3DNCA

Carboxysome shell protein, ccmk2 c-terminal deletion mutant, with a closer spacing between hexamers
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
IAVGMIETRGFPAVVEAADSMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVSAGIEAANRVNGGEVLSTHIIARPHENLEYVLPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights from multiple structures of the shell proteins from the beta-carboxysome.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Structural protein
molecule keywords Carbon dioxide-concentrating mechanism protein ccmK homolog
total genus 20
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dncA00
4OX7A 3SSQA 3DN9A 3I96A 2G13A 3N79A 5DJBA 4DDFA 3SSRA 3I6PA 3DNCA 2A10A 4RBVA 4OLPA 3VCDA 3BN4A 2A18A 2EWHA 3MPYA 4QIFA 4OX8A 4QIVA 4AXJA 4PPDA 3PACA 4OX6A 3H8YA 5L38A 3CGIA 2A1BA 3MPWA 3NGKA 3NWGA 4QIGA 3SSSA 3IA0A 4AXIA 4OLOA 4P2SA 4P7TA 4RBTA 4QIEA 3CIMA 4RBUA 4P7VA 4LIWA
chains in the Genus database with same CATH superfamily
1G3OA 2ZJRQ 2GNKA 3ILLA 3QFHA 2BKPA 1DTQB 3R9LA 3G96A 4LF4F 4I0WA 2AEFA 5JXSA 1XNQF 4FVMA 3DGVA 3I5AA 1WF1A 2P8IA 2RKIB 2YWKA 7FDRA 1V3SA 1M0SA 2O1PA 3T9ZA 5DDRC 1NHVA 2XULA 1KS2A 2XO6A 3CMQA 3UW1A 3G6XA 4USKA 4DQRA 1PC5A 4IO9Q 1JLQB 3LGNA 1OQ3A 2B8QA 2QA1A 4QIVA 4GVLA 2V2VA 2UZAA 4ZP6A 3T19A 2XMMA 5ETKA 1CLFA 1I5OB 3NGTA 1N32F 4P73A 2QT7A 3THTA 4CLZA 1HLWA 3G6YA 1LK7A 2IA6A 4P2XA 4UY8T 3PX4A 1BUXA 2EC0A 3IA0A 5M2PA 3KK2A 2RD5C 3QAUA 4KBIA 3ITHA 4KH0B 3IR6B 5GAEU 2Z30B 4GO5X 5HAOA 4OZJA 3C46A 3AB2B 3NCRA 4RW4A 2BW7A 2LQ5A 2E1RA 2OPPB 2YNHA 4ECRA 2OFGX 4NASA 4OYZA 2DVIA 1KNZA 3MECB 1JLFB 2RQCA 1S57A 5DM6Q 1FD2A 2B4UA 4CO3A 3P3DA 3HJFA 4NEYA 4ZVRB 2HFOA 4YB7A 3QIPA 2P2CB 1FTRA 4RW9A 3CCJS 5HQMA 4ECVA 1SJFA 4ZIVA 2L9WA 3CCUS 1S1VA 1KVJA 2HZVA 3HD1A 2V2QA 3CD0A 4O3NA 4DR2F 4X4VA 4P2FA 1LV5A 4QIGA 3P6YC 3OTCA 1WC4A 1SC6A 1NUEA 3CCZA 4ZP7A 3TJAA 1FRKA 4ZK7M 2E44A 3OR2A 4TQSA 4ED8A 1ZTTA 2FLLA 4JI6F 2J9CA 3M32A 3P5BP 1R8PA 2DEJA 4P7TA 4PAAA 2PMZD 1QAYA 3IMQJ 3M2RA 4CTAB 2BMBA 3D1OA 4LSNB 3OJUA 2MKYA 4IOCQ 2VU5A 1T9WA 4ZVOB 1U2RA 1MU2A 3R27A 3FBEA 2QEXS 4MFBA 3J80Y 3EGWB 3IO1A 2QMWA 4DZ6A 3TAQA 3DOKB 3MM9A 4ES1A 1NH7A 3K57A 4HEA9 3HSDA 4NXMJ 4A8KA 1PILA 2ZHAA 2YY3A 3SDEB 1R6YA 3GJQB 4EO8A 5JJBA 3V4IB 4DR1J 3AXKA 2ZJQQ 3AOAA 1HNXJ 4Q45A 3W3SA 5K8OA 4MIAA 3LWLA 1WF2A 2D3UA 1R0CB 2D7SA 1Z1ZA 3V6KA 2HQFA 1CG2A 1TKXA 2BKOA 2MKHA 4LBIA 4K4YA 1RKJA 2CZVC 2CPYA 4PQAA 1KHWA 4M5DA 3KDNA 3T6JA 5T14A 1KLNA 2HHHJ 2C42A 4M5HA 4WK1A 3VAMA 2PT0A 1S0MA 3KJQB 3EX7B 3CTRA 2OMOA 1ZETA 2W7OA 2XZDB 4RLEA 2IC3A 2K06A 1IVZA 3FVYA 5J1NA 5KFQA 3AQPA 1RT2B 3PHEA 3C15B 3DLBA 1NBEB 2JNJA 3CJ2A 5KOWA 2J8SA 2ATCB 3E8OA 4ZP9A 4OJ1A 5I3PA 3KHLA 1H38A 4PQUA 1UP1A 4ED7A 3HLUA 3C3LA 1FDAA 1BQNA 3MZIA 4I6YA 3Q23A 4DFKA 2DGTA 1KONA 1NLKL 3JSMB 5BYSA 1IQTA 1JIHA 8RUCA 1SQFA 2XGPA 4CO4A 4XPCA 1HBNA 3LUYA 5KTQA 4IRCA 1DJ0A 1N54B 2GHPA 2BA9A 2MQNA 1S9FA 1HQEB 2DTJA 5LT5A 2VOPA 2J9DA 5ADZA 3HJVA 2XLJA 2VG5B 5DGBA 1HWLA 3BGRA 5E41A 3OQ2A 1DAXA 2C3OA 3LPYA 1OO0B 4YDXA 3KLFB 1BE4A 1H73A 5DRKA 3FEXB 4ZPTR 3ENQA 1HI0P 1T7PA 1A0OB 5I4MA 5DQIA 1S7HA 2R2RA 1NEEA 4ID5A 3UDCA 3MM8A 1XMBA 4USVA 6FDRA 2FJEB 3PYDA 6AT1B 4AQYF 3T3FA 2MZTA 4IR1A 2R42A 4ZJOA 4PQUB 3I0SB 4USTA 1J5OA 3CD6S 5E7OB 1RT1B 1C0UA 4O4RA 1VOMA 3H0PA 2R7RA 4QOTA 4DI6A 2HZAA 3EE3A 4PWDA 4JI3J 1TMMA 1OWXA 3LA0A 2HGLA 5K8NA 3SSRA 4BC9A 1AA1B 4BC7A 4X4SA 3I32A 1VQ9S 2V50A 1FRMA 4ZPWR 4IG0B 5DO2A 1OYDA 2LCWA 2AHOB 2R3VA 3E01A 4HI2A 5LMNF 4A8YA 3OSPA 3HSJA 1RHRB 4LT6A 1VRTB 4PG4A 2DR5A 1S0OA 3CCSS 3WBZA 2KVIA 5KT2A 2JEJA 1FJCA 2ROEA 3K5PA 4I2QA 3NOGA 4DSLA 2W9BA 1VIOA 2QLWA 3UN2A 3PNIA 5SUHA 4JYAF 1HNVB 1LK5A 1X5PA 2E7WA 3MTKA 4LSZB 5KG3A 4F02A 5AE3A 2EK6A 4FYXB 1NXIA 4LBHA 1CPZA 2E1AA 2AJFE 5DLGA 5FDLA 3H40A 2AD9A 1CJUA 2FD2A 3NP5A 1HA1A 2AIRB 2Q6BA 3BN7A 3NKYA 3QATA 4LSLB 5G0RB 3SQGB 4NWBA 4F0HA 2ZH4A 5DQGA 2DO0A 2XZWA 3DDKA 3HULA 1IM4A 1S1VB 1TUWA 3D67A 3AH6A 3I56S 4C11B 4LF9F 4IR9A 3RB6A 2R7XA 2ZWOA 1SUQB 4ZVSB 4LUBA 2CPFA 4DV0F 2RH3A 8AT1B 3M6WA 4D3HA 1KN6A 4R0JA 1FT8A 3WX8A 4WWSA 1TQLA 3W9IA 1RP5A 1K1QA 3O8WA 2UUWA 5B0EA 2UVVA 2LXIA 2VL1A 4U8YA 3OHBA 4Y2KA 2EG2A 3M2UB 4JI2F 3OUYA 4HACB 4EEYA 3P5TL 3LOUA 1DURA 1FEEA 2GMLA 3LGMA 3MMAA 5KOXA 1RTDA 4FXWA 2F63A 3AD9C 4ICLA 3ZTOA 2RS2A 1N48A 1YJTA 3C19A 4DL4A 2RQ4A 2CNKB 1CULB 2UUBJ 3MWBA 2KT3A 3VVUA 1FVQA 1OYEA 2XG8A 4IFYA 3GV5B 3FNNA 2BEFA 5J1EB 2L48A 2RUSA 1N32J 2G4BA 3Q8SB 4HKQA 2N3LA 3CJTA 4XAKA 1FJ7A 4F8RA 1WORA 5DG7A 2G2YA 2B5JB 1RTHB 4K59A 4Q0BA 5I3UB 3K2YA 1KBRA 2HAFA 1HD0A 1RWNB 2LU1A 3TRGA 4B9MA 4ED5A 2G1HA 4Q7AA 5HMWA 5HL7Q 1T95A 1PCAA 3M1VB 4JI0J 2FIUA 1RT1A 1OJ4A 3IBCB 4X62J 1ZZNA 4TKTA 4AQYJ 5J2NA 2IA0A 2HBYB 2XWYA 3M4XA 3VGVA 5C2CA 4QWEA 2XYHB 1SB6A 1WACA 2XHCA 2Q43A 3JAMY 3GIKA 1SJ3P 2Y8YA 2XMUA 1C2PA 2XC9A 5HMZA 3OT9A 4CQ1A 2FZCB 4F2SA 3FSYA 1XMOJ 3HMJG 4ZVEA 2BUNA 3O6QA 1OY9A 5IZHA 2G0JA 4FXVA 1UCNA 4JI4J 4X62F 4ZCMA 1W2BR 2GMHA 2FTRA 4K2XA 1HQUB 4X84A 2EKNA 3DC2A 4U6PA 5KFAA 1FI4A 1GMUA 3EMTA 3NY0A 3U1NA 4ZIWA 1MROB 2QLXA 1P27B 5CXTA 