3DMTA

Structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma cruzi in complex with the irreversible iodoacetate inhibitor
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
359
structure length
359
Chain Sequence
MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Studies on Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi in Complex with Iodoacetate.
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, glycosomal
total genus 115
structure length 359
sequence length 359
chains with identical sequence B, D
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3dmtA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dmtA01
1F14A 2OP0A 4CM8B 1SAYA 3ADOA 1V0JA 4WCFC 4PLYA 4YAIA 2HMSA 1YWGO 3ONEA 4LISA 4MP6A 1CQJA 1Y8QB 1SB8A 2NADA 3ZWXA 4NFYA 1PGOA 4L74A 2FPIA 4YEDA 2G1UA 2GGSA 2XOXA 2YQ4A 4IGEA 4J7CA 3DWFA 1GYPA 1VJ1A 3I9MA 5JYDA 2EP5A 4ALNA 2O3TA 3HN2A 4LCEA 1ADGA 1D3AA 1P45A 2CSUA 3WQRA 1HLPA 1HTBA 1HDYA 5G0WA 3ZHBA 4XR9A 4YDRA 3DZIA 3WNQA 1JKJA 3QQPA 1TT5B 4CL3A 2P2SA 3L4BC 4IDAA 5JPIA 5JFOA 5JO0A 1EE9A 3GPIA 4XWYA 5BT9A 3GNQA 2O3QA 1P31A 4J9UE 3NX4A 3RU7A 4KWIA 4M55A 5JBIA 2AEJA 4BKUA 1DJNA 4EGFA 1U3VA 1R0LA 4YRBA 2IEDA 3PP8A 4CLRA 3GUCA 3NDIA 2PH5A 1Y81A 8LDHA 4GPD1 4DPLA 2B36A 2FP4A 2JL1A 4N18A 2E82A 3ONDA 3LC1O 1GUFA 4GSLA 2E37A 2O2SA 3JD0A 4DRYA 5U4QA 4FFMA 4C7JA 1P1KA 3VH3A 3KYCB 3F47A 2D59A 1A9YA 1N1GA 1ISGA 4RF3A 3WYCA 4BNTA 2HKIA 3RWBA 1WMBA 2JAHA 3QY9A 4NK5A 4R41A 3LT1A 3PQFA 2C7GA 3QWIA 1DC6A 1PL6A 2NTNA 4AJIA 2O4UX 4XKJA 2VOJA 3L4BA 4J1NA 2C0CA 4IDGA 3HQ4O 1N7GA 3ZV6A 5L51A 3JQCA 2OXIA 3NYWA 1E6UA 1IB6A 4A27A 4BNMA 1UAGA 1IE3A 1YL7A 4D41A 3KLMX 2HK9A 2J3KA 3KVOA 5KCZA 1BSVA 3INRA 3HZZA 3U4HA 1QYVA 4MKRA 4PG8A 2AE1A 1YQDA 2I9PA 1GFSA 4UUMA 1K6XA 4GWGA 3O4RA 1H6DA 1DC5A 1EVJA 4BKRA 1YL5A 1Q0HA 1BRMA 1HEUA 1LSOA 2HAEA 3BTOA 3RUFA 4ZQEA 4Z9YA 1EFLA 2GYYA 4FJ2A 3DTYA 4BGEA 4NFSA 4J1SA 2J3JA 2Y0DA 4XRRA 3WR5A 3I9JA 3GC6A 4YAKA 4MVJG 1VKOA 4NPCA 2OO5A 3GMDA 3WQQA 3VTFA 4BIIA 2DUUA 2IEBA 4P4LA 4AJKA 4CR7A 1Q2XA 2HMWA 5AXBA 1K89A 3MWEB 4PGFA 4CM3A 1HE3A 1C1XB 2IXBA 2C2YA 3O38A 4B4VA 4A5OA 2Y68A 4CV2A 4PZDA 3O26A 1D1SA 1O94A 3K2EA 1EVZA 3VC7A 3NRCA 5I7VA 1TB4A 5JAMA 5EINA 3JQ9A 1MC5A 4FCCA 2GN9A 2VYVA 2JHGA 4YPOA 1ZK0A 1DC3A 3ETDA 4Q39A 3TZ6A 5L53A 3BMCA 4GAEA 3L4SO 4NBUA 1E1NA 1W73A 1PJCA 4ZQGA 5ENVA 3UF0A 2IZZA 1VC2A 4IMPA 4I9UA 2DUWA 4L4XA 6LDHA 2PZKA 2YW9A 2BD0A 2CDBA 3AUAA 5KJCA 4K26A 4Y8VA 5I8WA 5JLAA 3DB2A 2QZ9A 4EBFA 3ZU3A 3F1LA 4IMRA 1P0FA 4JJIA 3RBXA 3M1LA 4GKBA 4G2NA 4BO4A 3V1YA 2X9NA 4E3ZA 1X7DA 3GG9A 4EITA 3DMTA 4PLVA 3NDRA 1KS9A 4C4OA 4YRDA 2GERA 4XEHA 3NJ4A 1H94A 2I3AA 1SOVA 2YY7A 3VPSA 1FDSA 3ICCA 1QV7A 4DLLA 4JBIA 1X0VA 3FHLA 4GWKA 2C29D 4QECA 4CMIA 3OJOA 2WDZA 4MP3A 1A7AA 2GR9A 3WICA 1N8KA 4PLGA 5F21A 1OBFO 3JD2A 3MEQA 4P4NA 5JMPA 1G6KA 4IUYA 1V35A 2NTJA 3WSVA 2YHIA 4WGGA 2TMGA 4XQGA 4TZTA 5DBGA 1U8FO 4E6PA 3EAGA 5TRTA 3GHYA 3K5PA 2CVQA 5KJ1A 3RC9A 2D8AA 4J6FA 2OL4A 1TXGA 5ER6A 4E2YA 1PS9A 5ILOA 1NWHA 3S2FA 4K1LA 1UP4A 3TWOA 1K6IA 4TRRA 3IKVA 4R1NA 3I1JA 2A4KA 4XYGA 3KTDA 3S2IA 2F00A 3BZUA 1GR0A 2EEZA 2CVZA 2IYPA 3H6KA 3OQ1A 3NTQA 4E32A 5G4LA 4LMPA 1YH3A 2JCVA 1PJQA 3FCOA 4BS9A 3TOXA 4PG4A 1GTMA 4OMUA 3PIIA 4IQGA 1ZK2A 4EYEA 1PWXA 2LDXA 1BW9B 3UGKA 4A7PA 1PJ4A 1R37A 3X2FA 5G4KA 2FR0A 3WWZA 4JBHA 1O8CA 1Q7CA 3H5RA 4OIMA 2WJPA 5KKCA 3NT2A 2J6IA 3M2PA 1OAAA 5IZCC 2EKPA 2NV6A 5FFFA 2FR1A 3TNLA 3GOHA 2H1SA 2VOEA 4U5QA 1T2FA 4CV3A 3AU8A 1DB3A 1U3WA 1UAYA 5DBFA 5G4KB 1A4UA 4IQ0A 4C7KA 3T7CA 3GVXA 3B70A 3D7LA 4B7CA 1PGQA 3AWDA 4CV0A 3DFZA 3A14A 1PX0A 2BGMA 3K96A 4LK3A 2W2KB 2NVUA 2OZPA 2ZIZA 3ENKA 1U5AA 3F1KA 4UUOA 4CM8A 2CF6A 3AUUA 5LDHA 4HBGA 3WMWA 1SEPA 5JDIC 4DA9A 2OP1A 5JYEA 5K6AA 1Z74A 4RO0A 4FSHA 1O9BA 3NT5A 1LLUA 5GZ1A 1PEDA 1GU7A 3JQ7B 4TSKA 4ZU3A 1KVUA 4PFJA 5K9ZA 3GEMA 1KETA 3FI9A 4CM9D 4G5HA 1IHYA 1T4DA 4RJTA 4W9NA 2NM0A 3H9JA 4RORA 2GUGA 2JHFA 1MP0A 2W2KA 5CDGA 2HSDA 2OFPA 3DZBA 3OETA 1GCUA 2DTEA 4HXYA 4IXWA 1HDCA 3WB9A 4DC1A 1ZEJA 5AQ1A 1V3UA 3WGHA 4MINA 1PQWA 2FMUA 1DAOA 4JNKA 4RQTA 4B3JA 3P19A 4FFPA 2Q49A 2ZATA 5I7SA 5IAAA 3DDNA 5B4VA 4FC7A 4S3MA 4E4YA 4YB8A 1LRLA 1DIBA 4HADA 1KVQA 2FR8A 3ZI0A 2X22A 2UAGA 3GH3A 1VL0A 1P1JA 3PYMA 1LRKA 1JN0A 1RM5A 1U4SA 5IDWA 1IY8A 4I8XA 3ICPA 2CVOA 3WDSA 3S8MA 5AVOA 2AMFA 2BGLA 5COQA 4WLNA 5IXYA 1A5ZA 1OFGA 3L9XA 3VPGA 1NXQA 4PLFA 3EMKA 4B4WA 5U1PA 3V2UA 3OF2A 1NASA 2OHXA 1OC4A 3UFXA 2JAPA 2HU2A 1GADO 4II2A 5JAIA 1HYGA 3KYDB 2Q2QA 4BQPA 4LRSB 3BMCB 1HDRA 3P7MA 4EJ0A 1JAYA 1YL6A 5EQFA 2D2IA 1ENZA 3WIEA 4OGWA 4ALIA 1PZHA 1UJMA 2VUTA 1ZW1A 4NK4A 1YKFA 1LBEA 3NEPX 4PLWA 4RLSA 4JJGA 4AJLA 4BO1A 3PFFA 4MIYA 2NVUB 4HY3A 3BTVA 1N92A 3INTA 3KHUA 2Q3EA 4JBGA 1XA0A 4ND5A 3QVXA 1E92A 5ADHA 5KJFA 4DMMA 1DEHA 1HYEA 2YDXA 2C82A 1BWSA 2ZYDA 1CF2O 4KUGA 3PJFA 4RDHA 2ZTLA 4MKXA 4RDIA 1W4ZA 1NPTO 2ZYGA 4LN1A 3AFMA 5KJEA 3TSCA 5A06A 2W2LD 3HDYA 5FWNA 3NAQA 3A9WA 1T2AA 1ZK3A 5B1YA 4YJGB 1T24A 3GVPA 4RPKA 3IMFA 3C1OA 1PGNA 4OQZA 2PV7A 1WZEA 1XU7A 3L77A 2Z1NA 3Q9NA 1J6UA 4CM5A 