3DNCA

Carboxysome shell protein, ccmk2 c-terminal deletion mutant, with a closer spacing between hexamers
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
IAVGMIETRGFPAVVEAADSMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVSAGIEAANRVNGGEVLSTHIIARPHENLEYVLPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide-concentrating mechanism protein ccmK homolog
publication title Insights from multiple structures of the shell proteins from the beta-carboxysome.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Structural protein
total genus 20
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dncA00
3MPYA 4AXIA 3I96A 3SSSA 3PACA 4OX7A 3H8YA 4LIWA 3DNCA 3NWGA 4OLOA 4RBUA 5L38A 3DN9A 3MPWA 4DDFA 2G13A 5DJBA 3SSRA 4QIFA 4OX8A 4PPDA 4RBVA 3I6PA 2EWHA 2A10A 3VCDA 3IA0A 4QIEA 3SSQA 3BN4A 3CGIA 2A1BA 2A18A 4P7VA 3CIMA 3N79A 4OLPA 4RBTA 4QIVA 3NGKA 4OX6A 4AXJA 4P2SA 4P7TA 4QIGA
chains in the Genus database with same CATH superfamily
3LH2S 2R7QA 3SSSA 5HQ8A 1XC9A 5DS7A 3P3DA 1FJCA 2KL8A 3W5YA 3WBZA 4ZPCA 2VODA 3TAQA 1FFSB 3HHLA 2KI2A 2H4YB 5K5MA 5BR8J 4QWDA 2DHSA 3HP6A 1VK8A 1KOOA 1S4FA 2VBZA 2VPWB 4C11A 3W2WB 5L9NA 1XIQA 4DPXA 4LRBA 1CJKB 2WONB 3GJRB 3PHTA 3M9MB 4PR6A 4ZVUB 3AD8C 4IFVA 2D9PA 3ZZPA 1EHWA 3T1YF 3AOBA 1RTHB 2B6AB 2QA4G 3BS9A 4AXIA 3EGZA 2XI2A 2U2FA 2BMBA 3AA8A 5BXIA 1QDUB 1Z4UA 1FFGB 2B0GA 2L08A 3M1VA 1IQTA 2ZH4A 3SEOA 3H20A 1X60A 4K7QA 1RTDA 2HHTA 3EJMA 1QTNB 4RKUC 1HBUB 2I5JA 4ID5A 3LP2B 2IMOA 2J9EA 2MQLA 2WSFC 4BC7A 2YX7A 3BKFA 2M5YA 1JLAA 1ZM3A 3DMJA 4MT1A 3OXFA 2HZCA 4LSZB 2UXBJ 3ZNJ1 3QAUA 2QT7A 3G96A 2F63A 1YZ6A 2XMVA 1F5AA 1FRMA 3NY0A 3J7A1 1NPKA 2YKMA 3I9ZA 1PILA 4B9LA 2F4FA 1JK9B 4Y34A 1CJTA 2M2BA 3TAMB 2DY1A 1KFSA 5D78A 5F0UA 3VHQA 1HNWF 1REVA 5C42B 1XERA 3UQSA 3OHAA 2EFGA 2ZOGA 1SQFA 2AJ4A 1S57A 2W1BA 5IT9U 1BHNA 4BBYA 2A18A 3VQTA 1ZM9A 3Q0AA 5A8RA 5J2PA 4RO0A 1JMTA 2DYAA 3T5HA 4IKAA 3V4IA 1DARA 2GIQA 1S1TB 3BV8A 5E33A 2MQOA 1JX4A 2VH7A 4HKQA 1HA1A 3GFHA 4BCAA 1D9DA 2HNDA 3AAWB 1LW2A 2OIHA 3UO0A 2MB0B 3A8IA 2R7XA 2PIIA 4FNHA 4IDKB 2M52A 1ZBTA 1RWMB 1VOMA 2IPOB 2M70A 5D0HA 3D6MB 3HD2A 1SXLA 5CQGA 1WSRA 4IH6A 2B4UA 3RJMB 3GYXB 1Y11A 2PA8D 4N8OA 2HURA 1AB8A 4OZ0A 4N56A 1U49A 1YJ7A 2OUGA 5DRKA 1YRTA 3M8RA 1VQKS 2EPIA 3LPEA 2B7BB 3FEZA 1FRJA 5DQHA 2F5GA 2Y0SD 1NK9A 4UW2A 3GIJA 1VRUA 1DTQA 2FVCA 5KFRA 3KLEA 4OI6A 3IC1A 4IO1A 4FN5A 5HI7A 4U8VA 3D0IE 4OYPA 3BM7A 2PI4A 5AXMA 3KLFB 1U2RA 2BJ1A 2X7IA 4J5OA 4OHWA 4O0NA 3K0JA 1RBLA 1L5UA 1GMUA 1GX6A 3RUBL 4ZVEA 1L3VA 4DV4F 1T05A 2XS2A 4F2RA 2DISA 4P10A 4IRKA 2GHPA 3PW4A 3K8WA 4K59A 2YX1A 5HMZA 1C0UA 2CQCA 4LFAF 3CJSA 4G1IA 1L3TA 2UUTA 2ZKTA 4WFYA 1RYSA 1BQNB 1NDCA 3BKTA 1PSDA 4HR2A 4KYZA 2ZHBA 3L9ZA 3MM7B 1YHQS 4P9SA 1UEUA 1X8DA 2KH9A 3DOMB 1HYSB 1GK8A 3OT9A 5HBMA 4TU7A 4EFAC 3QAEA 1XNQF 1FK9B 2WVEA 4IR1A 3M6XA 1YK9A 3R9LA 2XULA 5IV4A 2V4RA 1N54B 4ED1A 1CBKA 3BREA 1YITS 2OTLS 3DRPB 2OSQA 1VBXA 3ZZZA 3HT0A 1HWIA 8RUCA 3D68A 1JNRB 2LQBA 3D0GE 2OO4A 1S97A 3P6YC 3V2UC 5I42A 4ZP8A 3EUNA 5KFKA 3IBCB 4ED3A 1U02A 1FKPB 3KHRA 1RXOB 4PWDA 1XR7A 1HWUA 2DHGA 3H5UA 4BC9A 3BPSP 2HS4A 1N36F 2XNRA 4DL6A 4CT9A 1G3OA 3VR1A 5DDQC 1CQNA 2V67A 2UXCJ 1EETB 1I1GA 3HVWA 3CMAS 2P9CA 4HH0A 7FD1A 2LQJA 2UUBF 4NA3A 3F44A 4P7TA 3DYAB 3J7ZT 1R8BA 3NGUA 3NWRA 2EWHA 3F0NA 4ZCMA 3CD5A 3NGDA 3FMBA 3UDCA 1WF0A 2HEKA 2KYZA 1VQMS 2V8PA 4DR4F 3W2WA 4NLVA 2MGZB 1VGYA 1KS2A 1XMBA 1S1XB 5ETTA 4DS5A 4C0HA 4EBDA 2WHOA 1CJKA 2WONA 1E6VA 2AZ1A 3TANA 3THPA 4LF9F 2V8DA 5KOXA 2GX8A 2C42A 4C3KA 1RTHA 2B6AA 2EXUA 3RZAA 2YKNB 4FS1A 5D4PA 5HLFB 1RADB 2QL7B 4K5SA 3CF5Q 3HZEA 4NASA 5B0FA 3QRPA 2FVSA 3MMAA 1AFIA 3MGJA 2GFFA 1Y3KA 4K50A 3MR2A 4OI3A 4EYHB 1FEEA 1YVFA 1NXIA 2AYMA 2C3OA 3PW0A 1R8CA 2ZBRA 3I87A 3I9V9 4W98A 2X1AA 2QSFA 4WIQA 4Y3CA 4GVLA 3MUVP 3FZBA 1UVJA 3EXYA 4ZLLA 1PKUA 1BQMB 3CDUA 2J0WA 5D0RA 4DR7F 2RAQA 2YKQA 1R8AA 1QAYA 2XNQA 4QWEA 1Q79A 4QZVB 1Q4RA 4UZBA 2YWGA 5C42A 2VICA 2K8GA 2OP5A 3IGVA 5IQQA 1S6PB 1I3OB 3D2WA 1SV5B 3MMJA 5LMNJ 3T1AA 5D4OA 2MHNA 2ZE2B 5EUHA 5LJ5Y 4D3GA 1U25A 3CCRS 3CUNA 2IVFB 5HMYA 2A0FB 1S1TA 3QT6A 4IOCQ 3VVTA 3BO3A 4LF6J 3C8YA 3RAXA 4CO4A 4DHVA 2QMUB 2WVBA 1X9MA 4ED0A 2R8HA 2X1FA 3JAMY 2C2OB 4IDKA 5L1IA 2JFKA 4QW8A 4USHA 2WCXA 3ZZRA 1X4HA 4KJIA 2KT2A 1JJ4A 1X5TA 2G1DA 2DGXA 2PEHA 2G2OA 4FXDA 2RNEA 3H59A 1GH8A 5CYQB 2ZBCA 3DM2B 2RQMA 5A76A 1RT7B 4Q44A 2F4VF 1DQ9A 1T9UA 1NO8A 3AD7C 1GX5A 4M5HA 5L9XA 5I3PA 1IBMF 1RTIA 4NE9C 4B3RF 1R0CB 5AXKA 1PJ5A 2FZCB 2AEMA 4IQXA 1TL4A 1S7IA 4X65F 3DGVA 4YB1P 4ZVRB 4ZVSB 5C7PA 1HBOB 4KRWA 1TMMA 2ABYA 3KLFA 2CPYA 3A8EA 1KQSR 2DNOA 2JRSA 2WAQD 4PWUA 1NSKL 2MSSA 1UA1A 2W25A 3ZTPA 4NLDA 4NZ0A 3GB0A 1BC6A 5CD4A 1BY9A 4QJVA 2HNYA 3TEGA 5KFQA 2DNQA 2XS5A 2J76E 3RR8A 3CJ2A 4ANCA 3BF4A 5L1JA 2FZKB 2LXIA 4CP5A 1NDPA 1LKZA 1R6YA 2XYHB 4OJHA 4MK9A 3DI6B 2Y3YA 1BQNA 2F3JA 1Q86T 2FVRA 2ZWOA 3AH6A 2WOMB 1UZDA 2MQPA 1FJEB 1BLUA 3LPYA 2KDOA 2ERRA 4CQ1A 3DOMA 1HYSA 2J6SA 2VA2A 1KWMA 4WU2A 4OZ1A 1U48A 2OPSB 2V8GA 2GS8A 2FGOA 3T6BA 6AT1B 1SC1B 3PV8A 1JNZB 2QYGA 3DRPA 2C28A 1T9XA 4ECWA 