3DMTA

Structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma cruzi in complex with the irreversible iodoacetate inhibitor
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
359
structure length
359
Chain Sequence
MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, glycosomal
publication title Kinetic and Crystallographic Studies on Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi in Complex with Iodoacetate.
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
total genus 115
structure length 359
sequence length 359
chains with identical sequence B, D
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3dmtA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dmtA01
4FGSA 3P19A 3W4IA 1JTVA 3WB9A 2VHWA 1NYTA 2O2YA 2Q99A 2X9GA 1UUFA 3H9EO 1NAHA 3FWZA 4BO5A 2GLXA 1KEUA 3K92A 2E4AA 2FWMX 2GN8A 5A5FA 1VKNA 1TT7A 3ZWPA 2NU7A 5KCZA 1BXGB 1YJ8A 2PKQO 5EQDA 2VNSA 4EBFA 3ZV4A 1YL6A 2EF1A 2C7VA 3BMCA 4O0LA 3BYZA 1N7GA 5JY1A 5L45A 4WPGA 1NPYA 1IZ9A 1P1RA 1Y5MA 1D1SA 3MJCA 4WGGA 5F1PA 2H5LA 1RYEA 4J7UA 3VZPA 3WICA 4N5MA 1P74A 3OA0A 1XHLA 2UUOA 5G0WA 1DJQA 1ZIDA 1WDMA 3WIEA 3LQFA 4DLBA 4E31A 4CMBA 4ND4A 4BVAA 2AG8A 1T4DA 4QFDA 5JAZA 2R6JA 3CINA 2FRDA 5CFZA 2O50A 1X0XA 3Q2IA 3JQ6A 3LT2A 2DT5A 1Q7GA 1I3NA 3UUWA 4JLWA 4DLAA 4CPDA 3WGGA 5COBA 3ZWYA 1EFKA 2VHYA 4OYRA 5TRTA 1O6ZA 3JQ9A 4AJPA 3JQFA 5U9CA 1L7DA 4FR5A 2QZ9A 1PTJA 5AOVA 1T25A 1DC3A 3GVPA 3JD0A 3QVSA 3WBBA 1ZVMA 2DFDA 4OKNA 5H82A 5EINA 2CUKA 1ZJYA 3HADA 3RUFA 1IULA 1MP0A 2JKVA 4E2WA 1A4IA 2X5OA 4O63O 1NR7A 1DEHA 1QYVA 1ULSA 3C8MA 3HZZA 3SLGA 2C54A 1DO8A 3GA0A 5FF9A 1QV6A 1R0KA 3O8QA 4CMIA 1V8BA 3WMWA 3D3EA 4PRLA 4P8RA 4KMSA 1ZNQO 1PSDA 3BTVA 4OJNA 1ISJA 1UAYA 5JDCC 5A05A 2I5PO 3WLEA 4D79A 2HJSA 4CQLB 3TOZA 3RFVA 3DDNA 3VTFA 3B20A 1I3LA 1EVZA 3ZU4A 1U2DA 4HBGA 1M66A 4MVJM 4RVGA 3BAZA 3PQFA 1EK5A 1K0UA 4RVDA 4XYMA 5DOZA 3E5MA 4ALIA 4CM4A 2P2SA 3NTQA 4U6QA 1B15A 1E6EA 4IMRA 2JCXA 3OM9A 3F3SA 3QSGA 4QO8A 1LSJA 4YJFA 4XB2A 4D46A 4YQYA 4GMFA 2EKLA 1I32A 3GAZA 1Q7BA 1GYQA 3L4BA 2JCVA 5JYDA 1U4OA 2VOJA 1E7SA 3ROQA 3T4XA 1E3IA 4C7KA 2CVQA 3COSA 4FC7A 3H2SA 3INGA 2A4KA 2YDYA 1I2ZA 2GZ1A 1VL8A 5L95A 3NTRA 2ZYGA 5G4KB 1DLJA 3IS3A 4OM8A 4C4OA 4W4TA 2BRUA 2NVUB 3MJSA 3F47A 4Q3DA 2W2LA 3GGOA 1AXGA 4Q3NA 1Q0LA 2OP1A 4O5OA 5ILGA 3UVEA 1PS8A 3GPIA 4FSHA 1NBOA 3NTOA 4AJKA 4MP3A 4RGBA 5JC1A 2I65A 3S8MA 4FS3A 4E6PA 1YDWA 1LX6A 4XWYA 3QW2A 5IAAA 1CJCA 1PGQA 4Z3KA 1NQ5A 5J9GA 1RM4A 1EK6A 3PJEA 2ILTA 3QWIA 3SEFA 1HE4A 3ENNA 1A4UA 3JQBA 5L9AA 1RYDA 1YS4A 2FR0A 4OIMA 5EJ2A 4BL5A 4MVJG 5I7EA 3B70A 3ZI0A 5DBFA 4CM8A 4CR7A 4MIYA 5JCXA 1MUUA 1FDTA 4KQXA 3OMLA 4YAGA 3RC9A 1LA2A 1NASA 5IJZA 4TVOA 3I9NA 2C0CA 3GC6A 4N5NA 5BT9A 4JP3A 2YQ5A 5I8WA 3WXBA 3ZNOA 3AY6A 4CV2A 1KVSA 4Y9DA 4FFNA 3TPCA 1JWAB 4OGWA 3JD3A 4I9UA 2YHUA 3JQ8A 1VJTA 2BFAA 2SCUA 3D4NA 4L0QA 4EJ6A 3GEDA 4IIVA 3D64A 3QWHA 1D3AA 3K2BA 2WE8A 3OIFA 3FTNA 3GN2A 5J23A 1YOVB 3JQAD 3GDGA 4WEQA 4PG5A 4NK4A 4GVXA 3QY9A 2AEJA 4D7AA 1A9YA 2QRKA 1ZEJA 7MDHA 3EHEA 2GDZA 3G17A 5COAA 2CDCA 1TT5B 7ADHA 4R5HA 4I5GA 1MFPA 3FR7A 3SBOA 4Z3DA 2V6FA 4MVJA 4XYBA 3H9QA 1R15A 4BGEA 3ANNA 1WXDA 1ZSYA 3RBZA 2X6TA 4DC0A 5I9MA 1J5PA 4TVBA 3CZMA 4RVSA 1R4NB 5DP1A 1NR1A 2DBRA 2BGLA 4J9UE 1QLHA 4DC1A 5A9SA 1KC1A 4A03A 3F1KA 1U1IA 1HE5A 1R0LA 1P77A 2YW9A 2NACA 1TEHA 3OJ0A 1Z74A 3QVOA 5KOIA 3HDHA 4KQWA 2HO5A 3OP4A 4R51A 2EGHA 2EP7A 3VAZA 1P1KA 5A9TA 3WJAA 4IDCA 1R66A 4H15A 1ONOA 1C1XA 1CRWG 1VSVA 3E1KA 1NHGA 2C07A 2VTEA 3Q3CA 4LSMA 5JW6A 4E3ZA 3S2GA 3R1IA 5HWSA 3IJPA 2OUIA 4ZVVA 5T8KC 4IBOA 4XDYA 3K96A 4FB5A 1O5IA 1P45A 3MWEB 3PXXA 4Q39A 3KEOA 3AUTA 1IYZA 2VTDA 2ZIZA 1RM0A 1EDZA 4PFJA 4RF3A 4C7JA 2LDBA 4J7XA 5DCUA 5L7YA 4A2CA 2RIRA 5JYEA 2C29D 4RF2A 1YXMA 5AXDA 4IDDA 3RVDA 4MP8A 1RM3A 3L6EA 2OMEA 1E7RA 4BKUA 3KYBA 3WQSB 4S1VA 3MZ0A 2GF2A 5K6AC 3D1LA 1I36A 3ZWBA 3WWZA 2JHGA 5F5LA 3WQRA 4XYLA 3IKVA 3S2IA 3QQPA 2AQIA 3W8EA 4E5KA 4OXNA 4XDZA 4B4UA 5DNAA 4BO8A 2V7PA 1EZ4A 1Y8RB 1ID1A 2O7SA 2DUWA 1KIFA 1MXFA 1SEVA 3LF1A 1QLJA 3DFUA 3KYDB 5DCWA 1BDMA 2HK7A 2JJYA 5BNIA 1GQQA 1BRMA 1UXGA 2QZZA 3VZSA 1X0VA 4RDHA 3ZCXA 5B1YA 5AQ1A 1V3UA 3OHSX 3K9QO 5HTOA 1PS0A 3VOSA 4DIBA 5T64A 1BW9A 1J0XO 1SCUA 3DMYA 5EL0A 4IXTA 4MP6A 2W2KB 3KUXA 1F0YA 4O59O 4Q3BA 5BNTA 2DLDA 3I3OA 1PL6A 3FF4A 1MX3A 2CFCA 3GGGA 3CUKA 4QSMA 4QQRA 3ULKA 3GMDA 4U8GA 4YRAA 1RJWA 3EZYA 2JL1A 2DPGA 1T26A 2OHXA 3NGLA 4ILKA 4GMGA 1QYDA 4BHTA 3JQ7B 3AOEA 3GRPA 1HLDA 4PLVA 3V8BA 4CLDA 1W4ZA 4OMUA 3M6IA 3KXDA 3DAGA 3DBHA 3JYLA 4BQPA 1I33A 4IPTA 4E33A 1ENPA 2PTGA 2P5YA 2YV2A 3ZU2A 4L4XA 4HFJA 4PLPA 3VVCA 4BGVA 2P68A 4L75A 3INTA 2YHIA 4HFNA 4B7CA 1P31A 3PHIA 4F46A 3ON5A 3HNPA 3PPIA 1Z7BA 1I2BA 1EFLA 2JD1A 1H9AA 4ZU3A 5DBGA 2DM6A 3ZN2A 5GZ1A 4W9NA 1ZSVA 2Q1WA 3H5NA 3CEAA 4WEOA 3JYPA 5TT0A 3U49A 4J3FA 2RHCA 3ZNQA 4YAJA 5IZ4A 2I67A 5F21A 3FCOA 3L6DA 4OQYA 4ALKA 3VPSA 2HMVA 2A35A 1KVTA 2PGLA 2X0NA 1PIWA 4NIMA 3K6JA 4Z9YA 3H9UA 5JY6A 2OP0A 1BXGA 4LVUA 2NVBA 2H9IA 2G17A 5CG2A 4A7PA 4ALLA 2NTNA 3GEGA 2Q2WA 3GEMA 3VZRA 3PWZA 1EQ2A 1TLTA 2ZTMA 