3H8YA 2VOOA 4OI1A 4QYRA 3D1QA 3NAIA 2A1BA 2EFNA 3TA1A 5C5JA 3OVAA 5J2MA 4C3KA 1UL3A 1DHMA 1Z2ZA 2R7OA 2FY8A 4X4RA 4FS2A 2RRAA 3EM1A 2CPJA 3J81U 1UZHA 2PC6A 3R1LA 4E2FB 2N7YA 2UVRA 5A0YA 2LECA 4UOHA 1H72C 1NM2A 2KT2A 2DCLA 2CJ9A 2GS8A 1RWWB 1VRUA 3UN3A 4B9SA 5MAOA 2W9CA 1YITS 1H2VZ 1YX2A 4EGLA 2PE8A 4BWJA 3POTA 3H42A 3IAS9 5AE1A 5B0BA 5IM0A 4X66F 2IVYA 3HHKA 5LL6d 3LGHA 2MDAA 1YJWS 2VV5A 3Q2TC 1QAXA 3H2UB 4QWDA 1X4HA 3I0RA 5KFMA 1B64A 3PACA 2HNYA 3OTOJ 2PI4A 1F9FA 1S1XA 2UUAJ 1YKWA 2CG8A 2QL7B 4I69A 1TK8A 4JI1J 1QD1A 3CDEA 3D3CJ 3CVKA 1H74A 2GV1A 1B4SA 1HBOA 4OYIA 3S7RA 2D74B 3U02A 5DDOC 4TLRA 4FYYB 1AUDA 2D9OA 3OL8A 3MUTP 4DUZF 3J7AN 1V3RA 3B4MA 2MKSA 3TVZA 4ZHRB 3QMQA 4DR3F 1FKPA 2JZ5A 4IDKB 4NLOA 4BS2A 1R31A 1P8GA 3VAJA 2IDEA 4CLKA 3VAIA 3DOKA 3KNGA 3MM9B 3A8EA 1VC6A 1IUJA 2NXEA 4TY8B 1T03B 1FTCA 2O67A 2MGZA 1FXRA 3SCIE 2NS1B 1SXLA 2LEAA 4AL7A 4ECYA 4K4UA 2W8KA 4NA1A 2AGQA 3TNVA 3QQCD 1U45A 2R7VA 2BACA 4I64A 1XJWB 3HD2A 4UQGA 3UD3P 2Y3YA 3LP0A 3KJVB 2F4FA 2JX2A 2A0FB 5K9FA 5M2UA 3CD7A 1RT6A 2RSQA 3UCUP 1JJ2R 4Y28C 3BO2A 2VC1A 2YPYA 1D9AA 2OPRB 3HVWA 3WQPA 3KK3A 2GW8A 1S4FA 4LF1A 1YG0A 3BQ1A 3CB4A 2YKPA 1HBUA 4OHWA 4YDDB 1AUSL 1BQMB 1JLAB 1XR7A 3CNQP 4RNMA 2A3JA 2OD6A 4OZNA 5I42B 1ZAXA 3W2VA 5H9EK 3Q8RB 4LF6J 3C6UA 1UVMA 2F65A 4ECUA 3CO0P 4ZHRA 3KLIB 5T7LB 3UWTA 3J81j 2R4FA 1FRXA 2HBZB 1CSJA 1VHFA 3HI9A 2ZJPQ 2HWTA 2AEJA 3L4BC 3R6GB 3A13A 4MFBB 3T1HF 2EFVA 1DQ8A 1RBOB 2M9KA 3N0VA 4OZ3A 3P96A 2QLBB 4NCAA 1IKVA 2C3MA 1Q53A 3M2RB 2YQ1A 4C8ZA 5F0UA 3QZ8A 3ZNUA 2Z56B 1UWBA 3H5SA 3PJXA 4ELUA 3MFHA 1N33J 4ZS6A 4U67Q 2M8HA 3HKZD 1Z2LA 2GVZB 1S10A 2B6AA 4WBFA 2ZH7A 4NRTA 3BDPA 4G65A 2R9LA 2FZKB 2GHVC 5GADI 2VJVA 1FXLA 1FRIA 2RAQA 2K3KA 2G13A 4QU6A 1Y3KA 3OLBA 4CIOA 4R8UB 2VQEF 4ZJLA 1NRKA 1BC6A 5A8KB 3R5AA 1N34J 2CJKA 4V19X 2CPZA 3RU0A 3V81A 4ZCLA 1M5OC 2DISA 4IYQA 1RCXB 5IT9U 3WIUA 1EB0A 3W7BA 3SV4A 4PPDA 3IR5B 3LO3A 2MQLA 4F4AA 1R89A 1S9GB 2DNPA 3CJ0A 3KG0A 3AJ2A 3R5BA 3M8QB 1WF0A 4EK2A 4B9TA 1S1UB 2DNKA 2HLTA 2CIMA 2FJWA 3GONA 3UNYA 1X0PA 1YRTA 2V8DA 2NSBA 4NLRA 3LP1A 1O0PA 2L3MA 3FEZA 3PRBA 3PYEA 2VQEJ 1QAIA 3HHLA 4TU8A 1X4DA 2Z2YB 1WKLA 4DPXA 5F8MA 3MCOA 3Q8VA 3HHEA 4NL5A 5DG8A 2C2KB 3DXSX 4QWCA 5I3QA 1NHKL 4B3MJ 1JLCA 3IWNC 4DX8H 5LSRA 3TYTA 3W62A 3T1YF 1Q95G 3IRXB 4X4NA 3A3NB 4ECZA 4O44A 4EUVA 1B7FA 3BGLA 4DV6F 1DQAA 3VCDA 4LRCA 2OPQB 1CVJA 3SZ2A 5J2QB 4NCBA 2V8GA 3G4SS 3ZXWA 2AX0A 1X4AA 2ROGA 5D77A 2W9AA 2ASDA 2FQQB 1UPPA 3V5RA 3R5JB 2XS7A 2GQ2A 1LNQA 4X65J 5KFHA 5KFWA 1M90T 4X2BA 5FIIA 3V81B 3TAPA 1NK8A 2E29A 3MOZA 4IFYB 1WC0A 2ASLA 1D9FA 5E5NA 1I6JA 4JI7J 3AODA 4DL5A 4NLGA 2HHQA 3DOLA 5D8HB 3QZ7A 3ZZYA 2FVPA 3QGIA 1TTHB 2GHWA 3SQGA 2JVRA 3VZHA 3M6UA 4L75A 2R7SA 4TXSA 3DRPA 5AT1B 4C4WA 5K14A 1NK0A 4ZP8A 3D2WA 5D6GA 2DHSA 4OYXA 1NDPA 3PW4A 1PJ7A 2H4YB 2LQ9A 1SC1B 1YSJA 2W2NP 1NDKA 4M5NA 4DUYF 1IKWB 1WEZA 3J7Z5 3JTNA 2O5DA 4PG5A 1JWWA 1TMJA 5GMKa 1JLEA 2G9OA 2DB1A 3C16A 3O2IA 4RW8A 4GO7X 3IRXA 3J80U 4CP5A 2QC3A 1TU0B 2HLUA 4HL9A 2GIRA 2MJUA 4DR4J 2X3GA 2ZNYA 5E3AA 1K0VA 2YKQA 4KKOB 2K7JA 1M5VC 2B0GA 3OL7A 2FVQA 4MKYA 3ISZA 5BYRA 3UO0A 4B9UA 2QL9B 1VBKA 2HS4A 3UR3C 4KGVB 2ZH6A 4F3MA 3M2VA 1N6QA 2LFVA 3ISND 2MSSA 2HK3A 1TV6A 4EI2A 4J9NA 4ATNA 4A8MP 4A8FA 4OZ0A 2C2OB 3I87A 2AJ2A 3M9MB 1N56A 1U6FA 4OHYA 4IG0A 3HFVA 4ILRA 2ZZMA 4DV1F 1RI7A 2YH0A 3D0IE 1NDCA 4U95A 4YR0A 2DNQA 1AROP 1RAFB 2FHMA 2SXLA 2WSCC 3DCAA 3BGRB 5KFSA 3UDEA 1VQ6S 4WKRA 1PYOB 1XIQA 2EPIA 1FESA 2GC8A 4ED1A 2UP1A 2IHR1 1WHVA 4M5IA 2A18A 2EWHA 2RU9A 3FBCA 2P6TA 1H98A 3OXLA 4ES2A 2R8IA 5B0GA 2YKAA 3GFZA 3PX0A 1OS5A 3F41A 4L3NA 4EBCA 4K5SA 3BGOP 3ETMA 2ZBRA 3WC0A 4CZCA 2K1RA 5T41A 1U49A 1VQLS 5B0AA 3THVA 4RPFA 1RQ0A 2V67A 3M8PB 1Q8BA 4I7FA 3LALA 3DRSA 4WP9A 3F56A 4JV1A 4M1KA 3ZZUA 2FHKA 1LW2A 3FGVA 4DU7A 4RBUA 1HMVA 3W5XA 2YKMA 5CZXA 5L9XA 1XR6A 4QZVB 1JNZB 1ZAVA 3N79A 2VKZG 2KI2A 1X7VA 2NCKL 3D3BJ 5KT3A 3JSMA 3BEGB 3OTOF 4XDCA 1NJYA 2UUBF 4LMZA 3BV8A 3PTWA 3UVJB 3PO4A 4IUFA 1CJVA 2V4JB 2CQIA 2HQDA 3G2XA 4OQJA 2CZ4A 3CCLS 1E6VB 1SCJB 2ZH2A 4A4JA 1NKBA 4F3OA 1EKSA 1R8CA 1HQEA 1GQEA 3D1HA 4IH5A 4OYMA 2WVCA 2MSTA 1VRQC 5C25A 4GKJF 3JYTB 2VDHA 4DCOB 3TEGA 2HW3A 1X8DA 2HFSA 3FMBA 2MXYA 2I1RA 2X3DA 2QIFA 4KGXB 5L8RC 2AWZA 2NSCA 5KFJA 1KKHA 4CH1A 5B0CA 1SV5A 2D1CA 4XIUA 4DR2J 3QRPA 4DV7J 2GVZA 2RNEA 2IAJA 2BE2A 2VC0A 2QSWA 2OFHX 3DLGA 3EZUA 1RDRA 1DARA 1UW9A 1VBXA 1VC5A 5HO4A 2YKMB 3D66A 2JSXA 4GRSA 2W7PA 3CCTA 3UFCX 3J7YU 2MHNA 2POKA 2R2UA 1IBMF 2B7BB 5BR8F 1Y5LB 3GP9A 1S6QB 2CJYB 3BH6B 5HP1B 2ASJA 1HR0J 2UUCF 3PFOA 3W9JA 1H3DA 2Y1IA 5GVQA 3VR1A 3T5HA 1N8RT 2OH2A 3RBZA 1C0TA 1N5YB 1E6YB 2D3ZA 5F8HA 3L7PA 3DLEB 4K4ZA 4A8WA 4UQTA 5AJ3J 1U1PA 3KUEA 5I42A 2QA4G 2DHHA 4ECXA 1GMWA 2BQ3A 3PKMA 3HM9A 5BJRA 2DXEA 2F8MA 2KXHA 2AV5A 4IFVB 3GV7B 2NUHA 3AJDA 4AT1B 5JVGQ 1HNXF 2QN6B 4FNIA 5F8LA 2BABA 3B82A 3CCVS 2AX1A 5F8GA 4FZVA 2IYGA 1VGYA 4K5RA 2W1BA 3DDNA 7AT1B 2M5YA 4WTOB 1TK0A 1OMSA 2DNMA 2IM0A 4DV1J 4RW4B 3M2VB 1N6QB 2Y9HA 2YNGB 4LF8F 1A7GE 4X66J 1N0UA 1U26A 3BREA 3SQOP 2AGPA 1RAEB 4M5KA 1ZZFA 2YXLA 2RMLA 