2IUSA 1O87A 3D3QA 5SZJA 1ANKA 4EPVA 1M7GA 1N5LA 2Q9BA 1XTKA 1G7RA 5KPDA 2IX3A 1JR6A 3U3KA 5JMTA 1ZINA 1IHUA 1N5KA 4YC7A 1GTVA 2ZE6A 3LDAA 4IOJA 2QP3A 2ZI9A 3QOFA 2G83A 2YKGA 2VL7A 1G7SA 3FHCB 3NG1A 3QUSA 4A6PA 2H8KA 3QEOA 2AWOA 1WBBA 4US0R 1XCGB 1VYVA 2R6FA 5A4JA 4WZ6A 2N42A 5FI0B 3QPUA 3V00A 2WAYA 2YC2C 1XU4A 2GCOA 4KV9A 4O3MA 4LRWA 3UMRA 3MJRA 4M1SA 2IF0A 1GIAA 4U00A 4DXAA 1XEWX 3IIMA 3O8RA 5TY0A 4M0LA 5HPYB 2NO6A 4RVCA 1E79A 2O8EA 1F5NA 2O8EB 3W6NA 1TEVA 2O8BB 3D31A 1BYIA 5EZ6B 1YJ5A 1WXQA 2QA5A 5HKKA 2GVDC 2J7KA 2VH5R 4A9AA 4V0ME 3LQRA 4GBMA 1DARA 1QVRA 4QKQA 1YHNA 2JLQA 3QVUA 4M53A 3H4MA 3O47A 3EC2A 4CT5A 2FSHA 4Q19A 4Q7MB 2J0SA 3SQWA 4QGGA 3FDIA 4ZV4A 4RD2A 3EG5A 4TSFA 1W0KA 2VRWA 4GFDA 4LHXA 4OQMA 1KAGA 4PHGA 5FTMA 3VKGA 1N2CE 2IF2A 5E3HA 1NMZA 3LW7A 3TSOA 1G16A 1LY1A 2ZIAA 3A8TA 3DM5A 3REFA 3LX5A 1E0SA 3CRW1 1TF2A 1KMHB 5FOWA 2AFHE 4C0QC 3EWAA 2OCPA 1AS0A 4NP6A 4XH9B 4EKDA 4NCHA 1JR3A 2BCGY 4JZKA 1W48A 1HE1C 2WBLC 1X6VA 4EQ6A 3QXHA 1Z28A 3EPKA 3LH5A 1LF0A 4IOKA 3KKQA 3NC1C 4Z54A 3Q7PA 5CDFA 3MSXA 5TDHA 2O8DB 4AKHA 2V4ZA 2ZRNA 1Z83A 2C95A 3CPEA 2V55B 2CJWB 2I4IA 1DAEA 3ADCA 4CT4B 4YONB 3QKUA 3VU9A 2A5FA 2ZSAA 3JZMA 5GJVC 5L8VA 4G01B 1SVKA 4V0LA 2EYUA 4G5GA 4B35A 1NVVR 1R0YA 4DCSA 3PCRB 3AVXA 1CRPA 2JEOA 4B71A 2K5UA 3W34A 4FXPA 4G5OA 3I32A 5GVSA 4JYBA 1E2NA 1VG8A 4RZ3A 3DOFA 4N0DA 4GMDA 4DSOA 3B1XA 4B32A 5FL3A 4LC0A 1J7KA 5FPSA 4XIGS 1Y63A 2HLDD 1W2HA 4AI6A 3B1ZA 3CWQA 3GFOA 4JSYA 5EUMA 1KI6A 2QSZA 3R9IA 1P9WA 4HDCA 4B3BA 3QKSB 2WHXA 4C0AC 3OIVA 3HR8A 3OEEA 3SJCA 1P3JA 4V0NA 2VTKA 2GNOA 3F8TA 3EASA 1E1RD 2KSQA 2F1IA 4ABYA 4LBZA 1L4YA 4CDGA 3LBHA 5GJBA 2J0QA 3BH6A 1M6NA 2ODWA 3D6TB 1N6HA 1TAGA 1IN5A 1UBFA 1A4RA 2L0XA 3G5UA 5DIFA 2RH5A 3OEHD 1E2KA 1NMYA 3RS7A 2C04A 3FKSD 2QL6A 4I4LA 3L0IB 3UG7A 4BGDA 3K70B 1JBKA 5DHFA 1JI0A 4LV8B 1DS6A 1GG2A 1VKJA 2CDNA 3Q7QA 4KYUA 2BIFA 1RJ9A 3OAAA 2D2FA 1U8AA 2DWOA 3RAPR 4Q9JA 1P2TA 5KOYA 1II8A 4PR0A 4OHZA 2BJWA 3IQWA 4D26A 3R8FA 2PZGA 1S8FA 2C9CA 3CX6A 3SFVA 2RMKA 5JEEA 1G21E 1XFAA 521PA 3GD7A 2O0HA 1A5TA 4RD0A 4E03A 4F7WA 4PSAA 4TQ9A 3DMNA 5JI3E 1KNXA 1RZ3A 1NVVQ 1UKEA 3TKLA 4CZ2A 4P0TA 4MITA 4P4UA 4QG7A 4AG6A 3AUXA 5L3SB 4CEHB 1NKSA 3OZXA 4BZPA 1EXMA 4Q4HB 3WMGA 3KUCA 3IEUA 1GZSA 3EWSA 3PIRA 1PLLA 2FA9A 3Q3JB 5M04A 4DLZA 4H1UA 3TQFA 1EG7A 2YVUA 2P6UA 2FDCA 4Q1AA 4TYWA 2WKPA 3AGPA 2GKSA 1V5WA 2WAXA 3LNCA 1BYUA 3QPWA 2VBCA 1Q1QA 1OSNA 2G1KA 4B75A 5J4YA 1A1VA 3W5JA 4PSVA 4V0KA 3IBYA 3VR5A 1PUJA 1FNMA 4KVGA 5EE1A 5DHAA 2B21A 3BH7A 4X8LA 3U3OA 3KZ1E 3LD9A 3WBKA 4UJ3A 4EPXA 2AWNA 3GEHA 2XB4A 4G0NA 3QXXA 5L3SA 4DLTA 1U9IC 3TUZC 3EIEA 4NH0A 1KJWA 4Q7LA 2X1VA 4YMSA 3FWYA 2XZOA 2QNRA 1KGDA 1G6HA 2PT5A 2ZR7A 4IFBA 4D2IA 1CULC 4DEXA 5CYOA 5EXSA 3VR3A 1XWIA 5L3VA 5CK4A 3DEFA 1R5BA 1ZM9A 3OESA 1LS6A 1G3UA 4V0OA 4D0NA 2BHRA 5C46F 2XJ9A 5HR5A 1U0HC 1P9RA 2LKCA 3TUIC 