4MKRA 1H0KA 4IDFA 1F17A 4NQZA 1ZK4A 2X7HA 3DMTA 1E5LA 5KVQA 3VPGA 2D5CA 4BO9A 3ASUA 1DXYA 1XQ6A 4ZGWA 1A72A 1FDWA 2VHZA 4DTIA 1EE9A 3EC7A 5CDSA 4CMJA 3DTYA 4RQTA 5DZSA 3WGYA 3NDJA 2IZZA 4IDAA 4MVJP 2EP5A 3WSVA 5HM8A 4R1NA 1LC3A 2HRBA 2HSDA 2V6BA 3HG7A 4O6VA 3O26A 4W7IA 1U2GA 2FSVA 4FJ0A 3BIOA 3FPCA 1EVJA 4PGFA 1ZSNA 3PI7A 3L77A 3OEYA 4IQ8A 4GGPA 2EEZA 4CV3A 1HYGA 3TJRA 1AE1A 2Q1SA 5TIIA 4Y98A 5I7VA 5CHEA 3PZBA 4RQUA 1AHHA 3PJGA 1WW8A 2ZJ1A 4OOFA 4AL4A 1UP4A 3H5RA 4JROA 3H4VA 1D1TA 1I8TA 2NWQA 3PTZA 5TF4A 2DKNA 4AJ1A 4DMMA 2BH9A 3EDMA 1ZK1A 1QR6A 2V6GA 1GCOA 2X23A 4IJWA 2Q45A 3U4IA 4OSPA 1HRDA 2ZTUA 2XAAA 2PGJA 4WCFB 1ZBQA 4X54A 1FXSA 4QEDA 5K0ZA 4QFCA 4CQLA 1SOWA 4DYDA 1GY8A 4RO0A 3VDRA 3QJ5A 4D3FA 2O7QA 1YH3A 1T1RA 2WYVA 4JXKA 3EW7A 3WNVA 3JQ8B 1SB8A 5KNLA 4ZQBA 3ZHBA 4WKGA 3U9LA 3NT2A 5DBIA 2CDAA 2Y93A 1HYHA 3E5RA 3VKVA 3HDYA 5A06A 1JWBB 5CP8A 1NQAO 2W2LD 2E82A 5HS4A 1H5QA 2ZB3A 3F4BA 3SXPA 1LSSA 4YAEA 2AQKA 4UEKA 3M2PA 2Q50A 3ZGYA 2Q46A 3JQBC 3IP3A 1AN9A 2PWZA 1M76A 2NVUA 2AG5A 1C1DB 3H2ZA 1N8KA 4PZCA 1WAMA 4H3VA 3JYNA 1EUZA 1YDEA 3TZ6A 3TSCA 2HDHA 3HB5X 3VHRA 3AI1A 2NLOA 4YACA 4GX5A 3G79A 3FNHA 3MEQA 4NU6A 1NHWA 4EGFA 4A73A 2FPGA 2VWHA 3GG2A 4ID9A 3L9XA 4UULA 3G0OA 3LF2A 1EMDA 3PYLA 3BMQB 4LW8A 3WYCA 1UP7A 1F14A 1LC0A 4FFPA 4J43A 3FN4A 3G1TA 4NBWA 4L76A 3RQSA 1X1EA 1GEGA 3GHHA 1U3UA 2W4QA 1P33A 4BNJA 3GG9A 3EK2A 4NDNE 5THKA 4HKTA 1WVGA 4ZQHA 3WTCA 1YQDA 1B8VA 5L4SA 1XWFA 3ETGA 4GWKA 1UXHA 5A9RA 1VE9A 2FN7A 5K9ZA 2QX7A 4WOJA 1ZK2A 4RVUA 2PFGA 3RKRA 4FN4A 4MVJD 3A1NA 4B4VA 4ZQEA 5TGDA 3K31A 3BA1A 3N58A 4P4LA 1HWYA 1OOEA 1YOVA 1Z73A 3PDJA 1H6BA 5HBRA 4ZICA 2HMSA 3OIGA 2AXQA 1YQGA 3AI3A 2P91A 3K2EA 1P3DA 4L4SA 2CSUA 2Z1NA 5ILOA 4GI2A 1TT5A 5I8ZA 4CR8A 2PH3A 3LYLA 1ML3A 1DIGA 1XA0A 3GFBA 4U6SA 2EXXA 2YUTA 3H65A 4HX5A 1D7OA 3VZQA 4AJNA 1HDZA 1IZ0A 1NFFA 3PYMA 3DZHA 1R4NA 5AYVA 4CL8A 1UDBA 3DBRB 4XB1A 5EIOA 3GVXA 4EUFA 5F5NA 2CF5A 1AUPA 4HWKA 3HN2A 1ZH8A 3FNEA 4RPLA 1ORRA 4JNKA 1RWBA 3L07A 5G0TA 1NPDA 1X15A 1GEEA 3N74A 1ZXLA 3ONFA 2J3HA 2GZ2A 1QYCA 2OBYA 4PG7A 1P1FA 4IDGA 1B0AA 2Y1OA 3IP1A 5T57A 4FBGA 2UAGA 1U7TA 3WSWA 3DOCA 1MFZA 1HTBA 2X9NA 3H6KA 3RKUA 4J91A 4TRJA 2GASA 1BVRA 5ENVA 1RM5A 2O3UA 1YB4A 5TSDA 3PVZA 1KETA 1T2EA 4KP7A 1NVMB 3HSKA 4DQXA 1ISHA 4WCDA 4BNUA 2NV6A 3LVFO 4HP8A 4NZ9A 5I7FA 1CETA 1WP4A 4RPKA 1DFGA 5JLAA 4P22A 3C1TA 2YHIB 3TZKA 1HDXA 3ICPA 5U1PA 3B1JA 1YBAA 3K73O 2IZ0A 5L51A 1LRKA 4J4BA 4IZHA 4BO4A 4I5DA 4JGBA 1KS9A 2CNBA 2C82A 3TFQA 4U0JA 2IRWA 3LC1O 1T2CA 1KBZA 2PD3A 2NTVA 1UP6A 4L73A 3W6ZA 1W6UA 2DBQA 2HLPA 1GPJA 3DEYX 2P9EA 3F6YA 4PLGA 2G5CA 3KYDA 1OC2A 3A14A 2C2XA 1MG0A 4D0SA 3PZRA 3U3XA 2DU8A 3F46A 3HWRA 3LT4A 3ROPA 3VH3A 3VPFA 4B4WA 2D1YA 1CWUA 1T1SA 4J7CA 1HF3A 3BMOB 5IN5A 3U62A 4YT4A 9LDBA 3AOEC 5KTKA 2EKQA 4FPXA 3OH8A 1A9ZA 4UVGA 1SNYA 3WGQA 3TOXA 1JA9A 2W2KA 3QVXA 1ISIA 4CM6A 1T24A 5L3ZA 2PD6A 5ITWA 3ZWXA 2UVDA 2I66A 3C1AA 2WSBA 5JPIA 1MC5A 4OO3A 1U4SA 1W8DA 2ZTVA 2B5WA 1ADBA 4R01A 3FTPA 3ZW8A 1G0NA 4DPKA 4LN1A 1YVEI 4GGOA 4GX1A 2DBVO 4DXHA 3WX0A 3Q11A 4BO2A 3QE3A 3JQ7A 1NNUA 3INRA 4F45A 2Y1DA 4W9NC 4E32A 1O8CA 4R3NA 1SO8A 2VHXA 4OKIA 3KLMX 1DAPA 4BMVA 3OETA 5DP2A 3GVCA 3N7UA 2BKAA 1DIAA 1DRVA 4JK3A 4DUPA 5DDIP 1R6DA 1OBFO 4W6ZA 1E7MA 3NJ4A 3WGIA 2J6IA 2D5AA 4CQMB 4XQGA 1M6HA 4DL9A 3Q2KA 4NNJA 3HHPA 4BO7A 3AM3A 1ARZA 3H5AA 3ZWWA 3EUWA 3OQBA 5EESA 2OFPA 4EEZA 3AUSA 3TDKA 1WLYA 2ZB4A 5AVOA 3TZQA 1MA0A 2G76A 3WNQA 5JAIA 3DMTC 3MJ4A 4JCOA 1I0ZA 4ZRMA 2YDXA 1Y7TA 2O4CA 4FJ2A 4TRMA 3KEQA 4YCAA 4AFNA 2PZJA 2BI7A 1UZNA 1CEQA 1VLLA 4CLHA 4FFLA 3FNGA 1X7HA 4PVCA 4IS2A 2BGKA 1E7WA 1UDCA 2Q1UA 3E8XA 3FSRA 1I5RA 5BQFA 2VYNA 1L7EA 4D42A 4RZIA 2EJWA 1K6IA 3QVTA 1QMGA 4ZN6A 3D4PA 4NFHA 3L6OO 1PEDA 3ZWNA 5F1OA 3WGZA 1E0DA 2OORA 2I3AA 2GYYA 4M54A 4RVHA 3IIEA 3VH1A 1PJ3A 1Q0HA 5EPOA 3T7CA 2Y0DA 3C3XA 1Z6ZA 4HADA 5BSEA 1E3WA 3UCXA 1GYPA 3PDUA 2DFVA 2HK8A 3HFGA 4D45A 4XRGA 4TROA 1XU7A 4RZHA 4GL4A 1P9LA 3PFFA 2HU2A 5GY7A 4WECA 1ONPA 1U3TA 2GUGA 2CY0A 2NU6A 3DL2A 3F5QA 4BKQA 4EUEA 4B3IA 6LDHA 4CUKA 2X8LA 4N54A 3WGTA 3ZDFA 3OJLA 4P4NA 5IDYA 2X0JA 5IF3A 3KB6A 5JCJA 1BMDA 2C59A 3JD1A 4NFYA 5JXWA 1R16A 3ADOA 2GCGA 3I9LA 3PLRA 4J0EA 3ZV5A 2FY8A 3WBFA 1NP3A 4JP2A 4D3DA 4KUHA 3I5MA 5TNXA 1OMOA 2BELA 2HMTA 2YV1A 3HE3A 3PJFA 1LLCA 4WCFA 2XF8A 1ULUA 3EMKA 2J3JA 1H9BA 1I3KA 2JFGA 2IEDA 4RPHA 1EBFA 1ADFA 1YRLA 2I9PA 4JBGA 3S2FA 2UYYA 3UW3A 2IYOA 5B37A 2EHDA 1JVSA 3AWDA 3IDSA 3GOHA 3BHMA 4WASA 4ZHSA 1LSOA 4LK3A 2VWGA 4BO3A 4D3SA 5FEUA 4IS3A 1C0LA 1YONA 5A4DA 1S7CA 3GR6A 1PQWA 4IZIA 4BS9A 3LK7A 1ENYA 4J1SA 3U0BA 3E18A 2X5JO 4NR0A 4GWGA 3DAFA 3MWDB 1EQUA 3RUEA 2P4QA 3EZLA 5M6DA 5FWNA 4XZ3A 1T2AA 3ZNNA 2NQTA 5EMHA 3B6ZA 1Q7CA 4AJEA 1DIHA 4NFSA 1YB1A 4RL6A 2JFHA 1C0KA 3ZWCA 1C1DA 2G1UA 1B3BA 3MJTA 4Y8VA 1G6KA 3S2EA 1DRWA 5CPFA 3QP9A 4GKBA 1HDOA 1BVUA 1M6WA 3JTMA 4O1MA 1SOVA 5C5IA 1GR0A 4BV9A 3PGXA 5LDHA 4E5PA 3GN1A 1WNTA 1A71A 2PD4A 3BMQA 4MO2A 4BMSA 2IEBA 1SBYA 4OHUA 1K89A 3DHNA 4MVJI 2FP4A 4BKRA 3KSUA 3CE6A 2O3SA 2QQ5A 1MV8A 3AK4A 5KJCA 1NM5A 3WFIA 