3VALA 2EC0A 4ALZA 4AXJA 2V8HA 4ZVHA 4O0IA 1K47A 2QGFB 4C8MA 5LXRA 4USJC 2DNPA 1NPRA 4DR5J 4JV0A 1CS4B 2Y8YA 1FKPA 1TL3B 1ZETA 2APOA 1IUJA 4DUYJ 5KFVA 1RAFB 5CCLA 2VBXA 2HMIB 3CVKA 3PFOA 3HJFA 3RRKA 5HQMA 4JI8F 2LVWA 3O8WA 2FD2A 3BGFA 2AYBA 1D8ZA 3H98A 4PZVA 2FHMA 2ZUAA 3BBBA 1DTTA 4O3PA 1Q81T 3DYAA 2CQ2A 1JXLA 3CMQA 3UR3C 4A8MP 3OFGA 1S6UA 2KZMA 4ELTA 1RDRA 1MN7A 4MKVA 3PNIA 1RTJB 2RQCA 4PG6A 1YJRA 3LTOA 2MMYA 4QOTA 1OSDA 2Z58B 1B0PA 2MGZA 1B64A 4PEOA 2AGOA 3GJSB 4H54A 1S1XA 1IBKJ 1Q5VA 5IWAF 3DDKA 4X84A 1PJ6A 1QUVA 1V5IB 1D9AA 3BR9A 4TKTA 1VISA 2GV1A 1FX2A 5KFSA 4YB6A 3IS9B 3Q83A 1X4FA 5HJYA 4NZ6A 4P75A 2AF6A 4JI2J 1FCAA 2GMLA 3D6HB 2MY8A 2M8HA 2VV5A 5HAOA 2YTCA 3J7YU 4Z37A 3NGKA 3O44A 4R0EA 2F65A 1NB7A 4F0KA 2P5VA 4DX7A 2GJFA 1KVKA 2QRRA 1EJ7L 3HULA 3MFHA 1UWBB 1APSA 2LP4A 2XGPA 1HI0P 4V19X 2RHQB 2CQGA 1JQGA 2R7UA 3CJTA 3O6QA 2IBOA 5IV3A 2KHDA 4J9PA 2E1PA 4EZ6A 4F2SA 2ZDOA 1UVMA 1S6OA 3WIUA 3CCJS 5BYSA 4WE1B 5LOQA 2RDJA 3KJFB 4CYUB 3DLKB 3OSNA 3OL8A 4KGVB 3OTOF 2RUGA 1VJQA 1S6PA 3HKWA 3W7BA 4KGXB 2CRLA 2QC3A 3QIDA 1KDNA 5CCMA 1SV5A 3MI7X 2IJFA 3MECB 2ZH2A 4ITSA 1YZ7A 5THWA 2DVIA 2UUWA 2CPZA 4BDPA 2HNZB 5B7WA 2ZE2A 2OJ3A 1PO6A 1N5YB 3FSYA 2VU5A 4JUZA 1KTVA 2AV5A 4DBQA 4ZLNA 4LF2A 4NLRA 4DPYA 1WC0A 2HVZA 2V2ZA 4C8KA 1S1WA 5F9NA 2RRNA 2ZBPA 5KFPA 4DQQA 1GTHA 4A8WA 5KG7A 2IRYA 2OMLA 3PW7A 5LM7E 4ZVFA 5FJ4A 2C2EA 3V6JA 3TA1A 2YKOA 1T9YA 2PGCA 3NWGA 4RBUA 2XM3A 4DG1B 3MCSA 5CYQA 3BH7B 3TEHB 4PUOB 1BWEA 2HGLA 4MK7A 4ZPTR 2HQIA 3I31A 2WVFA 3VAHA 4EI2A 3C46A 3SV4A 1UP1A 3D28A 4M5MA 2PC6A 3LANA 2NZCA 2NCKL 4DL3A 4O3SA 3H90A 3W62A 2ZDPA 1G7CB 5J1NA 4DL4A 1HBOA 4F4ZA 5F8HA 3B6BA 3SDEB 1PYTA 3CB4A 3M8QA 5KFUA 3JTOA 5CYJA 3KJNB 2YKAA 1Q8KA 3OJUA 2CZ4A 4KQZA 4WP9A 4RW7B 1VBZA 4NRUA 1MROB 2V94A 4ZIWA 3KLHB 4Z7CA 4M5IA 4PCQA 2DNKA 3PEHA 1IKVB 4PAAA 3NL0A 2HRTA 2VC1A 4WZMA 1FE4A 1RP5A 2UUCF 1LW0B 3PO5A 4C0BA 4P6QA 1S9GB 1WTFA 1EP4B 4YR2A 3ENVA 1X0PA 1SH2A 3DI6A 2DHAA 2DIVA 3I5AA 2DH9A 5HN0A 2WOMA 3CCVS 5A8WA 2BKNA 2HK3A 1TKZA 2RSQA 1K1SA 3UD4P 2ADBA 2NLWA 3CNQP 1RAOA 4C8OA 5D8HB 5M2RA 4OIXA 4J9NA 2OPSA 3D54A 1F9EB 3ISZA 4DSFA 4F67A 2YNFB 4Q7AA 3DFEA 2UU9F 2MZ1A 4F7VA 3VF0B 4F3QA 1GEHA 4R5PB 4PQUB 5KAKA 1U1NA 3QZ7A 4X62J 3C14A 3GSIA 2DXEA 2J0XA 1HBMB 3D9BA 4DPOA 3G4SS 3FBBA 2YQ0A 4ILRA 2DO4A 1TL3A 2NSBA 3ZTOA 2VDIA 1GXTA 4K2JA 1MW7A 2XY6A 1RAHB 3N5BA 2M88A 2RH3A 4ELUA 3MM8A 2RU3A 4AQYJ 5DG8A 1HHTP 2BKOA 1T9TA 2HMIA 2JC0A 1T0TV 1SBRA 5KT4A 2Z8QA 1S1VA 1J2VA 4QIEA 4ZN1A 5C2CA 2DB1A 5J2QB 4YS2A 2ZZMA 5DDOC 5EX0A 2JX2A 3OQ2A 4UQGA 2XBPA 1FO1A 1K1QA 2CWKA 3PTWA 4NZ7A 1U4BA 1D1UA 1X4EA 3TZYA 3RW6A 3CD7A 2H54B 4RL1A 1MMDA 2AWZA 3IG1A 3LAMA 3KTQA 1FE0A 3A3OB 3T1YJ 1XBWA 2AZ3A 3MUMP 2D74B 4DR2J 4ZN3A 3NBPB 1KQKA 5B0BA 4DV5F 5J1EB 1GXLA 3MF5A 4OYOA 2W9CB 1HWJA 3PJ9A 3I0SB 1HNVB 2J6UA 1P6TA 4YY3F 4F3MA 3OPKA 4TNOA 1F9HA 5C5JA 1RT5B 2IM1A 3IS9A 5BYRA 2RJZA 2E1AA 2DNGA 1NKCA 2I38A 3LO3A 1NDLA 1RHQB 2H5JB 1ZAWA 2BE2A 4DR6F 3M05A 2EFNA 1RABB 4DSJA 5E2QA 1NNDA 5AXLA 5EGYA 3I0RB 2CQIA 1U09A 3VZIA 4OJ1A 4OJGA 1IBLJ 3MD3A 1KP6A 1VQNS 4CI0B 3MTKA 5HANA 2NSCA 1HNWJ 1VC0A 1NMEB 3QGGA 4CNYA 4K4YA 1OS5A 1YBUA 4JV2A 4KSEB 2OD6A 4CIOA 1RT1B 5KG4A 3MR6A 4O3OA 1RWNB 3DLKA 2HQCA 2BANA 4IYQA 4KKOB 2CPXA 1RWOB 4DV0J 1WUUA 1QAJA 1V5VA 3MECA 1EIYB 4QCLA 3LWMA 2ASJA 3ILIA 5F9LA 2YH0A 2DGQA 3IGNA 1VS3A 3P45B 2P9EA 2Y1LB 5JUMA 2F8EX 5KFNA 2N82B 3CIZA 3ZXWA 2KU7A 3Q8UA 3GR1A 4LIRA 1WJ9A 5J1PA 4RWWA 1QJHA 2CJAA 4CRJA 3WX4A 3UD5A 2CQHA 4ZA1A 4RU2A 1RU2A 3HVTB 1Q53A 1GXUA 2B51A 3QNWB 3H2LA 1UVLA 1RT4B 4DG1A 5GMDA 4JV5J 2N4DA 2PE8A 4CO0A 4GC6A 5DM7Q 4PUOA 3QO9A 3U02A 4GO5X 4ECXA 1C0TA 3U1NA 4H4KC 2PA3A 3I6PA 5JXSA 4ER8A 3W60A 2YNGB 2B4OA 1P27B 3KDNA 3ENQA 3WHIA 5DQIA 4M1KA 2UP1A 4CLSA 5L46A 2LECA 4RNHA 4FZVA 4XTTA 4C4WA 2HBZB 2FC9A 4N76A 1BWVA 2XYPB 3R7BB 4F4AA 4IRCA 3DHWC 2LDYA 3K58A 4M5GA 2NYHA 1DFDA 1W7WA 2CDRB 3CCMS 1WC5A 2B4PA 1S5ZA 1WF2A 1TL1B 4NLTA 1D9FA 3AODA 3CJ4A 3TZZA 1HQUB 5ETPA 1Y7PA 3PIOQ 1K9MT 4LQ9A 4K4UA 1GQEA 4DXLA 2IM3A 3KHLA 4LFAJ 2N3OA 4RW7A 4CO5A 3H2VE 1NM2A 2YKPA 2MSTA 2DNLA 4P52A 1FHTA 3QGHA 1IKVA 1YG0A 3NCPA 4CTAB 2W24A 2OFGX 3UVJB 3MD1A 3ILLA 1LW0A 3OTEA 1RWKB 3CJ8A 2B8PA 1RK8A 3MM5B 1NCLA 5A8KB 1S9GA 1T3OA 2RQ4A 4DN0A 1M5HA 4JB8B 3PYGA 4USUA 2AQ4A 2OTJS 4YUDA 4ATNA 3EDRB 1IKXA 1R0BG 4R8UA 5KFIA 4U8YA 4EZ9A 3J80U 8AT1B 4G65A 3BGOP 2FJVA 3KG1A 3EM1A 5KOWA 2YNFA 5D15A 3MCNA 2CG4A 1WKJA 4PQUA 4C97A 4CNZA 3THVA 3KUGA 3T6JA 2A2DA 4E0DA 1QSLA 4BHQA 4LF8J 2QA4S 2ZBIA 2WVDA 1HBMA 2UZAA 1X9SA 4DUZF 3A12A 5IXUA 2XCPA 4K5RA 1CJUB 1MWYA 5LT5A 2E1RA 3I55S 3GIMA 1UFWA 3NMRA 1F5BA 3D1OA 2UUBJ 4P2MA 1M90T 4URGA 2DH8A 2QJ3A 2B56A 1T11A 5EDWA 4CWBA 5H9EJ 3TZWA 2PMZD 3VGTA 5J2QA 1FTRA 4ETZA 3ZTSA 3CIMA 4ED6A 3V6DB 5ETNA 5F3TA 2CPFA 1C4AA 1TL7B 3EGNA 2CZVC 4DX8H 2C3UA 2DR8A 2D1CA 2HFZA 1LWEB 1FVQA 2I1RA 4YR3A 2V2QA 1S6QB 3CSKA 3R8YA 3MEEB 1PBUA 4ZDNA 1LQ9A 4Y2MA 1UJ4A 2OKQA 2FY1A 4C6AA 2VQFF 4S0MA 4AUKA 3CO9A 4X4UA 3NBPA 3JQKA 1UTAA 2H65B 4A47A 4ZS6A 1N5SA 2W9CA 3LQVA 3I0SA 1YTYA 2ACMA 2CKWA 