1RLDA 3NWRA 5FDLB 5KT7A 2BQRA 1U02A 4Q0BB 1QJHA 2BZ2A 3RTVA 3NGKA 5LM7E 4LF5F 3OFEA 2KT5A 4RW9B 3BO3A 2XWXA 3O5TB 3MOJB 2V9WA 1W2IA 9ATCB 3DRPB 4FXDA 3K0JA 1S48A 2DGSA 3MECA 4GVBB 4R5PA 1GK8A 3AOCA 3MMBA 3TO8A 3SSQA 2IRUA 2WZ1A 2HQ3A 1GH8A 4OZ1A 1RT4B 4RUCA 5KFVA 2H3EB 2CJXB 4O4GB 1X0FA 3C16B 2O01C 4RW8B 3ET6B 3K7RA 1J5EF 3MMCB 2BDPA 4LR8A 3KLGA 5CYJA 1WDDA 4K7QA 4ZN1A 2ZVSA 1TKTB 4DSIA 2KFYA 2J0WA 1VK3A 1O51A 2HGNA 2W7AA 4PXDA 3GLJA 5KG5A 4ERDA 3F44A 3C6TB 3MPUB 4B3SJ 3OBIA 1JLEB 2MB0B 1U7LA 3F0NA 2K8GA 4J9KA 3TI0A 2YNGA 3ILOA 3L95X 1RT5A 3LP2A 1S0VA 3D6MB 1KOOA 3MM6B 1JLCB 2ZHBA 3W5YA 4KR0B 6FD1A 2B4VA 1SJQA 3H4DA 4P2SA 1SL1A 2V94A 1FWLA 2CFXA 1UFWA 4QIEA 1EP4A 2ERRA 1NCLA 4P71A 4U7UD 2NZ4A 4DN0A 1WDTA 4IH7A 1SJ4P 2VBYA 2E9RX 5IQ6A 4NLVA 1PYSB 2QZ8A 3LPEA 2ZH8A 5AE2A 3BO4A 1VI7A 3I6PA 4NI2A 2HSEB 4YY3J 5HK4A 1S12A 2HHTA 2XZTB 4KV8B 3KFWX 2KTQA 2C28A 1WKJA 1VLYA 1C0TB 5DDPC 2DIUA 1Q82T 2P6SA 3LH2S 1N5YA 4KTQA 2QE5A 3GYGA 1FRJA 1RHQB 1T94A 4J9RA 3VZIA 1LXNA 1CS4A 4ITSA 4OHZA 5HP1A 1LWXA 3DKDA 4ECQA 2DHXA 2BJDA 3N6NA 2CPEA 4OHVA 3TZWA 4GKKJ 2DH7A 3CCMS 4Z7YA 1HBUB 4FYWB 1Q8LA 1S1TA 4ED0A 5EX0A 2MLYA 3W2VB 2L9NA 4NYZA 2W4CA 3UR0A 3JSYA 4ED6A 3GB0A 4O0IA 1ULRA 1DTQA 2VDIA 3ETOA 2YVSA 1HYSA 3ZTQA 2G1DA 4DR7J 1AW0A 2HQCA 1JX4A 2XYGB 4DR4F 5C7PA 2VASA 5KG4A 4DFMA 1RAAB 4IRKA 1PC4A 1G2EA 3N6LA 3EZ5A 2MYFA 4Y3CA 3BR8A 3QO9B 4OX9J 2XLKA 3MF5A 2WVBA 1JJHA 2QLJB 1Y7PA 3LF0A 3L3CA 1VS3A 3FDSA 2UU9F 4KAIA 5L39A 1N4LA 4D3GA 1KTQA 2JC0A 4NA2A 2FJVA 5CYQB 4WF9Q 3EXYA 3TX0A 4DR3J 1RT4A 3R5CA 2I6WA 3THPA 3VAFA 4KPYA 3BM7A 2PFFB 1S0NA 3D5MA 4NMXA 3HFKA 3GIMA 4DR7F 3TARA 3R2CJ 4ECTA 5A6WA 2BE9B 2AQ4A 5MLCV 4BHQA 1KQGB 4AFFA 2X1GA 2HHHF 4K4VA 4QYZJ 3VGTA 1S1XB 3TZZA 4A47A 2WONB 1ICEB 3QRRA 1N5TA 4OV1A 4KO0A 4O23A 1S6PA 2C3YA 1F2GA 2RU3A 1PJ5A 1DLOA 1YQHA 4DG1A 5IM0B 3LAKA 1FWPA 2EK1A 3MFIA 3D54A 3QAEA 1LWCA 4TYBA 3QSYB 5A6PA 4QYZK 4B3SF 2BR0A 3FQLA 1M1KT 4M5JA 3TQEA 4PWDB 1S6OA 4G1IA 1CC7A 5ETNA 1Y4ZB 2BRLA 2ZBQA 2J7UA 1KVIA 1BLUA 2R8GA 3MEGA 5C2GA 3A8JA 2MY7A 4DCPB 3CF5Q 1HD1A 1U2CA 3N6MA 1FK9A 1FX4A 5D0RA 1SIWB 3E2EA 4F4WA 2MZRA 2Y1LB 4AE5A 4I2QB 3W5ZA 2HHUA 1CJKA 3PRVA 4S0MA 4QQBA 2OTJS 4LREA 5B08A 1SC3B 1RYSA 1I94F 4DUYJ 3QSIA 3RAQA 3GIJA 3FJ2A 1D8ZA 2E7VA 3QT6A 4EFAC 3OHAA 3SDEA 1IQZA 1UVIA 1B0TA 1QTNB 2HWHA 1S6UA 3FSXA 1HNIA 4C98A 4CT8A 2OTLS 2OJ3A 2DRDA 2XSJA 3QWPA 2ATLA 4MKAA 2M4MA 2UXCJ 2OIHA 1RK8A 3C14A 5C24B 4MH8A 2ACMA 4YUDA 2VBZA 1KLMA 1Q0NA 1FKPB 4M5LA 5D4LA 4ZVTB 5CA5A 1YZ7A 4PUOA 2UVUA 5GAEI 4Q8EA 4RWWA 2BJ1A 4F04B 1B3TA 2JL9A 4USMA 3GFHA 4NZ0A 2B9YA 4V1Ak 4YHHJ 4DR5F 3N28A 1N0VC 1RTJB 3HPOA 2O66A 2OEJA 2P9EA 3G82B 1YWXA 1AB8A 2VQFF 2CQGA 1PBAA 2ZOGA 5J2PB 1ZM9A 4KRWA 4KHRA 5AJ3F 3BS9A 4YMEA 2PA8D 4XO0A 5A2QY 1ZYQA 2JC1A 3MD3A 3MEDA 2HVDA 4NMLA 1WWHA 4L3KA 2NPFA 3C6TA 1RJJA 3RUBL 5B09A 5KFFA 1TUVA 1JLGA 4ZDNA 1CC8A 3L7OA 2ZFHA 4DPTA 4YB1P 4WFBQ 3ILIA 2GJIA 2DJWA 3LP2B 3KHRA 5D0EA 4WCEQ 2BJ9A 1IBKJ 4YN3B 3M1VA 1S1WA 2X51A 5K8PA 1OSCA 4ECSA 4F7VA 5LSLA 1FDDA 4KV8A 3SFUA 1SQEA 3W61A 4DQSA 1RBLA 1NZ8A 2BJ8A 4CRJA 1SVDA 1FJEB 1S9EA 4KHPF 1AFJA 3M8PA 1VK8A 2COLA 4KJIA 1FE0A 3CJ5A 3L9ZA 3OTEA 4MTPA 2PIIA 5K14B 3IG1B 4DLGA 2DHAA 2V5HG 1MWYA 4MKVA 4DL7A 2LDIA 4IOAQ 5D4OA 2R8KA 5ETRA 2Z2LA 2H51B 5KFTA 3A3PB 1HNZF 3CC7S 3BQ0A 2R2SA 2B51A 1FXDA 2CG4A 1FCAA 5B0FA 3W64A 4CLSA 1EAYC 3H2VE 4FF4A 2BX6A 3C15A 1URNA 4LSLA 4NLQA 1F5AA 4WIIA 1UA0A 2YX4A 2NPIA 2CWXA 2B9WA 1X31C 1FDBA 1GT8A 2I2YA 4C8KA 4K4TA 4RO0A 5E3CA 1CJTB 2NXJA 3NLCA 3EJMA 1U6ZA 1QE1A 1WC1A 1RAJA 1TKTA 3VGUA 1H6KX 4FF3A 2AJ1A 2QSFA 2PGCA 1SUQA 2AMCB 3FUYA 2WB4A 4C8MA 1SJ1A 4WZQA 3DOMB 2C2ZB 1NB7A 3MCSA 3DHWC 4RU9A 4CO1A 2OEMA 2YBVA 5D4NA 1LQ9A 1UZDA 5A2QU 3AQOA 2M2BA 2EFGA 2W25A 3BKFA 3PFEA 2DT9A 4DV4F 2BANB 2DITA 2GA7A 3UNGC 2ZM6F 4CDIA 3NMAA 3MPYA 3CC4S 4LFAF 3JSBA 4KSEB 4MK8A 4QBUA 2C3UA 3IXQA 2FHOB 3TR5A 1YLXA 3ZZRA 1PGZA 1ZBTA 2GO8A 2CNLB 2VG6A 5KFGA 5IWAF 4EWTA 4CI0B 1HKAA 2ZH1A 1X9MA 2FJXA 1BHNA 1T9UA 4YS2A 3HHLB 3EGNA 2DR7A 1GX6A 2DNHA 4ZMMA 4K2JA 3TZYA 1Q86T 5KFEA 1IKWA 2Y1JA 2HQIA 2H5IB 2ZE2A 1FO1A 2IJRA 3EGVA 3CW2C 1ZAWA 3G82A 4CYUA 4DOZA 4E98A 2IBKA 4Q5VA 3LQVA 1Q1KA 1C1CB 4NZ7A 3HO1A 4ALZA 5D3GA 1WHYA 4UZCA 1C0UB 2MKCA 2OI2A 4M5MA 3OPKA 3MD1A 4QW9A 3OD2A 4ZLJA 5HJYA 1VJQA 2L9DA 3TA0A 1JLGB 3DLJA 3W66A 5IXUA 1NJZA 3M8YA 5KG6A 3NOCA 2YKNB 4WXOA 5HATA 3QLHA 1X4BA 1N34F 2FGCA 2CQBA 2WVDA 4TU9A 2AF6A 3JTPA 1IXKA 2UU9J 2WCXA 2FC8A 3RG6A 2VB6A 2ZDOA 2MLZA 4KYZA 1Y3JA 5EWGA 2HVEA 3A4TA 5EGYA 2G0CA 4PG6A 1KQFB 3R3TA 3MGJA 3MEDB 3H25A 2KJWA 5HBMB 3LWMA 1K73T 2Q79A 4F3QA 2W9BB 1CJKB 4NXNF 2DK2A 2RS8A 4F2RA 2XNQA 1WOPA 3M8WA 3SMZA 4K4WA 5CD4A 1BGXT 1VQ8S 4CH7A 1TL1B 2CPIA 1B70B 1PBUA 1VQNS 2BVZA 2LP4A 5CD4H 3UD4P 2PMHA 3PZPA 1SH3A 2F4VF 1S9GA 2GO9A 3MMBB 3MM8B 3GQCA 3KKFA 4MYTA 4W4MA 3CULA 3C6UB 2RHSB 4KB7A 1NK5A 4ZLLA 4WFNQ 3G8SA 4ED4A 1F3VA 3KLHB 1VQOS 2JFDA 4P74A 1KC8T 3JB9k 1S4EA 1RHUB 4J91A 4PWWA 1U48A 3QLHB 3OL9A 5ETVA 4OL8A 2JHEA 2RF2B 3WHIA 1Y00A 4QWBA 4CWBA 1KRPA 4OI6A 1GMVA 1NH8A 1Q5YA 4LBPA 