3I4FA 1K6XA 3F1LA 4E5NA 5IDXA 4KUEA 1O9BA 1QG6A 2DPHA 2QYTA 3NV9A 1SC6A 3AUUA 4R54A 4YB8A 2GPTA 3VVBA 4L74A 5MGBA 2GZ3A 4TSKA 1GQ2A 1NQTA 3QWFA 3A4VA 3O4RA 3OFSA 2E49A 3W1VA 1ZCJA 2AQ8A 3DQPA 2ZK7A 3DHEA 4B3HA 1JKJA 5AXAA 1FDUA 2V6MA 1LDGA 2EKPA 3I23A 3H9JA 1T2DA 4R1UA 3CTMA 4BNKA 1TVEA 1FDVA 4G2NA 5G2OA 4MINA 2OL4A 2XOXA 2R00A 1QV7A 3UCFA 2X1HA 3PWSA 3L9WA 4PRKA 5JAQA 3ZNPA 4I5FA 2NU8A 2GN6A 4D41A 3DBRA 4RDIA 2Q3EA 1U3VA 1HDRA 1KVQA 2A94A 2W8ZA 1MGOA 1Y9AA 1AHIA 1JW9B 1IHYA 5ADHA 2HRZA 1KEVA 1BSVA 2PGDA 2Y1GA 4Z0PA 1UAGA 2YYYA 3RBVA 4CL3A 5GZ6A 4CR6A 3OIDA 4NJMB 4NMHA 3KOUA 2H6EA 2ZCVA 4MOWA 2EW2A 1UXJA 2UDPA 1DAOA 2ZCUA 1TI7A 5T6BA 3WG9A 1XIVA 2XPCA 1KC3A 1SPXA 4R1SA 1VKOA 1VPDA 1LDNA 4H16A 1M67A 1AGNA 4KUGA 4E4YA 3RFXA 2XXBA 1YBMA 1C0PA 4R9SA 3UH1A 2IDZA 4NJOA 1EUDA 4KZPA 1DDOA 3ETDA 5TC4A 4XR4A 3DAPA 3OQ1A 4YRDA 3WGHA 3JD2A 3D4OA 4JQCA 1NFRA 2JCYA 1LXCA 1ZK3A 4J4HA 1LDEA 3C1OA 3FBGA 2FZEA 3UN1A 4PG6A 1NAIA 2V65A 4HV4A 5JO0A 4AJJA 3NGXA 4TQGA 4FCCA 3VTZA 3GGPA 1PGPA 4EI2A 4LISA 4II3A 4OQZA 1WPQA 2DC1A 1P1IA 4Z0TA 1LEHA 3DO5A 3DR3A 4P38A 2B69A 3WDSA 3EVNA 2FPIA 3D5TA 2WJPA 4E30A 4Z9FA 3BMOA 4OSOA 2PA3A 3C7CB 3ZU5A 4DBVO 1ADCA 3IJRA 1IOLA 1M75A 3TL3A 4R5MA 4UVEA 1DIRA 4XD2A 3ROMA 1PJQA 1CQIA 5IXSA 2PZMA 3LDHA 3D7LA 4DMLA 4GBJA 2UUPA 1KEPA 1W0CA 3ANLA 3LZ6A 1WZEA 3PHGA 3HB4X 4BO6A 2C5EA 3ADPA 3S55A 4KWIA 1GD1O 1LDYA 2WD7B 3WWYA 1A7KA 1LSUA 2A9FA 2GR9A 4IIUA 4IY1A 2AHRA 4J90A 3PJDA 4PZEA 5THQA 1CF2O 1E3WB 1C14A 1Y6JA 1KY4A 3P7MA 3Q9UA 1LLDA 1NQOA 3E9QA 4RV9A 4TKMA 4CLRB 3RU7A 1LQUA 3RWBA 2B5VA 4OXYA 5TS3A 4R1TA 3GDOA 1R12A 2X5KO 1F06A 4KTTE 1D8AA 4HUJA 1HYEA 1X13A 4MVJF 2HKIA 3BTOA 4K28A 1LLQA 2ZJ0A 3AM4A 4CQMA 4F6LA 3HFSA 5L7WA 1NVTA 2NUAA 2YV3A 2G82A 1R4MB 1ISGA 1HE2A 2D0IA 5B4TA 4QUKA 2Q2QA 1YWGO 5A04A 5IG2A 2C7GA 3JQGB 4DWVA 1GPDG 1PR9A 4GX2A 5BSFA 5EERA 1E3EA 4J2HA 5G0UA 4I08A 4URFA 1BG6A 1K2WA 4NBRA 1DSSG 3OJOA 2W90A 2PY6A 4YJHB 2VYND 4DRYA 3U09A 1K3TA 5JDIA 3RIHA 3LC2O 4DREA 2IZ1A 2ZYDA 5IDWA 1HE3A 2VYVA 2D4AA 4AJHA 4B7XA 2WMDA 3PHLA 1E3JA 1WDKA 2BMAA 2PK3A 4E5MA 4BGUA 5A1TA 4ZA2A 3GNTA 1PL8A 3E6AA 1S6YA 2GERA 3WQQA 3Q6IA 1B8PA 1HL3A 4NHEA 3P2YA 3SC4A 5TJ9A 3X2FA 5B12A 1NVGA 3TZHA 1K5HA 2VN8A 4S3MA 5JO9A 4BB6A 5L4NA 4TRNA 3AU8A 4PLYA 2RAFA 1KVUA 2DQ4A 1B16A 1YJQA 4ZJUA 3IAHA 1ZUD1 2ZKLA 3UOGA 3M1AA 1P1HA 1VSUA 3UF0A 4IJKA 4CM7A 4QXMA 5DOVA 5JCJD 4M86A 4ZD6A 2E48A 5AXCA 1LLUA 5KKCA 2Q4BA 4BNTA 1CDOA 2EJVA 3RC2A 1HZJA 4DQVA 1UXIA 1QYXA 3EY4A 4WCFC 1Q2XA 3TWOA 3DWFA 2AE1A 2Q49A 5CPBA 5KJFA 1MG5A 2WTBA 4JBIA 3IUSA 5KJ6A 4EW6A 3W4JA 1V35A 1ZEMA 3JQEA 3O03A 4PLZA 5MDHA 4EYEA 1IB6A 1CQJA 1ZMOA 4NBUA 1V9LA 2O3QA 2Z5LA 3DC2A 4LGVA 3JCZA 3PRJA 4P4GA 4U0KA 5A3VA 4CMEC 4IJVA 1VRWA 1GL3A 1H94A 4BNYA 4OOEA 6ADHA 3R6DA 1NPTO 2VZ9A 1ZXBA 4W99A 1GFSA 4BNXA 4E0BA 5BSHA 1B3RA 1BWSA 4YPOA 3IOYA 4UVIA 3G1UA 1TB4A 4RF5A 3KLPX 3KTDA 3NJ8A 1KEWA 5G0VA 1H6CA 4KDFA 2LDXA 1NFQA 4UUOA 3SVTA 2VUTA 3GLQA 2PNFA 1EBUA 2O3TA 2IYPA 3NKLA 4W82A 4EZBA 4XGKA 2P5UA 2Q4EA 3AI2A 1GUZA 3QV1A 3E9NA 2O2SA 1LDMA 4TWRA 3WJ7A 3RD5A 3ABIA 1XU9A 1GUYA 5A02A 4WLOA 1CERA 2AA3A 2BFOA 4DPMA 4IDEA 4WNCA 5DCYA 3TQHA 1OC4A 4INAA 2RBEA 4NK5A 3IQDB 1BGVA 4BNVA 3VPHA 3BTSA 2Y0CA 3ZZNA 4D44A 3GNSA 5I7SA 5I9LA 4LMPA 3WR5A 1PJTA 3UHAA 4DVJA 3NDIA 2X0RA 1GADO 5ES3A 4IQGA 3LU1A 2IXBA 1SB9A 1JVBA 3EVTA 3I9KA 4OH1A 1E1MA 1PZHA 2GGSA 2WWRA 3OECA 3FPLA 4B4OA 1B26A 1WMAA 2CDBA 5KIAA 1KY5A 4RJTA 3RCBA 2VWPA 3CIFA 4BKPA 1H6AA 2O4UX 1ZO8A 3OJFA 2GSDA 2NADA 1KOLA 3FRJA 3GQVA 4R4JA 1XELA 4QX6A 1MLDA 4JJFA 4IQ0A 3L4SO 1JQBA 2JD2A 5C7IO 1X14A 2D59A 3RUCA 1XGKA 4E13A 2NQ8A 1PJ2A 3JV7A 4G81A 4N5LA 4ZQFA 5ITVA 1JKIA 2Y66A 1J49A 3OA2A 1P0CA 4XKJA 2EIHA 4ITUA 4XJSA 4BV8A 4J16A 3PLNA 2R00C 4GLOA 3KM0A 4YA6A 3NRCA 3WIDA 4BB5A 1BXKA 3RSHA 4PCVA 4CM5A 4AJIA 1GDHA 3GZNB 1YGYA 3GZ4A 4WLEA 3DZJA 2EG9A 1ZK0A 3RASA 3C85A 3O38A 1DPGA 1O89A 5COQA 3GFGA 1NWCA 2OBNA 4BOYA 3NT4A 1PJLA 1Z75A 4M87A 1LJ8A 3KYCB 4AJLA 4CMKA 1HKUA 1HSOA 3GHYA 5KVVA 2VWQA 4KWHA 2QW8A 4J4TA 4I9HA 2X9VA 2VRCA 2E37A 5DULA 3WTBA 3I9JA 2R2GA 2HAEA 2IE0A 3DTTA 1VC2A 3R3JA 3RFTA 2WE7A 4YR9A 4WNIA 3RU9A 1F12A 1XCBA 3MOIA 4TMFA 2PH5A 3JQDA 4R69A 2OO5A 4XRRA 5KJ1A 3BXXA 1U9JA 1R37A 4Y6RA 5TX7A 5H81A 3BHIA 4YYZA 1UZMA 4PG8A 4UUMA 1CIVA 2QIOA 3HUDA 3DONA 5JE8A 5F1KA 4YWJA 1LDBA 5JMWA 5L7TA 3H7AA 1U8FO 4NJMA 4KOAA 3AM5A 1E3LA 2B0JA 4GX0A 2X22A 4YDRA 2F1KA 2VZ8A 4GVLA 3I83A 4Q3EA 5LDGA 4CLXA 2BD0A 1Y8QB 4N7RA 3H8VA 1VI2A 4BKOA 4AJ2A 2BHLA 4YBZA 1V3VA 5KVCA 3KRTA 3NX4A 4M1QA 5TQVA 3C7AA 3ICCA 2PKQP 1UDAA 3OF2A 4NPCA 4DYVA 1ADGA 2ZQYA 2X0IA 4ESOA 1DHRA 4YAKA 3ITDA 5KJEA 4FJ1A 4EJ0A 2HMUA 1PWXA 3OSUA 4RVFA 1YL5A 3NDRA 5JNLA 4CV1A 3HQ4O 3Q9NA 4OXKA 1BHSA 2VRBA 3A06A 4EUHA 1E6WA 4UUPA 3LLSA 5JMPA 4F3YA 3ORFA 1HDYA 5C7LO 3PQDA 1XEAA 4UVDA 3CZRA 1PGOA 3VH4A 5IN4A 4GKVA 3GY0A 1E7YA 1XLTA 2WEKA 5C37A 4MIEA 1LU9A 2HQ1A 1XG5A 3AFMA 4HXYA 2Y1CA 3GUYA 4JBHA 4CUJA 4K9DA 3OBBA 4CJXA 1HSZA 3V5NA 3GVHA 1V0JA 2Q22A 1GUFA 1FF9A 3I9MA 3PP8A 3TFOA 4H7PA 5C3MA 4ALNA 4HNHA 2ZB7A 5CEFA 