4XGKA 1B15A 3F5QA 5HWSA 1WZIA 5K0ZA 1QSGA 4RPJA 3FNHA 4TKMA 4ZRNA 4D0SA 1P77A 3F3SA 4OL9A 4F46A 3DOOA 5T67A 3OHSX 4NBWA 3E48A 1R4MB 2WD7A 4KMSA 3F5SA 1O5IA 2Y93A 1S7CA 3DR3A 1MFZA 2GPTA 5TF4A 5BSEA 1UZNA 5IF3A 1GDHA 1Q1NA 3W1VA 5FF9A 2C2XA 1EE2A 2V6FA 3PJDA 3WBBA 1E7QA 3VPXA 3H9EO 4Z3DA 5JDIA 4RVSA 2GO1A 2YQ5A 1NHWA 3JQDA 3NUGA 5JC1A 2PY6A 3PJEA 3JQBC 4TVOA 4M1QA 4BO7A 1P1IA 4AVYA 4F3YA 3EC7A 1KYQA 2B4QA 4XX0A 5B37A 3V8BA 3PWSA 3B1JA 4YJHB 4R54A 4E0BA 5LCXA 4R9SA 2FPGA 2DPGA 4GQAA 3EYWA 1UXGA 1YXMA 1EK5A 1U3UA 2P9CA 3I4FA 5AXCA 4NZ9A 4MOWA 4ZGWA 1DDOA 1ZXLA 3FR8A 3ZNPA 4MDHA 1NP3A 3ZWMA 4BGIA 4O59O 3I9LA 2Q22A 2AQIA 5CPBA 1MX3A 3GHHA 3PQDA 3RFTA 1CIVA 1LNQA 1B7GO 1AXEA 3DHEA 3KXDA 5DT9A 4UEOA 4CM6A 1D7OA 1ONOA 4RQUA 4R51A 3K2BA 3S55A 3S2EA 3AY7A 4NI5A 4M87A 4FOOA 3RCBA 1NR7A 4PCVA 3RJ9A 1I2CA 1YRLA 4XJSA 4ZN6A 5EPOA 3JSAA 4Z3KA 4I5GA 1X1TA 3JV7A 4DXHA 3MTGA 4L0QA 3G49A 4YJGA 1H6AA 3SJ7A 2UVDA 3WLEA 1B0AA 3WSWA 3PJGA 1E7YA 2YUTA 4YQZA 4A2CA 2Z5LA 1I3NA 3K30A 1JVBA 2X0IA 3RUEA 2X0NA 2YHIB 4ND4A 3C7DB 1ZNQO 3LF1A 1WPQA 1EMDA 2PD6A 2Y1DA 3H3FA 3IL2A 1YS4A 5L7TA 1EK6A 3DXFA 5G0SA 3GUYA 4B8WA 2R00C 4CPDA 3GGOA 3SXPA 1KOLA 4DTIA 3BTUA 3CMMA 2G17A 2RH8A 2I5PO 1UDCA 3MOIA 2PTGA 2WYWA 3HDJA 3PWKA 5TSDA 2HMUA 3I6QA 5ENDA 1ENPA 4U8GA 3HADA 2OBNA 3R6DA 4PLZA 2OBYA 1E3SA 3RD5A 3ZU5A 1JA9A 3DBRB 4IGFA 5L3ZA 3OH8A 4GX1A 3WOHA 1F8GA 3LQFA 1ZMOA 1ULUA 2UYYA 4HFJA 4UVDA 5JAQA 3JQ9C 8ADHA 1Y1PA 2B4RO 3W4JA 1Q7BA 1CYDA 2VWGA 2VN8A 3ZWYA 3WGTA 5DCUA 3D4PA 3UCEA 4KUEA 3G17A 2JD1A 2X5JO 5G0UA 1EVYA 2X6TA 1CJCA 1SEVA 4CMEC 3GRPA 4J16A 4CMGA 3GFGA 2P68A 3RC1A 1IPEA 3SVTA 1CERA 5ITVA 1GQ2A 2P4QA 3E5RA 3EGOA 1PJTA 1ISMA 3H5NA 1W6UA 1CEQA 3GQVA 4A10A 5L95A 7MDHA 4KUHA 3ZV4A 3PEFA 3WS7A 4BQRA 5ITWA 1EEHA 1WLYA 1EUDA 1E3LA 5C3MA 3R3JA 3QV1A 2EWMA 1QYCA 4J91A 3TFOA 1WXDA 3IUSA 4TKLA 4NH4A 4ZQBA 5A05A 3CKYA 3TZKA 4WPGA 4CMEA 3F4BA 2FOIA 3S1LA 3VOSA 1RM4A 1E7SA 2ZCUA 3ZN2A 4PZCA 3UVEA 4YT2A 2J5RA 5DNAA 4BMSA 4CMKA 1HZJA 3F46A 4BNGA 5CDUA 3FR7A 2JKVA 3I9KA 1SC6A 5IJZA 1Y5RA 1ZBQA 3QWFA 2B83A 1IOLA 1V8BA 1AGNA 2V7PA 3OFSA 4OXYA 3QW2A 3LSYA 1A4IA 5J23A 3ZU2A 3QVTA 4YTEA 3NJ8A 4R3WA 1BDBA 3M6IA 1PQUA 1UDBA 3L07A 1ONNA 1ZJYA 2PH3A 3AUTA 4BNIA 1YVEI 1R12A 5EERA 1U2GA 1ZK1A 3VHRA 4EUEA 1JKIA 1R4MA 1A27A 2WD7B 1WP4A 5HTOA 3WGIA 5DZSA 3RBZA 5C5IA 4ESOA 4NHEA 3PZRA 1QV6A 5HRUA 1UP6A 2ZYAA 1GPDG 1E7WA 3WG9A 4LSWA 1N1EA 1YE3A 3JQFA 4XIJA 3VDQA 4BO5A 5GZ6A 4FFOA 1TLTA 2HCTA 3ORFA 4UUPA 4MJLA 1P0CA 3P2OA 3GY0A 5B4UA 1NYTA 3JQGB 2HJSA 4FB5A 4IBOA 4F45A 1DO8A 5T57A 1XQ6A 3ROMA 3GZ4A 3VH1A 1LLQA 3OSUA 4NBTA 1RM3A 3F4LA 1ZO8A 3MWDB 3GDOA 1AUPA 5TC4A 4LRTB 2YFQA 1E3EA 2EP7A 1I30A 2JFHA 1E7RA 2XAAA 2O48X 4ZHSA 1O95A 4RPLA 2BRUA 3RQSA 4BNKA 3K8ZA 3VKVA 1ISIA 3OA2A 3LC7O 1NNUA 4B4UA 1M76A 4YBZA 4IJWA 3MZ0A 1FDVA 4Q3AA 3G3EA 4EUFA 3RUCA 1EDOA 2GRAA 1I36A 4XQ9A 4EI2A 3LK7A 2VHVA 1YBMA 4DL9A 2PZJA 3ETGA 2GZ2A 4BNYA 5CDTA 1OI7A 2DM6A 4WCDA 3JQEA 4YAGA 3DAFA 5FI3A 4G81A 2GASA 1UR5A 2Z1MA 5J9GA 4DUPA 1HSZA 4WCFA 3KSUA 3I3OA 4DIFA 2AE2A 4D3DA 3GGPA 3V1TC 2RBEA 2NVBA 1YJQA 4BNVA 1DHRA 4BL5A 3BTSA 2Y0CA 4GX0A 1D8AA 1PS8A 2VTDA 5BNIA 1E3WB 3E03A 3WFJA 4Z9FA 3I4CA 3IUPA 1CETA 3EVNA 4QUKA 4I5DA 3AJRA 2BFAA 2F1KA 1XLTA 4BO8A 3RROA 4BKOA 4CMBA 4D3SA 5CG1A 5TGDA 3JYPA 4RVUA 1X7GA 3KEQA 3EVTA 3T4XA 1PJLA 4MP8A 4ZQHA 3HE3A 3EK2A 4Y98A 3G0OA 3W6UA 1H2HA 2J5QA 5JS6A 3SC6A 3D4NA 2H5LA 5I9NA 1DC4A 4WECA 4FN4A 4BNJA 3GG2A 2EG9A 5DCYA 4BMNA 2GLXA 3OIGA 2AW5A 4E30A 1OMOA 1XKQA 2VWHA 4MO2A 1XWFA 4PVCA 2A94A 1OC2A 3DZGA 2B5WA 3FSRA 4GGOA 3AI1A 3COSA 1F12A 3CSDA 4Z9XA 5IDYA 3ROKA 5KTKA 3GGGA 3TL2A 4MKZA 1XCBA 2EERA 3MJEA 1GCOA 3SLGA 3I23A 4QFDA 1LLDA 1Z75A 3TDKA 1ADCA 4W99A 5IN5A 4OHUA 2VUSA 3D3EA 3EHEA 2QYTA 4N5NA 4J4BA 3ZWWA 2QZZA 2YYYA 2VRCA 2PKQP 3GK3A 1KEPA 3FRJA 1I2ZA 3VTZA 2PZLA 2DTDA 5A5EA 1FF9A 1DIRA 1R15A 3Q1LA 1LUAA 1UDAA 3U0BA 4RF4A 3PPIA 2FZEA 3W8EA 4R5HA 1HDZA 4L9RA 3H2SA 4L75A 2VRCD 3IJPA 4BNZA 3PGJA 4Y6SA 3F9IA 4U6QA 3RIHA 1E1LA 1GY8A 3DFUA 3U09A 2BMAA 4PIVA 3ZGYA 5KWEA 2NWQA 4BV9A 2OMEA 4AG3A 1MB4A 4EJ6A 5C7LO 3BHMA 1NTOA 3JD3A 4YJFA 4CL8A 1DHTA 1C0IA 2HQ1A 1RM0A 4GMFA 1GZ3A 1E3WA 1J5PA 2OUIA 1C0KA 3UH1A 1LEHA 2ZTUA 2Q46A 3WGYA 3HWRA 1EUCA 1KC3A 4D45A 4MVJP 2Q4EA 5C7IO 4LVUA 4MVJE 3ON5A 1YOVA 2XPCA 5DULA 3DBRA 3AY6A 5TS3A 3DMYA 1J0XO 2CDAA 5KKAA 4M8SA 4DPKA 1YJ8A 3OBBA 1MC4A 3LDHA 4RZHA 3GZNB 1DPGA 3VVCA 3PI7A 4HFMA 4OSOA 3U5TA 3DOCA 1JWAB 3H4VA 1YOVB 3RAJA 4K6FA 4FJ1A 2O7SA 5T64A 1NR1A 3PXXA 2FSVA 5THQA 3ZH2A 2PGJA 3ANLA 5CFZA 1U3TA 1EQUA 3W6ZA 2TMDA 1I3LA 1UXJA 4OYRA 4RVGA 4KOAA 3PDJA 4UVHA 3ROQA 3JQFC 2O7QA 5JY1A 1IULA 5CEFA 1LC0A 4Z0HO 3KEOA 1M2WA 3KV3O 4E5YA 2HMVA 2JCXA 5EN4A 1ULSA 3HJAA 2J3HA 2HK8A 3AOEC 3BIOA 2DVMA 1DJQA 2B4TO 3UXYA 3ZNQA 1YQXA 2ZJ0A 1JLLA 1V6AA 4QQRA 5DP1A 2A92A 4GX2A 3DHNA 2EV9A 4IDCA 4WLVA 1C3VA 1XELA 5AXDA 3DZFA 3GVIA 4XB1A 4PVDA 1U28A 5DCWA 5AOVA 1T1SA 4P22A 2VNAA 4WCFB 2FY8A 1QLJA 4YWJA 4E5NA 1CWUA 4JXKA 1PR3A 4FC6A 2IRWA 2J3IA 3M2TA 2DU8A 3DQPA 3AOGA 2B0JA 2HUNA 2PFGA 