5KG1A 2NQPA 2MHEA 4DPOA 2DNOA 2KRRA 2QL5B 4DCJB 3Q8QB 2R8JA 2X1FA 4WKYA 1HWJA 2Z2ZA 2M70A 3IGVA 2CNNB 2XNRA 3TOQA 1PSDA 4LRAA 2A10A 2VIHA 5AXKA 5GMDA 2E5LJ 3JXOA 3JS9A 4NLYA 5AXMA 1C4CA 2VPYB 1JJCB 1Q79A 1HHSA 2KXNB 1VC0A 2HFZA 4TY8A 2QYGA 1UWBB 5GAGU 1T03A 2EBGA 3EVWA 4RNNA 4KGMA 3MEGB 4YY3F 4EBEA 1T05A 3NNAA 3D6FB 3GCXP 3OXGA 4J9UE 3MAAB 3NGUA 3D4JA 3R2DJ 2W2OP 3QPIA 4USJC 3VWSA 4JUZA 4N5SA 1JNRB 2ZC3A 5KFRA 1XEZA 4OHXA 1RYRA 3I9ZA 1KWMA 3FQKA 4F4ZA 2NYIA 3T5KA 2XHWA 4JV0A 4OLOA 2GIQA 2HIQA 2RRBA 4USIA 5IS2A 5KFZA 4LF2A 1V5VA 2OPSA 2ZBIA 4G1PA 1I94J 1M1GA 1RTIB 4LQ9A 4URGA 4OYBA 1YRXA 3DNCA 2J7KA 2W9CB 3DLGB 1L3UA 1C1BB 4LFBF 3UPFA 4NYPA 3UN5A 3NCPA 4MIWA 4I67A 2CVEA 2BM1A 1HNWJ 2UVWA 1X4FA 3DYAA 4J9OA 1O8BA 1U24A 2H9ZA 4Y65A 1J2VA 1UMJA 2V4RA 4CM2A 1PJ6A 1YJUA 1AXQA 1XQIA 2R7WA 2J9DE 3CJSA 5KFOA 4A46A 4G1QA 4A8QA 3FFIB 2GJ2A 1PAEX 3SIPB 3TAMB 1V3ZA 1TL7A 2ZOMA 2H48B 4J90A 4YFUA 4FN5A 2XLIA 3R7SB 2XMTA 3LW5C 5E0OA 1F5CA 2EEYA 3AA9A 3BGFA 4MT1A 1D3WA 4KE5A 2FUG9 3TW0A 1R0AB 1QSSA 5IC6B 3KUGA 4QU7A 2IJFA 2OPQA 2NXCA 2V34A 3P4UB 4WP8A 4C3LA 1U25A 3MMAB 2FJAB 1RTDB 4IDKA 5HANA 1UEVA 2JFKA 1S79A 3I82A 3IS9B 1HPZB 2MZQA 3GYNA 3H90A 4KT0C 3RB4A 1VHIA 1NK4A 4ZITA 2DPJA 4NEZA 4L6V3 2IM2A 4FPIA 2DGWA 2QYCA 1FNOA 1NSAA 2V69A 4GMKA 2ADCA 3IN5A 3K8VA 2QGFB 3OFGA 1TL1A 2B4PA 1ZM4A 4I7FB 4OI3A 3ULHA 4ECWA 4JI7F 3CGIA 2C1EB 1RWMB 3SSSA 2UXDJ 2N82B 1RABB 1KFDA 3NMRA 5A8KA 1U1OA 4M8LA 1CS4B 2V8VA 5KFLA 2I0XA 2OP5A 4LRBA 3GIIA 3X1LB 2KN4A 3D6HB 4WZMA 5HQ8A 3DRRA 2WBRA 4M63A 1GX5A 4JV5F 5IV3A 4WFZA 4BWMA 2YKNA 4DL0C 2E66A 3W1YC 4XPEA 4B3MF 2XMWA 3T1YJ 2A6MA 3ZZZA 1N5SA 1R43A 3H2LA 4ETZA 3CJKB 2R8HA 4C8YA 1WC3A 3B54A 3EICA 3LP1B 4I2PA 3KLGB 2NR0A 1KFSA 2OKQA 1WJ9A 1I51B 2J8AA 1BWVA 1VRTA 2QMXA 1EQMA 1TL3B 3OUYB 2AU0A 5J2QA 4FYDA 2WOMA 1CULA 3VAHA 2EW9A 2Y0SD 1WOSA 5BR8J 1NSPA 5HLFA 1W25A 2FVRA 3H4BA 3PW0A 4GVBA 3DLKA 4HH0A 3LANA 2BW2A 2YNHB 4C8NA 9RUBA 1RAGB 3G6VA 4O4GA 3ZTSA 3R7BB 1UA1A 3EGZA 1DQ9A 2C22A 2HRYA 3T1HJ 4USHA 2GGPB 3VHQA 1UVNA 1WEXA 1S5ZA 2DY1A 2F7VA 1DFDA 1U1MA 4IG3B 3D68A 3J7ZT 2FPHX 3BBBA 2G0IA 3BSAA 2FY1A 5IFMA 3VAGA 2I5JA 2BRKA 5J2NB 4CNZA 1RT5B 4FNHA 1VQPS 2CWKA 1X5OA 4U7UK 4K0KF 1REVA 1CBKA 1NHUA 1XR5A 1D1UA 3TUZC 1QE1B 3MEEB 3US5A 2KKHA 5E3RA 3PYFA 4UOGA 2OGUA 2AJQA 5DDQC 4B3RF 3AHPA 3PM9A 2BXJA 2VD3A 4LIWA 4P7VA 2CPXA 4X65F 4QWAA 3MR6A 4F67A 2ZC4A 3ENVA 3D28A 4P72A 4N41A 3FFIA 5KT5A 4L73A 2GX8A 3TJ8A 3TUIC 2KG0A 1OPZA 3MR7A 4KH1B 2HVIA 4OYWA 4RWXA 1U1NA 3V6DB 4J9PA 2DH8A 3KK1B 3BYPA 3IGNA 1T9TA 4DEZA 2CAJA 4H4KA 1EX8A 3IS9A 1MSWD 2E9TA 3ZZ0A 4C6AA 2LEBA 1RXOB 2F8EX 2VBWA 3B4DA 3I55S 3QT8A 2LVWA 3GU0A 1GXTA 4LF5J 1SL0A 2W4PA 4R5PB 4PZVA 4DR6J 3NAHA 4ANEA 3ZO7A 4PYDA 4X64J 4UW2A 2MPUA 5CHCB 2YH1A 1JXLA 3A3OB 2O3DA 4MKBA 4RW7B 5DETA 1F5BA 1U0HB 3I0SA 3H5YA 2GJFA 1KOHA 1C4AA 3HHLD 1QM9A 2OPSB 5HQLA 2HMIA 2UUCJ 2ZD1A 4AL5A 2KFNA 4WE1B 4LR9A 1DTTB 3P8BB 1H7WA 5F8JA 1CQNA 3S6EA 1FKOA 1FD8A 4DV3F 4DLEA 3OTDA 2YKOA 3UVJA 2DD8S 2RF2A 3TWZA 4B08A 1UJ4A 3CDBA 3OTBA 4CLFA 4U9RA 3PCOB 4ZVHA 7FD1A 4F4XA 2HURA 2IMWP 3UI3A 3JSRA 3NWGA 2D69A 5LMUF 2KM8B 1WTFA 2C2NA 4B3OA 4V19J 2CJAA 4DHVA 1EHWA 2IPOB 3AY0A 2HVZA 2XCAA 2WVEA 2EI5A 2Q66A 1F2HA 4WYWA 2XO7A 3J81Y 3ENWA 1R8BA 2KB2A 2X1BA 4UOCA 3CIMA 3RGIA 4Z2XA 1HBNB 3E51A 2LXFA 1REGX 1S1WB 2C2MB 1X4EA 5SZTA 2CNOB 3K8WA 1K9MT 1OSDA 4LQ3A 3HK2A 1HW9A 1UFKA 2J9EA 2M0GB 3A8IA 3KUHA 4PYAA 4ZPAA 4IH6A 1BY9A 1VRUB 3T1AA 3UDLA 2XCPA 2HHWA 3JYTA 1YK9A 5A8WB 5IC4B 4HI1A 4A8XA 5LMUJ 2WRMA 3M9NB 5CYMA 5IT0A 2JLEA 2BJEA 1H2UX 2P5VA 4RX6A 2N4CA 2VJUA 4AXJA 2V63A 2HGMA 1KTVA 1FE4A 3IBWA 1NK9A 4XTTA 2H5EA 2OPRA 4Q2LA 1Q81T 2IAJB 1JXEA 3TVKA 2N7CA 4GC7A 5F9LA 2HNDB 2JLFA 2J0QD 3BPSP 5HI7A 1S99A 3MXHP 2RE1A 2KYZA 1YBUA 3CJQA 5A8RA 3KJNB 3ZC4A 3PR4A 1Q4RA 2QA2A 3FRZA 4ENOA 3KLEB 1ELOA 2B56A 3FEYB 5KFIA 1WSVA 2AYMA 3I4HX 1HARA 3PHTA 4IOBA 1RWKB 3AT1B 1JXVA 4IQMA 2M7SA 2HHSA 2MY8A 2PN6A 4CO2A 3HVTA 4CLYA 1H0HB 2LLZA 2VPZB 2E5IA 5KFCA 4FVCA 4HHHA 1U2FA 2A2CA 1UKUA 1EQ0A 4NI2B 1QTMA 3X3UA 3ZTPA 1IKXB 3MCNA 4RZRA 1MNEA 3DRYA 2DCUB 2QTWA 4USWA 4NX9A 5J2PA 3AXMA 3ZZOA 2ZZNA 2DR9A 1TL5A 4LF4J 3NNHA 4QJVA 2BANA 2XTJP 1LEOA 4F0KA 1X5TA 3G9CA 4AD6A 1KSPA 3A1YG 1UWAA 2QG9B 3ISNC 1YIJS 2GAGC 2F8HA 3I0RB 3Q0AA 2HZCA 2IFXA 2M3DA 3OXFA 3PXGa 4WFAQ 2DIVA 4F25A 2HEKA 2QJ3A 4TNOA 1B7YB 1ZS6A 3W9HA 4NCGB 2R2TA 1YGYA 2DRBA 2A6OA 2QRRA 2V4QA 1JLFA 1L3VA 3CJRA 2I38A 1LFWA 3EVOA 1VQYA 1NKCA 1CQMA 1VQSA 2B4OA 1LWCB 1U6BA 2E9ZA 1ZOTA 2MEWA 4OZ5A 4JI8J 5IWAJ 3KOAA 3IG1A 4N8NA 5F0WA 3HT3A 5CAAA 4HVZA 3GE9A 2C2RA 2AYGA 2XY6A 3B78A 3GR1A 1UJ6A 2IRXA 1AZSB 4ICLB 1APSA 5HJXA 1OQ6A 3ET6A 5KG0A 2K7KA 3ADAC 2DNNA 5HROB 3R5GA 4DN9A 1LFPA 4DF8A 1FFGB 1N5VA 1YHQS 3A8KA 1QSLA 3DFEA 3E01B 1J27A 3MAQA 2LYVA 1P1TA 2E5GA 1RAOA 3DMJA 1KQKA 3RZAA 4NRUA 1Q16B 4I4BA 4P6QA 3Q86A 4CLWA 4TQRA 4DV5F 1L5UA 4FBUA 3ITHB 1Y11A 3N4WA 4OX9F 3HHNB 2DO4A 4RBVA 2MQMA 4OLPA 1GAOA 1FNXH 1Q7YT 3ZTRA 5HLFB 4ED2A 4F4KA 3U7JA 3CIZA 1K1SA 3VVTA 5KFDA 2BE2B 4LFBJ 3WC2A 2WSEC 1RA7A 2NYHA 2K3IA 2FHJA 