3UAGA 4FFOA 2Y05A 4MVJE 2H63A 3CPSA 4B79A 3GRKA 4EITA 5DN9A 2PR2A 4JN6B 3GUCA 3ENKA 2TMGA 3STHA 1MB4A 2FPPA 3ZH2A 3LLVA 4I1IA 2PLAA 4MKZA 4TKLA 4B7UA 1H2BA 3DZKA 4A10A 1G1AA 3RC7A 3SJUA 3ST7A 1DRUA 3I6IA 3PQEA 2NNLD 3D3WB 1YE3A 4LRSB 3ZHZA 1PGNA 3BHJA 1CYDA 2X4GA 3JYQA 3U5TA 3RAJA 4DPLA 2WD7A 3V1UA 1MXHA 1SMKA 3M2TA 1N7HA 4CMAA 4J49A 2VUUA 3I9OA 3JQCA 4BNNA 1P1JA 4ALMA 1U8XX 3ASVA 4J2OA 2B36A 5HRUA 2IODA 4CQMD 3RJ5A 4XQEA 3TL2A 5A3JA 1V6AA 4CLRA 3JD4A 4RLHA 1JLLA 2QHXA 3E9MA 1I30A 4OAQA 4YT8A 5CAEA 1DC6A 1N9GA 2VOEA 4WOKA 4J1NA 4MJLA 3WGOA 1GZ3A 3PYXA 1PQPA 3QWBA 5JDIC 4CODB 3VPXA 3JQAB 1W73A 3ANMA 3U4CA 2QRLA 2Z95A 1GYRA 1BXZA 5GZ3A 4GQAA 2J5QA 4LMRA 1YO6A 1EUCA 4PLHA 3AW9A 3VDQA 4PLTA 4L9RA 3RC1A 1ENOA 2VCYA 1NX6A 1Q0QA 1R4MA 4PZDA 4Y6SA 3ZWVA 2VYVD 4UUNA 4IXWA 3RROA 5JAMA 1I24A 2GNAA 3P2OA 3JQGA 1K6JA 2YFQA 4R9RA 4RCVA 4W7HA 4PLWA 3PFWO 3V1YA 3E03A 3U4HA 4AICA 1A7AA 3HN7A 4XIYA 3VKUA 4WLVA 1D4FA 5GMOA 4YJHA 4J1QA 3DBVO 2VT2A 3UFXA 4Q9NA 1Y81A 2X86A 1PZFA 2B4TO 2CMDA 1XQ1A 4ND3A 1GQYA 1YBVA 2Y0EA 3F9IA 1ZKMA 1P44A 3FR8A 1VL6A 3QHAA 2GD1O 4DBZA 1EVIA 1IL0A 4UAGA 3QLJA 4BO1A 4CMEA 3RUIA 1NTOA 3IMFA 3KVOA 2JD0A 2OXIA 3PIIA 5G4LA 2FR1A 2Z1MA 3WLFA 4FC6A 5FI5A 4YQZA 4GSLA 4RPGA 4EDFA 4XX0A 5F3RA 3IKTA 5JSFA 4FIZA 3BTUA 2NSDA 4FOOA 1HXHA 4RLSA 3ZV6A 2FZWA 2I76A 3FNFA 4XGIA 2BLLA 5CDUA 3GPDG 4GPD1 1UXKA 2WD8A 4CM1A 1B14A 4HNGA 2D3TA 4CM9A 5LCXA 1ZW1A 1X1TA 3GH3A 2EV9A 3IUPA 5TJHA 4UEOA 3A28A 5CG1A 3EYWA 1UR5A 4JIGA 3DHYA 4R3WA 1WWKA 1KYQA 4XJTA 3FBTA 3PK0A 4M55A 3R3SA 4PLCA 4LVCA 1T4BA 1LTHR 8LDHA 3AY3A 2A92A 3Q0EA 1I3MA 1I10A 5TT1A 3TZCA 3RUAA 3S1LA 3K8ZA 3WMXA 2PKRA 1N5DA 3SX2A 3P5SA 3UXYA 2AQHA 1BDBA 2VUSA 1YQXA 3DBLB 3W8DA 2O3RA 5T73A 4BMNA 1PR3A 1QKIA 4DIOA 4K1LA 1JDJA 5KVSA 4EEXA 1GV0A 2QYSA 4I9NA 2D8AA 5L40A 2NM0A 4TZKA 1PJSA 1WZIA 3BMNB 4DIFA 5L53A 4ZRNA 1ZFNA 3TF5A 1DFHA 4FD3A 3MTGA 5B4UA 3LT0A 2CZCA 4Y67A 4ND2A 2HCTA 2J8ZA 3VH2A 3CH6A 1JU9A 1O0SA 3AUAA 3EAGA 2CF6A 1X7DA 3R0IA 2C5AA 4RF4A 2AEFA 2EWMA 5JC8A 3PEFA 1LNQA 2JHFA 1I01A 1OI7A 5IZCA 4LCEA 4BNIA 2EGGA 4XQCA 4CLOA 3DZBA 1B2LA 4XA8A 2WM3A 1XYGA 4QTZA 3ZWAA 1ZJZA 3B1KA 4UVHA 2Y1EA 3I52A 3E82A 1OZAA 4YJGA 2RH8A 5T67A 3PIDA 3DB2A 5KWEA 1E6UA 1HETA 4M49A 4XYEA 1PU2A 2HK9A 3OEWA 1HDGO 1JAYA 2FMUA 2B35A 1HT0A 3K5PA 5BNFA 3RJ9A 1LUAA 4LRTB 1N2SA 4WLFA 4AG3A 1DC5A 4AJOA 1E7QA 5U4QA 3F5SA 2P9CA 4YAIA 5I9NA 2OZPA 3DXFA 2Y68A 2Y99A 3DZFA 2BFPA 5ER9A 3FD8A 3I1JA 2O48X 1T2FA 4JJGA 1NWHA 1LRJA 1VM6A 1OAAA 1IPEA 1IY8A 3ONEA 4GH5A 2D2IA 2DTXA 4J0FA 3BMCB 1HEUA 3G49A 1DB3A 1DC4A 1FK8A 3IC5A 3NAQA 4ND5A 1FJHA 3OJEA 1ENZA 4BNWA 3LSYA 2GN9A 3HDJA 1TXGA 4CUZA 4MDHA 4NI5A 2ZB8A 4K6FA 1PJCA 3UICA 4DQUA 2JAHA 4QT0A 3UKOA 1E77A 4YVFA 3BZUA 3DZGA 3GMSA 5HS6A 3WFJA 5DT9A 4U5QA 3V2UA 2GN4A 2IXAA 3ZWMA 1HZZA 2BFMA 4PN3A 2Y67A 3RI3A 2BF7A 2HUNA 3H3FA 2RH4A 1J6UA 4BQRA 3GZNA 3ONDA 2YZ7A 1IE3A 2ET6A 3UCEA 4PG4A 3FWNA 2VRCD 4CMHA 4IMPA 1DIBA 1NXQA 1ONNA 3FI9A 4XEHA 4AVYA 2AMFA 4XGNA 5CDTA 3SJ7A 4A27A 1B7GO 4TRRA 4GAEA 3C24A 1XSEA 1O94A 1GCUA 1HDCA 2VHVA 3KYCA 3D0OA 2EW8A 2YJZA 4K6CA 1YKFA 4CLEA 4IJUA 3KSDO 4ONEA 4Q3CA 2YY7A 1MC4A 2PZKA 3O8QB 2OOSA 4Y6PA 4CMIB 2O3JA 4MPDA 3MTJA 4R16A 1XDWA 3PHHA 1XR3A 2VQ3A 4BNLA 3NYWA 1ZMTA 2J5RA 3W4KA 4DLLA 2WDZA 1ZZEA 1E1NA 2B4RO 4L8VA 1QXSA 4TZTA 1A5ZA 4MIOA 1E3SA 1UZLA 4DA9A 5CEEA 3ZHYA 1PZEA 5FI3A 5AXBA 1DHTA 4CM4B 4U7WA 1LQTA 2QG4A 3CKYA 1OFGA 1TA4A 3E48A 2JAPA 3GF4A 3ZV3A 1U3WA 2DTEA 3AFNA 3CSDA 4R68A 4ALJA 2B83A 4YJFB 3U4DA 3F4LA 1Y8QA 1R0SA 2I3GA 4LSWA 3JQ9C 4D43A 3JQFC 3TNLA 2J3KA 4CMCA 1FDSA 4DGSA 5JDCA 3Q1LA 3ZU3A 4BGIA 1KVRA 3NT5A 1N9GB 3HJAA 5JYFA 3T7EA 1KERA 2W98A 1SEPA 5A03A 3DOOA 4M89A 4A5OA 1QSGA 4BO0A 1N92A 1Z45A 4YT5A 1EDOA 5IDQA 2NTJA 3C7DB 2C2YA 3ETEA 1C3VA 4FGWA 4K26A 2HJRA 2RCYA 4E12A 1Z7EA 3I4CA 4NU5A 3OICA 1PX0A 2FSSA 9LDTA 1WMBA 1ISMA 3KSZO 3SC6A 3CMCO 2PV7A 3WYEA 3LT1A 2ZTLA 4Q3AA 1P0FA 8ADHA 1PS9A 5HA5A 4F6CA 3L0DA 5IFLA 2RHRA 4Z9XA 3GAFA 4FOSA 4EJMA 1A27A 1UJMA 3LC7O 3ZW9A 1LBEA 4LCJA 5IXYA 1M2WA 1GU7A 4XCVA 1DLIA 5FYDA 2JFFA 3W6UA 2GO1A 1GV1A 4XYGA 4BUCA 5LC1A 1LI4A 1N1GA 1L1FA 1GZ6A 4CM8B 2NVWA 1PQUA 2DVMA 3VC7A 1VJ0A 2F00A 2FHSA 4Z0HO 2G0TA 5C7OO 2ZYAA 3L4BC 4NH4A 3KETA 3DOJA 2H1SA 3WYBA 1Q1NA 4QECA 3D3WA 1VL0A 1QORA 1YL7A 5EQFA 3GDFA 2POQX 4PLFA 2BGMA 4FW8A 3PWKA 1AXEA 4UEJA 2XXJA 3SLKA 5EN4A 1GAEO 2AW5A 4RPJA 1Z82A 3AU9A 4WLNA 5KKAA 3I6QA 4A0SA 4J9VA 4BNFA 4ROSA 1N1EA 5BSGA 1HLPA 3IL2A 1JAXA 3QRWA 4WJZA 4Z6KA 3QIVA 5ICSA 3ZHXA 3TRIA 1PZGA 3ZWOA 2B37A 5TLSA 2Y1FA 3KHUA 4XR9A 4BIIA 2VZ0A 3O9ZA 1Y1PA 4M8SA 4JX8A 4D0RA 5ICMA 4HFMA 2HMWA 5JFOA 3JQAA 5H83A 1U7HA 5A5EA 3X2EA 3JYOA 5G4KA 3RBXA 1U5CA 4E5YA 5T5QA 4FQ8A 5A9SB 5JBIA 3KO8A 4B3JA 2DAPA 2FR8A 2J3IA 2Q2VA 3PHJA 3V2HA 3MJVA 1E5QA 3QVWA 2NU9A 2YQ4A 3OQ6A 3HDQA 2WYUA 3MCVA 4IM7A 4RORA 5CEJA 5JS6A 4II2A 4WUVA 1PJBA 1DFIA 1C1XB 4L4RA 3CMMA 4YT2A 2PZLA 2E6UX 3FHLA 1H2HA 4G65A 4IDBA 2Q1TA 1JKFA 3V1TC 1I2CA 3GT0A 4JJIA 2P9GA 3UGKA 1G0OA 3T4EA 4WLUA 3GVIA 4YEDA 1BTOA 2CVZA 4GLLA 2VNAA 3RUHA 1PL7A 3QWAA 