2VKZG 1S12A 1RT5A 2CQBA 4U7CA 3OXGA 1JB0C 2J9CA 4Q43A 4V1Ak 2O1PA 5CA5A 1Y9OA 4DOZA 3LW5C 2Y8WA 4FDFA 1U6ZA 4TY9A 4USIA 4M5KA 2V9WA 3W5ZA 4HHHA 4HT7A 5KT5A 3I0RA 2FLOA 3RRHA 4DR7J 2W2QP 1HD1A 1JWWA 3DDNA 1KQGB 1X4BA 4Z2XA 2LFVA 4B3MF 1O6XA 4JI1J 4OYWA 4WXWA 2YNHB 1WC1A 1SI9A 2VDHA 2HG4A 4F04B 1RT1A 3OR1B 3TX8A 2DPJA 1TAQA 1ICEB 2V6AA 2UVVA 2IHR1 2CA9A 4YFUA 3OLAA 4LR8A 3PX6A 4KKOA 2KVIA 2ZD1B 3W65A 4M5LA 5LJ3Y 3VAGA 2QL9B 5BYQA 4LRDA 4XK8C 4J9RA 1WEYA 2JFDA 2XMWA 1G6BA 4OL8A 3NNHA 4KC5A 4QYZJ 1T02A 3HCXA 1Y4ZB 3BSAA 1N33F 3JTNA 2P9GA 2VFUA 3BQ1A 1GFWB 3ZO7A 1I51B 3NKYA 2HQDA 2MKYA 2UUAJ 4YOEA 1ZPVA 1U1QA 2FJDB 3WC2A 5HATA 2ROPA 3CXCR 1P1LA 2MJNA 1K44A 3PO4A 3FK4A 4JI3F 1NK0A 5RUBA 2DRDA 4MFBA 1KTQA 1R6VA 1X4CA 3HVTA 5EHHA 5ETRA 2JLGA 2FLLA 2E1MC 2C22A 2O5DA 3EPGA 1RT4A 5IZHA 3TA2A 3G71S 2BW2A 1FDBA 5MAOA 3MFIA 4J91A 3OV7A 5GAHU 4U67Q 4Y2IA 1VHIA 2VF3A 4M95A 4C7QA 5C25B 2YNGA 2QLFB 5KFCA 1SKWA 4NXMJ 4CZCA 3EVMA 1XMQF 1NSPA 2FDNA 2YQ1A 4OHXA 3TJAA 3UCGA 2E29A 4I2QA 1HIYA 3HVRA 4QU7A 4NLWA 1UW9A 4MMOA 1PCAA 5GMEA 3NEKA 1TL1A 3VAFA 2BZ2A 2AP6A 2HHWA 1HQUA 3JQMA 4CM2A 1ELOA 3BO2A 4DZDA 1RJJA 2Y9HA 2YQ3A 5I3UB 2FJXA 4A8XA 3DHXA 2KFNA 1H38A 1SUQA 3UDEA 1MN9A 4CTAA 1WDDA 3UVJA 4U95A 1IWGA 3MM5A 3DLGB 5A8KA 1LWXA 3MAAB 3I5BA 3MEGB 1OPZA 1RUSA 3I5CA 4RUAA 5GADI 3BO4A 3ELHA 4CLLA 4ES3A 2VQEF 2G4BA 3SI8A 3GZ7A 4NLGA 1VQPS 2ZC3A 2HAFA 2L3MA 3ZTRA 2G0IA 4ZCLA 3DXSX 3ADAC 3C2PA 1A0OB 3R5AA 3M8PA 2GGPB 4KY3A 3MR3A 1SL1A 5D4NA 4NLUA 5B0AA 2JSXA 3VAKA 2HIYA 1FTCA 2MPUA 2VG7B 2PO4A 2ZM6J 3PYEA 3MMCB 1NH7A 1M5KC 1EQMA 3GONA 4KBIA 3C19A 1F2HA 1CJUA 4X4TA 4LUBA 3JSBA 4TU9A 2F9DA 2FJBB 3GQCA 2MLXA 2IVMA 3HZGA 5F8GA 3UCZP 4FPRA 1WC4A 4G1QB 3V6DA 3EGVA 4KHPJ 3PR4A 1HKAA 1ZA2B 5J2NA 1VQLS 3CC4S 4F0MA 4MIAA 2MDAA 3FCWA 4DR3F 3BH6B 4WFZA 4LQ3A 1TL7A 1TAUA 1RCXB 3DRXA 3FQKA 3I96A 1C2PA 1LWEA 1O51A 1RZMA 2EFOA 1URRA 2R7RA 4WBFA 4WFXA 4H4OB 3AT1B 3JSMB 4Q8FA 3W63A 2VPXB 3MEEA 2CQ0A 3GV8B 2C1EB 4K0KF 3ICLA 2XLKA 2AEFA 1VI7A 3SCJE 4TVAB 4ECZA 4KV8A 3IRXA 2WK4A 2X51A 2WBRA 1FFWB 4C11B 4J9UE 1M5VC 1TTHB 5DZ7A 4DV7J 3RTVA 2RKIB 3VQSA 4FBUA 2Z56B 3SZ2A 4J9LA 2L9NA 3VAJA 2F8MA 1RWVB 1U2CA 2R2UA 1FI4A 3E2EA 3HM9A 3FVYA 2W4CA 4NMLA 3M7VA 3ILOA 3MOZA 4TLQA 4OX7A 4U9RA 1F3FA 2VL1A 1F3VA 2XMTA 1OY6A 5F41A 3WC0A 2C2ZB 2POKA 2BOPA 4XIUA 2W2PP 2JWNA 1OPIA 1N52B 4DU7A 2W4PA 1WHWA 3BJYA 5DJBA 2YNHA 3H4BA 3G86A 2BVZA 2DNMA 4QPTA 2GAHC 3OR1A 5B0GA 5E3AA 1IBCB 3CWJA 2MZTA 4X64J 1HBNB 4DF4A 5LL6d 2ZHAA 2XI3A 3Q2TC 1RHUB 2ZD1A 5A2QY 3MPUB 4Y6IA 1KONA 3EVOA 3T5LA 2GO8A 3X3UA 3TQEA 3HMJG 3D1QA 1TV6B 4EUVA 2OEKA 3TJ8A 2HQGA 3X1LB 5H9FJ 2CUYA 4E2FB 2ROEA 2R2TA 2HGMA 3AA9A 3SFUA 4ED7A 5CABA 1WI8A 4CLWA 4OQJA 2ZUGA 4I68A 1RYRA 1CVJA 2QN6B 5E3PA 4ZLPA 3TAPA 5J2PB 3C6TB 2DGUA 3DRSB 3QZ8A 4HL9A 5D3GB 4Q5VA 1OSCA 4M5NA 2FJAB 1NSAA 3N5FA 4Q8EA 4PPZA 2YPYA 1TK0A 3PACA 3K17A 4DV2J 1V3SA 1WHXA 2QSWA 2E5LJ 4OYIA 4OHYA 2CPJA 4WYLA 2RQKA 1X5SA 5GAHI 3S01A 5BR8F 3MPYA 1R27B 4PYAA 4EU0A 5C25A 3L4BC 1P1TA 3LAKA 3N9UC 3D6FB 3JSYA 5FLXU 3G6ES 2KJVA 4B9TA 2HYIB 1L3UA 5HVHA 1CC7A 2AW0A 4X4OA 2FYXA 2KN4A 4K4WA 2VKRA 3HFVA 1VRUB 3T1HF 1Z1ZA 4ILLA 4YR0A 1ROFA 1YRUA 3KLEB 2GAGC 2D3UA 4JOUA 5HK4A 5A0YB 3UNGC 4WK1A 3QGPA 2NZ4A 4C9DA 2R7TA 3VCDA 1HMVB 2PI5A 1HNIA 5KFAA 3IBFB 1T05B 3CW2C 3O3LA 3DLGA 5KFJA 3MAAA 2KM8C 2P6SA 1OY9A 3MEGA 1TFWA 2X1GA 4LRFA 4AYBD 2MLZA 1UPPA 2RF2B 4KTQA 2CNNB 1CSJA 1FRKA 2IYIA 3POTA 5MLCV 2W2OP 2I0XA 3T5KA 2GJIA 2N7YA 2UU9J 4DV1J 1ZA1B 2B8QA 3ZZTA 3TQ1A 4A8OA 2QLWA 1KLMB 1UFKA 3OD2A 2MQMA 1S0VA 2GGPA 3SMZA 4IUFA 4QIWD 2VJVA 5HBMB 2CQPA 1WKKA 1CULA 3PKMA 3P96A 2D7SA 2P2CB 4NWBA 3VGSA 2PD1A 5JVGQ 5LMUJ 2VG7A 2R8JA 1TKTB 3ZZUA 2CJYB 3K7RA 2LXUA 4UOFA 4PWWA 1XTZA 2HK2A 3IFEA 3R5GA 2G2YA 3MURP 5IM0A 4DF8A 3H5XA 2RS8A 2ZOMA 2MKHA 4L3NA 3FFIB 5SUHA 4WU3A 4G1QA 5KT2A 1DQ8A 2YH1A 5K9FA 2CZ9A 3NGSA 3I56S 5D4LA 4LR7A 3K5OA 2NXNA 2SXLA 3DU5A 1YQHA 1VFJA 3TUJC 4PXCA 4ZVOB 3J81Y 3RBEA 3RR7A 2M4MA 4H4OA 3JSMA 3Q8RB 4U6PA 4YB5A 4FF3A 1KFDA 2QLBB 3EICA 2UXDJ 2VONA 2BJDA 2QL5B 3GYNA 1U0SA 3RGIA 2UVWA 2MZSA 5DETA 2COLA 2EFQA 4J37A 4YDDB 2RKIA 1I94F 5C24B 3TUPA 1YJVA 3C15B 1KNZA 1E6VB 1ITPA 5JVHQ 5IOLA 5L1KA 1VDHA 1N4LA 2HHQA 1PYSB 4NLYA 3G6YA 1D09B 3UCUP 2LA4A 2LEBA 2ZKUA 5E3QA 3T3FA 3OFFA 3VZHA 3MMAB 2LEPA 3Q8VA 2V4QA 4QYZK 2NXCA 3FBEA 1VHFA 1SKSA 1B99A 3QYYA 3HHLC 1K0TA 1XR6A 1IR2A 3GV7B 3EZUA 2EFVA 3PHEA 3DN9A 1YSJA 2XY7A 4PXEA 1TFYA 4R0JA 3G9CA 4LVOP 1NJXA 5IT4A 1HBNA 4I7FA 4L6V3 4HHUA 1NHUA 4QR1A 4OX8A 5K8MA 2DD8S 5KG3A 3A13A 5ETSA 4B9UA 2FLNA 3GWCA 1TV6A 3BN7A 3CT9A 2V9KA 2DR7A 2EKNA 2CAJA 5ETLA 4HLBA 1HWKA 4OHZA 4YP3A 4LSNB 1C4CA 1IM6A 2E5HA 3C6TA 1Q82T 4K4XA 1N34F 3DRSA 3KLVA 2EEYA 5D3GA 3B54A 3PJWA 4PG5A 3RB3A 2HS0A 4ZIVA 3HKZD 2DTJA 5T41A 1RACB 4IFYB 2J0QD 5EX3A 4DS4A 1S4EA 5K14B 3QWPA 2XHCA 1F9FA 1HR0J 3M2UA 4WP3A 2MZJA 1H74A 1SJFA 3KDOA 2RDIA 4B3SJ 3GIKA 4MKBA 2BX6A 3SSQA 5KFYA 1B7FA 3PVXA 3TUIC 4DR1J 3IO1A 3QWUA 1VC5A 2V68A 3M2VB 4X66J 2K2PA 5EWEA 4GKKF 1R8HA 4DL7A 2AJ1A 3HX9A 3SQOP 4WCEQ 3MM9B 3K59A 2QEXS 