2LDYA 4DPWA 2CDQA 1RHKB 1QAJA 2EVZA 4LF7F 1QUVA 1CJUB 2OSRA 2BBEA 4RW6B 5H9FJ 4LIRA 3MURP 4LJMA 4LRDA 2HYIB 4PUOB 2MQQA 2UUAF 2AP6A 5U47A 3DI6A 4YB5A 2RKIA 1RTIA 2E1PA 4ANCA 1L3TA 3KMQA 3O1LA 2Z2MA 1SI9A 3FSIA 3T9NA 1T11A 2ILYA 1IKVB 2MLXA 1M5HA 2YWEA 3DN9A 1V6HA 1IN0A 2B3TB 3R5DA 4DPYA 1YZ6A 1NB2A 1TZ0A 2CQHA 3KMSA 4DUZJ 1G6BA 2AW0A 2E7XA 4ID8A 4ZVQB 2RIJA 5H1SV 3T41A 5KFUA 2UXDF 3M30A 2GVDA 3PW2A 3BR9A 1RISA 1RWVB 3EVMA 3G86A 3NS6A 3O44A 3RR7A 1XNRJ 2RQKA 4ES3A 4BLGA 2BOAA 4WFXA 2CUYA 2HAIA 1NSKL 2YWWA 5L1LA 1T9XA 4JI5J 2AGOA 4H4KC 3HZEA 4NLSA 2I8EA 3RRKA 3GSDA 5FD1A 1R0AA 4ZPVR 3VTIA 1RWOB 5KFXA 1J5EJ 4EYIB 1VR6A 1TR0A 2HFUA 2HG4A 2MTLA 2YNFB 4NPOA 3OJSA 1D8YA 1FNMA 4MIBA 2XSFA 2WW8A 2KYXA 4CT9A 3MR3A 4KFBB 2JDJA 2GFFA 1GEHA 3CCWA 2AZ1A 3KLIA 5HVGA 2W2PP 2XI2A 5CH7B 1P9YA 2WTFA 2BYCA 3HXMA 4JI5F 1RWPB 5JMNA 4F4YA 4ZJQA 1T9YA 2IC3B 5KAKA 2XS5A 4ZVFA 5C42B 1GFWB 2KO1A 4X64F 2H1YA 3R1HA 3CDAA 1IM6A 4UZBA 4RW7A 1R8HA 4H4OB 4JI8F 2APOA 2CJBA 2J76E 5T7LA 1RKIA 2D41A 1DLOB 2ROPA 4N7TA 1HWKA 2VG7B 3DM2A 1WUUA 4O3QA 2KL8A 1LW2B 2GMJA 1RAIB 2Q1LA 2R7QA 4FF1A 4OZLA 4IFVA 1TKDA 1AYEA 2DBBA 2FZGB 2OHDA 3BYRA 3CWJA 4ZKAA 1KD1T 5IT9Y 2V8PA 3CE8A 4JYAJ 3BSOA 2KVQE 4CO0A 2VF3A 3KNAA 1FFWB 2DR6A 4LSNA 1VIXA 1Q8KA 1KEKA 5KT4A 1FRLA 1Y9OA 4CTAA 3OSNA 2KZMA 2DH9A 4GKKF 2GZOA 2UXBF 2VPWB 4UUWA 4WU2A 2PFDA 1UW4A 4HDGA 1VQ7S 1MU2B 4X4TA 3GJRB 2AKWB 3GG0A 3OVSA 4HHJA 2LEPA 1HR0F 1IR2A 4QPXA 4JI3F 4NLWA 3I5CA 2ABYA 1YJRA 1RTZA 5ETSA 2RDDA 3VGSA 4DX5A 2EXUA 2DGXA 1X5SA 2V8HA 2RT3A 1NDLA 1VISA 3FC9A 1H2TZ 1YDLA 3FRYA 3HSGA 4ID5B 1KVKA 4Q8FA 2NXUA 2QV6A 4I6WA 4Y00A 2EFOA 2YX7A 3NS7B 3P45B 2Q6CA 3I4PA 2B9EA 2DNGA 2Y0BB 2BM0A 4WJBA 3KXDA 4AYBD 3RBDA 1L3KA 3B8HA 3DHXA 4C48A 4WPAA 3MUVP 2A2DA 2VFSA 3VV2B 4B3RJ 1IR1A 4I6AA 4FBTA 2VFRA 4JBCA 4M5DB 5K5MA 1RU1A 3CMAS 1NZAA 1E6YA 2WB1D 2JOQA 3T5LA 4ZCIA 2KG1A 3HVRA 2AYBA 4URQU 1CJVB 4HLBA 1T3NA 3M30B 1XWLA 4ZCKA 1REVB 1VQMS 4DG1B 2WBMA 3BB5A 3NBPB 3NL0A 2R7UA 2W8LA 1MMNA 2JWNA 4A48A 4DV2F 1IJEB 1SH2A 5F8IA 3L09A 3SV3A 4JV5J 4EBDA 1RE1B 3DOLB 3D0HE 1F0XA 3DXBA 2DRAA 3CD5A 3K5OA 2FB0A 3Q8YA 1TL3A 1RLCL 4DSFA 2VONA 3QNWB 2I9SA 1DZ5A 2N4DA 3EPIA 1HQUA 3EDQB 4W90B 1F1BB 1RT3B 1RUSA 1VDHA 2VKRA 1UVLA 3GZ7A 3RRGA 4PABA 1BMQB 4P9SA 3AB4B 1X4CA 3QFWA 4CLLA 5C42A 1JK9B 4KHPJ 3BSCA 4OYPA 1JJ4A 1RTHA 1VBZA 1SKSA 2DGUA 3N5FA 2HNZB 4RW6A 1ZPWX 2ZH3A 1U4BA 1TAUA 1K44A 1S1TB 1P9QC 5D3GB 1P1LA 3EPGA 3KLHA 1XMOF 1FHTA 3DI6B 3F73A 4KKOA 1MN7A 1EIYB 3S8SA 5E3PA 2XI3A 3MHYA 2IM3A 2W24A 3UCGA 2DYAA 1X9WA 2AEMA 1PG5B 3H7HB 1VJWA 4H4MA 3GMGA 1IWAA 2DNLA 4RUHA 4XDDA 2IDLA 3CXCR 3CCRS 3UDVA 3IM9A 2ZHOA 2GCFA 3MMCA 4NXMF 3AAWB 4LVNP 3NBPA 1U8SA 2HQGA 4P10A 2VFUA 4KQZA 4YOEA 3CJ4A 1Y0HA 5FLXU 3CDWA 3M2UA 3D6TB 2KHDA 1XNQJ 4DR1F 1Q7LB 1TK5A 3SI8A 3PEJA 4H54A 4QW8A 5KFNA 3J7A1 4ZA1A 1EKRA 1HL6A 1TKZB 2MMYA 1W26A 4G6VB 3DRRB 3EUNA 4J37A 1SC4B 3PJ9A 3IRWP 1WEYA 4YQWA 1IKYB 4DV0J 2GVDB 4CM0A 1YJ7A 4Z7CA 4NZ6A 1UVJA 2UXBJ 2YWGA 4ZPDA 4AL6A 4CH0S 1CJTA 3TX8A 3PIPQ 3RW6A 3MM6A 2QFIA 1X9SA 3WIVA 2QMUB 2ZM6J 2LA4A 2AT1B 4JI2J 1WG5A 3V4MA 3SFGA 5KFBA 2KRBA 2RQMA 4RUAA 1Z4UA 1U47A 4JV2A 5ETLA 3PEHA 1VMBA 3DMJB 4Q2MA 2ASYA 3RYLA 1HNWF 2V9KA 4NLTA 3VALA 4R8UA 3M05A 4DV5J 1URRA 3N5BA 4B3TJ 3FCWA 1D09B 1F60B 4IG3A 1HNVA 4JI1F 4RNHA 1XMQJ 4WU3A 3GIRA 5IT4A 3PW5A 5KT6A 1L3SA 4PEOA 5B0DA 2MJNA 1S9EB 3BKTA 3S01A 1P6TA 3C66A 4FKYA 4DS4A 3NEKA 3AFGA 1SKUB 4J5OA 2BJ3A 3BBCA 4HTIA 5EWEA 3OV7A 2DY9A 3MM5B 2FYXA 3MPDA 4Z37A 3B6BA 3BN4A 5L46A 2KHCA 3DGPA 2OSQA 2ZDPA 2W2QP 2W2MP 1X60A 1WHXA 4G1QB 4HDHA 5EN1A 4C11A 1S59A 2NLWA 3BGUA 3P49B 1HBOB 3HFZB 2CJQA 4N8OA 2VG7A 3CT9A 4OI4A 1SJRA 2WAQD 1WG4A 1PKUA 2WSFC 2ZUGA 3EXCX 5THWA 3KYLA 4GC6A 2VA3A 1EETB 3SEOA 2CXEA 4WTYA 1F6TA 5B7WA 3KLFA 2ZBCA 1HWUA 4L72B 4JP8A 1HFEL 1RT7B 3JQJA 3MI7X 4N77A 5DS7A 5M2RA 1RT3A 2RILA 2XB2D 2OELA 1IKXA 4NE9C 2EBEA 3ENAA 2NXNA 3BF4A 4CLTA 2C3PA 4OI0A 2BKNA 1TP7A 2CPHA 5KG7A 3LP0B 4OYAA 2CKWA 4QIFA 4ZPCA 4KIAA 3J7YI 3KJVA 1D0EA 4JI6J 1FJGF 3UQSA 5LJ5Y 2F3JA 1IBMJ 2XSJB 2BJ7A 2ZH5A 3KHGA 1NPKA 3E3XA 4KC5A 3ZFVA 1KLMB 2IMOA 4MYUA 3TANA 2V2ZA 4U7CA 4PG8A 4B9VA 3H20A 3DLEA 3H98A 2WW4A 3OVBA 4PPZA 2EKYA 2AJ0A 2FVCA 1YJVA 4RKUC 4UF4A 3PKYA 1GXLA 3BBFA 2DHGA 4IO1A 2XQCA 2NREA 1S1UA 3CJ3A 3MTJA 4I68A 4J9LA 2YPZA 4RNFA 4BDPA 4C8OA 3KLVA 3OFFA 4DF4A 3MM7A 2F1FA 4F50A 4KPCA 1B99A 2MQOA 3TEHB 3PV8A 1RZMA 1RGVA 1WI8A 3KDOA 1RT7A 2Z4PA 4FYVB 4EO6A 5HVHA 4NLUA 3ZZPA 4EMDA 1HI1A 4ZN3A 5F8NA 2HWIA 4FPRA 3IM8A 4USUA 2CVIA 5JVHQ 1T3OA 5IV4A 2YNFA 4X4QA 4LF6F 4W92B 2UV8A 2KU7A 3HHDA 2IJNA 4YB6A 5LOQA 1U1LA 2B43A 4RR5A 1FK9B 2LA6A 1JMTA 1SH0A 4RL1A 5HVFA 5BYQA 1SV5B 5EUHA 2XMVA 3T6BA 5HN0A 3GFYA 5DZ6A 3KG4A 2HHPA 1VFJA 1GTEA 1HNIB 3DGPB 2RDJA 1S72S 1HIYA 1R8AA 1WELA 4X4PA 2CQPA 4R25A 4LFCJ 3QJJA 1WHWA 4RNOA 2V68A 4HR2A 2IVMA 3QGHA 4OJGA 4B3OB 2U1AA 4C7QA 3C8YA 2HS0A 1G7CB 1KDNA 2IIHA 1HMVB 4HACA 3UD5A 4UT4A 3NG8A 2NZCA 4I1TA 2HKEA 5E2QA 1NO8A 2HNYB 2AZ3A 4CLPA 1S7IA 1LOUA 2BV3A 3QO9A 4LVOP 4YR2A 2XS2A 3EZOA 1U1QA 3OR2B 1ZM2A 5JUMA 