2AEMA 4BNMA 4CLOB 4E2ZA 3PGJA 2DUUA 3H9GA 1SAYA 2I6TA 3B1FA 3DZIA 2P4HX 2X58A 3A9WA 1H93A 5CDYA 1H6DA 3RUDA 3D5QA 4NBTA 4YJGB 3W8FA 3WOHA 4CM9D 5CDGA 1E1KA 1DBVO 3H3JA 2VT3A 4KDEA 1SZJG 1Y5RA 5DF1A 4CMGA 5B4VA 4ZQGA 5T8KA 3MJEA 4FFRA 4XQ9A 1B8UA 4A26A 5BR7A 1LRLA 1ISFA 2FOIA 4J1TA 3GNQA 3NEPX 4UREA 4MVJH 3TN7A 2ZQZA 3AJRA 4WE3A 4B8WA 2EERA 3QA9A 4IUYA 1V3TA 4I5EA 1XKQA 1U28A 4PIVA 3DFZA 3KZVA 3M1LA 1IHXA 2DBZA 1E92A 1QYWA 2WYWA 3ROKA 1GZ4A 5K6AA 1BW9B 2ZATA 4E2YA 2CVOA 1F8FA 4HFRA 4YXFA 4J6FA 4WK6A 4E21A 2TMDA 4I8XA 1O95A 1PGJA 4MKXA 4FDAA 3NUGA 5L4LA 4B8ZA 3KV3O 4BNGA 4R41A 4CM3A 5IZCC 1X7GA 2I99A 3DBLA 2CD9A 4BNHA 1IUKA 1WDLA 4PVDA 1DJNA 4YJDA 4IINA 2YFHA 4FFMA 4G5HA 5FFFA 4CV0A 1EEHA 2QRJA 1FMCA 3WS7A 3BMNA 4E2XA 1C0IA 1E1LA 1DOHA 1Y9EA 5ENDA 3MOGA 4NG5A 2GRAA 1EE2A 4KTVE 5ER6A 3ITKA 5JYAA 4BNZA 1QP8A 3GK3A 3CXRA 2UV8A 1RKXA 3DBHB 3JSAA 1PWZA 1F8GA 2OGUA 3G3EA 4YRBA 2BI8A 1RPNA 1JN0A 1UH5A 1EVYA 3AOGA 4GSKA 2O23A 3KBOA 3K30A 1YB5A 3EGOA 4ND1A 4QO7A 2J5KA 1U5AA 4OL9A 1J4AA 2C20A 1PJ4A 3AY7A 4N18A 4XIJA 4IGEA 1VJ1A 2AE2A 4YTEA 4IGFA 4NBVA 1QRRA 2DTDA 2B4QA 1GTMA 3V2GA 4HY3A 1IPFA 5G0SA 1Y8RA 4AJ4A
chains in the Genus database with same CATH superfamily
2XYQA 3QEMB 1XTTA 2ACWA 1VMKA 3WB9A 1IG0A 4GLBA 2O2YA 4TS4A 4KR7A 3NEAA 2PGOA 4KQ6A 2QF7A 2X5XA 3H9EO 4MQBA 1JIJA 3FWZA 1LVHA 5A5FA 5KYUB 3HO1A 2PX0A 4AZWA 4F1WA 3R7NA 2Z43A 3IERA 3GUUA 5EQDA 4MRRA 2VNSA 1V6CA 1YL6A 4FYHA 2EF1A 2H4JA 4GPTA 1Q6ZA 3PRKE 4E09A 3GCGA 2ANBA 3AVWA 1VCIA 2FMXA 4UE6A 2OLEA 1RLJA 2Y92A 2YNMC 2PL1A 4JC4A 1C30B 2C9CA 2WJGA 1GN8A 3MJCA 3HZRA 1LGYA 4WFIA 3PC7A 1RYEA 2R4UA 3M4JA 2C3OA 4H60A 4WY8A 2A67A 3WGMA 1E60A 1OYVA 3SHWA 4AW9A 4DSNA 3Q3GE 3OA0A 1XZEA 2VK1A 1XHLA 1SUDA 4WVFA 1DJQA 4MV0A 3OE4A 1YZFA 2HSJA 3LQFA 2IUFA 3WIEA 1TIKA 1WZCA 1XPRA 3ERCA 2QSYA 2OBLA 4IJ6A 3GCWA 3VOTA 5JAZA 1AA6A 1WSWA 3E53A 5CFZA 2O50A 2SNIE 2KM1A 3LUPA 3W5SA 4ZVTA 3ISTA 3TLMA 1P19A 4J0CA 3ETHA 1OTXA 4O3MA 1NF9A 3WGGA 1WHSB 3NETA 3HBNA 3L0YA 2ZEJA 1YUNA 4OYRA 1JSRA 3QXCA 1O6ZA 3TW6A 1L5ZA 3S81A 3JQFA 2NMVA 2QZ9A 1DAHA 1PTJA 2IU3A 4PRYA 4WVLA 3SQOA 3LCRA 1MDBA 3VPBA 3NHSA 2GPWA 5JSUA 2YINC 1Y34E 1G3QA 4OKNA 2DFDA 2G6TA 5H82A 5F51A 3N2EA 2YTZA 5EINA 3RLFA 1GNVA 3T54A 2OOKA 3R0XA 3RUFA 1FRVA 1M1YA 2JKVA 4H1UA 4MUNA 2JIPA 3WL7A 1NF2A 4LZAA 4P7BA 5FTLA 2QLJA 3PEYA 4WFKA 1DO8A 3GA0A 1PUIA 4CMIA 2ZM6B 4RDXA 1MABA 3I58A 2PWBA 4PRLA 3RT7A 4P8RA 1F3OA 4WV3A 2FX2A 1BGXT 2JEOA 4KMSA 1WXIA 4OJNA 1UAYA 2BEUA 4I4TF 4B5KA 4LDZA 1W93A 4IQ4A 3FWYA 3T0FA 1JLSA 3PD1A 3RFVA 2I87A 1I3LA 3BWMA 4KKVA 4HBGA 1JXOA 3GUHA 4ZCTA 1M66A 3DTNA 5CT4A 4BASA 1Y1LA 4MVJM 2H00A 1X1BA 4F96A 1D8TA 5DRYA 2WQ6A 1ANKA 1EK5A 3D3KA 1A82A 2IA5A 2QVGA 3EIWA 4ALIA 4BWVA 4YI3A 3NTQA 1A50B 1G8FA 2YXPX 4CM4A 3GFQA 3K0BA 1XB2A 3M4XA 5LYJA 3OM9A 3TR5A 1AJEA 2X3UA 5ES4B 3J80A 1O57A 2R8OA 2HHJA 2QTAA 4JSTA 4XB2A 3RYHB 1NNSA 4K9OA 1R9GA 3VJKA 3TV1A 3MRXA 2WUFA 5K4AA 4GMFA 2PZ8A 4XM0A 1FFHA 3GAZA 3GJQA 4PFSA 3HDVA 2WJYA 3ZEIA 5I7UA 5AM0A 5ELMA 4Q9LA 4ZGBA 1HFJA 3UK0A 4Q82A 1KTIA 4II7A 2OEPA 4Y2JA 3ROTA 3TTYA 2CVQA 5LB2A 5BSTA 3AF1A 4O1HA 3LHKA 2PMCA 3IT2A 5FUYA 1YB7A 2G4VA 2YFYA 3IS3A 5EI5A 5AHXA 1DEAA 2I4IA 3CVOA 3PG5A 1T8PA 5JOQA 1K2VN 4MGHA 1JX6A 3OUTA 4FFSA 3DCIA 1AXGA 2PKXA 2OP1A 1NL3A 2WHEA 3UVEA 3BFXA 1PS8A 2PTHA 2RB5A 2FN9A 4FSHA 1NBOA 3QVUA 4M60A 4MQ4A 4LSZA 1OI2A 1DI0A 2QVZX 2ZJYA 1TC2A 4KLZA 2KX7A 2ZIEA 4JYPA 2I65A 4PYRA 4FS3A 4MPTA 4E6PA 1EFHA 1G8MA 3F2IA 3IMKA 2B4KA 1LX6A 1YFZA 3KUKA 4Y7DA 5HM6A 3OE1A 2UZ0A 1DKPA 3BIXA 1QAOA 1X7YA 3EBLA 4X3PA 4Z3KA 4HYTA 4MR8B 4KVFA 1DAEA 2NYAA 2ILTA 3SEFA 1K66A 2AUMA 1M5RA 1A9PA 4HXEB 3IPCA 4NJEB 1QTRA 5AMXA 2CXSA 4PX9A 1RYDA 3H83A 5B5SA 3KWFA 2FR0A 1MVOA 5EJ2A 3VKFA 2I4LA 2WDPA 2IQ5A 1VE1A 4DG9A 2QXUA 3KQMA 3LPDA 3WIOA 5J2TB 4YP0A 2WU8A 2GK7A 4RTLA 3EMDA 1QX3A 2GSWA 3TX6A 5JCXA 1DDGA 1FDTA 3IODA 1N0IA 4KQXA 5KDLA 3ZY3A 4YAGA 4CEJB 2G7ZA 3D31A 2JPDA 5CJPA 4NENB 1M0EA 5IAKA 1B76A 2DQYA 2QXTA 3N8HA 1T0UA 4N5NA 4JP3A 2CV0A 1P4AA 1U7PA 2VATA 3HABA 3IOEA 4L72A 3LJKA 3BRSA 3AY6A 4FN5A 2E4UA 4NEHB 3CR8A 3TPCA 4A0RA 4AZVA 4UNQA 3AP3A 1YS9A 4ZI5A 3CVYA 1M0SA 3A0RB 4BQIA 3S70A 4R2IA 4YRIA 1J0AA 1EFRD 1ORWA 2P9BA 4L0QA 4EJ6A 1E59A 3GEDA 3D7MA 4GRAA 4MW7A 3UK6A 4K81B 3GDGA 3BILA 4X61A 4W5QA 3THYA 1UBEA 3B1ZA 4ZK6A 2FEWB 4IOMA 1ZEJA 3SJZA 2EEPA 3G17A 5AKEA 2HU7A 1F6BA 1I1HA 1TT5B 4R5HA 2N1BA 3L92A 3G9QA 4GIBA 3SBOA 4Z3DA 4XYBA 5HRCA 5BW5A 5AVWA 3H9QA 4BGEA 4LQLA 4XH9B 5JNUA 4AF6A 1ZSYA 3RBZA 1XZ8A 4PR3A 4TT3A 4UTPA 2Q6IA 4KAFA 3USCS 3WGLA 2Z6UA 2DLCX 3ER8A 5DP1A 2HPHA 3IUEA 5FBHA 1JDBB 1EK1A 5BY2A 1JKMA 3FIJA 3CZ5A 3FPFA 3OCWA 1BQEA 2FJPA 1U1IA 1HE5A 1Y1TA 2ZUEA 2KHZA 1RC1A 1R0LA 1UOOA 1P77A 2EATA 4TOIA 3SBEA 4MQ6A 13PKA 2HWKA 3ETNA 3OJ0A 1Z74A 4KQWA 5FB3A 2CLDX 1VP9A 3GLGA 4HUTA 1P1KA 4JOCA 3Q3EA 5FHRA 1QG2A 4IDCA 1BE8A 4LY0A 4H15A 3WJAA 3E1KA 2SKCA 2QNBA 4GO1A 2VTEA 3SFVA 2M32A 4NKRA 4E3ZA 3R1IA 4QUAA 3CLVA 3KQVA 3CNOA 3OY7A 3OOJA 4OB8A 1T5HX 4G84A 1B43A 4HAVA 4KBGA 4CEHB 5GJBA 1CYEA 1P45A 3NB0A 5FI0B 4Q39A 3GXBA 