2PGLA 3ETEA 4W4TA 2DKNA 2HO5A 3A06A 1W8DA 1PJ3A 4TRJA 2VTEA 3CUKA 3WYBA 1XEAA 2PNFA 4BNXA 3LU1A 1DIHA 3AM4A 5KVQA 3LF2A 4HWKA 3RUIA 4TWRA 4MVJD 4JP3A 2QYSA 2Q50A 1SMKA 4AICA 1C0PA 3FWNA 4CLXA 4YRAA 2YZ7A 3HG7A 2HLPA 4CODB 5C37A 3KZVA 4PLPA 3VPHA 3WJ7A 3ZDFA 4WLEA 3P5SA 1LA2A 2JJYA 1DLJA 1C1DA 4E33A 3N74A 4WASA 3B1FA 5IG2A 1IHXA 1PL7A 4FDAA 2ZTVA 3MOGA 1PJSA 3KM0A 4JJFA 3U9LA 4AJ4A 4B7UA 3D3WA 2RH4A 3QLJA 4OSPA 3WQSB 4WNIA 2AG5A 1GZ6A 2D5CA 2FPPA 1F8FA 1VJTA 1TI7A 5T8KC 5U9CA 2D3TA 2C07A 4LMRA 1NM5A 5IZ4A 1PU2A 2WYUA 4J90A 4YCAA 4R1TA 4XDZA 3JYOA 3L0DA 2FSSA 3D0OA 1LJ8A 2UUPA 3ZWPA 2C20A 3SEFA 4D42A 4R3NA 3DONA 3JQ8B 1K2WA 1U7HA 1ADFA 3V2GA 4F6CA 4E2WA 3HFSA 5IDQA 3RUDA 1U7TA 3BXXA 2NNLD 3IDSA 1ZXBA 4K9DA 1R4NB 1U1IA 2Y67A 4R4JA 1KBZA 3OIFA 4R16A 2VHWA 2WM3A 1HLDA 4OKNA 5I8ZA 2P5UA 1GV0A 1G0OA 1Y8RB 2GSDA 2DQ4A 2X58A 4OQYA 5H83A 4CQMB 3WGGA 5CDSA 3N7UA 3PGXA 4HUJA 4J0FA 4PZEA 1YBVA 3VAZA 2GZ1A 4Y67A 5CP8A 4B4OA 1V3TA 3BMOB 3ZCXA 2VT3A 2C59A 4QO8A 5JE8A 2QIOA 2WSBA 1EQ2A 5JDCC 3PYXA 4FJ0A 5ICSA 2NVWA 4R68A 1HDOA 3UW3A 1WDKA 2AEMA 4K28A 4H3VA 4EDFA 4BB6A 1U4OA 4GMGA 3V1UA 3DAPA 1R0KA 1YDEA 5HBRA 3MJTA 3A4VA 3DO5A 2A9FA 4DREA 1R6DA 1P9LA 4UVIA 3ULKA 2OORA 1E1MA 2CD9A 1WW8A 1IZ9A 2YV1A 3WFIA 1ADBA 2QHXA 2NQTA 3Q9UA 4OAQA 4Q3BA 5JXWA 3VKUA 1M66A 3E8XA 3HDHA 1LDBA 1Y5MA 1DRWA 2CNBA 3K9QO 4IDDA 4GKVA 4I9NA 3OJFA 5H81A 4E5PA 1GZ4A 1XQ1A 2QRJA 1E3JA 3PLNA 4WOKA 4Y9DA 3JYQA 3GNSA 1UUFA 2RAFA 1KY5A 4KDEA 3I5MA 1H6CA 4A26A 3IJRA 1I10A 4URFA 5BSFA 2VZ8A 2ILTA 2FN7A 4AL4A 1V9LA 4Z0TA 4WLUA 4K6CA 4AJEA 5JDCA 4J9VA 3W4KA 3ZWNA 3H8VA 1U8XX 1X13A 1U9JA 4IJKA 2Q1UA 3WX0A 4IZHA 5A9RA 5BSHA 3E9NA 3PWZA 3TL3A 2ZTMA 3CINA 3GAFA 5EJ2A 2H9IA 3H9GA 1FMCA 3O03A 2EW2A 1PS0A 3LT4A 4R01A 2AG8A 4JCOA 1KVTA 5HS6A 5CPFA 3U4IA 4YYZA 3D4OA 4D79A 4CM1A 5EQDA 5GMOA 1HDGO 2Y0EA 2YHUA 3CZRA 2V6BA 4S1VA 1LSSA 4BGUA 3C7CB 1E5LA 4YJFB 4P4GA 2Y99A 2A35A 2ZQYA 1D1TA 5BSGA 3ANNA 3VZQA 1ZSYA 4DQXA 5JNLA 3Q2KA 3DZJA 3H5AA 1X15A 3MCVA 5DDIP 4HP8A 4MVJF 1LXCA 3C7AA 4OJNA 4LGVA 2UDPA 3N58A 2IDZA 2B69A 4FFNA 4DC0A 3WIDA 3HNPA 2O3UA 3QVSA 5TQVA 3RASA 1B16A 3GF4A 3RVDA 1E1KA 1NQOA 2DAPA 3IS3A 1H9AA 2BI7A 2O3RA 3V2HA 2DBRA 1UZMA 4RPGA 4XB2A 1ML3A 3WGOA 2E48A 2NU8A 4DWVA 3GPDG 5BQFA 3X2EA 1MG0A 2DPHA 3DAGA 1YDWA 1ID1A 4E31A 3JQGA 4GLLA 3GT0A 1NPDA 2WD8A 3PVZA 3ZWCA 1ZUD1 1PJBA 2XXBA 4IIUA 1BVRA 3LT2A 4WEQA 1H5QA 5GY7A 1GQYA 3U4DA 1IL0A 1WVGA 1RYEA 4ILKA 4XYLA 2BLLA 3AUSA 5A9SB 2EXXA 3ZV3A 3FBGA 2Z95A 5LDGA 5JAZA 2AQHA 4JK3A 4E12A 1CRWG 3FPLA 2C7VA 3PRJA 4NJMA 4IM7A 1ISJA 1K0UA 1X7HA 2I66A 2VNSA 1VI2A 5JC8A 2R6JA 3OJEA 2NQ8A 4YT5A 3D1LA 1CDOA 1N9GB 4XGNA 1LSUA 5A9SA 4DPMA 4BB5A 3F6YA 5H82A 1DRVA 3QE3A 1LI4A 4J1TA 4YAJA 1MLDA 3WJAA 1QKIA 3JQAB 4E5MA 4M89A 3EZLA 4KWHA 3VH2A 4EZBA 5TT0A 2YFHA 3ABIA 1T2CA 2G76A 1S6YA 1TEHA 2O23A 3TOZA 3LT0A 3DBLA 2W4QA 4BOYA 3KYBA 1DFGA 3OMLA 1HWYA 4HNHA 2EJWA 3JQAA 1XYGA 4DIBA 1LSJA 1HE5A 4BMVA 3C1AA 4CLHA 3Q2IA 3IOYA 3SBOA 2Q4BA 3BMNA 1DFHA 5DP2A 3TN7A 4ND1A 1MA0A 1QP8A 2V6MA 2NU9A 4B8ZA 1BG6A 3BYZA 3OQBA 4YQYA 3RKRA 2QQ5A 1Y8RA 3RUHA 1GV1A 1OZAA 2VHXA 4IJVA 2OOSA 3TZCA 4IINA 3PK0A 4MVJM 1HF3A 1LC3A 2ZCVA 1WDMA 4FGSA 4ROSA 3AK4A 4BNHA 1GYRA 3BMOA 5TJHA 4AJNA 4TROA 1T2DA 3UOGA 1CQIA 5T6BA 4BNNA 1MFPA 3AM5A 4EUHA 5BR7A 3DZHA 1I2BA 5KNLA 1QXSA 1FXSA 3NGXA 1ZSVA 4AJOA 2WE7A 4PRLA 3ASUA 1MXFA 3QVWA 4J7XA 1EVIA 3AOEA 4U7WA 1YB5A 4NR0A 5F5LA 2VRBA 4BGVA 1F06A 1C1DB 1DIAA 2ZB3A 1I8TA 1I24A 4YJHA 4B7XA 4PG7A 5A02A 1LDEA 3BHJA 4XQCA 3GN1A 5DF1A 7ADHA 3D64A 1YB1A 2CDCA 5F5NA 3TRIA 4JX8A 4B3HA 3D3WB 2ZJ1A 3R1IA 1ORRA 2GNAA 1LRJA 2I99A 1HDXA 4YR9A 1NBOA 1SPXA 4BVAA 1T2EA 1I5RA 4DYDA 1H2BA 1O0SA 4WKGA 5A3JA 4W6ZA 2PA3A 4RVHA 1PQPA 2I76A 3KO8A 1IUKA 2VZ0A 4RCVA 2ZK7A 1GYQA 2C5AA 1Z7EA 4BO9A 4Q3EA 4XYEA 4WNCA 1NX6A 1DIGA 3ZHXA 2X86A 1N2SA 4BV8A 1A71A 4DBVO 4GL4A 1Z45A 1YBAA 2J5KA 1VSVA 2LDBA 3WTBA 5IXSA 1VLLA 2DFDA 2DBVO 3I52A 4OH1A 3IAHA 2FZWA 5JW6A 2J8ZA 2EGHA 1E6EA 1SZJG 5KVSA 1XR3A 1PGJA 3O8QA 4I08A 4J7UA 3G79A 4XD2A 3PZBA 3WYEA 4AJPA 3JQAD 2C54A 2RIRA 4ZQFA 4YXFA 4ID9A 2X0RA 1Z73A 4JROA 3L6EA 4WK6A 3U3XA 1IYZA 2E6UX 2GN4A 3INGA 5IN4A 4DYVA 3ANMA 4M49A 5JCJD 1I33A 5FEUA 4DMLA 5KIAA 4BKPA 1PIWA 1ZJZA 5MGBA 4WLOA 4R1SA 2VT2A 2ZB7A 3O8QB 4IS3A 4DGSA 2P9EA 4YVFA 1M6HA 3SLKA 1R66A 4UEKA 1WMAA 3UHAA 3B20A 2GZ3A 3PHHA 1NVTA 4B3IA 1RPNA 4CV1A 3KB6A 4NMHA 4D0RA 2X5KO 5FI5A 4CR6A 2W90A 1JQBA 2NTVA 3I6IA 4NBRA 4OOFA 3JQBA 3FNEA 3KOUA 1KEWA 1RKXA 3ZU4A 1ZFNA 2VYVD 1MG5A 1XG5A 3QA9A 4ZRMA 1LU9A 3VZSA 4GLOA 1XDWA 4D7AA 3CXRA 4TQGA 2ZB4A 3G1TA 2BELA 4CMJA 5TNXA 4MPDA 5G0VA 1J49A 4HV4A 4QO7A 4P38A 4Z6KA 2Q45A 4L4RA 5EL0A 1K5HA 3ZW9A 2IYOA 4O6VA 4YT4A 5MDHA 3KUXA 3W4IA 3ZWVA 1NVGA 5BNFA 2I67A 3Q3CA 2FHSA 3BMQB 2JD2A 5I7FA 1AXGA 1BDMA 4KQWA 5JCJA 4JIGA 3WMXA 5T5QA 1NFRA 4BKQA 2PKQO 4GBJA 4E5KA 4IQ8A 5DBIA 3E18A 3AFNA 5CAEA 2PZMA 4TRMA 1VL8A 2WYVA 4A03A 1N7HA 3ZNNA 4WLFA 1T1RA 1B8UA 3PYLA 3RC7A 5A03A 1E6WA 1XHLA 4MVJA 2Q2VA 2V65A 3FTNA 1AE1A 4FIZA 1T4BA 1C0LA 1O6ZA 2W2LA 1E3IA 2EKQA 2DTXA 2G0TA 