1W44A 3I5YA 4OJQA 2R44A 2ODNA 5AJZA 4URXR 1AIPA 2WICA 3T34A 3VAAA 3P20A 3TW4A 1G5RA 4ILEA 5EP3A 1T91A 3GQBA 1B23P 3WXMA 1QF9A 1F6BA 4TYQA 1GWNA 4D25A 1T0HB 4JLDA 5E4FA 1J8YF 4LBVA 3KQUA 4KCGA 2WOOA 1GRQA 3N5CA 2YWHA 2MSEB 2WPDA 1T6NA 4TMTA 2HUPA 1R0XA 2OO7A 3W9YA 1F2UA 1DOAA 3KXKA 4DCTA 1NG9A 2YC4C 1ZCBA 4II7A 1E9RA 5FH9A 5JHGB 3CM0A 4AYTA 1NKTA 4M1KA 1CJVC 1YRAA 3C16C 2DB3A 3B9PA 1X3SA 4X8MA 5IHPA 1A7JA 1Z0AA 2OUKA 3RC3A 1QZXA 4GRAA 3C5HA 2LCFA 5DN6A 1Y3AA 5EQTA 4DEYA 5K8UA 2ZTSA 4LJ6A 5BXQC 1BMFD 4TSFD 5H70A 4CEHA 1LV7A 1S96A 4JVNA 1IXSB 3TQCA 4XTCS 3WYFA 2P0EA 1CJTC 2FEOA 2W58A 4HUQA 4JLAA 1KI1A 3D8BA 1XD2B 1P73A 1SVMA 4JIMA 4V02A 2ANBA 2F43B 5G3YA 5C18A 2J5XA 4MA4A 2JJ2D 2G3YA 3AQ4A 2QORA 1ZBDA 2IYZA 2RHMA 4BLTA 3QSYA 3GJ5A 4B76A 2XZPA 3CF6R 2ZRKA 1ZM4A 3K1JA 4KSCA 3M1IA 3EZFA 5AUOB 4IRUB 1P61B 3VNVA 2ZJ5A 3SBDA 3SNHA 2GZHA 4KJZA 4K46A 3KDSE 3B82A 1G20E 2BMJA 1G9XA 2ZQ5A 4TL6A 1ZJ6A 3N2IA 2BVNA 4BWYA 4C0KA 1RRCA 1VCOA 4HAYA 1KIMA 2CJWA 5H1YA 4DHEA 4MQBA 1G8PA 1DE0A 4YMTA 2YOFA 3K70C 5TV2A 1OW3B 2XEXA 1NLYA 1G5PA 1MOZA 1W4BA 2JLRA 3R8CA 3QXCA 4BRUA 3KKPA 2E9SA 4RD4A 3DL0A 4BASA 1GDDA 4A8JA 1JR3E 2AXNA 3RANA 4NZYA 4XSGA 1T8UA 2X2EA 2JLSA 1T3LA 1KKMA 5KDDA 5AJXA 2XXAB 3EARA 2XGJA 4PQFA 5CDFE 4D6PA 5FTJA 2QRNA 2C8VA 1Z07A 3QG1A 2XTNA 3CLVA 2FFBA 4IJMA 5C1BA 4FWTA 1CP2A 2BEJA 3AGQA 3AKEA 4MKIA 3GJ4A 4Q1CA 1RVDA 3RSOA 2OCAA 2XNDD 4YDSA 5DNYB 3ZS9A 4C0SA 2D4HA 2VQSA 5HE8A 2W6JD 2Z43A 1KK3A 1CTQA 1II9A 1NN3A 2ZYVX 4KSBA 3QEJA 3MWKA 4B2IA 1MO3A 3C14C 4LYFA 5B2ZA 3ICQB 2ERXA 1E2IA 2PJZA 3FKSA 1FP6A 1L7VC 4RCZA 3UMFA 1T9HA 2P67A 1XF9A 1JEDA 2V6JA 2UZ3A 4PC3A 3UIEA 3VU9B 2YWFA 4DSTA 1G7CA 2G0TA 4MYTA 1DAMA 2GA8A 4NTZA 1KY2A 4Q1FA 4QJ4A 2XOKD 4B6FA 4XVRA 4DUGA 5BWMA 2QM7A 2JIZA 2LWIA 2ZYWX 3CRRA 3T5DA 4RY2A 2X8AA 2JLXA 4WIAA 2O0JA 2J87A 3K0EA 3O8BA 1FNNA 1S0UA 2HT6A 2B6HA 5CJ2A 3LVRE 2HEIA 3MLEA 3H0KA 2VHJA 2FV8A 5FR2A 3L82B 3DPUA 3LRPA 5P21A 4QBIA 1P7CA 1G4AE 3CRQA 3GJXC 3U60B 1OB5A 2FNAA 1KHTA 1VMAA 1HT2E 4XWAA 4JS0A 2GILA 3SR0A 1YR9A 4PZLA 4QM7A 2IYVA 2R6GA 2CHVA 3Q72A 1OIWA 1G4UR 1F48A 2C98A 3R7WA 4BRWA 5LD2B 5GJWC 3K09C 1R10A 1JPJA 221PA 5KSPA 1XB2A 1UBEA 4OHXA 5SZKB 4KYIB 1N6NA 5DI3A 4CIDA 1EK0A 2FPMA 4L15A 1MKYA 3QF7A 1IXZA 4A0FA 4F91B 3U6KA 3K8YA 3EA5A 4O25A
chains in the Genus database with same CATH superfamily
3N59A 4ZHQA 2O1EA 1Q17A 3P2JA 2D5AA 4GP6A 2DR2A 1AKRA 1O0CA 1SA0A 2GHTA 3VNUA 5D84A 3HHPA 4OA8A 4PZCA 1GFIA 1OFHA 4B4OA 2V7PA 1QH9A 5A4DA 4CLEA 3H1EA 3IUJA 4RM2A 5CA1B 16PKA 3G9UA 1JLLB 2V6FA 1TGYA 3A4VA 1K27A 1ST2A 4KXXA 3V32A 4BX3A 2A9QA 3OEYA 4Q93A 1JIVA 3L0BA 4HVTA 1XEFA 4LZLA 3FDFA 4WXHA 5LDGA 2PH5A 3MFYA 4GU5A 1H6BA 1L1RA 3NW9A 3H99A 4N3NA 5LBUA 4B7CA 4G4JA 4DIDA 5IG2A 4LJ7A 4NOKA 5E3JA 3SS9X 5AM5A 1DC4A 2XE8A 3K6SB 1ZJZA 2Y4NA 4L8LA 1RBQA 5B7PA 1FDIA 1NQVA 2R751 5L3QA 4MW6A 4KWTA 