4QTXA 3AUTA 4DR6B 1D2NA 4ZI7B 1QQTA 4X93A 5A4IS 1F3LA 1EDZA 1ZH4A 3FUWA 3OO0A 4FKMA 5BQOA 2CYAA 4H7FA 4J7XA 5DCUA 3W9SA 4A2CA 1U0OC 5JYEA 5D86A 4HMQA 2C29D 1YXMA 1ODSA 5AXDA 2OV6A 5EE9A 4L8LA 4MR9B 3RVDA 3FE2A 1RM3A 3PT9A 4F5YA 3RF6A 3IUQA 1E7RA 4BKUA 4C9BA 5C80A 3ADDA 1TPYA 3MA0A 3R3ZA 4R1OA 5BR1A 4BN0A 5ECWA 4S1VA 1NZDA 1YDFA 1CJSA 2GF2A 3GYGA 3SHQA 3HJRA 4YCBA 4BDTA 4UDYX 3WWZA 2JZOA 2J5XA 2PIDA 3R9WA 4Q4AB 5AVSA 3W8EA 3OPVA 4JLSA 1NLFA 4E5KA 1U2TA 4XDZA 3U7FB 5DNAA 3ZE9A 2V7PA 1EZ4A 1OLXB 1IZZA 1Y8RB 2YC4C 1TTHA 4OGKA 4P34A 5E2AA 1KIFA 9MHTA 1NXSA 3LF1A 4PNPA 2I9KA 3WL3A 1QLJA 3IYLW 5BNIA 4OSEA 1UXGA 3KJEA 4NARA 4MNTA 1O95D 2GHIA 5B1YA 4L9SA 3WAKA 3A25A 1V3UA 4S2UA 3V4PB 3L8CA 3VBEA 1UT6A 1NULA 4PPGA 1NI5A 1EGQA 3UXMA 4LJRA 3IIMA 4KW7A 3QX7A 4B81A 2I91A 1J0XO 3K1AB 3WL4A 1NUQA 4EO7A 4EY4A 2BM1A 1MHPA 4Z8YA 5EL0A 4DCCA 1Z63A 2W2TA 5DHRA 4WBNA 1IAVA 5JRDS 2IXDA 3M1IA 3URKA 1JG6A 3KUXA 2FF5A 2ZFUA 3WAGA 4CKYA 1A04A 1XEXA 4Q3BA 2J6CA 3QTLA 3BJEA 4X9XA 3UMVA 1ZNXA 3IDFA 2ZJZA 4C4YA 3ISVA 3FF4A 1EFPB 3CUKA 1U2ZA 1TIBA 4WT7A 4KYIB 4AIIA 4ABYA 3FYUC 1Z5VA 1IXZA 4BE9A 4BRSA 4YRAA 1RJWA 5E7IA 1DCFA 4PCAA 1H2WA 3ZG6A 4Z1OA 3EZYA 2HWUA 1Y98A 3HCFA 2DPGA 2OHXA 1QDEA 1QYDA 3LX8A 4Q6WA 3MAGA 1RPZA 1R6AA 3AOEA 3GRPA 3HGTA 1L4GA 1HLDA 1PT7A 4YRQA 4ZOQI 1ESMA 3WRXC 1SXQA 1NRIA 2MSLA 3D1VA 4OMUA 1GJRA 3P0IA 3JVDA 4CG0A 3KXDA 4J0IA 5HKBA 4JASB 5T4BA 4YUXA 3UV7A 1T9BA 1FZQA 2CLSA 5PGMA 1EM8B 4K5QA 4E33A 1P2VA 2P5YA 3UFBA 3ACCA 4HUQA 1GR1A 1X2EA 1FJ2A 1FZTA 4PLPA 3VISA 3H1FA 2P68A 5EMNA 3QG5A 3INTA 2YHIA 2QPTA 1Y82A 4YCNA 2IIBA 4G0MA 4G1EB 2FPWA 3IR5A 2P1RA 3A6GA 5J4KA 3U6BA 1K5DA 2EWVA 3T7IA 1I2BA 4PHFA 1EFLA 3PTLA 5M2QA 3WISA 4G24A 2DM6A 5DBGA 2IBSA 2ZE7A 1LF5A 2ODEA 3C8DA 4WZAB 1J1IA 4MV8A 3ZE2B 1K7XB 3SF0A 4KR9A 3DV0B 3Q85A 4P83A 5TT0A 2VDQB 1I2DA 4WINA 1OY1A 4U8HA 4RTKA 1U94A 1Z0FA 3TUXA 1XI2A 1SWWA 3A6ZA 3QEMA 2JVIA 5DT2A 4FHFA 3FCOA 1A5TA 3VPSA 2GVDC 3QF7A 1HFEL 2DHQA 2VK8A 5IAJA 4Z9YA 3L8DA 4G0QA 5KYUA 1UAAA 2G08A 3O8DA 1T9GS 2RHWA 2OP0A 3DLPX 3N6XA 1C3OB 1TK9A 3AUYA 3VBCA 4B34A 4QQ8A 5LKAA 4KHPB 1RJGA 2VYCA 1G7TA 5CG2A 4A7PA 721PA 2RGEA 1G66A 2Q5IA 1LQ2A 2QVBA 4OU5A 3CLSC 3PWZA 4WTOA 3DDUA 5EJAA 3S5UA 3VZRA 2ZTMA 1T4GA 4FP9A 2OKGA 3D0QA 3VR0A 1C30A 1YC5A 2P3SA 1KEZA 3CLHA 2O6HA 4X7MA 5HJ5A 3Q7IA 1K68A 5SZIA 3V4RA 1F51E 1XKTA 1LK5A 3QJYA 4N01A 4A0QA 3K9WA 3VAAA 3MS2A 1ZK4A 3ZD6A 1QO0A 2XGSA 4BO9A 4XSVA 3ASUA 2XKKA 4ZGWA 4RANA 4GYKA 1EE1A 1ZOIA 3ZHUA 2VHZA 1NXOA 3QYPA 4JUDX 1EE9A 2DLNA 1XTBA 3EC7A 3EUEA 4IOLA 3MWFA 2QSZA 2WU4A 3SZ3A 1ND5A 4HPXB 2X9LA 3WGYA 1Q74A 4GR4A 4UFNA 3E7FA 4Y1GA 3WSVA 5CFNA 5HM8A 4O4HF 3WKDA 2Z6QA 5MF6A 1LC3A 4OQMA 4RTSA 3FDXA 4HGOA 4O6VA 4NDZA 2GAIA 5LB4A 1AUQA 2PX6A 3IAS6 2O5EA 4TSFA 4EWLA 3NKFA 5FWXB 4A4DA 4I2NA 1G19A 3JWGA 3A9SA 4MCIA 4Q24A 3RM3A 1LPOA 4GGPA 4L9AA 5IT4A 3TRDA 1HYGA 5AUOB 1Z4JA 4RKFA 1W1IA 4XJVA 1KOFA 4CVNA 3P2JA 5TIIA 5CHEA 1NVFA 3OZVA 3PWTA 4HGZA 4RQUA 1CSEE 5ERGB 3V8VA 4BP3A 1Y48E 1C9JA 4E07A 4EY3A 4LJ7A 2OD2A 1BCRB 1Z6AA 4JROA 4LY6A 2OD7A 3H4VA 3VU0A 2ENWA 2V98A 3DE0X 5EKXA 1PW7A 4N0PA 2BH9A 1Q1AA 1E5DA 2X23A 4W63A 4AQYB 1FX0B 1G8GA 1P2SA 1XDZA 3OIYA 4XVQA 3EDOA 4IJWA 4QLBA 1HRDA 2CNKA 2XAAA 4D98A 2QX9A 5K2OA 3OD1A 4X54A 1UPUA 2LIPA 3LRTA 4J0HA 1GY8A 1EBBA 8ATCA 1OFIA 3QJ5A 2X2EA 3LHFA 1W46A 1OV6A 3HJHA 1DC8A 2C8VA 4JXKA 1ZGAA 1KGSA 2GVNA 2Z2YA 2EFEB 3EW7A 1JEAA 5AHRA 1SB8A 1SD5A 3LUDA 3H0VB 4B46A 5BN4B 2EZUA 1SCQA 2FXVA 4ZZ1A 5JZSA 2OAGA 5K8LA 1KJQA 4MGEA 4EO4A 3M89A 2FJ0A 1IY2A 2XMDA 4IRUB 3HP4A 2Q6VA 1SC9A 3RTAA 2W6JD 5I7HA 1AU9A 5A06A 1M6NA 3QVJA 5CP8A 1G3IA 2PSDA 4LVOA 4ECAA 2W2LD 2AWNA 4LX0A 3OQVA 1H5QA 4EG4A 2NP6A 5CCBA 1TM1E 3QEJA 3ELUA 4BC0A 1C7RA 1CRZA 3IEIA 4GF5A 1G21E 1PX2A 4ZHQF 3LUKA 2PQ6A 1XMQB 1XAGA 2VG8A 2Q50A 5TVOB 1EGHA 3AR7A 4V2UA 3PNLA 3ZGYA 3U7GA 2ZZMA 3EXG1 1M76A 1ZITA 3BCRA 3RGGA 5MFZA 3IR7A 3I04M 7MHTA 3H2ZA 2JLVA 1N8KA 1BMQA 2WU0A 1SU4A 4FK8A 4I1YA 1Z6TA 3S8YA 3JYNA 1EUZA 1G7CA 4LZNA 4ZWNA 3KJHA 5EKSA 1HMYA 1QBKC 1Z8FA 2H2DA 3BA6A 4JJ6A 5EJ9A 2O8BB 2HDHA 3HB5X 4P7JA 5JRZA 3O4JA 1NVKA 2RJOA 3EZ9A 1QVZA 4HYYA 5KWIA 1IWBB 1EFUA 3L1HA 3G79A 3FNHA 4NU6A 5KNCA 1NHWA 3BK7A 1G2PA 3T5MA 4A73A 2H29A 5JAPA 2ZSHA 4MR8A 1FVXA 1JYEA 1J70A 1GPNA 4OGGA 5J2UB 1KU0A 1EMDA 5FRDA 3E35A 3LX6A 3QPCA 3TLXA 4YT4A 5IABA 4NJEA 2EFGA 1DX4A 4J43A 1L8OA 2CNDA 1XQVA 3NXKA 1QIMA 5EZ5A 3WQHA 1GEGA 4FI3C 1YQ9A 2OGZA 3B1VA 5FBKA 5J2TA 1P33A 1FYEA 2ZDQA 5C1PA 1EHYA 1JHVA 2B4YA 3CUTA 2GN1A 4L3VA 5DIZA 4HKTA 4CEJA 3PDWA 4OFBA 2PKCA 4FR2A 1VPEA 4NENA 1H05A 2A59A 1E96A 3GQBB 2E4XA 3ETGA 4IYJA 1Y3IA 1VE9A 4EB8A 2QTCA 1M2KA 2QX7A 5CD9A 4G5SA 2AK3A 2WFMA 3UAXA 4YMWA 2CLFB 4R2JA 4I7EA 4HNAA 3HNOA 3MLBA 3E3AA 3O8CA 4H27A 5LZ7A 3BJMA 5CD1A 1OOEA 1Z73A 3EXFA 2EW1A 4RGQA 1SG9A 4BVHA 3A7DA 2WFLB 2EFHB 1H6BA 4G4JA 4ZICA 4JQYA 3N1UA 1YQGA 5HR5A 4X1IB 1T0IA 2CSUA 3WVNA 5BUCA 1TT5A 3D7KA 1IG3A 4EGQA 4XVHA 1JH9A 2BEJA 3LYLA 4OXIA 1DIGA 1PKEA 1G64A 5DHTA 1ZLYA 1UEXC 3AJDA 1E6KA 3H65A 1T6XA 1ZRNA 4N6GA 2SKEA 1NFFA 3HEMA 1E1DA 2PNJA 