1RTIB 5T7LA 2M9KA 1FRIA 4PXBA 4J9OA 2VZ9A 2DEIA 2Z2ZA 1U1PA 3M6UA 3R2DJ 1TELA 4OI1A 2B9EA 5A0YA 2DJWA 2HHHF 5DLGA 2Z2LA 4K4ZA 3GFZA 3S1TA 1XK8A 1HMVA 2IAJB 1WACA 1SVDA 5G0RA 4OJ3A 3Q8QB 4JV1A 2HFOA 3QLHB 2HNYB 4C48A 5B0DA 1SKUB 3KXDA 3KK3B 2IDEA 1VQ8S 3TRGA 1KEKA 5ETMA 3MOJB 3M8YA 2RF2A 3NS7B 3PIPQ 3MPVA 4QW9A 3TW0A 4X4SA 1AYEA 1QM9A 2FLPA 1VMBA 1KLMA 2GMJA 3I82A 4L74A 5B0EA 5L8RC 5JMNA 1B7YB 4TYBA 2HBRB 4RPFA 4DUZJ 4HH1A 5LMNF 3EZ5A 1KQFB 4NLOA 3HPOA 3IR5B 3QJPA 3UW1A 3OL9A 2CIMA 1VIXA 2IRUA 2OELA 4X4PA 1TKTA 3HHLD 1CJVB 2IIHA 5F8NA 2CDQA 3AXKA 1ZZFA 4J7CA 3DU6A 3BGLA 1MU2B 2XC9A 1JLFB 4NA2A 2LMIA 3EZOA 2H48B 2J8AA 2IVYA 2ZZTA 3IP0A 1AXQA 2C2NA 1PAUB 1M1HA 2W7OA 2HVEA 4ECRA 4OLOA 4DLGA 3QSIA 4CM0A 4FF2A 3NNCA 5KG0A 1RAAB 3FFIA 4OYMA 2WSCC 4X4VA 3Q2SC 1PYOB 4EBCA 3PX4A 2BYCA 2HWTA 2VQFJ 4LREA 4I0WA 3CULA 4GKJJ 3NCRA 3BN4A 4HVZA 3TARA 1IR0A 1DTTB 2CFXA 1NUEA 4EMDA 2DR5A 1AZSA 4NLQA 3O2IA 4A4JA 2XSJB 2HKEA 2MY7A 5FDLB 3K5LA 3R2CJ 2HRUA 1XMOF 1XNRF 3V6KA 2GQ2A 1KHVA 2FB0A 1N32J 2O66A 3U27A 4ZHRB 4JI5F 2IYGA 1KBRA 3L95X 3DNCA 2V8VA 4ZPDA 2L9DA 5C24A 2VG6A 4LBIA 3C15A 1T95A 3M8SA 2OSRA 4P7VA 3ISNC 1QSYA 1WG4A 3BDEA 4OZ2A 3PY8A 2MEWA 1HARA 2W01A 4O44B 1WNEA 5M2PA 4KPYA 3RB4A 1OO0B 2XWYA 2VA3A 1KVJA 2EC2A 2AGQA 3QMQA 1UW4A 3QRRA 5DO2A 3G6VA 3Q89A 1HNXJ 2CQ1A 4DEZA 1OYDA 1EZZB 1OQ3A 3C6UB 3D3CJ 3HT3A 2K3IA 3NS6A 1Q8LA 2FIUA 1NLKL 5GVQA 3HXMA 3R97A 1AUDA 2C3PA 2QE5A 2OPQB 2RRAA 3M32B 2EG2A 4BWMA 1FDAA 4KPCA 2YWHA 2WTFA 1I5OB 1WD6A 2Q43A 4H4MA 3VVUA 3EGWB 1U1OA 2ZFHA 4KH1B 3ONQA 4ANEA 3KK2A 2LDIA 4RWXA 5AE3A 2VD3A 4NCBA 3L7UA 2MKCA 4DR5F 1X9WA 1H2VZ 4EYIB 2DRAA 4M5JA 2CJ9A 3CJRA 1MLAA 4AFFA 3UR0A 1PC5A 4LSNA 4O3QA 3KK1B 4IR9A 3P8BB 2VASA 1SC3B 1XQIA 4DUYF 4QIFA 4FYDA 4ZVTB 2FJEB 2DCUB 4I67A 3AY0A 1FESA 5F8JA 4AD6A 2DITA 4L76A 2CQ4A 3CCSS 2XZWA 4IFYA 2ZEJA 3AQPA 3LP0A 1S1WB 5K14A 3HHKA 3R5CA 4NI2B 4I4BA 3P4UB 3AFGA 2OI2A 3U1LA 1VR6A 4D3HA 2BXJA 2HRYA 4F02A 4HDGA 4JYAJ 5CZXA 2KKHA 2BRKA 3A3PB 3M2VA 1TZ0A 1YJUA 2GW8A 1LK7A 2KHCA 4P2XA 2XGQA 1M5OC 1A9NB 5IC4B 1YJTA 1EAYC 4IOBA 1YDLA 2CJBA 3OXLA 2XLIA 3GIRA 3MM9A 2LYVA 1YJNS 1RHMB 4ZP6A 4LF7F 3FKBA 2ADCA 3IM8A 3G8SA 3DLJA 2W9BB 2FHJD 4JI2F 4CLTA 2DXFA 1GT8A 3D6TB 1HWLA 2CQDA 1UKUA 3M8QB 2IAJA 3MDFA 1RGVA 3ENWA 2VB6A 2VQEJ 2ZBQA 1XWLA 3B8HA 4ZPAA 2VFSA 3H7HB 3QLHA 3IXQA 4JBCA 1AW0A 5IT9Y 4KFBB 2HGNA 2XG8A 2KVQE 1FA0A 4B9VA 1W25A 1Y00A 3KK3A 3FJ2A 5C2GA 1FJGF 2NPIA 1JLQB 2GCFA 2YWKA 2E44A 4FP9A 5AJ3J 3ITHB 1F6TA 4LFCJ 4DSLA 3ISND 5T14A 5AE1A 4C3MA 2IY5B 3TVKA 3HFKA 5DG9A 5A8WB 2I9SA 4XDCA 1JKHB 4HEA9 1IKWB 1TKZB 3P5TL 1UWAA 3QFHA 1RAGB 1DURA 2F9JA 2W2NP 3ENAA 5EWFA 4OI0A 1UVIA 3IAS9 2GA7A 2Q79A 2QLXA 5EWGA 1NK7A 1WOOA 2C2DA 2AJ0A 5HVFA 2AYEA 5B0CA 1S9EB 2BDPA 3SXLA 4DLEA 4RNFA 2BJ3A 2AHOB 1NU4A 1CJVA 1HL6A 4OX6A 3QIPA 2CVIA 3QT8A 4CLPA 2KTQA 1RISA 2R7OA 3DLLQ 4ZP9A 4B3OA 2MXYA 2IJNA 3C14B 2LLZA 3OW2R 1MU2A 1JLFA 2QYCA 2B43A 4TN2A 3CCES 2AKWB 2GIFA 1RHRB 1VC6A 2CJXB 4LJMA 4USWA 3OFEA 1RA7A 1V9OA 3FEYB 4GC7A 5CHCB 4LF1A 3MM8B 1JXEA 1N0UA 3NXZA 3LGMA 1S1VB 1HI8A 4LVNP 4QR0A 3TJ9A 3ZC4A 1LOUA 2JOQA 3S8SA 2ZH1A 2GVZB 3KHHA 3CJ5A 2XSJA 4CLYA 5FDLA 1H3DA 1UVKA 2BACA 2EW9A 4ICLB 3R3TA 4ZPBA 3IG1B 3IA0A 2EG1A 1VCTA 4ZHRA 3AD9C 2MTLA 2EI5A 3QATA 1SB6A 3GLJA 1RB0A 1NHKL 1SJQA 1B3TA 3H25A 2AGPA 1WELA 3Q23A 1HLWA 1HFEL 1TQLA 4O44A 1OJ4A 2HPUA 1S0OA 4ZPVR 2FPHX 1ZZNA 2EKYA 3CJKB 2UVRA 3MM6A 3MEKA 1O0PA 1X7VA 4UF4A 2MQQA 4CLFA 2BE2B 3NOGA 3EYZA 1REGX 1TR0A 1DY3A 3C6UA 3AJ2A 2LEAA 4LF5F 2BBEA 4HYKA 4NPOA 2BQ3A 1SL0A 3PYFA 2OPQA 3M32A 2YNIB 2D41A 3DCAA 2B4VA 1TMJA 2DGWA 1UEVA 2MHEA 2B9WA 5E3RA 2JHEA 3HVAA 4TY8B 4X62F 1N8RT 2LQ8A 3KUEA 2VC0A 1JJCB 2BANB 4DV3F 2QTWA 1GTEA 4PYDA 2H9ZA 1YBAA 4J9QA 4UOHA 4M5DB 2QX0A 3KK1A 1JLBB 4B08A 4USTA 3VGVA 4RW9B 2K1RA 4IG3B 2EK1A 5AE2A 1WC6A 4AQYF 3MMBA 4WYWA 2B9YA 3WX8A 1RE1B 3PRVA 3T41A 2Y1JA 1FRHA 3HO1A 1CC8A 4I69A 3B78A 3IWLA 1VQSA 2B7CB 2BR0A 3N4WA 4NI2A 2X3GA 2PT0A 3JXOA 4F4XA 2E7WA 1PG5B 5GAGU 4NLPA 1UEKA 1WDTA 1IJFB 5KTQA 2PSZA 2HHXA 2DBBA 2LQ5A 4L73A 3CCUS 3Q22A 3PR5B 5DLFA 2J6TA 3T1HJ 4LF4J 3QO9B 4LFBJ 2WW4A 1C0TB 4DR2F 5A6PA 2DY9A 3K5PA 3T9ZA 3E8OA 2Z30B 5KFZA 4KR0B 3JAMU 1X31C 2E7VA 4WPAA 1J5EJ 2VOPA 4DPTA 4XO0A 3VAMA 1H7WA 2V34A 1RT3A 2AMCB 2KJWA 2W9BA 1NSQA 1S79A 5HSPA 2K7JA 3ZZOA 2AJFE 2KO1A 2AT1B 1KR4A 2HS3A 3K57A 2BV3A 3QT5A 1ZPWX 1SJ4P 3M6WA 2NXJA 2R7SA 1CPZA 3DRRA 2HWHA 4EO8A 4WTYA 4QPXA 2XY5A 4KFBA 1N6QB 4A8SA 1ZAXA 1IBLF 1Y5IB 3W1YC 3W9IA 2CVEA 3KYLA 2NS1B 1JLQA 3N28A 2XB2D 1UL3A 3ITHA 2K06A 1GMWD 2ASDA 5KFMA 2VOOA 3CDWA 1PJ7A 4CT8A 3MZIA 3UN2A 3N79A 5AT1B 3RB6A 2ATLA 1JKHA 1RSCA 1IKWA 3UDVA 1IKXB 4R8UB 6FDRA 4N77A 1S48A 3KMQA 4LSLA 5HROB 4DV0F 3MR7A 2KXNB 3H5YA 4K4SA 7AT1B 1FF2A 4NX9A 2K7KA 4MK8A 4E98A 4NCGB 5K8NA 4RJVA 2AX0A 2HSEB 4RUHA 3TR5A 4F36A 3AOCA 1S9EA 4OYZA 1QE1A 2DH7A 1KHWA 5HMWA 1X5PA 5KFTA 2JZ5A 2JLFA 1M1GA 3W64A 2R8IA 2QO3A 4I6YA 4Y2KA 2HZVA 2LXFA 2C2RA 1SIWB 9RUBA 3JB9k 1IVZA 4WXOA 2QIFA 2RDDA 5LXYA 4KB7A 4NYPA 4DU8A 3ZFVA 4USMA 4UOCA 1C1BB 5E0OA 3NP5A 4JV5F 