2YV2A 4H15A 2HK7A 2HDHA 3I9OA 2IZ1A 1MUUA 2RHRA 1A7KA 1G1AA 5EIOA 1YQGA 4HFNA 3U49A 4UAGA 3PTZA 2RCYA 4BO3A 3ITKA 3H9UA 1Z6ZA 2QX7A 3KLPX 5A4DA 4W82A 1U2DA 1Y9EA 2CY0A 4HFRA 1P1FA 2GN8A 3W8FA 2IXAA 2O50A 4Q9NA 3UCFA 4KTTE 5F1PA 1RJWA 3LLVA 5AXAA 1T25A 3RSHA 1ISFA 1R0SA 1GL3A 3FD8A 1PL8A 3AI3A 5F3RA 4TZKA 1ENOA 6ADHA 5T8KA 1PJ2A 3FBTA 4TRNA 2PKRA 1NFFA 3RUAA 4ZICA 3GRKA 5A3VA 1HSOA 1V3VA 2PR2A 3JYNA 4R69A 3SC4A 4FW8A 9LDBA 3DOJA 3BAZA 3ZWBA 1A72A 3PHGA 1E7MA 1GQQA 2P4HX 4L73A 3S2GA 3QWHA 3C24A 2D1YA 4HNGA 1OOEA 4NFHA 3LLSA 5M6DA 1GUYA 4PG5A 4TMFA 3C85A 1DLIA 1B3BA 4NJMB 3CH6A 4O5OA 4R9RA 1I0ZA 5G2OA 1LDNA 3GZNA 3IP1A 4IJUA 3GMSA 3AU9A 1P1HA 4RV9A 2Q1TA 1I3KA 4RVDA 5L7YA 3B6ZA 1ZEMA 2EJVA 4EEXA 1WWKA 1N9GA 2EKLA 3HN7A 1RWBA 1JU9A 1UP7A 3GNTA 4L4SA 3RFVA 2IZ0A 4CM4A 3HB5X 4JP2A 2H6EA 4LVCA 3E82A 2HRZA 3DHYA 3OEYA 2SCUA 1AHIA 1SCUA 4LCJA 1I3MA 3DBHB 2W98A 1VKNA 2DT5A 1L7EA 3AM3A 4JGBA 3EDMA 3KRTA 4KTVE 4Z0PA 4RL6A 4ZVVA 3DEYX 3H9QA 1HL3A 5THKA 3T7EA 1BGVA 2D0IA 2NACA 4GSKA 4DBZA 5A1TA 3KYCA 1NQ5A 1JWBB 3QHAA 4J2OA 1AN9A 2X5OA 2JFFA 3ZZNA 4CM4B 5A5FA 2WTBA 5JCXA 5JO9A 1WAMA 4D46A 4UVGA 4KQXA 1Y6JA 2W8ZA 4YT8A 3GDGA 3PDUA 4II3A 2NUAA 3FTPA 1BXGA 4BO2A 4CUJA 1F17A 3KSDO 3BMNB 4D43A 4YA6A 1HKUA 3OM9A 3VZPA 1B8VA 2VHZA 4NG5A 4W7HA 1VPDA 4AJJA 1G0NA 1TA4A 4JQCA 5COAA 1M67A 1NWCA 1QYXA 5ER9A 5TT1A 3QSGA 4B79A 1YO6A 3TJRA 1MGOA 2P91A 1J4AA 3H3JA 2O2YA 1DXYA 4CMCA 2AHRA 1DFIA 1GEEA 3VZRA 4CJXA 2DLDA 5ICMA 3JYLA 2AEFA 1M75A 4R5MA 5HM8A 3PHLA 2X9GA 1LLCA 4P8RA 2EW8A 3D5QA 3PFWO 4WUVA 4CLOA 3STHA 3QVOA 1DSSG 1PR9A 3WTCA 3QP9A 1PSDA 3I9NA 1E77A 3EW7A 1KC1A 1ZZEA 2WE8A 3OQ6A 4NQZA 1LTHR 2NU7A 2R2GA 3HHPA 3Q11A 4ZA2A 4XJTA 4RLHA 3GA0A 2Y66A 3ZW8A 1B8PA 2DFVA 2UUOA 1TT5A 4F6LA 1DAPA 5AYVA 1BVUA 3PQEA 2VCYA 1RYDA 5BNTA 2UV8A 4E21A 3WXBA 1BXZA 2ZQZA 3IP3A 1E5QA 1TVEA 2GDZA 4OOEA 5I9MA 4ALLA 1KY4A 4CMHA 1VJ0A 2WMDA 4HKTA 2NU6A 4QX6A 1P74A 1VL6A 3NKLA 2WWRA 1QG6A 1XGKA 4FGWA 4U0KA 2YJZA 3AY3A 4FFLA 3TFQA 2D5AA 1W0CA 1JKFA 2PK3A 4JN6B 3K31A 1FJHA 4J0EA 5ILGA 3ZV5A 1UZLA 3QJ5A 2Q2WA 4XYBA 1QR6A 1X1EA 2BHLA 3ZWOA 2Y1FA 1FK8A 3GEDA 1PZFA 1R4NA 1WNTA 4RPHA 3HUDA 3GEGA 3U4CA 1UXIA 4ALMA 3CMCO 4CQMA 1N5DA 2CMDA 1LDYA 4OKIA 1M6WA 4L8VA 3BHIA 4XZ3A 2PWZA 3D5TA 2VYNA 2GCGA 1ZIDA 3UAGA 2HRBA 1H6BA 1YB4A 4PLHA 1X0XA 5DOVA 5DN9A 2QRLA 5KVCA 4XA8A 4H7PA 4IDEA 2BI8A 4BO6A 5F1KA 4CQLA 4BNUA 3OICA 1MV8A 3FWZA 4W9NC 5L9AA 3UCXA 5JYAA 1HE2A 1PTJA 5LC1A 3A1NA 3U62A 3K92A 3RKUA 3PLRA 5CHEA 2Y05A 3GAZA 4AFNA 4J3FA 3OP4A 3HFGA 3JQ6A 4OO3A 1LQUA 4U0JA 4DLBA 5CEJA 5B12A 2PD4A 2HJRA 4UULA 3BMQA 3SX2A 1XSEA 2X9VA 5COBA 5A9TA 3RJ5A 1EFKA 5ES3A 2ET6A 1TT7A 3GDFA 3NTOA 1QORA 1VE9A 4G65A 3FF4A 2CFCA 3NTRA 2BFMA 1IPFA 2BH9A 1BW9A 3OJ0A 4JLWA 2B37A 4RF5A 3UICA 4XRGA 1ZSNA 5IDXA 4FS3A 3DL2A 3VH4A 2Y1CA 5IZCA 1ZCJA 1L1FA 5K6AC 2AA3A 4O63O 1HYHA 3OEWA 4GH5A 1QRRA 3CIFA 2O3SA 4QSMA 4OXNA 3L6OO 4CR8A 4ND3A 5TIIA 1H93A 3JCZA 3C1TA 4CUZA 2NSDA 3MJ4A 4J4HA 3Q6IA 1T26A 3CZMA 3UKOA 4KDFA 4MVJH 5TX7A 4RF2A 3DBVO 2JCYA 2BFPA 3LVFO 4WOJA 3ROPA 4J43A 3JD1A 1D4FA 1ONPA 5JYFA 1GAEO 2X1HA 1JDJA 3T4EA 3VDRA 4QXMA 4XYMA 4KP7A 2X4GA 4YACA 1BTOA 2EGGA 3JQ7A 4U6SA 2O4CA 1P44A 2VYND 1YONA 4GGPA 2H63A 1EUZA 4OM8A 5T73A 3OJLA 2DC1A 2VZ9A 3PHJA 4PLTA 3P2YA 1NVMB 3GN2A 1FDUA 3OIDA 1ARZA 1GUZA 3RU9A 3MJSA 4IXTA 4N5LA 3EUWA 1ENYA 3L6DA 4BNLA 5L40A 3PHIA 4ONEA 1NAIA 5IFLA 3UUWA 3H65A 3K6JA 1NPYA 2HMTA 2IE0A 4CM7A 3IQDB 3B1KA 1NQTA 4CQMD 3DZKA 1HETA 4ALJA 5I7EA 2X23A 4O1MA 1O89A 1Y9AA 2GN6A 2V6GA 9LDTA 1EBUA 1DOHA 1QYWA 3CEAA 1EDZA 4RGBA 5KOIA 3DMTC 4AJHA 4IY1A 4CLOB 4L76A 4PRKA 3WNVA 3E9QA 3WLFA 2E4AA 3HDQA 4J4TA 1GEGA 3ZHYA 3DBHA 2R00A 2D4AA 1HE4A 3O9ZA 4QTZA 1KVRA 2PLAA 3RFXA 3QIVA 1P3DA 4H16A 2X7HA 1VRWA 2X8LA 3DC2A 2FWMX 3IC5A 3TQHA 3WGZA 4ALKA 4CLDA 2I6TA 4BHTA 5CEEA 3MTJA 2AQKA 3QWBA 2XXJA 4Q3NA 2VWQA 3KYDA 1LQTA 4R1UA 2EF1A 1SOWA 4ITUA 3JQ8A 3JD4A 4DIOA 1SBYA 1B14A 3Q0EA 4IPTA 1PGPA 4D3FA 1EZ4A 3FPCA 5EMHA 4DQUA 4PG6A 4CM9A 3RI3A 3DBLB 3CPSA 3W8DA 4FR5A 1BMDA 2VHYA 4E2XA 1SNYA 3EY4A 1ZMTA 3LZ6A 4BUCA 1HRDA 1I01A 3GLQA 1Q0LA 1QYDA 3EZYA 4INAA 3R0IA 1X14A 3A28A 3TZHA 4ZJUA 3KSZO 5F1OA 1EBFA 3H2ZA 1Q0QA 3C3XA 4M54A 1GD1O 3IKTA 5EESA 3ASVA 3RBVA 3OECA 4DVJA 1YGYA 4Y6RA 1P33A 3WBFA 2X0JA 4DLAA 2DBQA 1VSUA 5KVVA 2I65A 3ONFA 5TJ9A 1I32A 4J49A 3JTMA 3MJCA 4Q3CA 3E9MA 1BHSA 2P9GA 4OXKA 4PLCA 1GPJA 1ZH8A 2B35A 1ISHA 1KEVA 1XU9A 1FDWA 2YV3A 2AQ8A 3MJVA 2C5EA 5L4NA 4M86A 1ZK4A 2Q99A 2P5YA 2AXQA 2I3GA 2G5CA 4X54A 2FRDA 2O3JA 1FDTA 2E49A 4N5MA 4FBGA 4CMAA 4IZIA 4LW8A 4CQLB 3RC2A 1WDLA 1ZKMA 2QW8A 4AJ2A 1KEUA 3AW9A 3C8MA 5JY6A 1AHHA 4GI2A 4KZPA 4BNFA 1DBVO 1NQAO 3E6AA 3KETA 2Y1OA 1K6JA 2YDYA 1C14A 3CTMA 2PD3A 2NLOA 1L7DA 4J1QA 4CLRB 3GR6A 3ADPA 4GX5A 4WJZA 4FQ8A 4N7RA 3SJUA 5JMWA 4CUKA 2RHCA 1U5CA 3ZNOA 2JD0A 4D44A 3VPFA 3ST7A 2WEKA 1H0KA 2Q1WA 3NGLA 2JFGA 1NAHA 5DOZA 4O0LA 1B3RA 4NBVA 3ENNA 4Q3DA 1SO8A 5CG2A 4YJDA 4GVXA 4Y6PA 4RVFA 4I5EA 1LDGA 3ZHZA 4MIOA 4ND2A 1UH5A 5C7OO 2GF2A 3TF5A 2CF5A 1VM6A 1ZVMA 3NT4A 4IS2A 3LC2O 3GFBA 