2VCHA 4RZUA 4ZI2A 2QQGA 3VR4D 1DOAA 3CB4A 4OLFA 5EIOA 1WZUA 1J39A 2FN8A 4DMCA 4HWKA 3JAWB 4XI9A 4AC9A 3M9XA 1ORRA 2CMFA 4UPDA 1ZS9A 4F5DA 3G68A 2YHSA 3OM1A 1GEEA 2ZRBA 3LQ1A 4MA4A 1ZXLA 3ONFA 2OBYA 2GZ2A 3HBLA 3NXSA 2DWCA 1P1FA 3QW4B 2D06A 3IP1A 2Y1OA 2OZLB 4RM3A 4HMPA 1VRVA 2UAGA 4FBGA 4G8CA 1NVXQ 2VF4X 3AYZB 3DGFC 1SZDA 2BGIA 1AUVA 2OXFA 3DOCA 3EWSA 4N3BA 2X9NA 3H6KA 4V0RA 5TPZD 2DPYA 1BVRA 2WP8J 2YVQA 3PPVA 4CEHA 4ZOLB 4GRIA 2W5UA 1G59A 3VTAA 5KKNB 5ULLA 3V55A 3CNEA 3CO5A 4X7BA 4AJ9A 1JSLA 1RBZA 1ISHA 2HQBA 4OYLA 2IT1A 4BNUA 3LVFO 1B93A 2QL5A 1IM5A 2CLOB 1WUJS 1CETA 1IHDA 3KZOA 4LQ4A 4RPKA 5FX2A 3EG9B 5FPQA 4WXRA 4MV1A 4JAVC 4MR9A 3U39A 4GP6A 3B1JA 3A1EA 1BRTA 3RRYA 3K73O 1EUDB 1ZISA 2IZ0A 2PYDA 1FSFA 1LRKA 4J4BA 3ND8A 2AFHE 2D5BA 4I5DA 3MIZA 5E7MA 4BN4A 5JR3A 2YBEA 4WGFA 2CNBA 3QX8A 3DHVA 3D6AA 4U0JA 4JA2A 2R25B 3LC1O 4Q4AA 1KBZA 4N8DA 1IMOA 4MUHA 3PX7A 1E79A 3RGWS 3RF7A 4UTRA 3SE0A 1UP6A 3W6ZA 1AKYA 3BFJA 2DBQA 2P0YA 1SGWA 2P9EA 4KO8A 1QGED 5HGJA 2G5CA 2BN4A 1BX0A 4U2EA 3DL7A 4UEQA 1WRBA 2H0QA 3MK31 4EA7A 4UFPA 4ND8B 3L7OA 1JIUA 4ZVMA 4D0SA 2ZIVB 1ZD1A 5B2EA 3PC8A 1CRQA 2A88A 3ZHQA 2RHJA 4B4WA 2I8CA 3QHQA 2D1YA 2IHBA 3FOEC 3LH5A 1CWUA 3EEQA 3CONA 2I4NA 3AP1A 3QYAA 1NMZA 1WSDA 4G67A 5IN5A 3S28A 1LZLA 2QZ4A 4S24A 1ODTC 4BMXA 9LDBA 4FINA 3K1AA 3TECE 3WMEA 5LXTF 1T10A 2YWDA 1SNYA 1NBMA 3OCUA 4G1FA 5FFMA 5CA0F 4ZCLA 3TOXA 1JA9A 2EJUA 3QVXA 4CM6A 5L3ZA 4PGMA 4KNYA 2D1QA 5ITWA 5KYYB 1ETUA 1Z0IA 2UVDA 4TKVB 3SGLA 3C1AA 1GPYA 2WTAA 4S05A 2XZOA 4GPAA 2YNMD 1JVNA 1W8DA 2YHBA 3W5CA 1OX6A 4ZYXA 3GRVA 1DZIA 3O6VA 5FPKA 1QS0B 3E9ZA 4V38A 5FKJA 2ZU6A 3BJIC 1QC5B 3F5DA 3QLEA 3RSFA 1ECPA 1CZKA 1FMTA 1PFKA 1V3QE 1FPQA 4UCWA 2C2ZA 3Q11A 1JMYA 2JDID 3QE3A 1X92A 2R79A 3PS9A 1P3Y1 2BL4A 5I9TA 3UMCA 1ES9A 3Q7EA 4ND7A 4G1MB 4KXVA 3HCOA 4M1ZA 4R3NA 1L5SA 1SO8A 4RMIA 5EIFA 1YI1A 2VHXA 3B82A 3KLMX 3U1VA 2WTMA 1ZC3A 1B0ZA 1LX7A 3K0FB 4WAUA 5B7PA 1EM8A 5CVTA 3GVCA 2JG3A 2QRHA 3N7UA 4MUEA 3SEQA 3ICEA 2GXSA 3GEPA 3LKDA 3IUJA 1IN8A 1DQRA 2H59A 3KQYA 4TTIA 3L02A 4POOA 1X8KA 3HV2A 4W6ZA 4QXRA 1E7MA 2VH2A 5JZOA 3VPAA 5KS2A 5FCDA 3QI2A 3D2BA 4YS6A 1RCFA 4DY6A 4ER3A 3G23A 1TCBA 3YASA 1I51A 5F5XA 2OWEA 1AVTA 2YXNA 4L7VA 4BO7A 2ROQA 1C8BA 2WM8A 3T5DA 3NBMA 3OY2A 4DV3B 3DAOA 1MOZA 2XUHA 4LY3A 1SULA 1B6SA 1QGYA 4WZAA 5EWLB 4DV0B 3ETCA 3DV0A 4CIVA 4K9RA 4D92A 2PUFA 1WLYA 2UKDA 4YMLA 4QBFA 1I4DD 1OIWA 2G83A 1E9SA 4KO2S 4PZLA 3MJ4A 3NEJA 4R6XA 4M9XA 3WK5A 1I0ZA 1RC8A 3NIWA 1VSBA 3H5IA 3K09C 5H3HA 1Y7TA 5E6SA 3K6SB 4KGXA 3OTIA 1C3OA 3FCXA 4TRMA 2I1WA 2QYOA 3FH0A 1MAAA 2GS9A 5K5EA 4FT4A 2RBGA 3KT8A 1C8VB 2BSXA 3I6ZA 3NRBA 3QLVC 1X7HA 2CBXA 1RSZA 4PVCA 4NCNA 3FWPA 2BGKA 2OLKA 4B6JA 1I4LD 3IMEA 2QT9A 3LW7A 2BGUA 4NSNA 1IJBA 5FUMA 2CNNA 2PQMA 3FSRA 1I5RA 3ONNA 1Y8AA 4B80A 2VEOA 1QF7A 2CLHB 1UK9A 1YRHA 1QV9A 2HV8A 4HWRA 3NR2A 2O2IA 1L7EA 1KXJA 4RS4A 4TPKA 3HS3A 5FPPA 2VSXA 4RZIA 4X63A 3MQ4A 2IYFA 3T15A 4ZN6A 2O9JA 3ZWNA 2GBPA 3VPCA 3WGZA 3GEIA 3Q15C 4BKMA 1GUDA 1O08A 1V8ZA 2NAPA 2GYYA 5TGZA 4M54A 1QBGA 3A1WA 3FSGA 3IIEA 3UENA 1N2XA 1PJ3A 3QUBA 2DERA 1KKLA 5CH5A 2H5JA 2W37A 5BSEA 1TEVA 5DTMA 4NOJA 2YOFA 4RD3A 1JDSA 1VG8A 3SMVA 1XRPA 2Z8YM 2JJMA 3PFFA 3OI7A 4C4XA 5ALYA 2ZJ5A 2IP2A 3DW1X 5FWXA 3IJEB 4RHCA 1U3TA 4EKEA 3F5QA 3DL2A 4EUEA 2PGXA 1JEEA 4I1UA 1FYVA 4I46A 4N54A 4P4NA 2J7KA 3OJLA 4PAWA 5IDYA 3HY3A 4URUR 3KB6A 3PV0A 3VX4A 1I7SB 5I3ZA 1GL6A 1PYOA 1K7FB 3LQQA 1BMDA 1G5PA 2AT1A 5JXWA 3AFIA 3O5AA 2ZS8A 1R1DA 3UAZA 1IZ7A 5SYMA 3FXAA 3AETA 5DGIA 3KFXA 3X1JA 4B3RB 4DZRA 5B3JA 2H7CA 2XWBF 3WBJA 1SUPA 2H4WA 4JT2A 1RBYA 2Q5OA 4OP2A 3WGNA 4ZZ0A 5HHTA 5JCOA 1FX0A 1OMOA 2HMTA 1W52X 3EXHC 2E4YA 1KQ3A 3T9FA 1GNQA 3KKMA 3ND6A 1KI2A 1E3TA 1NV9A 3IUBA 4HGPA 3ZGZA 2GKOA 3SMQA 4Z2AA 1TUBB 2O2GA 1SUIA 1E9AA 2J3JA 3P94A 4ZARA 1P5HA 4RPHA 1EBFA 3GPLA 4F4UA 2JJ1D 4WQMA 5AKLA 1YRLA 1IDOA 3W78A 1NTRA 3GFOA 2QMZA 3L0CA 3GGCA 4BX3A 5JADA 4BFYA 2IYOA 2EHDA 4BUZA 1NMQA 5AK3A 3P9IA 4RA9B 3V7FA 1UK7A 3BSYA 4DLWA 3H4TA 2C9MA 4HYQA 3U3MA 5BN4A 3GOHA 3LUBA 1J1ZA 3C48A 1AXRA 2BHRA 2D2FA 2PUTA 4ZHSA 3NPMA 4WOPA 1FFXB 2JK0A 3W7BA 4XTRA 2VWGA 4BO3A 1LPNA 1U6KA 1C0LA 1UBGA 1XMVA 2HHLA 3PQ7A 4RVNA 2X3YA 3LUJA 1C9KA 4GLFA 3OKAA 3LK7A 1ENYA 2BUCA 4J1SA 2X5JO 4G5GA 2Z2KA 3DAFA 4L3OA 2XMZA 3HZOA 2EFDB 4NZPA 3ZDZB 3RJZA 4V0OA 1CY0A 4KXUA 5I47A 5LA6B 1Z3CA 1YFLA 1KARA 3EWIA 5M04A 1FLNA 3KELA 3ML1A 1T2AA 4LCBA 5SY4A 2VQDA 4P2BA 4WK2B 5EMHA 4HOYA 1J5XA 2W6ID 3WWEA 4AJEA 1L4NA 4LQDA 3GLSA 4UOZA 4NFSA 4B2LA 1YB1A 5HK9A 1KJWA 5HDBB 1J8QA 1SD2A 2XUOA 1JYFA 1XLUA 3R74A 2JFHA 3RAPR 1J8DA 1RKBA 1UJ2A 1J22A 2G6BA 1OVGA 4LHZA 4Y8VA 3QGMA 5EJFA 5AIBA 4LKOA 3UWKA 1I7PA 4UPVA 1JQ5A 1HDOA 2M6KA 3CGGA 1H5NA 1D2EA 3JTMA 4JBNA 5K0JA 2W22A 2PUEA 1ORTA 2GA9A 1C7JA 5SY9A 3X1MA 4TKUB 4LF5B 1GR0A 3LD9A 1N57A 3O91A 4BV9A 4QVGA 1Z8DA 1R7RA 1E62A 2F43B 1WNTA 2HREA 1QMIA 5J2UA 4KSYA 4ECEA 1LWNA 4KQGA 4O33A 5BT8A 2C00A 2IYLD 3GROA 4OHUA 3NHKA 1K89A 3TG2A 4ZTZB 3JVEA 1SIUA 1K8YB 3IHWA 2WLSA 4JUAA 4U7FA 2WNSA 3F2VA 5DNEA 1XHFA 1I1QB 2NPOA 3FOBA 5IMBA 4Q01A 2FDCA 