1H2UX 4HI2A 3D5MA 2X1BA 2V5HG 4ERDA 3LF0A 3R5BA 1T3NA 1Q1KA 4ZJLA 1FVSA 3M30B 4F8RA 1ULRA 3FEXB 4AL5A 4KE5A 2R2RA 2GNKA 3BPDA 2GVZA 3Q86A 2J5AA 2XZDB 4KHRA 4QR2A 1I94J 1VQYA 1WOSA 2JC1A 3RBDA 4MH8A 3EXCX 4ICLA 2ALZA 4U7UD 3NRBA 2AYGA 2CG8A 1BGXT 2Q1LA 2Q6CA 1S1UB 2YXLA 2WRMA 1RWXB 5ETOA 3CDBA 4AT1B 2R3VA 1AFJA 3T19A 2H4WB 1S59A 1CEZA 1SIZA 4TXSA 2OPRA 5DZ6A 1RBAA 1NBEB 1RTZA 5IQ6A 5KT6A 5KT3A 4M94A 3CJKA 3OLBA 2QV6A 1LK5A 4BS2A 3UE2A 3J7YI 2FHJA 3A3NB 1S99A 2RRBA 1WEXA 3SSRA 3U7JA 1WHYA 4N47A 1OWXA 1Z2ZA 3OJSA 2A6OA 2R42A 1HPZB 4DN9A 1VLYA 2AU0A 4KO0A 5KFFA 3OR2B 3OVSA 4I56A 2MKKA 3OL7A 1UFLA 1TVRA 2YNIA 3HFZB 1C1CB 1MG7A 2BKPA 5CAAA 1N88A 1FERA 1S10A 4C8YA 1Q16B 2QMWA 2YPZA 4TY8A 2AJQA 2I2YA 4LBHA 5B08A 4LF8F 4PKDB 4ZCKA 3SCIE 2OH2A 2XYGB 2G1HA 2ZVSA 1N34J 4RR5A 4M5DA 2D69A 1JLBA 4RW9A 4W4MA 5DDPC 4IG3A 1UCNA 2VJUA 5KG6A 2W8LA 2A1BA 2ALYB 4CH1A 3HF5A 1UMJA 2XZTB 1WORA 4Q0BB 4JI0F 6FD1A 4WK3A 3TA0A 2JEIA 4B02A 1QY7A 3OFHA 2OGUA 4UZCA 4DX5A 2C2MB 3OHBA 5DGAA 4DI6A 3NAIA 2XSFA 2VPYB 2BM0A 5K8OA 5HMXA 2E7XA 5GMKa 4RNOA 3DLHA 3FRZA 2WB1D 4OFZA 3HSDA 4DMZA 2ACYA 3RYLA 1LFPA 3BR8A 4MFBB 4GKKJ 5GAGI 4C8NA 2DPIA 4P74A 3ETMA 5F8IA 3BB5A 4P2SA 5KFLA 8ATCB 1T9VA 3GU0A 3T5JA 4FF1A 3FUYA 3KNAA 3BSCA 4OZLA 4JI6F 3CE8A 3MHYA 3GCXP 3RW7A 3CDAA 2HHHJ 2I6WA 4AL7A 2HFVA 1WC3A 3LGHA 2DHHA 2JLEA 4DFPA 3VGUA 2RMLA 2GQQA 3PRBA 3V4MA 2KRBA 2OEJA 2H51B 4DV4J 2ZH8A 3SYZA 3G87A 3EVWA 1WEZA 4I2QB 2H1YA 1HBUA 3LP2A 1V6HA 5L38A 2E5JA 2GJ2A 4TQRA 2ZNZA 4WIIA 4LRCA 4L72B 3K89A 2ZNYA 9ATCB 1SUQB 4M8LA 1T7PA 1V3RA 2E9TA 1N6QA 5L1LA 1PIEA 3TAMA 2DR9A 2Z2MA 2ZH6A 4QQBA 4JI1F 4X2BA 3S6EA 3RAMA 4O4GB 1U6FA 3DLBA 2DIUA 3FC9A 2D3ZA 2C3YA 3RBXA 4GVBB 5K20B 1XNQJ 4QU6A 3UI3A 4MKAA 1WWHA 2X3DA 3KNGA 1LWCB 1VBKA 2YWFA 2E5GA 4JI4F 4WJBA 2YX4A 1Q7LB 5HROA 3MPDA 2QG9B 2HWIA 4A8YA 4NCGA 4OYXA 5M2UA 3M8PB 2LKZA 4OYBA 3ETOA 3CJQA 2PN6A 2DT9A 5D6GA 2DGOA 3EMTA 2ZITA 3S7RA 1YRXA 2UUAF 4LIWA 4CLZA 2V4JB 2O01C 3IR6B 4ED4A 3NOCA 4HDHA 2EBEA 4OZ3A 4NXNF 3IAM9 5IS2A 4C8ZA 3CTRA 2GIRA 4NYZA 3HK2A 4I2PB 2IRXA 5K8PA 1N36J 4CLKA 2DR6A 3N6MA 4B3TF 4OI2A 4F0HA 5GAEU 4FYVB 1IXKA 2R4FA 3D66A 4YQWA 2PMWA 2BEFA 1UPMB 3NAHA 1C1BA 3DC2A 2VPZB 5HJXA 1GMVA 5HL7Q 1RLCL 4UUWA 2HHSA 1SQGA 2PEBA 1F2GA 2HAIA 3G6XA 1UZHA 4IG0B 4PG7A 1XMOJ 1XNRJ 3M30A 3ZZ0A 2EK6A 4Y2CA 2ZH9A 4NXMF 4DR4J 5J2NB 4XPCA 4DFKA 4ES1A 4JI5J 3TWZA 2DNYA 3NGTA 2DHXA 4M63A 1RHKB 4DJBA 4DV6F 2G13A 2ZWPA 2JJ4D 3G82B 3HHNB 4LF9J 5BJRA 1ZH5A 2HHUA 2Z4PA 2LA6A 3CMES 1S1UA 1B0TA 1SPBP 2H3EB 1A6LA 2YBVA 2HFUA 4DL2A 4KV8B 3HJVA 3IRXB 2IDLA 2Z57B 5E5NA 5LSOA 3PKYA 4P71A 2CPIA 3MM7A 2GVDB 1H73A 2LCWA 5F0WA 2DNZA 4CDIA 4Q2LA 4OYAA 2C3MA 2DXDA 3FSIA 3V81B 2GO9A 1FK9A 3O1LA 2OAUA 4G1PA 3GTYX 3QSYB 4NLXA 2YVSA 1HPZA 3HDSA 3F73A 3N0VA 3GCWP 4NMXA 2IMWP 1NEEA 3OR2A 4DX6A 1JLGB 3ZTQA 4ECYA 1VBYA 4QYRA 4IO9Q 1C1CA 2QLJB 2HQ3A 1UJ5A 3J7AN 4BWJA 3KFWX 2ZH5A 1VJWA 4I6AA 1FXLA 2A6MA 3VTIA 4ILMA 4OV1A 3R1LA 1JXVA 4FXVA 1W2BR 2P6TA 1GMWA 1NJWA 4NA1A 2U1AA 3R7NB 4AL6A 4N8NA 3E51A 1D8YA 2RHSB 3CCLS 4G6VB 2ZM6F 3C16B 1J5OB 1BUXA 4HTJA 3OVAA 2HVIA 1TUVA 2QMXA 1VQ4S 2FZGB 1HNZF 1SJRA 1EETA 2MKSA 3TO8A 4Q0BA 3UDLA 5E41A 3AB4B 3D7SB 4USKA 4N7TA 4DCPB 3EPIA 3BQ2A 4RX6A 4J9MA 4ZLJA 4ECUA 4KHPF 2BE7D 1WF1A 1MMLA 3J81j 4ZKAA 3H42A 3V6HA 2F4VJ 4RW6B 1U8WA 1O8BA 1U8SA 4KGZB 2J0SD 1DLOB 2GC8A 1AA1B 1IBMJ 1OIAA 2FY8A 4B3RJ 3MR5A 2BE9B 4QWBA 4LF7J 2G0JA 4XDDA 4F26A 4O3NA 4X65J 3PW5A 1QVGR 3A1YG 3FRYA 3BQ0A 2CJQA 4URSA 2YKNA 5HLFA 1V3ZA 3F56A 2EVZA 2HBYB 3HD1A 2MLYA 3CEDA 4NCAA 5A6WA 2JL9A 4DV7F 3GG0A 4PG8A 5D77A 3IRWP 2BJEA 2RIJA 3H8YA 1SC4B 1K0VA 2RE1A 2YWWA 2XMKA 1QTMA 2XEXA 4A8QA 1X4AA 2R8GA 1FXDA 3BKUA 2KXHA 4UOGA 3T9NA 1E6YB 3Q8PB 3VV2B 4NOHA 1LXNA 4MAKA 3OL6A 4HI1A 1FJGJ 2M3DA 1U7LA 1BQMA 4ED2A 4ZVPB 2R7WA 5G4DA 5KFGA 3QPIA 4ES2A 3CCZA 3MAHA 1HNIB 1Y5NB 2BW7A 3E3XA 3U1MA 1NDKA 3GP9A 1RQ0A 4O4GA 1FXRA 2EFPA 2VFRA 1BMQB 4OI4A 4GVBA 2RUSA 2V50A 1M0SA 3BGUA 1DQAA 4ZPWR 2XS7A 2VHGA 2D9OA 4OZNA 1X4DA 4X64F 3I4PA 2RB7A 1LWCA 5KFEA 3POTB 4DCOB 2H5EA 1FD8A 3CCTA 2M0GB 2F8HA 5DGBA 4NYOA 5ITHA 4RW8B 2RVJA 3JS9A 3KWMA 1OQ6A 1D3WA 3W9HA 2AEJA 2D3O1 4NRTA 3LWLA 1F60B 1RBOB 1CULB 4C2MA 3R5JB 2V4JA 4YN3B 1TK8A 2ZZNA 3FNNA 2J7WA 1T8EA 4GO7X 4Z7YA 2XO6A 5LSLA 1EB0A 2GQCA 4I2PA 1AROP 3DM2A 1DRZA 2KG1A 4K4VA 1Z2LA 1RT7A 2HVDA 3NS5A 2HFNA 5GAEI 3J7Z5 4JI8J 4NLSA 3CPWR 2UVUA 2CJKA 3L7OA 2KB2A 4JP8A 3N6LA 4DV2F 3SCLE 2QFIA 2CQ3A 1YX2A 4RLEA 4CH7A 2E5LF 3SV3A 1QLNA 2HQFA 4I64A 4ZVQB 5IM0B 1WHVA 2JEJA 2FC8A 4OZ5A 2DRBA 4MYTA 3PFEA 4IG0A 1RAEB 1BE4A 2MQNA 4NL5A 1GNKA 3C3LA 3R6GB 4DUTA 2CYYA 3TI0A 2HLTA 2RT3A 3G82A 5IT0A 4YHHF 1U6BA 2V0NA 1FNMA 2ZOFA 1QAIA 5IWAJ 3JSRA 2Q3PA 1YI2S 2HBQB 1IQZA 2VBYA 4ECTA 3FSXA 3J80Y 3KLIB 3GILA 1FDNA 4DDFA 1H7XA 4RU9A 5HVGA 1N5TA 3DRYA 3GJQB 1JLCB 2ZC4A 1MNEA 1TK5A 2KT3A 3OUYB 2W8KA 1SL2A 3D3BJ 2F7VA 2KYXA 3JYTB 7FDRA 3MEDB 4WFAQ 2YWEA 1EX8A 4UUXA 2GVDA 2DNNA 1RKIA 4MKYA 4LF5J 2BJ9A 4WKRA 4ZJQA 4JI7F 1AUSL 3V81A 1U1RA 4RNMA 1S0NA 4YEAA 4I6WA 3NG8A 1JIHA 1LEOA 3AOAA 2PDAA 4F25A 