3CEDA 4IKAA 4N56A 2XMAA 4ILMA 4DR6F 4DXLA 1LKZA 3G8QA 1Q8IA 1UAWA 4JB8B 4OV6A 3KK1A 3H5UA 3W8GA 1BQNB 3GWCA 3AD8C 1NJIT 4DZDA 1RB0A 3OLAA 1UEUA 4DU8A 2W4DA 3MR5A 5EDWA 3I5BA 2PEHA 3I9V9 4RJVA 4M5GA 3W8PA 1XN9A 2QFJA 1QVGR 4Y2MA 3IR7B 2JLGA 3BKUA 4TY9A 5DGAA 2Y8WA 5CCMA 4DL2A 3DLKB 4PXBA 4TLQA 4J9MA 1G1XA 1FFSB 2WHOA 3QT7A 3GTYX 2WONA 2FVSA 2MKKA 4DQIA 2MKJA 4PXEA 1N33F 1UPMB 1XTZA 1Y10A 2FLPA 1C1CA 3ZZTA 3W2WA 1CEZA 1RBAA 2ZUAA 4DV6J 5DM7Q 1YBTA 4ZVPB 4CYUB 2VG6B 1LWEA 3RRHA 3VQSA 3GSIA 2C2EA 3GFXA 3A12A 5IQQA 4F26A 5GAHI 3I96A 3EDRB 4DJBA 4DDFA 1NK6A 2RHQB 4CCHA 2HHXA 5DLFA 2IY5B 4LF9J 5ITHA 4OIXA 2KH9A 2DGVA 1AT1B 2K2PA 4YR3A 4EYHB 3R97A 3FK4A 5F41A 3IWXA 1RHJB 5LJ3Y 4OI2A 5KG2A 2QO3A 1PO6A 1HBMA 3QIPB 4NA3A 3ICLA 2HIYA 3Q24A 4QCLA 5L38A 3EYZA 1N36F 2ALYB 4MJKA 2VA2A 2EFQA 3G71S 2ADBA 2ZWPA 4K4XA 1FKAF 3PYGA 1NAQA 4UTGA 3U1LA 2ACYA 2LKZA 4B02A 3GILA 2W01A 2WOMB 1FX2A 1HWIA 4OMFG 5A76A 4LF8J 1HNZJ 3HF5A 4DX6A 2VQFJ 1Y5IB 2DGQA 3PRDA 4NCGA 3BSNA 4YEAA 2F40A 2HS3A 4I2PB 2E5HA 3Q89A 5DG9A 4Y2IA 2L41A 1H7XA 4P2MA 1EP4B 2M88A 4PG7A 3S1TA 3QT5A 4CO5A 1DY3A 5C24A 4QIWD 5I3UA 1JB0C 1NKEA 3M8QA 1EARA 2H4WB 2UUTA 5EWFA 4DFPA 4HT5A 4ZVUB 1EZZB 1MWZA 2E1CA 3PY8A 1OY8A 2H54B 4DPUA 3FBBA 2X7IA 1XBWA 4OJHA 8ATCB 5EHHA 5H9EJ 3PVXA 4EZ6A 3H59A 1FVSA 1MWQA 1AZSA 4DV2J 1LW0A 1LXJA 4Q43A 1IBKF 1JKHA 3LTOA 5KFPA 1UEKA 3CJ8A 3DLHA 1WKKA 3N01A 3U1MA 2J0SD 2IYIA 3CPWR 3I31A 1WNEA 4PR6A 4AXIA 5HROA 2KJVA 5J1PA 4O3RA 1K0TA 3SCLE 1V5IB 3HVAA 1RWUA 5GADU 2DXDA 1JLBA 2ILZA 2YWHA 5D0HA 2CQCA 1NJWA 1BWEA 1YBAA 2MKIA 2J6UA 2IRYA 1GTHA 1S77D 3IBFB 3K89A 1F3FA 2M52A 3DOMA 3FCHA 4TYAA 2JJ4D 4I56A 2XMJA 2RDIA 4NOHA 3NGDA 3WX4A 1N88A 3MCMA 1SIZA 2J7WA 3N9UC 5F3ZA 1FDNA 4PWUA 2DNYA 1UFLA 1MLAA 1SKRA 1HPZA 1WOOA 3ONQA 5KFYA 3FCVA 5H9FK 2E5JA 2MZ1A 1Q78A 2ZZTA 3NGRA 4IQXA 5DQHA 2XMKA 3GG1A 3D9BA 3GJSB 3QBCA 4MK9A 4TU7A 1Y5NB 4N47A 1BQMA 1JLAA 2VHGA 2VFVA 4FKXA 1M5SA 5HSPA 2PMWA 5LXYA 2QA4S 1ZM3A 3MMJA 2VODA 3W63A 4G3IA 4DV4J 1ROFA 1UETA 2L08A 4U96A 4DL3A 1S76D 4KO0B 2CQDA 4DSJA 1S49A 1WG1A 3C14B 1C1BA 4H4OA 4NLXA 2DPIA 1FJGJ 3PDNA 4L76A 4DL6A 2OMLA 4O3SA 1U8WA 4Y6IA 5RUBA 3K59A 2HFNA 3DYAB 2HFVA 2YQ3A 3M9OB 2ZD1B 1YI2S 1W7WA 3CSKA 2CQ2A 3NRBA 1U09A 4HTJA 3PJWA 3TAMA 1RACB 4E0DA 2Y1RI 1RAHB 2OUGA 1MN9A 1R0BG 3RAMA 3SCJE 4JI4F 3OFHA 5ETTA 3RW7A 5ETPA 2PDAA 2CPDA 5FJ4A 2DNZA 5BXIA 1WTBA 1DBDA 2OO4A 4OYOA 2G2OA 3GR0A 2D3OR 5D78A 3D7SB 2LU2A 4QPTA 2HMIB 2HVHA 3V6HA 4B17A 1GXUA 1HYSB 4LF7J 1QVFR 1EETA 1YRUA 3MM7B 1ZTWA 4OX7A 5J2MB 1RT6B 2ZVIA 4ELVA 3BJYA 1QLNA 4DQQA 4B3TF 4UY85 1OY6A 3MDFA 4F0MA 1SL2A 1ZPVA 4DX7A 1FWKA 2CQ1A 1GMWD 2ZITA 3MAAA 3NXZA 3G6ES 2LXUA 4K0KJ 3PW7A 1FF2A 4HHUA 2XM3A 3K5MA 3VF0B 3CCES 1F9EB 2FJDB 3CUNA 1T05B 4OZ2A 4B9NA 4A8OA 4GKJJ 1SBRA 5A8WA 1HW8A 1KR4A 4OX8A 1IBLF 4IRDA 1N5QA 2P9GA 4OX6A 3KTQA 1ZA1B 3DM2B 5LXRA 2XGQA 3IP0A 1TVRB 4EU0A 3KG1A 3FZBA 1NPRA 3SYZA 1S97A 3JTOA 4F36A 1SKWA 1LW0B 3CC2S 1OIAA 2OAUA 2OEKA 2ZBPA 2OLWA 3DRSB 4EZ9A 2F4VJ 3TUPA 4HT7A 2CQ4A 4ETXA 4FS1A 1FRHA 1SQGA 4DFJA 1M5PC 2RRNA 3CJKA 4R0EA 1RSCA 1RT2A 2CADA 1T0TV 4L74A 3WDOA 3R7NB 3Q8PB 1G4CA 1KHVA 3FKBA 3HP6A 3MEEA 1VBYA 3K5LA 3PX6A 4DMZA 4JI0F 5C25B 2MZJA 3M8RA 4HH1A 4LR7A 3TQ1A 2WVFA 1AFIA 3QJPA 2FGOA 3CDUA 3BDEA 2F9JA 1T9VA 1XNRF 1VQ5S 3NCQA 4FDFA 3NNCA 3PIOQ 1HBMB 2VFTA 2H5JB 4FP9A 4C3MA 4ZVGA 1IKYA 2P9CA 2Z57B 2JEGA 4LRFA 4X4UA 2VZ9A 4OFZA 1GNKA 4PCQA 3HKWA 4MMOA 3UCZP 2JH3A 2GGPA 2KXFA 3DLLQ 2VG5A 2R7TA 4KFBA 3M6VA 1RHMB 4KGZB 4WIQA 1QDUB 3ZNJ1 5LSOA 1A6LA 1QY7A 2LQ8A 2E5LF 3HCXA 1IJFB 1VQ4S 2J6TA 3KHHA 2LQJA 2ZKUA 2Z8QA 2EFPA 1VLOA 1HHQA 5D4PA 1TFWA 3HZGA 4U8VA 1UTAA 1T02A 1M1HA 2AYEA 4P75A 5ETMA 3RAXA 2F9DA 1WC5A 3SBMA 2AJ4A 2FLNA 2B5JA 5GAHU 1PAUB 2B9XA 2ZKTA 5L1KA 2VH7A 3RB0A 2HNZA 1O6XA 1U0SA 2XY5A 2FC9A 4Y34A 5HMXA 3VQTA 2ALZA 2I5JB 2IBOA 3HHLC 4NLDA 4BCAA 1XMQF 4ELTA 4J9QA 1TV6B 5EX3A 4AUKA 2ZNZA 4RBTA 2VICA 4YHHF 4NLPA 3UE2A 2GIFA 1YTYA 5J1EA 2YQ0A 1HQ2A 4O44B 1BQXA 2KFZA 3GV8B 4DQPA 4WP3A 4O3PA 3SCKE 2KDOA 3GCWP 1ZA2B 3ILJA 2V6AA 1RWXB 2GAHC 2WK4A 2KZZA 4B9LA 1F9HA 5AXLA 4ZLNA 1U1KA 1IBCB 2DR8A 2D3O1 2J6SA 1BD6A 2LQBA 2NUUG 1FA0A 4ILLA 3Q2SC 5G4DA 3HX9A 2GQQA 2MQ8A 4NYOA 5CQGA 1PYTA 1RU2A 1U1RA 3V6DA 1D9DA 2DXFA 1I1GA 1B0VA 2FLOA 2ZEJA 3OR1A 4QR0A 1IBLJ 1N52B 3PO5A 1NMEB 1TUGB 4C0BA 3W2WB 4LFCF 2IVFB 4ZOSA 5G0RA 3PR5B 2LMIA 1T8EA 1R6VA 1TL4A 2HK2A 2D9PA 1HI8A 3LAMA 1B0PA 4DUTA 3QJLA 5ETOA 1J5OB 1FERA 1S6QA 4TN2A 4PRFA 3R6LB 3RJMB 2C2DA 2V2KA 2BOPA 5HMYA 3CMES 4DS5A 5IOLA 2CQ0A 2HRTA 3GPAA 1TL7B 3T5JA 2ZH9A 1TFYA 3Q8UA 3FZ2A 1R27B 3MPVA 2HPUA 1EJ7L 1JLQA 5DZ7A 4DBQA 2QX0A 2JEFA 3JQMA 3H5XA 4C2MA 3AJ1A 4XK8C 3BQ2A 1PIEA 2XBPA 4K8RA 2V0NA 5D0GA 2N3OA 3BH7B 3TVYA 1K8AT 4CNYA 3CO9A 2DKOB 4Y2AA 3O3LA 1YJNS 4DWIA 3DU6A 3HVTB 4TVAB 3TP2A 5FLXY 2JEIA 2PI5A 3ELHA 5F3TA 2UV8G 2RUGA 1TELA 4PKDB 3TZXA 2J5AA 2VBXA 1RTJA 1OPIA 2VPXB 1XC9A 1DRZA 1WSRA 1RA6A 1NU4A 1UJ5A 4UOFA 4X4OA 2PEBA 2RJZA 2UXCF 2YNIB 3GYXB 1I3OB 5CYMB 3KK2B 5LMNJ 2YX1A 3V6JA 2B6AB 1FEHA 3HSZA 3IFEA 3BZQA 3MUMP 3RR8A 3JQKA 