1QCDA 2F3QA 2GBLA 2R6AA 4I2NA 5AVXA 1K86A 4MRNA 5IDQA 4CL2A 5E95A 1POWA 4MVJD 1I1NA 1SB9A 2Y9MB 4FJ0A 4UU7A 2IBTA 2IQ5A 4C7XA 3UOGA 1K4MA 4JOSA 1SGWA 1XJQA 4IMPA 4AQYB 5JY6A 2NXEA 1HL3A 5B58C 3C70A 4JJ7A 2X1MA 1IEWA 4A0SA 3RT1A 1WD7A 3T4EA 4TS1A 1Y6FA 3M81A 2FWAA 1BWPA 4J4BA 4I81A 3ZY5A 4B9EA 5DHSA 4Z9YA 2R8BA 1TYCA 2KE5A 4HLDA 4WZAE 4ISBA 5EZQA 5JSUA 1JLMA 2WFZA 3MPUA 2OFXA 1K6XA 3N2ZB 4WH0A 3TR6A 2ECQA 2ZB2A 4M89A 3RLIA 1IN4A 1IPEA 3OPYA 4MGEA 1NYRA 2HU2A 2VYVA 1MJGM 2M1ZA 5CVDA 5IDVA 4R5HA 4ZREA 2ATIA 4Y6GB 2OP0A 1FXSA 1U0GA 4D3XA 1VJDA 4K28A 1JG7A 3V4ZA 2JASA 5KMGA 2IZOA 3KPWA 1MB3A 1FNDA 3FSJX 2QR3A 4QOSA 4XYGA 4TV8A 4QOGA 2Z6AA 1E0JA 3GRUA 5FJJA 4MQ6A 3LFHA 4ILKA 1AU9A 1ST3A 1KJYA 4H6XA 2WW8A 4QBGB 2YOHA 2UUAB 3CLUC 4QPJC 1KDYA 1XTJA 4QDTA 3LZDA 1PT7A 1O6BA 1P4HA 2BCEA 5GGXA 2BLLA 3DZ8A 4LJKA 3U49A 5EWLA 1WAMA 2G4VA 5GZ3A 2H59A 4UTOA 1NAHA 2AW3A 2WABA 1CXZA 1NMSA 3RM3A 3QFHA 1K7SN 1JFSA 1WM1A 4Z7QB 1SOMA 4G85A 1M2NA 2QRKA 2Q46A 1CF2O 1IY9A 2TMKA 3NUGA 3NIFB 1O1YA 3I04M 4PXAA 3K6JA 5MN6A 1KAQA 2FOXA 3E5RA 4YAKA 2P1ZA 4Y9RA 3WQRA 2PN1A 4R6WA 4WAUA 2FW1A 2A57A 2NV6A 2KB0A 2VDPB 4BN4A 3VI3B 4EJSA 5JJLA 1CUBA 3D0RA 3PR2B 3HEBA 4H7PA 3WGIA 2FK8A 3H6HA 5CTAA 3GPBA 2I71A 5KNBD 3URKA 3T1HB 1GPMA 1RKBA 3FOAA 2VHTA 2YHIB 4MUNA 4N6NA 4JI6B 3WOVA 4XB2A 1NRIA 1VJRA 4ZT2A 3EUFA 2Q8QA 3INGA 2G0NA 4GMKA 1NUHA 3FG9A 2P4SA 3WJ1A 1GPNA 4TTSA 2BEWB 2DQKA 4DMUB 4LHYA 3WKAA 4PHTA 3ZN2A 3BFPA 2ZU0C 4F9TA 5BUQA 5AKHA 4TYYA 1YZTA 3CRVA 2XCUA 5DGIA 4D9BA 5C7OO 1XTBA 2Q0QA 1J9GA 1LA2A 1KJQA 3UAWA 2CNKA 1IONA 1GV0A 3LXRA 1VLMA 3PWTA 4NFSA 3RAJA 5BO5A 4EQ6B 3LUGA 1S2IA 3AIKA 3MAGA 4HS4A 4RGQA 5AW2A 2BKUA 2IYSA 2R8PA 3JQGB 1P29A 1Y5RA 2X6QA 4WBXC 3T5CA 3QHPA 2ZTHA 1GLNA 5CAEA 4KE6A 3EQZA 4URFA 4DC0A 3RIXA 1V6AA 1GRRA 4LZNA 4JQCA 4DQKA 2E6UX 2XSZA 4BIMA 3VDQA 3CVOA 4JL5A 1HNZB 4Q16A 4GPBA 3M33A 1ORDA 1S4QA 3HJTA 3W8NA 3S99A 9GPBA 5AVWA 4JKIA 1BXRB 1PV2A 4TRMA 1AZWA 1GGEA 2JFZA 2WHPB 5KSYA 3OLCX 1K5GA 3HABA 5BYJA 3WDLA 2FZ4A 2HH9A 3CX7A 1GUYA 3FUVA 5ALMA 1JG3A 4HDNB 4IGKA 3HV2A 5TQJA 1YB1A 1MUUA 1QHGA 4I4TF 4KKVA 2CBGA 2ONYA 4MV3A 4P4SB 2YV2A 5AT1A 3L0OA 4I6EA 2ENUA 2J48A 3UMBA 4E5YA 2QVXX 2H3HA 2C0PA 2Q7DA 4ZZ0A 1AA6A 2LR0A 4XX0B 5ECGC 3ICWA 3HA2A 2DT8A 2QK4A 2J9FB 2P8SA 2VT2A 4WKPA 3HR7A 2NPFA 3SYTA 3WMRA 1DMRA 4FHZA 1CHDA 4EHAA 2RHWA 1T2EA 1PTJC 3WFIA 5CA0A 2Z58A 4FMDF 3BC1A 3UPTA 1IL0A 2AFRA 4F92B 2B3TA 3PQDA 5ISMA 1RKVA 1GM5A 2JJ8A 3A1SA 4MR9A 4H60A 1EVZA 4M8KA 5TPZA 1P3DA 5BQOA 3R9XA 4PPNA 1R5JA 3R74A 4DS3A 2ZW9A 3KR2A 3IPRA 4MYCA 1N5DA 3BXXA 1NNEA 1G9TA 3BSWA 4RPGA 2H4WA 5JZBA 4MGHA 3RT9A 4TLBA 3I72A 2PGNA 3MRSA 1T6ZA 5LMZA 3QVKA 5EZ5A 2OYRA 2HQBA 5IJ9A 1R74A 5EVJA 4TLMB 1WZEA 4W5QA 1BD3A 1AF4A 4KPGA 1HEYA 4MV5A 1XWFA 2BGIA 4XDHA 3SLGA 4BFSA 1IEQA 5B1EA 3T5AA 1RZRD 5FI1B 3UJHA 2PX3A 3UF0A 1T2UA 3GMTA 3QFTA 2ILTA 