2L48A 4Y0FA 1EKRA 2JDJA 3IMQJ 2HHVA 2RU9A 2VFVA 3SBMA 4DV1F 1G4CA 3BZQA 1RWWB 1JLGA 1FDDA 4OX9F 5IC6B 4WWSA 3KHGA 3KJVB 3FMWA 1S72S 3D67A 4QIGA 3K5MA 3UWTA 1IR1A 4J9SA 1WOPA 1VRTB 1RHJB 4DV3J 3K8VA 1CS4A 1PAEX 2V2VA 3OTOJ 2AD9A 2E1CA 2CPEA 2Z2YB 3THTA 4ANDA 2CXEA 2XTJP 1W26A 2PMHA 5LMUF 4K2XA 4FKYA 3ET6B 1RT6B 1H0HB 1I6JA 3C16A 4DQSA 4I7FB 4LT6A 5ETVA 1WTBA 1J5OA 3A8JA 3NGRA 4UT4A 2V69A 4W90B 2IFXA 4B9MA 1VYAA 3PDNA 1ZTTA 1HW8A 4ENOA 5F3ZA 4DZ6A 3C66A 1X0FA 4MIBA 3CD0A 3LOUA 3M2RB 1M5PC 5I3QA 4A46A 2IC3B 3GE9A 1RTJA 2XCAA 4Y00A 2BOAA 2P8IA 4DL0C 4ZJOA 4Y2AA 1SKRA 2OD4A 1WG5A 5HQLA 2J7KA 3QBCA 1WG1A 4RW6A 2FJWA 2GZOA 1B0VA 3W66A 1DLOA 1R43A 2KRRA 2RILA 2QZ8A 3D1HA 4A8FA 3TYTA 3M2UB 2I8EA 2W7AA 4ZP7A 3TUZC 5KG5A 3QJJA 2UXDF 4MJKA 4URQU 2XLJA 4WZQA 3BBCA 2VIHA 3CO0P 2KXFA 4HACB 4DFMA 3PX0A 4J9VA 3LUYA 1U26A 5E3CA 3K2YA 2FTRA 1FRXA 1TKXB 2A10A 2K3KA 4RUCA 3OVBA 4CO1A 1HQ2A 1RCOB 2VG5B 2Y1IA 2CPDA 1NJIT 2DEJA 3CD6S 1NK8A 3FZ2A 2MJUA 5T7LB 2XMJA 2LU2A 1UWBA 4V19J 3GYGA 1LXJA 1E6YA 3E01B 2UUCJ 2BQUA 1Q0NA 1FJ7A 4B9NA 3Q8YA 1NK6A 1VK3A 3DXBA 4PG4A 4PPDA 2ZJPQ 3KLGB 2XMUA 1IWAA 2ZVIA 1RU1A 2FHOB 1BQXA 5G0RB 1OMSA 4WE1A 4CYUA 1YKWA 3L7PA 1FWPA 4LRAA 1FRLA 2FGCA 3K5NA 1RWUA 4H4KA 3WQPA 2UXBF 4WTOB 4Q2MA 1HW9A 1RT2B 4FXWA 5KG1A 2HHPA 3B82A 2HNZA 1KC8T 1N5YA 3MPWA 1TL5A 4E8UA 2KFZA 4FYWB 3KG4A 1ZYQA 4FF4A 1VLOA 4RW8A 2WW8A 2BJ7A 1MWQA 2ASLA 4A48A 5B09A 4HHJA 5H9EK 2BABA 2NUHA 5FIIA 1T03B 4OHVA 4RBTA 3WIVA 4OMFG 3MUTP 1NKBA 2HZAA 2FVQA 4C0OC 4TLRA 1W2IA 1Q7YT 1NZAA 1SJ3P 3BYRA 2MYFA 4PQAA 1S49A 2N4CA 2JNJA 2VUGA 1HR0F 3TVZA 1BD6A 3TOQA 1UJ6A 1VQ9S 3IWXA 2DGTA 4RBVA 2KG0A 4B3SF 1BXNA 1WKLA 2BUNA 3IBWA 3OSPA 2BM1A 4G3IA 4DR1F 3W9JA 4TU8A 1TKDA 3SDEA 3RBZA 4X66F 3TP2A 4ID8A 2HVHA 1L3KA 4N5SA 4YDXA 2GHWA 4DV5J 3EE3A 1JJ2R 2DKOB 3G2XA 4L75A 1MROA 1RKJA 3ULHA 3KLHA 3FBFA 4YY3J 1AZSB 1FD2A 1KKHA 4KIAA 4QWAA 3DOKB 4PRFA 2RS2A 3RAQA 3NNAA 1KOHA 3KLIA 2KZZA 5KT7A 1EP4A 4DQPA 1JLCA 3OUYA 2CWXA 4DR6J 2JVOA 5GADU 2DGSA 3CCQS 4KGMA 3QRQA 3JYTA 2NXEA 3MEDA 1U1LA 2ZJQQ 3W8PA 2VG6B 4IH5A 2UV8G 3VWSA 2ROGA 1Y10A 2E9RX 4A8KA 1R3NA 3OTBA 1P9YA 3VAIA 5E7OB 1F5CA 5ETKA 3PG9A 4B17A 1NAQA 2PFFB 4ZVGA 4LR9A 1ZM2A 1T94A 1M5SA 2R8KA 2W9AA 3DGPB 5IFMA 1NZ8A 4R5PA 1U0HB 5KFWA 5D0GA 5CXTA 3KJVA 3DKDA 3W2VB 1LFWA 3W5XA 2B5JB 3GJTB 1SC6A 1VRTA 1H98A 3FBCA 2NQPA 1SCJB 3KUHA 4ECSA 1AT1B 5FD1A 1NKEA 1ZS6A 1IKYB 3TNVA 4EO6A 3LALA 2R9LA 1TUWA 2OEMA 3M9NB 4NEYA 3EX7B 3BBFA 1R31A 3ET6A 3PYDA 4DWIA 1VQ7S 1RT6A 3HHEA 3PEJA 4JI0J 4H4MB 4AE5A 1JJHA 4XAKA 1VQ5S 4ZMMA 1MMNA 3KK2B 4B9SA 4O3RA 3G8TA 3LGNA 4RNNA 4Y65A 1HQEB 2J8SA 1YJ9S 4PXDA 4DFJA 1WSVA 1SQEA 3IR7B 1YWXA 5CYMB 3MWBA 1ZOTA 4EK2A 5HP1B 3IWNC 3H0PA 3M2RA 3V5RA 1UVNA 4I1TA 5A2QU 1DBDA 3AB2B 4FYYB 2IC3A 5JJBA 3FQLA 4DL5A 1QD1A 4IH7A 2XHWA 4R25A 4FYXB 2MKJA 1OY8A 4JI6J 1UA0A 5U47A 4GKJF 5J1EA 2UXCF 3CGIA 1KRPA 2XQCA 2F1FA 3LP0B 1UETA 1HNVA 5AXNA 2OPPB 2MZQA 3M9OB 2NREA 4DQRA 2CNOB 2W2MP 1N5QA 5CD4H 4BLGA 2B3TB 4HACA 1NHVA 1RA6A 2W4DA 1N32F 1URNA 4O4RA 5SZTA 2IJRA 1CG2A 1TKXA 2VG5A 3BYPA 3QFWA 4EWTA 3PJXA 1GAOA 1QUPA 1U2FA 1U1MA 4FVMA 3BSNA 4NEZA 1NJZA 3AHPA 2G2ZA 4TYAA 4DPUA 3TZXA 3GIIA 3E01A 3QQCD 4CLUA 1M1KT 2V63A 4QIVA 4J9KA 2Z0GA 1HNXF 3KLGA 4FBTA 3H4DA 2J7UA 1NH8A 2BRLA 1S76D 4F4WA 2DGVA 4MIWA 4F4YA 2OMOA 5I4MA 4JI4J 3PW2A 3R7SB 1HI1A 3MCOA 3LP1B 1RT2A 4UQTA 5CH7B 1YJWS 2AIRB 1S9FA 2A2CA 4DCJB 2HFSA 3FDSA 2MKIA 2ILZA 3BGRB 2WBMA 4NXNJ 3G8QA 4P73A 5DDRC 3FCHA 3AJDA 2L41A 1G1XA 4UY8T 1LNQA 4C8LA 1NRKA 4B3TJ 4K4TA 1EKSA 1T03A 3D0HE 1KLNA 1U24A 4KHMA 2J9DA 3GPAA 1N56A 3ILJA 5FLXY 2O67A 4CH0S 3QIPB 3N6NA 4B3OB 3HSZA 1MWZA 2XWXA 4LF6F 4WKYA 1EQ0A 2KM8B 1JLEB 2PFDA 4XPEA 2DNRA 4FPIA 1H2TZ 1QVFR 4JYAF 2WZ1A 3BDPA 4DV6J 3W61A 2LQ9A 2WVCA 3Q8SB 3CC2S 4RUBA 1T9WA 2NR0A 1FKOB 4W92B 1CQMA 3DLEB 2WB4A 3HSGA 2AJ2A 3GV5B 3B4DA 1S0MA 3HHDA 4X4RA 3DOLB 5KG2A 1YLXA 5CZVA 4J90A 5DM6Q 3CDEA 1LV5A 1YIJS 3FCVA 4FVCA 4ZK7M 3EDQB 3QJLA 3B4MA 1R8PA 3DOKA 2LU1A 3ZNUA 1IM4A 2FHKA 1NK5A 3AJ1A 3R5DA 1ZM4A 1YGYA 3GR0A 2FUG9 2NYIA 1VRQC 2Q66A 2V2KA 3J81U 1D0EA 1TU0B 3PZPA 3CJ0A 3H2UB 1Q8IA 3GSDA 3F41A 1R0AB 4ED8A 3UFCX 1TP7A 4OLPA 2QA1A 1R7IA 4F4KA 2C2KB 5ETQA 5KFOA 5F8MA 3N01A 4CO3A 1Q95G 4B3MJ 2RD5C 4HTIA 1IJEB 3ZZYA 5AJ3F 4YMEA 3MM6B 3RG6A 2ZH3A 3HLUA 4LFCF 4ECVA 3DGPA 1U0HA 2VBWA 3W2VA 1PC4A 4F50A 5H9FK 2B5JA 2AX1A 4RW4B 4DSIA 4FNIA 4ZCIA 3DDIA 2ILYA 4LMZA 1ZTWA 1IKYA 3OTDA 3UD3P 1VQOS 3SQGB 2H5IB 3R1HA 2Y1RI 1HNZJ 1IN0A 1U47A 4N41A 3L3CA 2EBGA 3O5TB 5F8LA 1N33J 4LBPA 3OTCA 1MSWD 1K73T 1HQEA 2QA2A 4KGKA 5CYMA 2GMHA 4JI3J 5HP1A 4WF9Q 2FQQB 1LWFB 5J2MB 2IBKA 2M8DB 2K1RB 4KT0C 1XEZA 1RLDA 2IM0A 1S6QA 3QGIA 3CJ3A 3MMBB 2O3DA 3PXGa 1KVIA 1KN6A 1WI6A 2NXUA 4U7UK 3GMGA 3MCMA 4QWCA 3HHLB 4IOAQ 3TVYA 1P9QC 4FS2A 2W7PA 4F3OA 3CCWA 2OPPA 1Y5LB 2E5IA 4P72A 1ZAVA 4IQMA 1XMQJ 1U1KA 1SJ1A 4ETXA 3A8KA 4DQIA 4FKXA 4TQSA 1X5OA 3KOAA 1RWPB 4IFVB 3I32A 3WZ0A 3H5SA 3KG0A 2OLWA 4DSKA 2BA9A 3A4TA 1HHQA 1QAXA 2DO0A 1Q8BA 3AXMA 1F1BB 2DNHA 5H1SV 4UTGA 4EGLA 1IBKF 2IA0A 2A3JA 4GMKA 1NJYA 1XJWB 