2PGDA 4QEDA 1Z7BA 1JW9B 3M1AA 3PIDA 4N54A 3ITDA 4PN3A 3CE6A 4NU5A 4ZD6A 4HX5A 4MIEA 3G1UA 1HZZA 3E1KA 2XF8A 1B26A 3NV9A 3GVHA 1PWZA 4IDFA 4E13A 1Y7TA 5B4TA 1NFQA 2IODA 3BA1A 3R3SA 3UN1A 5CDYA 3H7AA 2Y1EA 5L7WA 4BNWA 5HA5A 5I9LA 3K73O 1QLHA 2BFOA 1NHGA 1KVSA 2BF7A 2OGUA 2VQ3A 1Q7GA 4XQEA 2GD1O 2Q1SA 1E0DA 2CUKA 3I83A 1XIVA 4FD3A 1HT0A 3FNGA 2CZCA 1H9BA 1SB9A 3HB4X 4A73A 4FFRA 4CMIB 4IIVA 3DTTA 4XR4A 4AJ1A 4YAEA 4I5FA 2DBZA 4TVBA 1UXHA 3NDJA 4NNJA 3FN4A 5TLSA 4QT0A 5KJ6A 2Y1GA 4EJMA 4UUNA 5JSFA 2BGKA 1C1XA 2BKAA 2VWPA 4A0SA 5G0TA 3VVBA 4E2ZA 1DRUA 4XDYA 4BO0A 3E5MA 4XGIA 1PZGA 2ZB8A 1A9ZA 4WE3A 4GVLA 1BXKA 1HXHA 3TZQA 3WWYA 4NU6A 4QFCA 4XCVA 4J2HA 5L45A 2VUUA 1KIFA 1PZEA 5L4SA 4RZIA 4DQVA 3QWAA 3OA0A 4FPXA 4WEOA 3GVCA 3QRWA 4EW6A 3ZWAA 1LX6A 4XIYA 2EHDA 1BXGB 1B2LA 2EIHA 1Z82A 4CLEA 1JVSA 5FYDA 4LSMA 2B5VA 2QG4A 3TPCA 1IZ0A 5HS4A 2G82A 4IDBA 1R16A 1JAXA 1K3TA 4I1IA 3WGQA 3IIEA 1LDMA 3LYLA 3HSKA 5GZ3A 4FOSA 4UEJA 5A04A 4NIMA 1F0YA 1UXKA 2POQX 4MVJI 3V5NA 3FNFA 4UVEA 1JTVA 1MXHA 1Y8QA 4W7IA 4UREA 5L4LA 2QRKA 2ZKLA 1P1RA 3AI2A 4EEZA 1KERA 4I9HA 3KBOA 3L9WA 4NDNE 1QMGA 4NJOA
chains in the Genus database with same CATH superfamily
2A4MA 4MHSA 4YLYA 3K1TA 2ZB2A 3LBNA 1FLNA 1QG0A 1NTRA 4IKPA 4MRAA 1CW2B 2OP0A 5FXMA 1SAYA 4AS2A 3ADOA 4WCFC 4CM8B 1MRSA 2YVLA 4HRAA 4ZVRA 2HMSA 3ZI4A 2ACWA 3ONEA 4MP6A 2FFHA 3ESBA 3GT3A 1DDGA 1YRQA 4ND7A 3ROZA 1Y8QB 4LXHA 1IXZA 1QFMA 3Q0TA 3ZWXA 4QT4A 2B21A 4L74A 3DTVD 3HJNA 3M3HA 5KYXB 3R9XA 1HX7A 1WU7A 4JYBA 3TOXA 3MWLA 4J7CA 3KAJA 1M5UA 1FPQA 4PXYA 1GYPA 4H31A 3UBMA 2J4FA 1OFUA 1QIEA 3I9MA 1MENA 3NNSA 1BJRE 3OVMA 1ZNZA 2V7EA 3PHBE 2O3TA 4L7VA 4LCEA 1ADGA 3ESQA 3TM5A 3T4PA 4I99A 1T1EA 5HX7A 3GYGA 3P32A 4FYWA 1HDYA 3W6NA 5J59A 1XAHA 3ZHBA 2BGGA 4MB0A 4XR9A 4YDRA 3V8VA 3C3YA 2DLCX 4YP7A 3UAWA 2GBFA 2P9TA 2QRQA 1GT6A 3BT7A 1TD1A 3ONWA 4KGXA 3S28A 1J99A 5LPNA 5LMUB 2ZT7A 1BJKA 4QU9A 2P9FA 5BSVA 1EFPB 5IWCA 3HB1A 2EBFX 2NV0A 2O3QA 4TWBA 1QF6A 3FVRA 4HDRB 2E9SA 1AUXA 4J9UE 1TAHA 4IEEA 4PCLA 5FLKA 3UYLA 4LPKA 3O90A 3Q10A 4KWIA 1JILA 2EKBA 5L6LB 3H97A 2RHTA 5C3UA 3UQZA 4CI0B 5I4CA 4BTLA 2ODPA 1G4HA 4IX1A 1GSAA 3NBAA 3VR6D 3FUVA 1P9OA 3ZK8A 3K1ZA 3NDIA 1AK1A 1R6BX 3AX6A 5TS2A 1Y81A 2JG3A 8LDHA 2ZG6A 2XMGA 3P9RA 4MRMB 2Y27A 2FP4A 2JL1A 3SIPA 2E82A 3ONDA 3LC1O 3QELB 3AR7A 3KJFA 2COKA 2EZUA 3JD0A 1OWLA 4D6YA 4C7JA 4OH7A 3RYCA 3VH3A 2JIDA 3GUVA 2GJ9A 3GCWA 3WL7A 2RJNA 4YXWA 1M1UA 4MITA 4XWWA 1HNWB 2QOEA 5C34B 5HQJA 4RF3A 1NSTA 2IELA 5EAIA 3L7KA 4NMMA 4URHA 3G0CA 4FSDA 1F2UA 4JUFA 2GRUA 3W79A 3QEMB 1WMBA 3GLFB 4ZV4A 5J9FA 3AFOA 4Z5XA 5TQ2B 2F3TA 2B4AA 2C7GA 2G4LA 1DADA 1QUEA 2D7CA 3AR9A 3E7XA 2P3LA 2VDUE 2IC5A 3QBVA 4DLTA 2BGJA 5DIFA 5E1DA 1F2TB 1M8KA 1ZP6A 1YR1A 1Y7LA 1YDFA 2CXXA 2WZQA 5CDFA 4PYJA 4IDGA 1TK2A 3ZV6A 3CVXA 2JB9A 2OD2A 2Q4OA 4LQ4A 1NSFA 2VF5X 1ZU4A 3FLMA 1E6UA 1H0HA 1R5JA 1XKXA 4Q18A 4MWZA 4WKOA 3GYBA 3O2JA 3C4JA 3SYRA 4B35A 4D41A 4D98A 3HY6A 3KLMX 1E1CA 1OLSA 3DQQA 4DMFA 1YQWA 1VIMA 2CNWD 1BSVA 3HP4A 2ZWPA 3FG9A 1QYVA 4MKRA 1DC7A 1CUCA 2AE1A 3U4HA 3CE9A 3I2FA 1MN6A 3WMRA 3PUIA 5AW0A 2EEPA 1B6SA 4IFBA 5LP6B 1KOGA 1LW6E 1RTKA 2CYAA 4LHWA 2YMPA 3PENA 4KX3A 3RS9A 1DG1G 1Q0HA 4UU0A 3ND9A 3A27A 3OIUA 3BTOA 1J5EB 2AIRA 1VRCA 3KJZA 1EFLA 2GYYA 2HQRA 3DTYA 2XUHA 1G20B 4FD2A 2V7TA 2JIMA 3GA5A 3GCXA 4TLBA 1AMUA 3HJRA 4XRRA 1ZGHA 2Y0DA 2FKAA 4OQMA 3I9JA 4K9KA 3BWYA 4D9FA 4B6OA 1FRNA 2OO5A 2QLJA 2ZROA 4FGUA 2ZU0C 3VTFA 1Q44A 2R44A 1EFCA 4Z99A 4RGYA 4BTEA 4N47A 4AJKA 3BH0A 4JLSA 3ZGOA 3JWPA 5M2QA 1YR7A 2HMWA 2RHMA 3B51X 1Z8DA 1M2HA 1XNGA 3ONNA 2HPVA 4RHCA 1C1XB 1XRRA 2YZGA 2BJVA 1LJLA 1W1UA 3QG1A 4IWNA 4PZDA 1ZGJA 3HPQA 3L8MA 3O26A 4KWTA 1EVZA 4MRPA 3NFRA 5DHAA 5I3ZA 1VIYA 3PE3A 5BVGB 1DJLA 5JAMA 1OASA 1C8BA 2NAFA 3HRHA 3JQ9A 4QG7A 4BMYA 4H27A 4JI3B 1PVOA 3HY3A 3UQYS 1GAJA 3QKTA 5FUBA 4EY5A 4YPOA 1ZK0A 1X7YB 3O9MA 4HWSA 3ESDA 3FH0A 2BGNA 4RA9B 1RXUA 4FI3F 4FOPA 4NBUA 4GAEA 5DO9A 3UF0A 5L53A 1W73A 3L8HA 1TUEA 1SXJC 10MHA 5DN6A 3N0TA 3F3MA 4LXQA 4P34A 2PEYA 1JFSA 2R7MA 4CCWA 3ZGZA 2ZT5A 2C7BA 1GTL1 2JZNA 3JSXA 2ERYA 4JFRA 3AJ9A 4L4XA 3V4FA 4E5SA 3AF1A 4EY3A 2CDBA 5LJIA 4K26A 4RA6A 4QDZA 4S0ZA 5AR1A 5DM0A 1U8CB 3IQGX 2DCUA 2QZ9A 1RLTA 3ZXIA 4P3XA 3SYLA 3BVPA 2UZIR 4N9WA 3BREA 3HYLA 3LECA 3VQTA 3RRYA 4GKBA 4B5KA 3P9NA 2P27A 5C4GB 3ADCA 1K7EB 2AYZA 2II6A 2FE4A 4TQ9A 3EXHC 4EITA 5LA6A 3DMTA 2BAGA 4PLVA 2WTAA 4QQFA 5DGDA 3JASB 5IPFA 4R40A 3W3ZB 2GERA 3NJ4A 1H94A 4F2WA 3ZHVA 4Z7JA 2I87A 1KQ3A 4KN8A 2OV2A 1R3DA 3TQOA 2AOWA 4IUDS 4LRWA 1TW2A 1X0VA 1H1LA 1QDEA 3LGSA 4JBLA 3OKAA 5LMZA 2GR9A 1D1QA 2XCOA 2OCDA 1E9DA 4PLGA 3NJRA 2XBLA 2XITA 3NIBA 4NCJA 5HFNA 3R7DA 2F1HA 3RW9A 1V35A 2NNWB 2WP0A 3MINA 3A4NA 4R6WA 1QGUA 4AMGA 2VSQA 3EXHB 2TMKA 4WZAB 2B30A 3CLHA 4WGGA 3KL2A 1J24A 4TTAA 2WWHA 2HC9A 4E6PA 5CXSA 3DW3X 3INNA 5KJ1A 5AW4A 1GQRA 3TSZA 2WM2A 4H08A 4OY3A 1E9FA 4E2YA 3OIYA 1PS9A 4FYIA 1CR0A 1HL7A 1AY0A 4K1LA 3TWOA 3MWEA 4OUDB 1JSZA 2PMKA 1MJGA 3JR7A 1QP4A 3R44A 1VBKA 1PR0A 3G6KA 5J2UA 3H2HA 5EPEA 4BX2A 3A3KA 1GR0A 1X7ZA 1QC5B 2CVZA 2CKDA 