4HUQB 2X22A 3T95A 4BFXA 1NW4A 2YNMA 3O2JA 1DWOA 1E3EA 2NU6B 5KQSA 3NHYA 1U94A 2V0NA 3CVWA 4C1NA 2F4NA 5T41A 3LC1O 3ZBUA 4BP1A 1MDBA 3BGOS 3JQRA 2D6FA 2H1RA 2OOSA 1KKLA 3PGLA 2DEUA 1DHRA 2JA2A 1RWQA 3KPUA 5HF5A 4INOA 4M9ZA 4WFIA 1NIJA 4D4LA 1Z5PA 1YUBA 3JAWA 3TNFA 3RRNA 4EG0A 2PT7A 3WR5A 1U0BB 3ORSA 4KO2S 4RFSB 2A33A 1K92A 3IIEA 3WDSA 2IW3A 1H3EA 4WZBB 5BYBA 1IZ9A 3I2YX 2IOFK 1NFRA 3KEQA 3LYAA 3RKSA 3MMNA 1Q7CA 2VJYA 4MB6A 5KYWB 4WRRA 5EN4A 2A0KA 2O3QA 5J58A 1X8XA 2IYQA 3RUHA 4GOKA 1YJAA 3PVCA 4XDGA 1IUNA 4E13A 4I14A 4R71A 1R88A 5SY6A 2WYWA 1XQWA 1XVVA 3MTQA 4UULA 2C4UA 5DOVA 2ZATA 1AMNA 1WG8A 4HEHA 3L9XA 4Y2RA 1C1DA 4D1YA 4E4RA 1S3SA 1Q1NA 2CXXA 4MO9A 4H27A 4CM4B 1E1RA 1M0WA 4NPHA 4PYLA 1TFUA 2NZJA 2WJPA 4WMLA 4ZU1X 1NASA 2K2WA 5T8KA 4KB5A 4IZIA 3TQTA 2YV3A 4OSOA 4HGYA 2EZUA 3B5JA 1KPHA 1OY1A 3LGSA 4I4IA 4OQLA 2WVJA 5FOVA 2JVIA 1WXWA 4INJA 1VI5A 4LV6A 2EHJA 1N8TA 4WUTA 3Q7SA 3V80A 3SKXA 1SBNE 3DFKA 4E6PA 1OE0A 1R0SA 2ON6A 1OZAA 2NU7A 4WY8A 3U3ZA 4EHNA 1IOZA 1C30B 4BVJA 4TN5A 2XRMA 3SJUA 4C89A 1ZA2A 3PL5A 2L19A 3T5MA 3K1AB 2DWUA 1PDOA 2RBEA 4IL5A 4CI0B 2REOA 1GYPA 1FQJA 4HYEA 2ZPAA 4O4JA 3S1AB 4WBNF 1MC5A 3F7NA 3NHBA 4JC0A 2ILVA 1KTIA 1LW7A 2FWMX 4NJEA 2OM6A 3H5LA 3M6WA 3PA8A 4MUXA 1Q1ZA 4TWAA 4QU8A 2DFDA 2C3OA 2DKNA 2SNIE 4I1SA 1M2VA 1EIZA 2YYYA 5DNCA 3IPYA 1JEQA 1U3UA 1Z33A 2AC7A 2BFDA 2PS9A 2VAVA 3QX9A 2ZR9A 3PGA1 3KQPA 4ZV7A 3TX6A 4ER7A 1JMYA 5F3RA 4UOZA 4DC9A 5F7OA 3MJCA 4OGFA 1HUQA 2VKQA 1WE2A 4RZXA 3RK4A 2WWXA 1FYXA 4C4OA 3OKAA 4K9SA 3SY8A 1RXEA 3FMIA 1W36C 3EXG2 1QFJA 4HG2A 5J43A 4LHWA 2LUOA 4Q9KA 1LVUA 3UMYA 5I48A 1MN6A 1D5CA 1ZBQA 1QX4A 2H1IA 3MXTA 2ODAA 4YCLA 3ZZNA 3DEJA 1JSCA 3O8QB 3WYCA 4B47A 3ZHTA 1Y5LA 3DXFA 3H3JA 3EZNA 1B8NA 3X1ZA 1CZNA 2YX1A 3OLWA 2Z2XA 1AHNA 4IS3A 4K6GA 4ZO7A 2XX3A 1ZRSA 5BQ5A 1RP7A 1W29A 1KARA 2C1ZA 5B1SA 4DR6B 1BQ4A 4GP9A 3CGWA 5E0OA 3ZIAA 1F2TB 2Z56A 3OJLA 4RFLA 4B2PA 2ZTLA 3NWJA 2XNDA 3FVQA 3BCRA 4ZK2A 4RABA 5BN1A 5D01A 1YL7A 1YZNA 3IAS6 1QTNA 3LQFA 1HX7A 1OFUX 1QHIA 3JQ8A 1XRPA 3R5TA 4M0KA 1EQAA 2EL9A 4ALMA 4IVPA 3PL1A 4B73A 4HDRA 3EIFA 2GAJA 4FOLA 1FS4A 2JGLA 1QK4A 3JCZA 2IC5A 1T9KA 2W6MA 4LC9A 1ZCZA 2JHGA 1L7DA 2EW2A 5LYYA 4LPKA 3T7TA 2IXAA 3W2TA 2AOXA 2ZT6A 2JI9A 3AMVA 4C7JA 3KT8A 5HSGA 4QRDA 2J3HA 3EF0A 4GG1A 1YR1A 3JX9A 4R7ZA 3HSKA 3V6MA 4AF6A 4B48A 1E4VA 1P5JA 2WJIA 1N8NA 2Z3WA 2JVKA 1K6JA 2WF5A 4MDFA 2PS0A 2XMZA 3EVNA 1SB8A 5IKPA 3A6PC 2FQ1A 5FWXA 3T54A 5KOHB 1G4HA 3AUTA 4E5UA 1AO3A 1L5HA 3KQNA 3KWFA 1ULUA 4U8GA 1HZZC 3DBVO 4R83A 1AKEA 4MV9A 2PMKA 3HL4A 2XMGA 3FWZA 3LT0A 3EX7C 3U39A 1TUBB 1PD0A 5CUQA 4YR7A 1U7UA 3OHMA 2HDNB 4PX9A 2VTDA 4KVFA 1AJEA 1CRQA 3QKWA 4R9SA 4QYIA 1TCAA 2LZ0A 2CL5A 1N1GA 3HB9A 3NETA 2WIDA 4CEJA 4KO3S 4JENA 1ULHA 2ZWIA 4DSZA 2FHSA 3PC2A 2O52A 2WTXA 4CLDA 3PTAA 3L2OB 1BXKA 3LPNA 1ZMOA 5DXJA 2JLZA 2NTYC 2C92A 4XWGA 5B3JC 1P2VA 4HVLA 