5EN1A 3FGVA 1RT3B 3M1VB 2ZJRQ 1RTDB 3HI9A 3JQJA 3KJQB 3NMAA 1DHMA 4C3LA 5KFXA 2I5JB 4ID5B 3LA0A 1RI7A 2ZHOA 3PRDA 4HT5A 1JLAB 1DZ5A 3DMJB 1OYEA 5DG7A 3RB0A 2M7SA 2IA6A 2XO7A 4MYUA 3DRRB 1ACMB 3NLCA 2JEFA 2KFYA 1N0VC 2J9DE 2YKMB 2CNLB 1YBTA 1CJTB 1S7HA 4PABA 2BQRA 3UNYA 1N48A 4U96A 4WFNQ 3LP1A 3UN5A 1REVB 2Q6BA 3L09A 4CCHA 1VIOA 3HSJA 1FNOA 3NCQA 2R2SA 3BGRA 3M6VA 1G2EA 2FVPA 1FWLA 3GFXA 1S77D 5A8RB 5LSRA 3R6LB 3RRGA 1FKAF 4CO2A 3SFGA 2R7VA 4LSLB 3V4IB 4EBEA 3IN5A 2ATCB 2B9XA 1FT8A 1U45A 3M8WA 1Y0HA 1NK4A 3MTJA 2HNDB 1A7GE 1B4SA 1LW2B 1NB2A 1XR5A 1QE1B 3EWGA 4RZRA 4ZITA 4MTPA 1Y3JA 1P8GA 2DCLA 1SH3A 4L3KA 1KD1T 5KFDA 1FWKA 2HW3A 1J27A 4ED5A 1H72C 1F0XA 1PBAA 1QSSA 1JLEA 3UPFA 4X4QA 4Q45A 3OBIA 4DR3J 2HLUA 3KKFA 5D0EA 1HD0A 1RAJA 1DJ0A 3R27A 3I4HX 1N5VA 3BEGB 4YHHJ 4KAIA 1O5JA 1FKOA 2E66A 3DLEA 5KFBA 3MAQA 3IM9A 4LF4F 1DTQB 4LFBF 2DK2A 2QFJA 2XMMA 4K0KJ 1H6KX 3DOLA 5L39A 2D3OR 5DQGA 5I3UA 2CPHA 3PCOB 2OFHX 1J5EF 3KMSA 2VFTA 1FX4A 1RAIB 3TX0A 1FNXH 3M8ZA 1SH0A 3US5A 1R89A 2G9OA 3M4XA 4DPWA 3GG1A 4C98A 1K8AT 4JI7J 2N3LA 1L3SA 3Q24A 3CC7S 4YB7A 2Y0BB 3SCKE 4WP8A 2HIQA 3D4JA 1R0AA 2BJ8A 1C0UB 3PM9A 4KH0B 3WDOA 2CADA 2OPRB 4USVA 3GFYA 4OZJA 2XMAA 4OX9J 2NPFA 1FEHA 3SIPB 4ZOSA 4P2FA 3RU0A 2JVRA 1XN9A 2ASYA 3AQOA 3BSOA 2OHDA 1UAWA 2IM2A 3H40A 1Q78A 2JEGA 1HHSA 2F40A 4RW4A 2CNKB 4EEYA 3MMCA 1B70B 5HO4A 1NPPA 4ELVA 4KO0B 5ADZA 1TVRB 5KFHA 3SQGA 3P5BP 1CLFA 2MZRA 2N7CA 4X4NA 5I42B 2L9WA 1PGZA 2MQ8A 3JTPA 4QBUA 4DSEA 2G0CA 4PWDB 1EARA 4UY85 3QT7A 4Y28C 4GRSA 2JH3A 1X4GA 2YY3A 3MXHP 4ECQA 1DAXA 1VQ6S 2GHVC 2UV8A 3P49B 3W3SA 1Q5YA 4K8RA 3UN3A 4WFBQ 2NUUG 4OV6A 3W8GA 2E9ZA 1KSPA 2ZH7A 1LWFA 5J2MA 4IRDA 2WSEC 2KT5A 1TUGB 4O23A
chains in the Genus database with same CATH topology
2B4PA 3LH2S 5DGBA 2R7QA 1WF2A 3SSSA 1TL1B 4NLTA 2CQ1A 4NYOA 5HQ8A 4DEZA 5ITHA 1XC9A 5DS7A 3P3DA 4RW8B 1FJCA 1OQ3A 2RVJA 3C6UB 1D9FA 3CJ4A 3KWMA 1HQUB 3HT3A 1OQ6A 1D3WA 2K3IA 3NS6A 1Y7PA 1Q8LA 3PIOQ 1K9MT 2FIUA 4LQ9A 4K4UA 1GQEA 2IM3A 4NRTA 3WBZA 3LWLA 3KHLA 4ZPCA 2VODA 3TAQA 1F60B 3HHLA 2N3OA 4RW7A 5GVQA 2KI2A 4CO5A 3H2VE 4C2MA 2V4JA 3HXMA 5K5MA 1AUDA 2C3PA 2QE5A 2OPQB 2DHSA 2YKPA 4QWDA 2MSTA 3M32B 2EG2A 3HP6A 2RRAA 1TK8A 4BWMA 1FDAA 1VK8A 2DNLA 2ZZNA 3FNNA 1KOOA 2J7WA 1T8EA 4GO7X 1FHTA 1S4FA 2VBZA 2YWHA 3QGHA 2WTFA 1IKVA 1YG0A 2VPWB 3NCPA 4C11A 3W2WB 4CTAB 5LSLA 2GQCA 4I2PA 1WD6A 2W24A 2OFGX 5L9NA 2Q43A 1AROP 3MD1A 3DM2A 4H4MA 1LW0A 3OTEA 1DRZA 2KG1A 4K4VA 1RK8A 1RT7A 1Z2LA 3EGWB 3MM5B 2HFNA 3NS5A 5GAEI 3J7Z5 1U1OA 2ZFHA 5A8KB 1S9GA 4NLSA 3CPWR 2UVUA 3ONQA 2CJKA 1T3OA 3L7OA 2WONB 3KK2A 2KB2A 2LDIA 2RQ4A 4RWXA 4DN0A 3M9MB 4PR6A 5AE3A 1M5HA 2VD3A 4NCBA 4IFVA 3N6LA 2D9PA 2MKCA 4DV2F 3ZZPA 3SCLE 4DR5F 3T1YF 2AQ4A 1X9WA 2CQ3A 4RLEA 4CH7A 2OTJS 4YUDA 2E5LF 4ATNA 3SV3A 1QLNA 1H2VZ 4EYIB 1IKXA 4I64A 1RTHB 4R8UA 5KFIA 1WHVA 2B6AB 5IM0B 3BS9A 2QA4G 2DRAA 2CJ9A 3UR0A 2JEJA 4AFFA 2FC8A 4OZ5A 1PC5A 2DRBA 4LSNA 4O3QA 3KK1B 4AXIA 4MYTA 4EZ9A 4IR9A 3PFEA 3EGZA 4IG0A 2XI2A 2U2FA 2VASA 3AA8A 4DUYF 1Z4UA 4QIFA 2MQNA 4FYDA 4NL5A 2B0GA 2L08A 3M1VA 1IQTA 2ZH4A 3SEOA 1GNKA 3H20A 2FJEB 1RTDA 2DCUB 2HHTA 3C3LA 4I67A 3AY0A 1FESA 2FJVA 5F8JA 3KG1A 2DITA 2CYYA 5KOWA 2YNFA 3TI0A 4RKUC 2HLTA 1HBUB 2I5JA 4ID5A 3LP2B 2IMOA 2CG4A 2J9EA 2MQLA 2RT3A 2CQ4A 3CCSS 2WSFC 4BC7A 2YX7A 2XZWA 5IT0A 4YHHF 1U6BA 2V0NA 1FNMA 2ZOFA 2M5YA 1QAIA 4IFYA 4PQUA 1JLAA 1ZM3A 4C97A 4CNZA 3THVA 3AQPA 3JSRA 3LP0A 3T6JA 3DMJA 2A2DA 3OXFA 4E0DA 2HZCA 1S1WB 2Q3PA 4BHQA 1YI2S 1QSLA 5K14A 2QA4S 3HHKA 3R5CA 2ZBIA 3QAUA 4I4BA 2QT7A 1IQZA 2VBYA 3G96A 3U1LA 4D3HA 2BXJA 1HBMA 4ECTA 2XMVA 1F5AA 2HRYA 4F02A 4HDGA 2UZAA 1X9SA 1FRMA 3FSXA 3J80Y 4DUZF 5CZXA 3J7A1 3KLIB 2YKMA 3GILA 1FDNA 2KKHA 4DDFA 1H7XA 5IXUA 4RU9A 3I9ZA 2BRKA 2XCPA 1N5TA 4K5RA 1PILA 3DRYA 4B9LA 1JLCB 1MWYA 2ZC4A 1JK9B 4Y34A 1MNEA 1TK5A 5LT5A 2M2BA 2KT3A 3OUYB 2E1RA 2W8KA 3M2VA 3I55S 1SL2A 1TZ0A 3TAMB 3GIMA 1YJUA 1KFSA 2GW8A 1UFWA 1LK7A 3NMRA 2F7VA 1F5BA 2KHCA 5D78A 5F0UA 3D1OA 2XGQA 2KYXA 3JYTB 1M5OC 1HNWF 7FDRA 1A9NB 1REVA 3MEDB 5C42B 1M90T 1XERA 1YJTA 4WFAQ 2YWEA 4IOBA 4UUXA 3UQSA 2CJBA 4URGA 3OXLA 2XLIA 2DNNA 2DH8A 2B56A 3MM9A 3OHAA 2EFGA 2ZOGA 1RKIA 2LYVA 2AJ4A 4MKYA 5EDWA 1YJNS 4ZP6A 5H9EJ 2PMZD 4WKRA 5J2QA 1FTRA 4LF7F 4JI7F 4ETZA 3V81A 1U1RA 4BBYA 4RNMA 2A18A 3VQTA 1S0NA 3CIMA 2ADCA 4ED6A 3V6DB 5F3TA 4YEAA 1ZM9A 3Q0AA 5A8RA 4I6WA 5J2PA 3NG8A 1JIHA 2PDAA 4F25A 2L48A 4Y0FA 3G8SA 1JMTA 2CPFA 3DLJA 3T5HA 2JDJA 2W9BB 2FHJD 4JI2F 4IKAA 1C4AA 2HHVA 3EGNA 3V4IA 2RU9A 2CZVC 4DX8H 1GT8A 2C3UA 2DR8A 2VFVA 1DARA 2GIQA 4DV1F 2D1CA 1S1TB 2HFZA 5E33A 1LWEB 3BZQA 1FVQA 2I1RA 4YR3A 2MQOA 1HWLA 1JX4A 2VH7A 1S6QB 1JLGA 1HA1A 4HKQA 2CQDA 1FDDA 3GFHA 1UKUA 3CSKA 4OX9F 4BCAA 3M8QB 3KHGA 3KJVB 1D9DA 3FMWA 3MEEB 2IAJA 1S72S 2HNDA 3MDFA 3AAWB 4ZDNA 1LW2A 1LQ9A 4Y2MA 4QIGA 1RGVA 3ENWA 1UJ4A 3K5MA 2OKQA 3UWTA 2OIHA 4J9SA 2VB6A 2FY1A 1VRTB 2MB0B 3K8VA 4AUKA 2VQFF 2R7XA 3CO9A 4X4UA 2PIIA 1XWLA 3NBPA 4FNHA 3B8HA 4IDKB 4ZPAA 2AD9A 2M52A 1ZBTA 2VFSA 3QLHA 3IXQA 1VOMA 2E1CA 2M70A 4JBCA 4A47A 2CPEA 4ZS6A 1N5SA 2W9CA 