2ZYHA 3H6KA 4H1WA 3NTQA 1CFJA 2FZLA 3SJCA 1G42A 2VF7A 1RFGE 2R6GA 3GJ5A 3EGDB 3WKBA 1YH3A 4YCCA 3ZKWA 1I7NA 4A0FA 5BUZA 1ND6A 2AR0A 1TAQA 1T2VA 2BISA 3NHJA 4IXDA 1RAFA 3PIIA 4IQGA 2GN0A 2AVDA 1KWKA 1NQUA 1NYLA 1AH2A 1YCHA 3OX2A 3EC2A 4P80A 4RH3A 3R0QA 4A7PA 2FR0A 4KU4A 4TYQA 2OZLA 2GZSA 4JBHA 5DLEA 4WKBA 3UUEA 2RC5A 3EGWA 1IWOA 2EFYA 1L5LA 3PICA 1EA7A 2OQ2A 2P65A 2XDYA 2RKOA 2J6IA 3NIGB 3P0FA 2R8ZA 4CCSA 2P2DA 2EJCA 1VBFA 4I4CA 2E5FA 4UZFA 3GOHA 3W2TA 4HPJB 3AU8A 1RRVA 4ZYXA 5ALTA 2GVDC 3GNLA 2YCBA 3TLGB 4EKGA 5D2CA 3SWWA 4M60A 1UJ4A 4IQ0A 5K3SA 4C7KA 1ZRSA 4ENTA 1F7VA 4B7CA 1PGQA 1N78A 3OKCA 1UM9A 2C8VA 1UOEA 5C37A 3L7BA 2ZIZA 3GCGA 4UUOA 4ZARA 5G3YA 2Q29A 2R6ZA 3T1OA 121PA 3RVOA 2OP1A 5C2JB 2W5UA 4Q1AA 3TQIA 1US8B 1MB0A 1Y7IA 3CO5A 1JIIA 3NT5A 2PJUA 2IDKA 3GJ8A 3FTQA 3LWZA 4LMAA 2AX3A 1Z0IA 1BRTA 1JFFA 5H1YA 1SD2A 2CVPA 4S1WA 5LLSA 1KVUA 4ZJZA 2LNDA 3ZJYA 5CTJA 2ECPA 3HSSA 1REQA 2IV3A 4FILA 1HH4A 1T4DA 5ALOA 1YKGA 1OREA 4RJTA 1CIJA 4AUEA 4JUDX 3GFVA 3F98A 2OFPA 1LBHA 3V4SA 3A1FA 1ZEJA 2R8BA 1TYEB 2GSWA 4FM9A 4KE9A 1X9HA 1HI9A 5ICEA 3DNMA 5HFJA 4B6EA 3GJZA 5ES4B 1CB7A 2FMUA 3O2NA 5BR1A 5D7BA 2CLLB 4LZAA 1II8A 5FWDA 3VSDA 4J16C 3T5AA 4MQBA 1Z62A 3DDNA 4KH1A 4KI0A 3NMUF 1YZUA 1QZ3A 4KJZA 3BXFA 1M6EX 1KVQA 4UTRA 1OKKD 1RRFA 3Q7TA 4H9GA 2X22A 4DMHA 1VL0A 4ZCIA 2O59A 4BMOB 3PYMA 1GLVA 3A9VA 1L4GA 1J0DA 1IY8A 1L6RA 2HL6A 1AO0A 4ESVA 1BEZA 2CK3A 3L6CA 3WDSA 1CKEA 4IDOA 4LXGA 3NIWA 4QPPA 1OH5A 4PC3A 2AFHE 2COEA 1F0PA 4MHOA 2AMFA 2A33A 4D82A 5HKBA 1EESA 3K9LA 5IXYA 4TQUS 4F8YA 5HYVA 2VBGA 3PC2A 1KSGA 4GBED 4Q3LA 1OXBB 1NE2A 3SFZA 1NXQA 4PLFA 3SU8A 4B4WA 3BGWA 1Q7EA 2GMWA 3WHIA 3AF3A 5U1PA 3BF7A 3IIJA 1N6KA 2WIJA 3QMPA 3P0RA 5KREA 1JG7A 1T36B 4N6GA 5DI3B 4K5QA 1EWQA 2GX6A 3ASZA 4ZOBA 2JAPA 3DOHA 5ALQA 3G2IA 1F2UB 4R05A 5BQXA 1YAJA 3F7NA 1K27A 4MGKR 2Q2QA 3DUWA 4LRSB 1EXMA 2JGEA 2WAAA 4JOBA 3VHQA 1DVRA 2YWBA 4B40A 1ENZA 2FSIA 4OGWA 5DTJA 4ALIA 1PZHA 5IT9A 3A4TA 1XQYA 1LS1A 4PBRA 1AGXA 4OJYA 2WIFA 4U7PB 4PLWA 2GM4A 1ZIXA 4NF2A 4P0PB 4JJGA 2KW5A 4D6PA 5I7OA 4JBYA 2CMKA 3MK31 3HN6A 2QVBA 1FC0A 1XXHE 3UKJA 2VHJA 3ZS9A 1BYUA 3CRMA 3KHUA 2Q3EA 1E92A 4EW3A 5KJFA 5KO2A 2OK8A 4DMMA 2CMGA 2QRZA 1HYEA 2VLBA 4JI4B 4RY0A 3ENQA 3WK8A 4TV8F 4KUGA 1UMKA 4DT1A 5NLLA 4RDIA 3W5HA 2C61A 4MR7A 3RVJA 2ZYGA 3CH5A 1KJ8A 4LN1A 4D0GA 5FWNA 3NAQA 2BMJA 2WB4A 2Q5JA 4G0OA 4NWIA 4JLVA 1GJRA 1TYCA 1DTWA 3N75A 4RPKA 4EP1A 1P1BA 5E6SA 1PGNA 1T4CA 2QI9F 3R7WB 4UBKA 1WZEA 3FRIA 4JJZA 3GJ3A 3Q9NA 3NOVA 4HK4A 1B15A 5K0ZA 1WZIA 5D85A 4EENA 4ZCRA 3ROFA 2QD5A 1A77A 3AMVA 1ZA1A 4TKMA 3G13A 1P77A 3ACBA 3F3SA 4FU0A 1ZJ4A 2HUPA 2QMOA 3TGPA 3DOOA 1QH9A 1FRVA 5T67A 2ZIVB 3LNTA 4BZZA 1GAWA 2WJJA 4NBWA 3J80A 3BCUA 4IIYA 2WD7A 2X1LA 2JIPA 2OGTA 1Y42X 1VXOA 3SSAA 3BD9A 4KIFA 1NW3A 4NPHA 5FV7A 2GPTA 1CZOA 1Q0UA 3AHFA 3KZ1E 3LLUA 3JVEA 4AT1A 1NVDA 1RLUA 2FSGA 3QKRA 4PR0A 5BSEA 1U0OC 4LV6A 2V6FA 3PJDA 1QS0B 4L85A 4U6SA 2FPNA 3RVLA 1E7QA 4KHZA 4UAUA 1A69A 4IQFA 1XWWA 3Q3VA 3D6MA 5LZ5A 1WABA 4PYKA 2QN8A 3E9RA 3OPYB 2XNDD 5FL3A 4C6TA 4JIMA 3PRHA 2GO1A 4JXJA 5JDIA 1NHWA 3NUGA 3PFHA 3QOXA 4Z2YA 5GOZA 4ZAYA 4QU5A 1MIHA 3CGGA 1PP4A 2QLFA 3KU4A 3PJEA 2QBYB 1P1IA 1QDUA 4AVYA 1DV2A 1KYQA 2PVCA 2BTEA 3FDIA 5JRJA 1IBRA 2E85A 3ZBTA 1G98A 1E18A 4HGZA 2F8LA 1BDJA 1UFOA 1UL1X 2H7VA 4ZOLA 1XVUA 2P9CA 3LNCA 2C7QA 4DV6B 2DMRA 4NZ9A 4CTNA 4MOWA 4EGQA 4B3MB 1DDOA 2C3YA 4GZ3A 4P7GA 5D8DA 5E6RA 1JT2A 4MDHA 3GQBA 4E51A 5K5EA 1NP3A 3HNRA 2QBYA 3ZWMA 3RKSA 1QGZA 1U2PA 3AEZA 5CPBA 3GHHA 2GOYA 1QK5A 1CIVA 5KI6A 4QZVA 4DR1B 1NW7A 1ODJA 4KXUA 1B7GO 1AXEA 1VHWA 1PKEA 4UHJA 1G8JA 4BQOA 4C5AA 4CM6A 1Z7GA 4B32A 4NZZA 3KKPA 3E5NA 2HF9A 4QODA 5J4YA 4A0QA 2C42A 4Q0MA 3S2EA 1I1NA 4ZC1A 3QJGA 4KB5A 2ETXA 3ET5A 4O4IA 3USCS 3VSAA 3RJ9A 1YRLA 1CY0A 3GV0A 5EZ5A 3UMVA 1X1TA 3JV7A 4XWGA 1P7WA 13PKA 1T3ZA 2HQOA 2RAUA 3A7DA 5FOWA 3STTA 1U9IC 4NJOA 4KIUA 1H6AA 1XT6A 1WQ3A 1S2NA 3J7TA 1Z3IX 2GDJA 4U4AA 2W2QA 3CX8A 4QOFA 5AH0A 4YQZA 4A2CA 4YHBA 5EXDA 2PKCA 1IC6A 3K30A 3VISA 3JS5A 2IPOA 2GHIA 4LQLA 3SFTA 5GIPE 2G1JA 2ZM6B 4UPDA 2YHIB 5CNIA 2CHEA 5LUBA 3C7DB 3EFEA 3LF1A 4GPZA 5HZHA 4IICA 3BWDD 3IL2A 4QXPA 5ICFA 3TG2A 1YS4A 5A71A 1EK6A 1RMYA 2VPQA 3DXFA 2R8EA 3COWA 2R00C 3OWHA 5BORA 1TCCA 3CN7A 1Z2PX 2V0CA 4RD1A 3VPCA 3BTUA 1Q5PA 3Q12A 2G17A 2XDWA 3PD7A 2I5PO 1UDCA 3AF5A 4HVAA 4JYZA 2XEDA 3IMCA 5LZ7A 8MHTA 3GDHA 3PWKA 1H23A 2BFEB 4G24A 4DSNA 1SUIA 3G8CA 2OPHA 2FW6A 3FMVA 2OBYA 1E3SA 4LJ6A 4OHRA 2C4KA 3RODA 4QJIA 1ZOSA 1AKQA 3T7AA 2B99A 3GLIE 2PL5A 2ZRMA 4GX1A 3LQFA 4HWTA 5HKOA 2UYYA 1U0BB 1NXXA 3DEHA 8ADHA 1Y1PA 1Z17A 1KP9A 1D2AA 2ZUVA 5FX2A 1CYDA 2VWGA 3KKNA 3H0EA 3SOPA 4OK6A 4KMMA 5KNBH 2G8NA 3EB9A 3EVBA 3G17A 2JD1A 4KUEA 5FBQB 4ZJPA 3CF4G 4M98A 2X6TA 2F7SA 4C08A 4JI2B 4EHFA 4RK5A 4CMGA 1RBMA 4BKMA 2ZRGA 3B3FA 4A9AA 3K4HA 3SVTA 1FUIA 4JT9A 4RTNA 3E5RA 1EX6A 2CUNA 3EGOA 3R0JA 3H5NA 1HE1C 1UM9B 3VJRA 3SMVA 1XPJA 1CEQA 2WHRA 3GQVA 1G2QA 1PYGA 2XTMA 3QXGA 4K7JA 2VXBA 3U7HB 1TAGA 1EEHA 1E3LA 3GA7A 3E23A 2VZLA 3KQUA 3QV1A 1QYCA 4ZQBA 4BVKA 1TE2A 2DE0X 