4BQSA 1XEXB 4JK3A 5JPDA 1SVIA 1JA1A 1C8BA 1CUXA 1I4LD 1VGQA 3BTUA 1MO2A 4HQLA 1CF9A 2D0PB 4UD2A 5ALLA 5GONF 4C3VA 1DWQA 5BV0A 1NBMA 2HV9A 4RLHA 4HDMB 4KDRA 4K0KB 1XCMA 1DWUA 2R6DA 3RVLA 4CG0A 2QTGA 2CK3D 3HCRA 1ESEA 1T1GA 3WNQA 2E18A 4KE9A 5FPTA 2B1GA 2QMEA 1QYDA 2NTJA 4G86A 3R77A 4ZT6A 4UTNA 4C21A 3VAYA 3L02A 1X15A 1TO6A 5DWQA 1DAFA 5FOSA 2DGDA 4KGDA 3L92A 2I3ZA 4CKBB 3FSRA 5JFGA 2MU1A 3G2OA 1KY3A 3E23A 4ENSA 1P19A 2B4TO 4R3UC 1V0JA 1UFOA 3BD6A 3Q0TA 4FYWA 4LE1A 5T57A 2EIXA 4QU5A 2G7ZA 3UJCA 3W2EA 1MRNA 5JJKA 1U9CA 1IVYA 1T0PA 3QW4B 3X44A 4A5OA 5KYVA 3HWRA 4RXMA 2LIPA 3GUYA 3EFEA 4GZLA 3UEOA 3QIAA 5EGSA 4BJ1A 1LBQA 2G8LA 2ZQYA 3QKRB 5THQA 4ZTZB 1JF8A 2WJZB 4Q9LA 2OBXA 4QXAA 4RVDA 4L4UA 1P5RA 1E69A 2Q8PA 2JD2A 4PPGA 4FFDA 2G82A 4CM7A 2NYVA 2PMBA 3QOWA 4I1VA 2C5BA 1KDOA 1KVSA 4GKBA 4CR6A 4KLAA 1Q7BA 2I2AA 3HHEA 3K0CC 4MW1A 4RMJA 2WA1A 2AR0A 3U9TA 4DT1B 3HU5A 4BO5A 3NGMA 5KQPA 2X23A 3THXA 1ZUHA 3BMCB 3LUPA 1ZGAA 2GPNA 2ZJ7A 4P7BA 3C3WA 1XEAA 4UQPA 1DOHA 3NBYC 2F1KA 1DTSA 4TMZA 5JSQA 2ZSJA 4G5QA 4IO0A 4MR8A 1UOOA 1VB5A 4CMIA 1A2OA 3RJTA 5CW2A 1Z73A 2BFCB 1Z5OA 3I76A 1FIUA 1T3SA 1OPXA 2CYAA 4PYJA 1RQ7A 2Q2NA 3ETLA 5CT5A 3VU0A 2IP1A 3TQHA 2BSAA 3EDYA 1XJ0A 2OYCA 3ST7A 3BE6A 5HVNA 2Z1DA 3BREA 4TRNA 3PDHA 1RQGA 3MJEA 4Q6WA 5E8JA 3FWNA 1BDIA 1D2AA 1IUOA 4EBBA 3IGFA 1RI4A 3MS4A 3ANYB 3OIUA 1EBBA 4RHEA 1KYTA 3FTQA 1WMFA 2VVTA 3DD5A 3N8GA 4JT4A 4BNVA 1RYDA 3ENNA 4TTPA 5FNVB 5DRYA 3SS8A 1G3IA 3ZIDA 4Y2TA 2WHRA 1SFRA 3JD3A 2OD9A 3N0TA 3C0KA 3Q87B 4OMCA 5IXYA 5CPFA 5AVJA 1V1MB 2GD6A 1K8XB 2HWKA 5EMKA 4CYMA 1XRMA 4DQUA 3D3KA 1X39A 4OOEA 5KUTA 1RWOA 4BEJA 1EX9A 2C1XA 3A14A 1KHHA 2WTNA 4DB4A 3LUBA 1IB0A 1R8YA 5JARA 5CCBA 1R3UA 4H2DA 3T12A 1FVXA 1UMBA 3QEMB 3PQFA 4RM3A 4P7KA 4E70A 4ESVA 4KPEC 4QHTA 3Q1LA 3FTDA 1M3SA 5D3MA 1JQEA 2VJMB 1WHTA 3JQAB 3K92A 3QE2A 1XTRA 4RF2A 1LC0A 4YCSA 2O1WA 4DJ5X 1ZC3A 1YZGA 4CQMB 5A4AA 1CR1A 2DUNA 2F3UA 2QMQA 1MAUA 2A30A 1ZFNA 3VX3A 1CY8A 1FB5A 4PG6A 3CZPA 4UZEA 3JVIA 3QV1A 4AKIA 5ILOA 3ZVLA 2RGAA 1UWCA 4KODA 4ZRMA 5KNBH 2NO9A 3GUZA 3K94A 1J20A 3V1KA 4V0QA 3HM9A 2O50A 3LCUA 4ASUD 3G3EA 3G82C 2H16A 5ALOA 1QQAA 4QM6A 3O3MB 4UNSA 2BDTA 4PSKA 5DZSA 2GCNA 4TL7A 2XNSA 1MU0A 3DD1A 3K0KA 4Y6LA 3KKMA 4MUMA 5IARA 4JDUA 2PGDA 3ZCRA 3EUAA 4AD8A 1SN7A 5BWOA 1CK4A 3E3OA 2A5JA 4LUCA 1ID1A 2IU6A 4JVSB 5UKDA 4D3ZA 4D6YA 5CNIA 1EVEA 3C7CB 2PKEA 3H9UA 1QO0A 4Y3UA 5FA6A 4AMGA 3HYTA 2AYYA 2QX6A 3EAFA 3RAEC 1QRTA 4YAIA 1D04A 5H80A 1FFCA 1QCZA 4LISA 2GEKA 2QLLA 3IB6A 3OJOA 4YIHA 5DW0A 3NOXA 1UZUA 4L78A 2QXTA 4FW9A 4ITUA 4RVNA 4MTLA 4MQEB 4OF4A 4X9XA 3W1WA 4BE7B 2VQDA 2Q5EA 1I3NA 5JZ9A 4KPUB 1L8OA 3FUCA 2HREA 3TOSA 2AD5A 3WSTA 1NJGA 3PUHA 1FS6A 2BGGA 3T7DA 5HJ5A 1KBZA 4PFQA 3MWYW 1FUEA 1SPBS 1T0UA 4FE4A 4U6QA 4YI3A 3T9EA 5BNIA 1MABA 2VUSA 1T1RA 4W6QA 1A9TA 3THXB 4U3JA 4ZU6X 1XFDA 2Y1KA 4GWLA 4B6EA 3K6RA 