3THTA 1AW0A 3LQVA 5IT9Y 1SXLA 4KFBB 2HGNA 2XG8A 3I0SA 1YTYA 1FA0A 2CKWA 2PMHA 5LMUF 4B9VA 2VKZG 1W25A 5CQGA 1Y00A 4K2XA 3KK3A 1RT6B 1H0HB 1I6JA 4IH6A 2B4UA 1RT5A 3FJ2A 3GYXB 4DQSA 2CQBA 4I7FB 1FJGF 4LT6A 2NPIA 1JLQB 1WTBA 2GCFA 2PA8D 2YWKA 2E44A 4U7CA 4FP9A 4N8OA 3ITHB 1J5OA 3OXGA 1JB0C 4OZ0A 4N56A 1U49A 2J9CA 4Q43A 5DRKA 4W90B 1YRTA 2O1PA 3M8RA 1VQKS 2IFXA 2EPIA 5CA5A 4DSLA 1Y9OA 2B7BB 1FRJA 3FEZA 4DOZA 5DQHA 4B9MA 3PDNA 3LW5C 3ISND 5T14A 1ZTTA 5AE1A 2Y0SD 4C3MA 1NK9A 3TVKA 4UW2A 3HFKA 1U6ZA 5DG9A 3GIJA 1HW8A 5A8WB 4TY9A 1VRUA 4USIA 2I9SA 4XDCA 5F3ZA 1JKHB 4HEA9 1DTQA 1IKWB 1TKZB 3P5TL 3C66A 2V9WA 1DURA 2FVCA 4MIBA 5KFRA 1X0FA 2F9JA 3CD0A 3LOUA 3M2RB 4HT7A 3I0RA 5KT5A 3KLEA 1M5PC 4OI6A 3IC1A 5I3QA 4IO1A 2FLOA 5EWFA 4OI0A 4A46A 1UVIA 3RRHA 3IAS9 2GA7A 2Q79A 2QLXA 4FN5A 5HI7A 5EWGA 2IC3B 3GE9A 3D0IE 3BM7A 1NK7A 2PI4A 5AXMA 1HD1A 3KLFB 1JWWA 1U2RA 3DDNA 1KQGB 1RTJA 2C2DA 2XCAA 1X4BA 4Y00A 2AJ0A 4J5OA 4OHWA 4Z2XA 2AYEA 5B0CA 4B3MF 4DL0C 3K0JA 4Y2AA 1SKRA 2OD4A 1S9EB 1L5UA 1WG5A 3SXLA 1GX6A 4DLEA 2BDPA 4RNFA 4WXWA 4ZVEA 2J7KA 1L3VA 4DV4F 1T05A 2XS2A 1NU4A 2YNHB 1WG1A 4RW6A 1HL6A 2FJWA 4OX6A 3QIPA 2CVIA 1B0VA 1SI9A 2KTQA 4F2RA 2R7OA 1RISA 1DLOA 1R43A 2DISA 2HG4A 2KRRA 4ZP9A 3DLLQ 4B3OA 2MXYA 2IJNA 2LLZA 2RILA 1RT1A 2QZ8A 3OR1B 3OW2R 4IRKA 3D1HA 1MU2A 3TX8A 1TAQA 3TYTA 2DPJA 2GHPA 1JLFA 4A8FA 3M2UB 2QYCA 2I8EA 2UVVA 2W7AA 2B43A 2IHR1 4TN2A 3CCES 4ZP7A 3TUZC 4YFUA 3PW4A 5KG5A 1VC6A 3OLAA 3QJJA 2UXDF 4MJKA 4LJMA 3K8WA 4URQU 4K59A 2XLJA 2YX1A 3PX6A 5HMZA 4WZQA 1C0UA 2CQCA 4KKOA 2KVIA 2ZD1B 3OFEA 1RA7A 1V9OA 4LFAF 2KXFA 5LJ3Y 3FEYB 4G1IA 4DFMA 1L3TA 3VAGA 3PX0A 3LUYA 4GC7A 1U26A 5BYQA 4XK8C 5E3CA 2UUTA 2ZKTA 4J9RA 3K2YA 1WEYA 4WFYA 5CHCB 1RYSA 1BQNB 2JFDA 2XMWA 1G6BA 3MM8B 4OL8A 3NNHA 4KC5A 4QYZJ 2FTRA 1JXEA 1N0UA 1PSDA 1FRXA 1TKXB 2A10A 2K3KA 2ZHBA 3LGMA 1T02A 3MM7B 4RUCA 1YHQS 3OVBA 1Y4ZB 4CO1A 1UEUA 1X8DA 2VG5B 2KH9A 2Y1IA 2CPDA 1NJIT 3BSAA 1N33F 3JTNA 1S1VB 2P9GA 2VFUA 3BQ1A 1HI8A 1HYSB 4LVNP 3CD6S 5HBMA 4TU7A 1NK8A 3NKYA 3FZ2A 4QR0A 2MJUA 5T7LB 3ZC4A 4YOEA 1ZPVA 4EFAC 2XMJA 1U1QA 2LU2A 3QAEA 1XNQF 1FK9B 4IR1A 2FJDB 1UWBA 3M6XA 1LOUA 2XULA 4V19J 3WC2A 2ROPA 1LXJA 2V4RA 1N54B 1E6YA 2JOQA 4ED1A 3CXCR 1P1LA 3S8SA 2ZH1A 2MJNA 3PO4A 4JI3F 3E01B 3KHHA 3CJ5A 3BREA 1NK0A 2BQUA 1YITS 2OTLS 4MFBA 3DRPB 2OSQA 2XSJA 3ZZZA 1VBXA 1FJ7A 1KTQA 5FDLA 1H3DA 1HWIA 1UVKA 4B9NA 1NK6A 2BACA 1VK3A 1X4CA 2EW9A 3DXBA 3HVTA 4ICLB 5EHHA 4PG4A 3R3TA 2JLGA 1JNRB 2LQBA 3D0GE 2FLLA 2E1MC 2OO4A 2C22A 1S97A 4PPDA 4ZPBA 2O5DA 2ZJPQ 3KLGB 2XMUA 3IG1B 3EPGA 3IA0A 2EG1A 1RT4A 5IZHA 2FHOB 1BQXA 3P6YC 5G0RB 3V2UC 5I42A 4ZP8A 3EUNA 4WE1A 4ZHRA 5KFKA 4ED3A 2EI5A 3L7PA 3TA2A 3G71S 2BW2A 1FKPB 1SB6A 1FDBA 3KHRA 5MAOA 3MFIA 4PWDA 1FRLA 1SJQA 1XR7A 2FGCA 3H25A 3K5NA 3OV7A 1HWUA 5GAHU 1RWUA 2DHGA 4H4KA 4U67Q 1WELA 3H5UA 4Y2IA 4BC9A 2AGPA 4M95A 4C7QA 5C25B 2UXBF 2YNGA 3Q23A 5KFCA 1SKWA 1HFEL 4Q2MA 4CZCA 1HW9A 1RT2B 2HS4A 1TQLA 4FXWA 4O44A 1N36F 5KG1A 2XNRA 2HPUA 1S0OA 4ZPVR 4DL6A 2HHPA 1XMQF 3B82A 2HNZA 1KC8T 4CT9A 2XS7A 2FPHX 1ZZNA 2EKYA 2FDNA 3CJKB 1G3OA 3VR1A 1N5YA 2UVRA 4OHXA 3MM6A 3MPWA 3MEKA 1TL5A 3UCGA 5DDQC 2E29A 4I2QA 1O0PA 1CQNA 1X7VA 2MQQA 3HVRA 4QU7A 4NLWA 4E8UA 4MMOA 2BE2B 3EYZA 2KFZA 1EETB 1I1GA 3HVWA 3CMAS 2P9CA 3KG4A 1TL1A 4HH0A 7FD1A 3VAFA 2LQJA 1ZYQA 1TR0A 4FF4A 2UUBF 4NA3A 2BZ2A 3F44A 4P7TA 3C6UA 4RW8A 3DYAB 2AP6A 2HHWA 3J7ZT 1HQUA 3AJ2A 1ELOA 2WW8A 3BO2A 2LEAA 2ASLA 4A48A 5B09A 1R8BA 4HHJA 4LF5F 1RJJA 2YQ3A 5I3UB 2FJXA 2BBEA 4A8XA 4HYKA 4NPOA 2EWHA 3DHXA 2BQ3A 1SL0A 2BABA 2KFNA 4ZCMA 2NUHA 2OPQA 3CD5A 5FIIA 1T03B 4OHVA 1SUQA 3M32A 3FMBA 3UDCA 3NGDA 2YNIB 4RBTA 1WF0A 2D41A 4OMFG 2KYZA 1VQMS 3MUTP 3DCAA 1NKBA 3H5XA 4DR4F 2B4VA 2FVQA 4CTAA 3W2WA 4NLVA 2DGWA 4C0OC 4TLRA 1W2IA 1Q7YT 2MGZB 1VGYA 1NZAA 1KS2A 1XMBA 3MM5A 1UEVA 1SJ3P 2MYFA 3DLGB 1S1XB 2MHEA 5A8KA 4PQAA 4DS5A 4C0HA 1S49A 2B9WA 4EBDA 3I5BA 2WHOA 2JHEA 3HVAA 5E3RA 3MEGB 4TY8B 1OPZA 2WONA 1E6VA 3I5CA 2N4CA 3THPA 3TANA 4RUAA 4X62F 5GADI 3BO4A 4LF9F 2V8DA 5KOXA 2GX8A 2C42A 2VUGA 1N8RT 1HR0F 3TVZA 4ES3A 2VQEF 1BD6A 2VC0A 3TOQA 1UJ6A 2BANB 4DV3F 1VQ9S 3IWXA 2DGTA 3SI8A 2G4BA 4C3KA 3GZ7A 1RTHA 1GTEA 4RBVA 2B6AA 2H9ZA 2KG0A 1YBAA 3RZAA 4B3SF 2YKNB 4FS1A 4J9QA 4NLGA 1VQPS 4M5DB 5D4PA 2ZC3A 5HLFB 3KK1A 1JLBB 4B08A 2L3MA 4RW9B 4K5SA 2BUNA 3IBWA 3CF5Q 2K1RA 4IG3B 3OSPA 2BM1A 3HZEA 4G3IA 4DR1F 5B0FA 4TU8A 2EK1A 1TKDA 5AE2A 2FVSA 3MMAA 1AFIA 3MGJA 2GFFA 3SDEA 4AQYF 4ZCLA 3MMBA 3DXSX 1Y3KA 4WYWA 4X66F 4K50A 3TP2A 2B9YA 3C2PA 3MR2A 3R5AA 4ID8A 3M8PA 2GGPB 2HVHA 1L3KA 4N5SA 3MR3A 1SL1A 5D4NA 4YDXA 4OI3A 2GHWA 4EYHB 2Y1JA 1FRHA 3HO1A 4NLUA 1JJ2R 1CC8A 4I69A 1FEEA 3B78A 1YVFA 3IWLA 1VQSA 2B7CB 5B0AA 2JSXA 1MROA 2AYMA 2C3OA 3PW0A 3VAKA 1RKJA 1R8CA 3I87A 3I9V9 2BR0A 1FTCA 3N4WA 3ULHA 2QSFA 3KLHA 2X1AA 2MPUA 2X3GA 1FD2A 2PT0A 2VG7B 2PO4A 4Y3CA 4F4XA 4KIAA 3MUVP 4QWAA 3FZBA 3DOKB 3MMCB 1NH7A 1M5KC 1UVJA 2E7WA 3EXYA 4PRFA 1BQMB 5GAGU 4NLPA 2RS2A 3RAQA 3CDUA 4KBIA 3NNAA 1KOHA 1IJFB 2J0WA 3KLIA 4DR7F 2KZZA 5KTQA 2PSZA 2YKQA 5KT7A 1EP4A 4DQPA 2HHXA