4CMEA 2IXFA 3GJ6A 4HRYA 5ESDA 1REQB 1U6IA 2R4QA 2YIVX 2ZIFA 4AZTA 1QE3A 3NXKA 3PGVA 3S1LA 3WZLA 1CUJA 1E7SA 4HDNB 3USES 3VYVA 3MBOA 4YT2A 3BD8A 4RLQA 4XX1A 4BMSA 2ID9A 4CMKA 5EUCA 1SC6A 3KHKA 2FWNA 3QI2A 2B8JA 1KNQA 1A9QA 4R2KA 3FLEA 3SDZA 1V8BA 3KLBA 3W8NA 4OXYA 2P9YA 3GPLA 1C8LA 5HZKA 4CBVA 2FSPA 4B46A 2Z9CA 4GQIA 4R3WA 1H2XA 1QG2A 1BDBA 1NG1A 3W3AA 2VXCA 1DV1A 2WINI 1UDBA 4J0DA 1L4UA 2GETA 2PH3A 4OP2A 3FOCA 3PU6A 4YRQA 5C46F 3E9EA 1CP2A 2Q4RA 2PZEA 3IO5A 4A1OA 2UXDB 4EPXA 4LK2A 2BZ1A 1K7FB 1G2OA 2JGRA 4XE5A 3UJNA 3NIFB 2GK6A 1BE8A 3RR2A 4ESOA 4I3FA 2PDAA 4KL8S 4MHTA 2ZYAA 1B00A 1GPDG 1QGYA 3SF0A 1DWQA 1E7WA 3A3OA 4DE5A 3DE4X 4K9SA 1PZNA 3U2QA 4LX0A 4M1ZA 2WRZA 4IRXA 3C7TA 2HCTA 4POAA 1EH5A 1SBNE 2V4UA 4UUPA 5B4UA 4BC0A 3ABZA 2R8XA 4JL5A 2HJSA 4F45A 4IBOA 1W52X 4AB1A 5ECGC 1AMNA 3B6MA 4ZYWA 3PEVA 1I6KA 1GCAA 4GL2A 5ALEA 1NBAA 3MQ2A 1JSXA 4WFKA 1T6YA 1LLQA 5ABPA 3MAAC 5EJ4A 5HRAA 2AXNA 1QGAA 3MWDB 2XCRB 5DYTA 3D6AA 1IXSB 1T2NA 3DNFA 5AHOA 4LRTB 1SKUA 1E3EA 2IYAA 3ZCSA 1W5FA 1G3MA 3AKDA 4RETA 1QTIA 1USUA 1N0WA 1QOQB 4P93A 2SICE 2VPTA 3TPZA 4ECEA 4HLQB 3II6X 4M76B 2XAAA 4V0KA 4MV9A 2G1AA 1HFWA 1SBQA 2V5VA 3TRJA 4BNKA 3QMVA 1TMYA 1ISIA 1JR3E 3A2KA 1E3MA 3M9WA 4AKEA 4YBZA 3N2KA 1ZLXA 5LNK6 1W44A 4IJWA 2WWVD 1KFKB 1B6GA 2EFDB 2Q5LA 3AUXA 3U44B 1BXRB 1EDOA 1I36A 4XQ9A 4HCJA 4EI2A 2VHVA 1YBMA 1ESCA 3FMOB 4WA8A 4UM8B 2PZJA 2CXUA 3AHEA 1MZPA 1U2DC 1BD4A 1OI7A 4Y9UA 1Z0UA 1PK7A 3ANXA 3BMXA 3JQEA 4A92A 4W5HA 1IB0A 3PKZA 2QU8A 1JXAA 2VPYA 1OLXA 5AI5A 3L7AA 3ZWQA 2B6NA 1UR5A 2QLBA 3CVOA 1EUQA 1C1HA 1DG9A 2O2GA 1C4OA 1UWVA 2WVAA 2P9ZA 3HY4A 2FUNB 3IBYA 3NHRA 3WZ2A 4DIFA 1C7QA 1OCEA 1Z8FA 2CEAA 2FCAA 2NVBA 4L51A 1GTZA 3SMQA 1LH0A 1BFDA 3BL6A 5K8JB 1SWWA 3HKDB 3C8DA 4M0UA 4CZ2A 3K53A 4UEWA 1JHDA 1LPAB 3O4GA 2WNHA 2RE8A 3ZX4A 1BCSB 5FOTA 4DAEA 4L5AA 5K6RA 3QSYA 1L8AA 1NOJA 1ZUNB 2J9XB 3BK7A 1P5HA 2RKBA 4QUKA 2NUTA 3SAJA 3T99A 4IOLA 3ZOKA 2XYVA 2JGDB 3EE6A 2JHCA 3RROA 4BO8A 2WJ6A 3GBPA 4RK7A 5KWJA 1IG3A 1USGA 1X7GA 2A9QA 2QD2A 3KEQA 4QJ5A 2G04A 4LFBB 1FFXA 2P7IA 4RMIA 3LPMA 4C05A 5K8LA 1UPXA 1JIQA 2IW3A 1GZDA 4PBSA 4HWOA 4Q9DA 3EK2A 4YDQA 4P4SB 5AHXA 2QRVB 3DWEX 3FYUC 3SC6A 3D4NA 1Y0BA 3MUOA 2H5LA 4P1ZA 2F2TA 4WECA 3W5VA 2QZJA 2IHKA 3SQWA 1JR2A 1ZIOA 4N4AA 1GARA 1MCZA 3OIGA 5L3QA 4JR1A 2CMHA 1CG6A 1XKQA 4FFVA 3DE2X 1XWFA 4LWZA 3KDPA 1OC2A 4HUQB 2B5WA 4DLZA 4GGOA 2X4DA 3CSDA 5DIZA 5KTKA 2R6FA 3ZY4A 1BHJA 3EFBA 3GGGA 4PFQA 4YASA 2OE2A 1Q20A 2E89A 1JBQA 4EMUA 2EERA 3WI7A 1Z5OA 5DMHA 2I2WA 4QL3A 3CUTA 2JZOA 3EWIA 3ISTA 1SVKA 3VU8A 1AN0A 3BWMA 3O82A 4US1R 2PKQP 3B5IA 1LNSA 3GK3A 1XDSA 2XB4A 4RH0A 5D5QA 1I2ZA 5JBQA 4PNPA 2XKKA 5B1IA 1I6MA 1PL0A 2UZ3A 5BN5A 1LUAA 1BS1A 1OE0A 2FCRA 3ED1A 4HVTA 5E9JA 3U0BA 1IQRA 4RF4A 2FZEA 4B33A 4R5HA 1Z2NX 2GVNA 3NVKI 2ZANA 3BZWA 3H2SA 2R47A 2XTJA 3B9BA 2R7KA 2FUG6 5BWOA 1EIZA 4BNZA 3TKYA 3TTTA 1S8NA 3G1WA 2Y3IA 1E1LA 1IEVA 1NF9A 3LHDA 2WAOA 1FOEB 3HYRA 3RIHA 4PIVA 3S4YA 1K8YB 4I14A 3ZGYA 5IKEA 4BV9A 5JZVA 4OQPA 1TZJA 3WRXA 3OJCA 4AG3A 1L3CA 4A15A 4YJFA 2M32A 1DHTA 2GPAA 1RM0A 3ABRB 3VOTA 1E3WA 1J5PA 1C0KA 1YS9A 3G85A 3WV4A 2Q46A 3WA7A 3STUA 4B9AA 1Z83A 3HACA 4RS3A 4UNRA 3RS7A 5A4AA 2IBMA 1ESEA 3LOUA 1H8ED 2NVOA 2IIBA 4LVUA 3JWEA 1LB1B 3H4IA 1R0ZA 4P3NA 2A1UB 3RLIA 1P5ZB 2PT6A 2BRUC 4M1KA 1YR6A 4EARA 4S05A 4TS4A 2CDAA 3EY9A 1ST2A 1RBZA 4QYXA 5GONF 4FCVA 5JSYA 1MHPA 4DPKA 3ZD9A 1X7ZB 1LY1A 4JXZA 2BY4A 3AR3A 3I6MA 3PQCA 1DPGA 4WACA 2CLDX 4X84A 4OSOA 5F77A 4DCCA 3H4VA 5DGHA 2XCSB 5JSUA 3MCWA 4XVRA 3JAMA 4H1VA 3PBKA 1NR1A 3VO8A 5E9WA 2FSVA 1RPTA 4QGGA 3SE0A 2N0SA 1M1YA 1YZQA 2VDQB 1ZCAA 2DWQA 4ZZ2A 3V7WA 4A8PA 5C7YA 1B23P 5FOVA 1ZOPA 4WK0B 2WICA 4I3HA 1IM2A 4OYRA 3N7TA 3OOEA 4JOSA 4KOAA 4LYJA 4UVHA 3RREA 3TMAA 4I1PA 2R3SA 5EIBD 2XIQA 2CVHA 1S3IA 2QGNA 2VPXA 2W83A 2KI5A 1SUPA 5CEFA 1JQAA 3H11A 4B3GA 3S2ZA 4DCNA 4E5YA 2V59A 3LCCA 4HAYA 2B25A 4TYWA 2HMVA 2HSZA 4O2AF 2JLZA 1KJWA 2XB2A 1A5TA 2VYFA 3REQB 3S8EA 1K9SA 5K0NA 1ZOIA 2QTMA 2HN9A 4LBWA 1ULSA 4L2IB 4CCYB 4IV0A 5DHFA 5AUOB 2C8KA 2J3HA 2HK8A 4ERNA 2R25B 4UOQA 4URWR 1IHPA 2GTIA 2YFKA 3OG9A 2ZJ0A 4V3BA 1JLLA 3QBJA 5KHLB 3C6QA 4UU1A 3NIDB 4JBWA 1BOFA 3CIOA 3I92A 4YRJA 1T5IA 1UBEA 5AK3A 5HRCA 3NANA 3DHNA 4K8OA 5TVKA 3SJBA 5KC9A 2JLRA 2WFMA 1H9CA 1RXVA 3A6FA 5G1NA 3T06B 2XMSA 1V4VA 4C1NA 3T7DA 5AJZA 1HA3A 4JLBA 1COZA 1BA3A 1T1SA 1R6TA 3EEFA 2FY8A 4UM7A 3HJCA 5A4JA 1CWUA 4JXKA 2R5NA 2IRWA 4YJ2A 2J3IA 3B38A 4DARA 2BEWB 1V1RA 1KNXA 3EP6B 3M2TA 3EMBA 2DU8A 3MXTA 4OV6B 4TL7A 4C14A 3AHCA 2X8JB 2B0JA 2PFGA 3PHCA 3L8YA 4TS3A 3P0IA 4H18A 2FEAA 1SVMA 5FFNA 4LX8A 4W4TA 5KHAA 3VJLA 5K0FA 4KPUB 2ZPAA 1RCUA 1P61B 4DCUA 1L7OA 1OFHA 2Y92A 4C78A 3MLEA 4BNXA 1RXSA 1ZA2A 2Q9CA 2HADA 3R0VA 2C3MA 3QXSA 4ZWNA 2RHBA 4BLSA 3K94A 2ZUBA 5CB8A 1I14A 3AV3A 3ORSA 4IUCS 3WOVA 4F8EA 4K2AA 4C22A 5GINE 5EHNA 2PRSA 2JDID 3ZX5A 1XMOB 4PLPA 3WJ7A 4ZCQA 1O97D 3TEJA 1M1NB 4WLEA 1NXTA 3K5IA 5IAKA 2BEKA 4N5HX 3WLJA 4B0PA 4FZRA 3B1FA 3S1AB 4FDAA 5YASA 1O96B 4O3MA 4GZ6A 4TT3D 4HPWA 1PJSA 1E32A 5HEKA 4WZZA 5DXFA 5AWFC 3KV1A 