4ETMA 4Q4AB 4P38A 1WP4A 3G0IA 2FKNA 3V4RA 3U17A 4YRMA 1JDTA 2BZGA 5K0ZA 1MFPA 1IBLB 2V7WA 4M9RA 5TIIA 4RC9A 5H4GA 1ZCFA 4IBOA 3RSZA 4KITB 5KS2A 1B00A 2GN0A 5TMBA 2PXHA 3F74A 3SE0A 5LP1A 1HDGO 1U5CA 1U5BA 1XMSA 3ROXA 1I7QB 2IV2X 1ZIOA 4HDSB 2IBMA 5FPQA 1SXQA 1NQXA 1PZEA 3MQ4A 4LYJA 3TIGA 2HMSA 3LLUA 3RVKA 3MTGA 1NOKA 1N1MA 1W19A 3KELA 5TGTA 1GRCA 2IFTA 2AZMA 4UHFA 2BTOA 4F21A 6CHYA 1WCWA 1GR0A 3B9RA 1LCIA 4V3CA 3TLXA 3UHAA 1EEHA 4CKBA 2F9MA 3SJBA 4U7GA 1A1SA 3I04A 4UARA 4WLOA 3ZWAA 2H06A 3QX3A 2RGDA 3PUIA 4YT5A 3U61B 2I55A 2QTLA 4OK6A 2H5LA 1FFSA 2COUA 2OMKA 4FHGA 4QHSA 1L5YA 3SDSA 5CDUA 5JEDA 3AKZA 4FZRA 1W9HA 1E66A 2QZSA 2G88A 2Q62A 2SECE 3B1VA 2VS1A 4B8WA 2A58A 1F38A 1QG0A 4MLCA 2W6ID 3F90A 2C77A 1AKNA 2O48X 4YRRA 4PWZA 3TTYA 1L7XA 1EFKA 5F1OA 2NSDA 1KZ1A 2C9ZA 1SURA 3QU2A 4TZTA 4URHA 5IKMA 5EJEA 3JASB 3IKJA 3U9SA 1E3DA 3OOWA 1QO9A 3AESB 3HUEA 5IU6A 5TC4A 2QQ0A 1S2NA 4OGKA 1T9CA 2VYFA 2AT1A 4J4HA 3B9BA 5DBIA 4RIIA 1PTKA 2PK3A 3IELA 3K1ZA 4C6SA 4GZMA 4KAFA 2PH3A 2O0MA 2CFSA 3BE4A 4PGHA 4M7OA 4WNAA 4BGEA 2DKOA 4JLPA 4Z0HO 2QYSA 3T99A 1PX0A 3FOCA 4ED9A 4EYSA 2I2DA 3O8NA 4LRTB 3G0HA 3RRZA 3X1XA 3AG5A 2VP2A 3PJGA 2XF2A 5FI5A 4E2YA 2I33A 2XODA 1RJFA 2JAHA 3JTMA 3PDJA 3NBUA 1U3FA 1TJ3A 1Z82A 2HQOA 3CE6A 5A9RA 2VR1A 2OV2A 2ZDHA 3B7PA 3IERA 4EAQA 1KIFA 2EDAA 4HB0A 3WRYA 4N1AA 1IC6A 4Z7NB 4AFNA 3ND7A 1I10A 1VKRA 2GQ0A 5J4LA 1BVHA 4BB6A 1F4PA 4JI0B 4AKEA 4JT2A 3T4XA 3D7LA 5FO0A 2VRNA 3TFOA 1QS0B 3CRNA 2DVMA 3CIOA 1MZVA 1L0BA 3HY6A 1C9DB 3PP8A 3T15A 1RD4A 1I5RA 1MV8A 3RYFB 4WFJA 5KTPA 3STVA 4A1FA 1I6MA 1AURA 1C5KA 4IHJF 1U0SY 4DCUA 2JFOA 1I4DD 2PRSA 2QUKA 1YK0A 4RL6A 4TRJA 4BMOB 4BNXA 4BX8A 5IXSA 2WMYA 4C2BA 1FW6A 1WLYA 2V9PA 4QT4A 3VU8A 1U4OA 3OLVA 2A5DA 4IGIA 3CXUA 5HJ7A 5CVVA 4KQ6A 4LY0A 3Q9NA 3T4UA 3H11B 3NU1A 4LKRA 2J0VA 3MWDA 4BPBA 4CQJA 4AQDA 1XIVA 3A05A 3ZE6A 1KJNA 3RSCA 4LZAA 4DM7A 2I9PA 1WU8A 3H5WA 4MZDA 3X43A 4E22A 4EO4A 4P3KA 5L3RA 2ERYA 3U7GA 1CLEA 3Q7EA 4O1IA 3ONDA 5EZYB 3WADA 3TVYA 4U7WA 4D3YA 1STOA 4LZJA 1C2TA 3URMA 3ZCVA 3R3ZA 4ZXPA 3FBTA 3OFNA 1K1EA 1U4SA 3DKRA 5KHAA 3SYNA 3CF0A 4Q15A 2V4UA 1UKVY 3W05A 1YFKA 3ZLJA 1KI9A 1E9EA 1DC8A 5COAA 1ZMRA 2HU7A 4UNRA 2PZ8A 4TQUS 1Y98A 3OU6A 3W9BA 4FONA 2CXTA 3P19A 4XGQA 3LPDA 2WSSD 3T5BA 1JTVA 1J0BA 1BX1A 1EGVB 1Y6GA 4OXRA 3E0XA 4FFVA 2A9RA 3R0QA 3B6EA 4LSWA 4CKYA 2XJ4A 1C1XA 5KU1A 3T5PA 3SQXA 3HK2A 1E6WA 1INLA 1RLUA 3R3SA 4TM8A 2KLBA 2ZI3A 4AXXA 5L40A 2FU5C 4MS1B 5ALXA 2QTAA 2IV3A 4C9BA 5I7OA 3DLHA 2W6QA 4J9UE 3G6WA 1ABBA 1C7JA 2V7UA 3LWBA 1Y1LA 3IHLA 4ZPXA 4UCFA 3SQLA 3WHLA 2HV8A 4D0LB 2CL6X 1PW5A 4KVAA 3KJGA 3WB9A 3PXCX 1CC1S 2HI0A 5JHHB 4K9MA 2PQMA 1IIBA 2AYXA 3OPQA 4G1BA 4BTVA 1WVIA 4LGYA 1DJPA 4J2TA 4YFYA 2PZFA 1XO1A 3GZNA 4E5MA 3IKTA 1ZD9A 3L6OO 1U90A 3VISA 1R37A 4UPEA 2IL1A 4WXPA 5CAEB 3TB6A 1N5RA 3DE7X 5CVUA 3E8SA 4YCDA 1OLSB 2VHYA 5IZCC 