1X4GA 4Q44A 1A9NB 2BQUA 1SPBP 3AOBA 2OD4A 5L9NA 4ER8A 3L7UA 1RCOB 1LWEB 1Q5VA 4Y0FA 4PXCA 2B8PA 2H65B 4DR5J 2XY7A 3DRXA 5K8MA 1IWGA 4DV3J 4K4SA 4H4MB 4DV7F 2CRLA 2EC2A 2HNDA 4ANDA 3MPWA 2KM8C 2J0XA 3HDSA 1M5KC 1VCTA 3MEKA 3FBFA 1U0HA 3SXLA 5A8RB 3QGPA 1TVRA 2DNRA 3PG9A 1N36J 1E6VA 1K47A 1R7IA 2ZOFA 3G87A 4WE1A 4Y2CA 3JAMU 3TA2A 3W60A 2EG1A 2FJBB 2XYPB 4YP3A 2CZ9A 4KHMA 3KK3B 3Q22A 4A8SA 1VQKS 5ETQA 1MG7A 4ZPBA 1LWFA 3IWLA 2HBQB 4N76A 2RB7A 2GQCA 1ACMB 4QR2A 2G2ZA 5E3QA 1FKOB 2RVJA 2VUGA 3AA8A 1XERA 1IR0A 5CCLA 1BXNA 2FHJD 1NK7A 2HBRB 2FDNA 3M7VA 3KLEA 3U27A 2PSZA 4OJ3A 1KQSR 1NNDA 3IC1A 3K17A 3VAKA 4J9VA 5D15A 3MR2A 1WC6A 1XK8A 2Q3PA 2PA3A 3KWMA 4C0HA 5K20B 2XEXA 1R3NA 2QLFB 2PO4A 5HBMA 4J9SA 2HRUA 1MW7A 2BE7D 4NXNJ 4WXWA 2F5GA 3QGGA 3TUJC 3OR1B 4RUBA 3V4IA 5CYQA 3OL6A 3DDIA 3NS5A 2CDRB 2K1RB 3MAHA 2CQ3A 4ZLPA 2HHVA 4E8UA 2YTCA 1O5JA 2CA9A 2MZSA 4C9DA 1S6PB 1TKXB 3BPDA 4WYLA 3POTB 5DJBA 3WZ0A 4URSA 1QSYA 3D0GE 3V2UC 2E1MC 2JRSA 1MMLA 2DGOA 1NSQA 3Q83A 3QYYA 4P52A 3DU5A 1LWFB 3IAM9 4JOUA 3M8SA 4M95A 4HYKA 1DTTA 4K50A 3FMWA 3CCQS 4UUXA 2DEIA 2YWFA 1JQGA 2MQPA 5F9NA 1YVFA 1NPPA 5GAGI 4ED3A 3RBEA 2ZE2B 4J7CA 5L1JA 1WI6A 2IM1A 4DSKA 3M8ZA 4C0OC 3TJ9A 4KGKA 1JLBB 3W65A 1MROA 4DSEA 4C8LA 1UVKA 4MK7A 5AXNA 3C2PA 1ZH5A 3QRQA 4LFAJ 1TKZA 1WD6A 4O3OA 2X1AA 4FF2A 3R8YA 1TAQA 2MGZB 2V4JA 3RBXA 3M32B 3HT0A 1V9OA 3M6XA 3EWGA 3NGSA 4WFYA 5A0YB 3G8TA 5KFKA 3K58A 4W98A 5CZVA 2YNIA 2PD1A 2B7CB 4BBYA 4O0NA 1HHTP 5E33A 5CABA 5L1IA 3OW2R 1NJXA 3KJFB 3AD7C 1ITPA 4KY3A 2CYYA 1RADB 2Z58B 4CLUA 2Z0GA 4RU2A 1KP6A 2U2FA 4MAKA 3MM5A 4C97A 2JVOA 3RB3A 1YJ9S 4M94A 1MMDA 4QR1A 1JKHB 2OPPA 5GMEA 4WK3A 3QIDA 2M8DB 1VYAA 3K5NA 3QWUA 1QUPA 3GJTB
chains in the Genus database with same CATH topology
1G3OA 2ZJRQ 2GNKA 1DTQB 3G96A 4LF4F 4I0WA 5JXSA 1XNQF 4FVMA 3I5AA 1WF1A 2RKIB 2YWKA 7FDRA 1V3SA 1M0SA 2O1PA 3T9ZA 5DDRC 1NHVA 2XULA 1KS2A 4EBCA 3UW1A 4DQRA 3G6XA 1PC5A 4IO9Q 1JLQB 3LGNA 1OQ3A 2QA1A 4QIVA 2UZAA 4ZP6A 3T19A 2XMMA 1CLFA 1N32F 3THTA 2QT7A 3G6YA 1LK7A 2IA6A 4UY8T 3PX4A 2EC0A 3IA0A 5M2PA 3KK2A 2RD5C 3QAUA 4KBIA 3ITHA 3IR6B 5GAEU 4GO5X 4OZJA 3C46A 3AB2B 3NCRA 4RW4A 2LQ5A 2E1RA 2OPPB 2YNHA 4ECRA 2OFGX 2DVIA 1KNZA 3MECB 1JLFB 2RQCA 5DM6Q 1FD2A 2B4UA 4CO3A 3P3DA 3HJFA 2HFOA 4YB7A 3QIPA 4RW9A 1FTRA 3CCJS 4ECVA 1SJFA 2L9WA 3CCUS 1S1VA 1KVJA 3CD0A 4O3NA 4DR2F 4X4VA 1LV5A 4QIGA 3OTCA 4ZP7A 1SC6A 3CCZA 4TQSA 4ED8A 2UVWA 1FRKA 4ZK7M 2E44A 3OR2A 1ZTTA 2FLLA 4JI6F 2J9CA 3M32A 1R8PA 4P7TA 4CTAB 2PMZD 1QAYA 3M2RA 4LSNB 3D1OA 3OJUA 4IOCQ 1U2RA 1MU2A 3R27A 2QEXS 4MFBA 3J80Y 3EGWB 3IO1A 2QMWA 3TAQA 3DOKB 3MM9A 4ES1A 1NH7A 3K57A 4HEA9 4A8KA 1PILA 2ZHAA 2YY3A 3SDEB 1R6YA 4EO8A 5JJBA 3V4IB 2ZJQQ 4Q45A 3W3SA 5K8OA 4MIAA 3LWLA 1WF2A 2D3UA 2D7SA 1Z1ZA 3V6KA 2MKHA 1CG2A 1TKXA 4K4YA 1RKJA 1BC6A 2CZVC 2CPYA 4PQAA 1KHWA 4M5DA 3T6JA 5T14A 1KLNA 2C42A 4WK1A 1S0MA 3VAMA 2PT0A 3EX7B 3CTRA 2OMOA 1ZETA 2W7OA 4RLEA 2IC3A 3FVYA 5J1NA 5KFQA 3AQPA 1RT2B 3PHEA 3DLBA 3CJ2A 5KOWA 4ZP9A 3E8OA 4OJ1A 5I3PA 1H38A 4PQUA 1UP1A 3C3LA 3HLUA 1FDAA 1BQNA 3MZIA 4I6YA 3Q23A 4DFKA 2DGTA 1KONA 3JSMB 1IQTA 5BYSA 1JIHA 2XGPA 4CO4A 4XPCA 1HBNA 3LUYA 5KTQA 4IRCA 1DJ0A 1N54B 2GHPA 2BA9A 2MQNA 1S9FA 1HQEB 2DTJA 5LT5A 2VOPA 2J9DA 5ADZA 2XLJA 2VG5B 5DGBA 1HWLA 3BGRA 5E41A 3OQ2A 1DAXA 2C3OA 3LPYA 1OO0B 4YDXA 3KLFB 5DRKA 3FEXB 4ZPTR 3ENQA 1HI0P 1T7PA 5I4MA 5DQIA 1S7HA 2R2RA 1NEEA 4ID5A 3UDCA 3MM8A 1XMBA 6FDRA 2FJEB 4AQYF 3T3FA 2MZTA 4IR1A 4PQUB 3I0SB 1J5OA 3CD6S 5E7OB 1RT1B 1C0UA 4O4RA 1VOMA 2R7RA 4QOTA 4PWDA 1OWXA 2HGLA 5K8NA 3SSRA 4BC9A 4BC7A 4X4SA 3I32A 1VQ9S 1FRMA 4ZPWR 4IG0B 5DO2A 2LCWA 4A8YA 3E01A 4HI2A 3OSPA 5LMNF 2DR5A 4LT6A 4PG4A 1VRTB 1S0OA 3CCSS 3WBZA 2KVIA 5KT2A 2JEJA 1FJCA 2ROEA 3K5PA 4I2QA 4DSLA 2W9BA 1VIOA 2QLWA 3PNIA 5SUHA 4JYAF 1HNVB 1LK5A 1X5PA 2E7WA 3MTKA 5KG3A 4F02A 5AE3A 2EK6A 1CPZA 2E1AA 2AJFE 5DLGA 5FDLA 3H40A 2AD9A 2FD2A 3NP5A 1HA1A 2Q6BA 3BN7A 3NKYA 4LSLB 2ZH4A 5G0RB 3SQGB 4NWBA 5DQGA 2DO0A 2XZWA 3DDKA 1IM4A 1S1VB 3AH6A 3I56S 4C11B 4LF9F 4IR9A 3RB6A 2R7XA 1SUQB 4LUBA 2CPFA 4DV0F 2RH3A 3M6WA 4D3HA 1KN6A 4R0JA 1FT8A 1TQLA 1RP5A 1K1QA 3O8WA 2UUWA 5B0EA 2UVVA 2LXIA 2VL1A 3OHBA 4Y2KA 2EG2A 3M2UB 4JI2F 3OUYA 4EEYA 3P5TL 3LOUA 1DURA 1FEEA 2GMLA 3LGMA 3MMAA 5KOXA 1RTDA 4FXWA 4ICLA 4X4UA 2RS2A 1N48A 1YJTA 4DL4A 2RQ4A 3MWBA 2KT3A 1FVQA 2XG8A 4IFYA 3GV5B 3FNNA 5J1EB 2L48A 2G4BA 3Q8SB 4HKQA 2N3LA 4XAKA 1FJ7A 4F8RA 5DG7A 2B5JB 1RTHB 4K59A 4Q0BA 5I3UB 3K2YA 1HD0A 4B9MA 2LU1A 3TRGA 4ED5A 4Q7AA 5HMWA 5HL7Q 1T95A 3M1VB 2FIUA 1RT1A 4TKTA 5J2NA 2IA0A 2XWYA 3M4XA 4QWEA 1SB6A 1WACA 2Q43A 3JAMY 3GIKA 1SJ3P 2XMUA 1C2PA 2XC9A 5HMZA 4CQ1A 4F2SA 3FSYA 3HMJG 4ZVEA 2BUNA 3O6QA 5IZHA 4FXVA 4X62F 4ZCMA 1W2BR 2GMHA 2FTRA 4K2XA 1HQUB 4X84A 3DC2A 4U6PA 5KFAA 3U1NA 1MROB 2QLXA 1P27B 5CXTA 3H8YA 2VOOA 4OI1A 4QYRA 3D1QA 3NAIA 2A1BA 2EFNA 3TA1A 5C5JA 3OVAA 5J2MA 4C3KA 1UL3A 1DHMA 1Z2ZA 2R7OA 4X4RA 4FS2A 2RRAA 2CPJA 3R1LA 2PC6A 2N7YA 2UVRA 5A0YA 2LECA 2KT2A 2DCLA 2CJ9A 4B9SA 1VRUA 5MAOA 2W9CA 1YITS 1H2VZ 4EGLA 2PE8A 4BWJA 3POTA 5AE1A 3IAS9 5B0BA 5IM0A 4X66F 