5C0OE 4N03A 2O2XA 4FT4A 3FMPB 4CG2A 3DYBA 4EGCB 2BR5A 1YACA 2WKWA 4LI3X 4B6FA 3K0BA 2FPPA 2JH3A 3DR5A 1KZYC 4XI9A 1QQ6A 3PD1A 3DE0X 3VR5A 3ZE8A 2W6MA 2BWJA 1AQIA 1TUIA 3AZPA 1RNLA 2I34A 2D3TA 1U0JA 2NW6A 2YBEA 4Y0VA 4BCDA 4DLVA 5BV8A 5J58A 1OBVA 1M72A 3AG6A 1N8SA 3QPUA 4J90A 4BGDA 2IS6A 2BTQB 3A2MA 1DQZA 4C7BA 1MX5A 3D0OA 4WOPA 2G9VA 5FBWB 3SEFA 3L82B 3NHUA 2ZRPA 5E7MA 1PFWA 4PGAA 2O1XA 3C41J 2XHEA 3DONA 5THXA 4PTYA 4QLBA 2O19A 2D0OB 4HBZA 2FW8A 5IDQA 1J2JA 4EYOA 2AVNA 1U7TA 1IM5A 1BH6A 1VLVA 4OK5A 4R8RA 3ZHOA 1JUDA 2P2CA 4R16A 1U1IA 1WEKA 4TV9B 3OIFA 5I8ZA 1QMPA 2H85A 2VHWA 1U5BA 3BFKA 3FYHA 3WL3A 4I4TA 1Y8RB 4BRZA 2DQ4A 3W0LB 2NSLA 2FMKA 2FEMA 1GZHB 3PGXA 2WA2A 3KALA 5IARA 3T3PB 2R87A 1NLZA 2YJGA 3PT5A 4OHPA 4PZEA 3RK1A 2P9HA 1V3TA 3UW1A 5KPDA 2IHYA 2VT3A 3DLIA 1E6MA 2G25A 2E4UA 2LGJA 4F3RA 1DO2A 3WIVA 1LBSA 4FJ0A 2WQ7A 2ZRHA 1HDOA 3UW3A 3PV0A 2AEMA 5CVEA 4QLAA 4H3VA 3B9RA 3DA8A 4GR4A 3V1UA 3IHTA 3VC3A 3DAPA 3GZTB 3GCZA 5HBRA 3A4VA 2A9FA 5GWXA 2Q8NA 4M0PA 4DREA 3IAM1 4D3ZA 1G21E 3OTIA 3OUUA 2ZCJA 4FQ7A 1NDHA 1AKYA 1ECCA 1Z39A 4ZEOA 2CD9A 4X41A 4N6NA 1KR2A 4DLRA 3L84A 3FZEA 2VEOA 4UU7A 1UCFA 3E8XA 3CF0A 4FBLA 4U7TB 5ALZA 2VK4A 5BXQC 5DYGA 2JGIA 3ZIUA 4B3TB 1YHNA 2AXEA 1DRWA 3CA8A 4JB2A 3I61A 3JWHA 1DTEA 3VYUB 4I9NA 3OJFA 1IVSA 2PANA 5TY0A 5TVOB 1SU7A 3U3DA 3TVYA 4E5PA 5G41A 1ZD2P 2I7XA 2MSDB 3U1VA 3C16C 4Y9DA 3I37X 3JYQA 2PYIA 4QWMA 5EFZA 3R6WA 1YGPA 5AK6A 2AJDA 2CFRA 4JT2A 3VR5D 4YC7A 3I2KA 3I5MA 1H6CA 3MWJA 3PNQA 3IJRA 4A26A 4BQQA 3AERB 1I10A 3GFQA 5JCOC 3CN9A 3ICVA 2A7XA 5KOYA 3ETNA 1IVYA 4YCMA 5F2EA 1MC8A 1Z29A 1JFVA 2Q7XA 3RS8A 1EDEA 4REQA 1GIAA 3ZWNA 1KQPA 5BP7A 1V11B 1NZDA 4B48A 2Q1UA 3WX0A 1KI8A 4IZHA 5BSHA 3NALA 5EPUA 1VIVA 2H9IA 3H9GA 1GA1A 4ZAZA 1X94A 3AILA 4R01A 4QUAA 1I7BB 2AG8A 3OPNA 1OT3A 1RIIA 3HA5A 4JCOA 4B47A 5CPFA 3U4IA 4PANA 3GLFE 3ZBUA 3AHJA 4D79A 4OATA 1RHQA 5DLQC 4CM1A 4ZCTA 4CEJA 4H1TA 1TGYA 1LSSA 2PV0A 2D5LA 1KSHA 1E5LA 4NPAA 1YZTA 2ZTSA 2BFFA 5K6TA 1BVYF 2O0KA 3OQHA 2JW5A 3FYCA 3VZQA 2OHOA 1ZSYA 1FFGA 1KH1A 1UK7A 5JNLA 3DZJA 3H5AA 3MCVA 2FN8A 1VZ2A 4MVJF 1L7PA 1SQSA 1LXCA 1EBBA 3C7AA 3EVFA 3QEOA 2FSUA 2GEUA 2UDPA 2IDZA 3N58A 3RRXA 3QM1A 4FFNA 2O1EA 4PXAA 2ZBGA 3ZHUA 1B16A 2DAPA 1VIAA 4P7FA 3KQSA 2ID8A 3EC1A 3SN6A 4RPGA 4XB2A 4ZT2A 1ML3A 1P19A 4AW9A 2C5GA 1MNAA 5TPZA 2NU8A 3GPDG 3WHPA 3HUUA 1MG0A 4L0DA 4DWVA 3EPBB 1G8GA 1WRBA 2CDNA 2DQYA 4E31A 9GPBA 3A37A 4A1FA 3MRSA 4YIKA 1NPDA 3DDHA 3VM6A 2K4MA 1ZUD1 3D2CA 5EEGA 1HPLA 2WWFA 3HU3A 4S1TA 2IKSA 3EBLA 3W77A 5IAOA 1DEXA 1GQYA 1Z2OX 1HYQA 3MXOA 4BP3A 2P90A 2QV7A 2PUDA 4AWBA 1M1YB 1NV9A 2BLLA 4GSYA 3BGOS 3LVBA 4YMWA 1E69A 6REQA 5A9SB 1TQDA 4XPIB 3JY6A 1RZVA 4HQRA 2AQHA 5JAZA 1NN5A 1RC8A 2IUSA 2I4TA 1XMPA 1EP1B 2C7VA 3AR5A 4CN8A 1UDXA 4Y2VA 3FHTA 4ZFNA 3R3HA 2HSWA 1IJEA 2BM0A 1VI2A 4Q82A 2VKQA 1O77A 4OP3A 3H0WB 4EF5A 2UYGA 4M8KA 4DIEA 1ULTA 1KYVA 5I8PA 1C7IA 3OZTA 1CDOA 4XGNA 5A9SA 4OI0A 2W43A 1X1SA 1OAOA 1VTKA 2FWBA 1P6XA 4XGRA 3HVIA 3EPHA 3G2PA 2OCPA 2PPVA 4DDKA 2QM3A 1SU8A 2JKZA 3IELA 1OTXA 4JX8A 3JQAB 4EHDA 2PTHA 1JYEA 3A2LA 4IIJB 3KKOA 2C04A 1WKCA 3CF4A 4HZIA 5IC6A 5JAOA 1L5ZA 2P78A 2R8RA 4FDTA 2B7CA 2OD7A 2YFHA 3CZQA 4MGIR 4ZVPA 1QFZA 2HLNA 5ESWA 3S7TA 4GXTA 1FNDA 1D0SA 5K8IA 2CW5A 4HVLA 1QVRA 1DFGA 1TEXA 5P8WA 4RNDB 2A5FA 4GG1A 4MZXA 5A6SA 3K71B 2BP7A 3CKKA 3EUAA 2VK2A 3K0FB 4QUEA 3UMBA 2ORIA 2EJWA 2PRJA 3K2IA 3ZV7A 2P67A 2ZRNA 4G1CA 3NS7A 5JYCA 1HE5A 2B4YA 2PSSA 4BMVA 4C88A 2IY9A 3Q2IA 3SBOA 1J2UA 4JAVC 1MABB 2REBA 3KKMA 3N28A 3I5AA 2RB5A 2ZWMA 3DKVA 1BJTA 2FMHA 2OQVA 2C2KA 2PUAA 1T1IA 1IJKA 2V6MA 1OV4A 1W76A 2BFDB 2OEPA 3BYZA 4YQYA 3RKRA 2C4WA 1Y8RA 1GV1A 1XTJA 4OU4A 4RJ2A 4PR3A 3TVDA 2ZKIA 4RHUA 2R6CA 1GRVA 4MVJM 2I1WA 4R8MA 4BNHA 1GYRA 5TJHA 2RHOA 3PA6A 3T94A 1L4MA 1T2DA 5I7RA 5IU6A 2HEIA 5AKJA 5T6BA 1MFPA 5BR7A 1IQ0A 1I2BA 3PC7A 5AHKA 3N6VA 1U7ZA 3NGXA 2WE7A 4PRLA 3TH5A 5BVHA 2WSLA 4CIWA 1OXKB 1EA5A 1EVIA 1L8LA 1SCQA 4AY5A 2IZ5A 1ZVKA 4DNXA 1KYXA 1T3LA 1F06A 2PU5A 2ZB3A 3PNLA 4YRNA 3IQHX 2GYWA 3S1AA 4Q93A 4G01B 5CHYA 4KVGA 4PG7A 4I1YA 3I5YA 5A02A 4FSXA 3Q7IA 1CIPA 1CHNA 5GOTA 5EJ5A 2XAUA 2D1SA 1MEJA 3BHJA 4QEKA 1KDRA 2RHLA 3DMNA 3D64A 1YB1A 1G9XA 1PEYA 1BDHA 1BGWA 1X8JA 2I8CA 2GPBA 4KR2A 1P2DA 1SBCA 1MW9X 1XEWX 2JFXA 2NAPA 1NBOA 2SKCA 3DVRX 4PGHA 4UHCA 1I5RA 4M22A 5T7BA 1NW4A 4I8DA 4Y6GB 2PA3A 4RVHA 1PQPA 3D2LA 4EYSA 4KO1S 1T0IA 1V4NA 5AUPB 1V8ZA 2C3OA 1BFUA 2C5AA 3ZD8A 1Z7EA 4BO9A 4Q3EA 4EK9A 5IBQA 1DIGA 3DCJA 4YCBA 2PKWA 2X86A 4BV8A 1G18A 5FNVA 1CUDA 3UWKA 4DBVO 1NF8A 4HT3B 2NP7A 1I2AA 2OAP1 4RHEA 4X92A 4TX1A 3UY4A 4FFBA 1YBAA 4LDJA 1W5AA 4D8XA 2J5KA 1N2BA 3WTBA 1W0JA 1VLLA 2E4VA 2WAMA 3ESXA 2DBVO 3N2KB 4LJ9A 3IAHA 3SSOA 3HVJA 3DE5X 4Q4AA 3UJ3X 3QFRA 1U1FA 4LRQA 5SV2A 1UFRA 3HMQA 1V7QA 2SKEA 5JNVA 3EJWA 4US2R 3BIJA 1JDVA 3DVAB 3G79A 2Q41A 1Z5ZA 4TV9A 4DCOA 5HOEA 3OFNA 3RIEA 3V48A 2OENG 3HU1A 5TQ2A 5FWXA 3A4LA 3WQBA 1Z73A 3AL0C 4YFVA 5E6UA 1IEWA 1P7YA 1Y1SA 1TM1E 1WPRA 3D7NA 4TLDA 3DV0B 4DMLA 4UOZA 4TLAA 3Q72A 4JYPA 3VO9A 5HCIA 1ZJZA 2GPSA 4GP6A 2HQSA 2POC