3HFJA 1AV7A 4M8IA 2PDAA 3FPJA 3U5TA 2RGNC 4Z9BA 4KLZA 4LHSA 4UAJA 2H4HA 4NJMA 2X0JA 1XDGA 3V4LA 3OZCA 2RCNA 5I7SA 2HA2A 3G2PA 2PRKA 2TYSB 3Q5EA 2ZYIA 3FLMA 1DXOA 3TPFA 1IRIA 5EIHA 2Q3LA 5JS2A 4TYPA 1KEVA 5JI2E 3QUBA 1GL9B 2UYGA 1Z4MA 1Z0FA 2D4AA 2Y68A 1HQCA 3WMEA 4EYQA 3KZNA 3TQOA 2CZGA 2YZ7A 4RCVA 1UQUA 4EY8A 5TVKA 4O2AA 4US1R 3TS1A 2QM3A 1OVMA 1TZKA 2ACVA 1WCV1 1L7EA 1PSZA 4NHOA 5AVUA 1EWTA 5H8WA 1RADA 2WD9A 2PZKA 1AC5A 1VE5A 1NQTA 2QVYX 2XW6A 3OPVA 3LPMA 2V65A 1CX9B 1WRBA 3T1YB 1PUIA 3ZBTA 3S7TA 5DO9A 3RWMB 4TLAA 2H1FA 2BE9A 3OM1A 1TKRA 1DX4A 5AWFC 1SCJA 2V5AA 2MJLA 4ZOLA 4N6GA 4IZ6A 3SICE 1FYDA 2O3JA 3HPRA 3FJYA 1NP6A 1XHEA 4KIGA 1PHPA 1SCNE 1DWPA 2OHHA 1SCDA 1FTSA 2JJ2A 1M34E 4HAVA 2WJ3A 4RK5A 3B8HA 1TPYA 1QHHA 2AV6A 4PONA 3M4NA 4NWIA 1OWPA 1PSDA 4G0OA 3PNMA 4HNHA 1DUSA 1GUFA 1QWOA 4C7MA 2ZCVA 1Y89A 2HHAA 4LQ4A 2X9VA 4HWRA 3KOOA 3EISA 4CEIA 2X86A 3ZVKA 3BEOA 3H1GA 2CNDA 1O95A 3PQ3A 1W73A 2J09A 2WZQA 3RK1A 4DTCA 4N76A 4GR4A 2JK0A 4TMVA 5CFLA 4J49A 3PYXA 3PHHA 1DQSA 4D9KA 2B9VA 5CFPA 3RADC 5BQXA 1WXDA 1L7BA 2WM9B 2HC9A 3PENA 4UDNA 1N1DA 1EJ6A 1I30A 3I2KA 2GHIA 1GZ6A 1U2GC 4A6EA 1TTTA 1MRSA 1ODTC 1UC8A 2VP9A 2FFHA 2GPTA 2QRPA 3AT1A 3C7TA 3RBAA 5DM1A 3HKDB 4IIGA 3T7KA 4C88A 4CM9D 1PBTA 4YMVA 2C9YA 1E5TA 1M66A 2FWRA 1X86B 1DEKA 3QELA 5H9VA 4IJUA 2HFJA 5ALKA 2WIBA 4Q00A 5ITZB 4N12A 1WF6A 3JQCA 5T4FA 3A1WA 1WULS 1TU3A 4URZR 5KOJB 3U62A 3HFSA 2WQ7A 1J6UA 2DECA 3C1UA 3KOWA 4ND5A 1Y7HA 2OHVA 3V42A 3FDZB 3H0CA 4BVFA 3P4XA 3AVYA 4GWKA 5EJ9A 1KNQA 1W52X 3AI3A 4MS1A 5JCJD 1RM5A 3P71T 4P2BA 5EE0A 1X80B 5F2NA 3JQAA 3LYLA 5DTEA 2Q3MA 3SJZA 1LTHR 4XOIA 3Q0IA 1JLRA 4HLUC 1XTPA 4WVLA 4Y2SA 3O73A 1PNQA 2J9RA 4QRIA 1XJCA 3O91A 3I61A 2EBHX 1GKUB 3AUJB 4OUDA 3T1QA 2QV7A 1GQFA 2Q99A 4YCCA 2C78A 2WUEA 2WEKA 3HZRA 3OJCA 4L5IA 4UTVA 3TINA 1KDRA 2F90A 4D4MA 5EWJA 3FCCA 4A1OA 1IN8A 4ZVLA 3L1IA 1KEEA 1P5ZB 1U8FO 4GMFA 3KP1A 2IYLD 2IPNA 2H0QA 3KS9A 2NYRA 4PRKA 2HMVA 2G8NA 4XDYA 5AKEA 5HKBA 4LGVA 3TO5A 2JA1A 1KVRA 3DGFC 2H4JA 4F4UA 5G1OA 4Y1RB 1DT5A 2FX3A 1XZBA 1FVOA 4EW1A 5LXTA 1EESA 2GS9A 1T4GA 2O7VA 3DFFA 5FBLB 4DDTA 4W5HA 1C8LA 1NNLA 5EZYA 3V8PA 3EAGA 3OZGA 3GPLA 2PGJA 3U7RA 1X9GA 2BHLA 2IYPA 2KWIA 3SDBA 4P4GA 1EX1A 4AIIA 1AZSC 1D1QA 4RDIA 5HW0A 3MWEB 3RE1A 3NPAA 4FMCF 1F2UB 4M2LA 1I2AA 1W4CA 3EVCA 4DIFA 5MHTA 1XBTA 1YONA 1BS9A 4Z3DA 2OAGA 4LVUA 5JNWA 1XRLA 4LDRA 4GM4A 4ZCQA 5I7VA 4HGNA 4RA6A 2OP1A 5E4JA 2F48A 3PEUA 1J97A 4OIFA 4ZCRA 2XUIA 3DZIA 3HI4A 1CDOA 1NC3A 3HYNA 3MD0A 1N2HA 4K3UA 3M4ZA 4TV9A 1MT0A 3RHSA 3GLIE 3AUKA 2J3KA 2OV3A 3KWJA 1NP7A 1LLQA 5G2OA 7MHTA 4JC5A 2M6KA 3HJGA 3IS3A 2J9XB 4AICA 3P2IA 1V41E 1L7AA 1YV9A 5CXQA 1EWQA 2EU8A 2IPMA 1URPA 2QMYA 4CFSA 4KXMA 3VYSB 1B6SA 2HHLA 2OD7A 3G5AA 3LFTA 3L7YA 4HPJB 1PT8A 3BFJA 5U1PA 2NSHA 3A1VA 4LXGA 3DZGA 5CT8A 2A5YB 4G5RA 1PVVA 4C4XA 1LBIA 3TG2A 4KU4A 4TV8B 1OH8A 1JMVA 