2IVYA 3HHKA 5LL6d 2MDAA 1YJWS 2VV5A 3Q2TC 1QAXA 3H2UB 4QWDA 1X4HA 3I0RA 5KFMA 1B64A 3PACA 2HNYA 2PI4A 1F9FA 1S1XA 4I69A 1TK8A 3CDEA 3CVKA 2GV1A 1HBOA 3S7RA 3U02A 2D74B 5DDOC 4TLRA 1AUDA 2D9OA 3OL8A 3MUTP 4DUZF 1V3RA 3B4MA 2MKSA 3TVZA 4ZHRB 3QMQA 4DR3F 1FKPA 2JZ5A 4IDKB 4NLOA 4BS2A 1R31A 1P8GA 3VAJA 3VAIA 3DOKA 3KNGA 3MM9B 3A8EA 1VC6A 1IUJA 4TY8B 1T03B 1FTCA 2O67A 2MGZA 1FXRA 3SCIE 2NS1B 1SXLA 2LEAA 4AL7A 4ECYA 4K4UA 2W8KA 4NA1A 2AGQA 3TNVA 1U45A 2R7VA 2BACA 4I64A 4UQGA 3UD3P 3LP0A 3KJVB 2JX2A 5K9FA 5M2UA 3CD7A 1RT6A 2RSQA 3UCUP 1JJ2R 4Y28C 3BO2A 2VC1A 1D9AA 2OPRB 3HVWA 3KK3A 2GW8A 1S4FA 1YG0A 3BQ1A 3CB4A 2YKPA 1HBUA 4OHWA 4YDDB 1BQMB 1JLAB 1XR7A 4RNMA 2A3JA 2OD6A 4OZNA 5I42B 1ZAXA 3W2VA 3Q8RB 3C6UA 1UVMA 4ECUA 4ZHRA 3KLIB 5T7LB 3UWTA 2ZJPQ 2R4FA 1FRXA 1CSJA 1VHFA 3HI9A 2HWTA 4MFBB 3T1HF 2EFVA 1DQ8A 2M9KA 3N0VA 4NCAA 3P96A 1IKVA 2C3MA 1Q53A 3M2RB 4C8ZA 5F0UA 3QZ8A 3H5SA 1UWBA 3PJXA 4ELUA 3MFHA 4ZS6A 4U67Q 2M8HA 3HKZD 1Z2LA 1S10A 2B6AA 2ZH7A 3BDPA 4NRTA 2R9LA 2GHVC 5GADI 1FXLA 1FRIA 2K3KA 2G13A 4QU6A 1Y3KA 3OLBA 4CIOA 4R8UB 2VQEF 1NRKA 5A8KB 3R5AA 2CJKA 4V19X 2CPZA 3RU0A 3V81A 4ZCLA 1M5OC 2DISA 4IYQA 3W7BA 3SV4A 4PPDA 3IR5B 3LO3A 2MQLA 1R89A 1S9GB 2DNPA 3CJ0A 3KG0A 3AJ2A 3R5BA 3M8QB 1WF0A 4B9TA 1S1UB 2DNKA 2HLTA 2CIMA 2FJWA 1X0PA 1YRTA 2V8DA 2NSBA 4NLRA 3LP1A 1O0PA 2L3MA 3FEZA 3PRBA 1QAIA 3HHLA 4TU8A 1X4DA 5F8MA 3HHEA 4NL5A 5DG8A 3DXSX 4QWCA 5I3QA 1JLCA 3IWNC 4DX8H 5LSRA 3TYTA 3T1YF 3IRXB 4X4NA 4ECZA 4O44A 4EUVA 1B7FA 3BGLA 4DV6F 1DQAA 3VCDA 2OPQB 1CVJA 3SZ2A 5J2QB 4NCBA 2V8GA 3G4SS 2AX0A 1X4AA 2ROGA 5D77A 2W9AA 2ASDA 2XS7A 3V5RA 2GQ2A 5KFHA 5KFWA 1M90T 4X2BA 5FIIA 3V81B 3TAPA 1NK8A 2E29A 3MOZA 4IFYB 2ASLA 1D9FA 5E5NA 1I6JA 4DL5A 4NLGA 2HHQA 3DOLA 5D8HB 3QZ7A 3ZZYA 2FVPA 3QGIA 2GHWA 3SQGA 2JVRA 3VZHA 3M6UA 2R7SA 4TXSA 3DRPA 4C4WA 5K14A 1NK0A 4ZP8A 3D2WA 5D6GA 2DHSA 3PW4A 1D1UA 2LQ9A 1YSJA 4DUYF 1IKWB 1WEZA 3J7Z5 3JTNA 2O5DA 4PG5A 1JWWA 5GMKa 1JLEA 2G9OA 2DB1A 3O2IA 4RW8A 4GO7X 3IRXA 2HLUA 4HL9A 2GIRA 2MJUA 2X3GA 2ZNYA 5E3AA 1K0VA 2YKQA 4KKOB 2K7JA 1M5VC 2B0GA 3OL7A 2FVQA 4MKYA 3ISZA 5BYRA 4B9UA 3UR3C 2HS4A 2ZH6A 4F3MA 3M2VA 1N6QA 3ISND 2MSSA 1TV6A 4J9NA 4ATNA 4A8MP 4A8FA 4OZ0A 1N56A 3I87A 4OHYA 3M9MB 1U6FA 4IG0A 2ZZMA 4ILRA 4DV1F 1RI7A 2YH0A 3D0IE 4YR0A 2DNQA 1AROP 3DCAA 2FHMA 2SXLA 2WSCC 5KFSA 3BGRB 1VQ6S 4WKRA 2EPIA 1FESA 2GC8A 4ED1A 2UP1A 2IHR1 1WHVA 4ES2A 2A18A 2EWHA 2RU9A 3OXLA 2P6TA 1H98A 2R8IA 5B0GA 2YKAA 3GFZA 3PX0A 1OS5A 3F41A 4L3NA 4K5SA 3WC0A 4CZCA 2K1RA 5T41A 1U49A 1VQLS 5B0AA 3THVA 1RQ0A 3M8PB 1Q8BA 4I7FA 3LALA 3DRSA 3F56A 4JV1A 4M1KA 3ZZUA 2FHKA 1LW2A 3FGVA 4RBUA 1HMVA 2YKMA 5CZXA 5L9XA 1XR6A 1JNZB 1ZAVA 3N79A 2VKZG 2KI2A 1X7VA 5KT3A 3JSMA 2UUBF 3BEGB 3OTOF 4XDCA 1NJYA 4LMZA 4IUFA 3PO4A 2V4JB 2CQIA 4OQJA 2CZ4A 3CCLS 1E6VB 1NKBA 2ZH2A 4A4JA 4F3OA 1R8CA 1HQEA 1GQEA 3D1HA 4IH5A 4GKJF 2MSTA 5C25A 3JYTB 2HW3A 1X8DA 2MXYA 3FMBA 2I1RA 2QIFA 5L8RC 2AWZA 2NSCA 5KFJA 4CH1A 5B0CA 1SV5A 2D1CA 4XIUA 2RNEA 2IAJA 2BE2A 2VC0A 2QSWA 2OFHX 3DLGA 3EZUA 1RDRA 1DARA 1VBXA 1VC5A 5HO4A 2YKMB 2W7PA 2JSXA 3CCTA 3UFCX 3J7YU 2MHNA 2POKA 2R2UA 1IBMF 2B7BB 5BR8F 1Y5LB 5HP1B 1S6QB 2UUCF 2ASJA 3PFOA 1H3DA 2Y1IA 5GVQA 3VR1A 3T5HA 1N8RT 2OH2A 1C0TA 1N5YB 1E6YB 2D3ZA 5F8HA 3L7PA 3DLEB 4K4ZA 4A8WA 4UQTA 1U1PA 5I42A 2QA4G 4ECXA 2BQ3A 3PKMA 3HM9A 5BJRA 2KXHA 2F8MA 4IFVB 2AV5A 3GV7B 5JVGQ 2NUHA 4JV5F 1HNXF 4FNIA 5F8LA 2BABA 3B82A 3CCVS 2AX1A 5F8GA 4FZVA 2IYGA 1VGYA 4K5RA 3DDNA 2M5YA 1TK0A 2DNMA 2IM0A 4RW4B 3M2VB 1N6QB 2YNGB 4LF8F 1A7GE 1N0UA 1U26A 3BREA 2AGPA 5KT7A 1ZZFA 5FDLB 2RMLA 4Q0BB 2BQRA 1QJHA 2BZ2A 3RTVA 3NGKA 4LF5F 3OFEA 2KT5A 4RW9B 3BO3A 2XWXA 3O5TB 3MOJB 2V9WA 1W2IA 3DRPB 4FXDA 3K0JA 1S48A 2DGSA 3MECA 4R5PA 3MMBA 3TO8A 3SSQA 2IRUA 1GH8A 2HQ3A 4OZ1A 1RT4B 4RUCA 5KFVA 4O4GB 1X0FA 4RW8B 2O01C 3K7RA 1J5EF 3MMCB 2BDPA 3KLGA 5CYJA 2ZVSA 1TKTB 4DSIA 2KFYA 2J0WA 1VK3A 1O51A 2HGNA 2W7AA 4PXDA 4ERDA 5KG5A 3F44A 3C6TB 3OBIA 1JLEB 2MB0B 1U7LA 2K8GA 4J9KA 3TI0A 2YNGA 3L95X 1RT5A 3LP2A 1KOOA 3MM6B 1JLCB 2ZHBA 4KR0B 6FD1A 2B4VA 1SJQA 3H4DA 4P2SA 1SL1A 2V94A 2CFXA 1UFWA 4QIEA 1EP4A 2ERRA 2NZ4A 4DN0A 2E9RX 4IH7A 1SJ4P 2VBYA 5IQ6A 4NLVA 2QZ8A 2ZH8A 3BO4A 5AE2A 1VI7A 3I6PA 2HHTA 4KV8B 3KFWX 2KTQA 2C28A 5DDPC 1VLYA 1C0TB 1Q82T 2DIUA 1N5YA 2P6SA 3LH2S 4KTQA 2QE5A 1FRJA 1T94A 4J9RA 3VZIA 1LXNA 4ITSA 4OHZA 5HP1A 4ECQA 2DHXA 2BJDA 3N6NA 2CPEA 4OHVA 2DH7A 3CCMS 1HBUB 1Q8LA 1S1TA 4ED0A 5EX0A 3W2VB 2L9NA 4NYZA 2W4CA 3UR0A 3JSYA 4ED6A 3GB0A 4O0IA 1ULRA 1DTQA 3ETOA 1HYSA 2YVSA 2G1DA 1AW0A 1JX4A 4DR4F 4DFMA 2VASA 5KG4A 4IRKA 1PC4A 1G2EA 3N6LA 3EZ5A 2MYFA 4Y3CA 3BR8A 3QO9B 2XLKA 3MF5A 1JJHA 1Y7PA 3LF0A 3L3CA 1VS3A 3FDSA 2UU9F 4KAIA 5L39A 1N4LA 4D3GA 1KTQA 2JC0A 4NA2A 2FJVA 5CYQB 4WF9Q 3EXYA 4KPYA 2PFFB 1RT4A 3R5CA 3THPA 3VAFA 3BM7A 1S0NA 3D5MA 3HFKA 3GIMA 4DR7F 3TARA 4ECTA 5A6WA 2AQ4A 5MLCV 4BHQA 1KQGB 4AFFA 2X1GA 2HHHF 4K4VA 4QYZJ 1S1XB 4A47A 2WONB 1N5TA 4OV1A 4KO0A 4O23A 1S6PA 2C3YA 1F2GA 2RU3A 1DLOA 1YQHA 4DG1A 5IM0B 3LAKA 2EK1A 3MFIA 3D54A 3QAEA 1LWCA 4TYBA 5A6PA 4B3SF 2BR0A 3FQLA 1M1KT