3F1LA 4A2QA 4IKOA 4YX9A 3BGOS 1O9BA 3GQBA 1W5FA 4X6LA 2REQA 3I92A 3TEFA 1N34B 1W4RA 2C4HA 2HA5A 3U3RA 2XVAA 4IFIA 4L74A 2ATXA 3TL6A 3H16A 1JU4A 4KLNA 4M1SA 3IT0A 4QHTA 3L04A 5DXFA 3OP1A 3V7WA 4EI9A 5C18A 4MS1B 1GQ2A 1IK4A 1NQTA 1Q84A 2FKAA 3STTA 2H7VA 5CBPB 1E5VA 1QUFA 2IOFK 2E49A 3ED1A 4JEHA 5DI9A 3AUJB 1ZCJA 2WFLA 3WYDA 4C2BA 3T1OA 3O73A 2AQ8A 2QSUA 4E08A 3I6YA 3PR2B 3D6UA 1FNCA 1MJ5A 4X1IA 2IDKA 2IHKA 4B3HA 4W5RA 2VDUE 2IH5A 1LBQA 4PO8A 1LDGA 1QIFA 2BTOA 2QU7A 1ZW6A 3R5TA 3QKUA 1HY3A 4DJDC 2YXBA 4ZYLA 1T2DA 4R1UA 2HDOA 3TTUA 4BNKA 1U0NA 3LC0A 1TVEA 3EA5A 3OE7D 4FEGA 2H1LA 2I29A 2OL4A 1QV7A 1RAAA 1GG8A 2G5GX 1U11A 2PH1A 2X1HA 3NYQA 1KBOA 4PRKA 1P7VA 5H1YA 5BNWA 3ZNPA 1EXNA 4I5FA 3BCHA 4D41A 1DQSA 2Q3EA 1U3VA 4I50F 5IAEA 2VBIA 3ZCPA 5A1TA 1TYZA 1PBTA 3HXPA 1E8DA 1FSSA 1WIWA 3MTAA 1M2FA 4FYYA 4JD5A 1R6BX 5AK6A 3TW8B 3WA6A 1AHIA 3G6WA 2ISSD 3DOUA 4PXAA 1IHYA 5FH9A 2P40A 5ADHA 2PGDA 2YYYA 3SPXA 4LOIA 2I6GA 2OZLA 3ZS9A 2KMLA 2NO1A 3L8EA 4U5XA 2UYQA 3DOFA 2A0KA 2JFNA 4BY9E 5CURA 2ZCVA 1JEJA 3GJ0A 1JIKA 2UDPA 2C61A 4OJMX 1BVYF 1TO1E 3WNCA 4ZOLA 1PLLA 4HN4B 1XIVA 3H1BA 1W0JA 4LV8B 5D7NA 4ZPXA 1SPXA 4C4SA 3CCBA 3L7LA 5KDOA 2XNJA 3HCNA 1SBIA 5EP4A 1CZHA 3JWIA 3TI7A 1QRDA 1VPDA 3EA0A 3W8RA 3T5PA 1CXZA 1OCEA 2DF8A 3M34A 3QUSA 5HKLA 1SQ0A 2CXRA 4Q1VA 5B55A 4HNTA 4KUGA 3UWMA 5YASA 2UZAA 3EG9A 3W2TA 4E4YA 5AW3A 4HQNA 2DWPA 2CLMB 3V34A 4JOQA 1NQXA 4FGKA 3LCVB 4NJOA 1EUDA 2D7CA 4C0WA 1Y3HA 1Q44A 3TGPA 2QTWB 3IEVA 1BWQA 2Z6VA 4KQFA 2VPYA 5GV7A 1MC1A 4DLVA 1L5LA 2YS6A 3LQ4A 2ZB2A 1C29B 2J3DA 3D4OA 1Y0BA 3OJWA 3DBIA 1LDEA 3FBGA 4HV4A 4XIIA 4AJJA 5ALVA 1RRKA 2GJAA 5LZ4A 3GGPA 4EI2A 4PXSA 2QW1A 4ND8A 2ISCA 4B73A 4LISA 1QIKA 4HN2A 2ETVA 4OQZA 1P1IA 4Z0TA 2HJGA 3DR3A 1DINA 1F5SA 2PUHA 1E6MA 4ZXPA 1L7NA 4L8YA 4FGLA 5EP2A 5EXTA 2FQXA 4O2AF 3DZ5B 3HB1A 1Z2CA 5JH7F 4ZEVA 2HCRA 1D2GA 4OHBA 4IWYA 3F90A 3VYVA 5HVNA 4GM1A 4WJLA 2D1TA 1NJ2A 4XWTA 3TL3A 1TJYA 5B58C 5LIRA 1ZR4A 1SUWA 2WSSA 121PA 3QKSB 4UVEA 2NXNA 1PJQA 1PKXA 1R9JA 4ZOAA 3EHDA 4KCGA 4Q9KA 5KYYA 3RAEC 2OCLA 1WPXA 2PZMA 5HIMA 4OHKA 2VF2A 1JJ7A 3GRCA 3WGUA 1V71A 2GQ0A 3S8EA 1ZI8A 1ZR2A 3TIVA 2UYHA 4PGAA 1QS0A 1PV4A 4HZGA 2FUKA 2J31A 1TAGA 1E4EB 1GD1O 4ML3A 4N0DA 1LDYA 4QSHA 1H2RS 3OHMA 1QC5A 3WWYA 3TTTA 1A7KA 1LSUA 1LI5A 3FZQA 4IY1A 4NTZA 4EPWA 1T8RA 2AHRA 1V26A 2R47A 1U65A 1CPYA 3AUKA 2Z3VA 3GT7A 3DNMA 5J40A 3GELA 1C14A 1ZD9A 1IBRA 3P7MA 3MTDA 4R9VA 4QRDA 2Q8QA 5LIPA 4RV9A 4TKMA 3PDCA 2M98A 4FI3F 2CNLA 3K0FA 1L5MA 4O8CA 3S2UA 2B5VA 4CDGA 2BMEA 3D9QX 5JZBA 2IEAA 1LBIA 1QIIA 2PH7A 4OLBA 1TJPB 3M6UA 3FTDA 2IXEA 4FKZA 4F2PA 1T1JA 4BJ6A 3SQLA 4P31A 4ZVSA 2PA0A 4M36A 4JFAA 4BVGA 1PJAA 1UBSB 4BFLA 3KV1A 4Q7QA 3BTOA 4PZAA 1GFWA 2IBMA 3BB3A 1A1SA 1PJ8A 4BMPB 4PAOA 3V8RA 3ESDA 4ZO8A 5L7WA 4F4FA 1NATA 4I5IA 3T7KA 3W3AH 3AHFA 3V48A 1SOUA 2GPBA 3HVJA 4O4JF 4M4SA 3MB5A 2D0IA 3QK7A 5B4TA 1UMKA 1XEFA 4QIHA 2AXNA 1VE6A 3LCMA 4TMZA 5A04A 3NKVA 3H5VA 2P6PA 1H2YA 5BSFA 2PMDA 1VJRA 1E3EA 4J2HA 2XHEA 4G9GA 4HDKA 1Y89A 4EY6A 5I7RA 1E61A 4URFA 1K2WA 4NBRA 3DKPA 3K8QA 2XKJE 5LMCA 3U09A 3K6SA 1K8QA 3QU4A 4UE2A 4YLGA 2GD2A 1G63A 4Q34A 4TSRA 1D09A 2WVGA 3PUXA 5EIAA 4BCCA 2D4AA 3M81A 4YAOA 3GRYA 3JZMA 4Q7MB 1E3JA 1XAIA 3F71A 2PK3A 4CE6A 3QFHA 4BGUA 4UHKA 1U31A 1DBQA 3SZLA 2FRXA 3ZXYA 4COOA 3ABRB 4DG8A 3I6BA 3BFPA 3B9RA 3GNTA 1PL8A 1N2HA 3E6AA 1SXJB 1S6YA 1UF9A 2FDXA 2A1UB 2GERA 1IHUA 3P0JA 4AMVA 1GGVA 5A3RA 2ZIFA 4BMYA 2P6RA 4REMA 3TUTA 3PFNA 1SVMA 4EQZA 4ZU1X 2DYKA 5F12A 4QKQA 2JA2A 2P6MA 4XX0B 2ZJ7A 4Y1EA 4GI7A 1KJYA 5IX8A 3EIUA 4ZJZA 4NZYA 3VYRB 1ZUNB 4BB6A 5L4NA 3AVUA 3LQYA 3AU8A 1FQJA 3QXXA 4NOKA 3T41A 4DR5B 3H9BA 1X8JA 5I51A 4Z4EA 1EB9A 1P60A 4D81A 3ECAA 2B99A 4K86A 1M1ZA 4R05A 3UOGA 4BWGA 3RS5A 4PF1A 4UM8B 3QU2A 2CZGA 3HDTA 4G0ZA 3VTKA 2WPDA 2HBZA 4PPFA 4JB0A 2AYXA 1UBKS 1I80A 2JARA 4Z1MA 1RTKA 2CKDA 2OPHA 5KWSA 3A3PA 4ACBA 3RC2A 1QFMA 3DLIA 5TPWB 1RQLA 4QLOA 5J5CA 5JZ9A 2PAAA 1NMEA 3H2BA 3IE2A 3HLYA 3JRXA 4HH1A 4X71A 4C20A 4EVQA 3ADCA 3ZLJA 1UBOS 3DE1X 4Y3UA 3DWFA 1ZRMA 5ERYA 3BFKA 3DO6A 3QMMA 4PXYA 2NO7A 4AI6A 5KJ6A 2R8XA 3WKAA 4EW6A 4RADA 1V35A 1ZEMA 2Q3LA 1RI4A 2RGYA 1UBJS 3KDPA 4P54A 3D0KA 2O7RA 4R9NA 5AT1A 3SX0A 4ER5A 1DJLA 1IB6A 2XOKA 4EYEA 2EBHX 2IJGX 3ROZA 3BIFA 3PI6A 5EPEA 1UBLS 4NP6A 4Q12A 2A4MA 4F2HA 3ADBA 5A3VA 3O93A 1VRWA 2IV3A 1NN5A 4OOEA 1G5QA 4FD2A 4MRPA 3QMVA 5JJCA 3ER6A 1W2WB 5JFGA 3VR6D 3F74A 5B7QA 5BV8A 1I4WA 2HJVA 4BRWA 5F7XA 2A1IA 3H87A 1TUBA 2R6AA 1PEYA 3R6TA 1TAUA 4NU0A 1EVEA 1JSZA 5P8WA 3KLPX 2NV2B 3RANA 3KTDA 3UXEA 4NEQA 3GUVA 2M6RA 3HK2A 4W5OA 3UW1A 1NFQA 2JBAB 1H65A 3PDIB 2NT3A 5AK5A 3I72A 4EYQA 4RA9A 1D1QA 4DIKA 2O3TA 5J1TB 4Y0AA 4RIFA 4YCSA 4YQFA 5C35A 2R86A 1FFXA 5B58T 1ZDMA 3M3PA 1JR4A 3QV1A 1B74A 1TZ2A 1E9EA 1NBME 3U6KA 3ABIA 1A69A 1GUYA 1L5GB 2ZUCA 1FNDA 1Z4KA 2ZKIA 4QDUA 3NBUA 3DEZA 1RLTA 2BFOA 2R5NA 4IDEA 4PANA 3S29A 3TQHA 1OC4A 4INAA 1NUTA 2C1XA 3A9TA 4O4LA 1SU6A 3B12A 4V24A 2CLCX 5LA6A 2X0DA 3BTSA 2LCIA 4KBYA 3ZLUA 3QUAA 5TB5A 1RABA 4LJYA 3A9VA 3QVLA 4YMGA 2MMGA 2P2GA 1Y8ZA 2PMKA 2QY6A 3PC2A