4QYMA 2Z08A 5ICEA 5KKNB 4RMHA 5HQ3A 5I9NA 2IITA 3R44A 2QU7A 2BEUB 1EXNA 4CQLA 4ALIA 4QJIA 4OBBA 3JWIA 3KLNA 2I4RA 4FD2A 4IQ4A 3RUFA 3DZHA 1E1KA 1E5XA 1R4NA 2PLNA 3F47A 4ZOEA 4XX0A 4JI3B 4UMEA 3MCZA 4ER3A 4BQFA 3TKAA 4KW7A 2GLUA 1HI9A 1SD5A 2PL5A 4NEHB 3OPYB 4RH1A 3J81k 5EZSA 2JG3A 1WW2A 4IRXA 3S5JA 4B87A 4K03A 3EMKA 1KYVA 4QDKA 4XZ3A 1R8JA 1U7WA 2AI3A 4ACAA 2H29A 2P3LA 4S2EA 3WLNA 2ANCA 1CUYA 2P3OA 2Y92A 1C7EA 4MYRA 4PPQA 3R75A 2CZCA 1H8ED 1M7BA 4HKTA 4KMRA 3VHRA 4G2NA 1EUQA 1X70A 5JC1A 1AHHA 1FP1D 5EFZA 1HE5A 1I3CA 1QVWA 4A8HA 2QRVB 3CT4A 5HFNA 3RNLA 3E3AA 4OQZA 3RU7A 3PE4A 2PT6A 1YK1A 3DTTA 3FHLA 6YASA 1LD3A 1Y1SA 3KPJA 5JXIA 4EUNA 2AE1A 3EQ7A 5JVDF 1XD2A 1P9NA 4RVUA 1ZM3A 1FYVA 2BI8A 2DTEA 1YE8A 4OGGA 4QOEA 4Q03A 1YBFA 2XH8A 1H5UA 1J2YA 1RYYA 1ZGZA 2ZJ0A 3I2JA 1G291 1C4KA 1MO4A 1UMDB 3MPOA 5L3QB 2ET6A 5EIBD 2XXAA 4IEFB 4Y6RA 1KRWA 5J5AA 4R81A 1LH0A 5FNVA 3ADPA 2ZSDA 1GGVA 4P4TA 4FNGA 3KD3A 5D2CA 3OQNA 1QFMA 2XNJA 3P9SA 2O8FB 1L3CA 3SC6A 1CF4A 4QBFA 2P9TA 3A6LA 4MUEA 3K2IA 2RI0A 4U7TB 3A6DA 1WB9A 4PO8A 4E2WA 4RY0A 1N2ZA 1I01A 1OF1A 4DYVA 4Q9IA 2NQTA 3EVDA 5E6UB 5ECWA 5KHOC 5KVSA 2VTEA 4QFBA 3TH5A 1IMJA 2XCSB 1NVFA 1N77A 4PLYA 1VPVA 2GHQA 3GLGA 1ZO8A 2BBTA 2VTVA 5BW4A 3LP8A 4MJ3A 4WOPA 1P60A 5DVZA 2G63A 2XUQA 2PO5A 1ICIA 4BVEA 3X2FA 2HBRA 1KMNA 5D5QA 3T9BA 1ECPA 3PIDA 3NHAA 5DI3B 2LXNA 2BGRA 1JECA 2IYNA 5H3LA 3ZY6A 4CG3A 3P9ZA 3DVLA 2AG6A 3KTAB 4DNXA 4CDNA 4PYIA 1NBWB 2FUEA 3AM5A 4KPUA 5JD6A 3FCAA 3R7WB 2FJ0A 3K9BA 4F4JA 1C0EA 5FUVA 4FP9A 5C7IO 5JH7F 3GK3A 2V3WA 4UUBA 1L4NA 5H68A 2DHRA 2ZOSA 2PNFA 4QQKA 4NNOA 4LF4B 1I3LA 3HG7A 4HXYA 1FFXA 1L7PA 2JCBA 4JXJA 5IAGA 4N41A 1V7PC 1FTQA 3ZE1B 2PTHA 1CBUA 2R6R1 2YDYA 2A1TS 1F17A 4EM6A 4IEIA 1EHCA 3TR5A 2CE2X 1DDOA 1LBEA 1R3DA 4GM1A 3DW3X 2GXQA 4MKXA 2FF5A 4BZXA 1ILWA 1KYIA 5BSWA 2PWBA 5DYIA 3OZDA 4QUKA 1T3GA 3BKXA 2EX1A 3FVWA 3JR7A 1GPLA 2J5KA 4HAZA 1KEEB 1XAHA 1YU9A 4X24A 2HRDA 3ASYA 1I2ZA 2FPIB 1JP7A 2O4CA 2OQIA 2PFGA 3AOEC 2ONZA 2QVZX 4WLEA 4G8DA 5BSMA 5KAPA 1BEEA 3SNKA 4BFWA 2QLJA 1T2NA 3D8TA 4K40A 1R6UA 2UVQA 3DLPX 3RCBA 2VP0A 4HDMA 3RDPA 5BNZA 3SHVA 1GSIA 3IT3A 4NS4A 4LBWA 3GWZA 1GNRA 1DLIA 3DHWC 3KTOA 1D09A 3K1AA 3G0CA 4W1QA 3NEYA 3TRJA 4JEIA 3TGPA 2H3EA 2OCBA 2E4WA 5J9FA 4FBGA 3RRYA 1UMBB 2H4FA 2ZRJA 1L5QA 3HJAA 3I1FA 5EUQB 4DTIA 3VR4D 4B0OA 5IABA 3S8YA 1YL6A 1I0IA 5T64A 2AUMA 4I1OA 1X7ZB 3H1AA 5F35A 4BNJA 1XNGA 1OGJA 3QFFA 5FAKA 1PV4A 2B69A 1SHLA 2OXEA 3A4YA 4R98A 1SXPA 1IU9A 3WWYA 2QN9A 4G5YA 1JE0A 3CF2A 3VSBA 3TAUA 1HM5A 1TVCA 2BI7A 3MHPA 4HH0A 1NT2A 2UUPA 5IK2D 2GPWA 2GZ3A 4L16A 4IWXA 2D1TA 3R7NA 4EG7A 1GPKA 1DPGA 3HDJA 2JFQA 1ADFA 3BYZA 3DDUA 3DMTA 4PX5A 3JYNA 3NC0C 3OC0A 4LHZA 4A16A 4CTMA 2YXEA 5TXGA 1OXSC 3CE9A 4RHXA 2HWWA 3GFSA 3V2GA 3RF6A 4MQMA 4YP6A 5JH7A 3N74A 4K1XA 4AB1A 5BN3B 1DJNA 3KYDB 2CDAA 4XCVA 4XFJA 1F14A 1WWKA 1ZNWA 1CPYA