3DNFA

Structure of (e)-4-hydroxy-3-methyl-but-2-enyl diphosphate reductase, the terminal enzyme of the non-mevalonate pathway
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
MVDIIIAEHAGFCFGVKRAVKLAEESLKESQGKVYTLGPIIHNPQEVNRLKNLGVFPSQGEEFKEGDTVIIRSHGIPPEKEEALRKKGLKVIDATCPYVKAVHEAVCQLTREGYFVVLVGEKNHPEVIGTLGYLRACNGKGIVVETLEDIGEALKHERVGIVAQTTQNEEFFKEVVGEIALWVKEVKVINTICNATSLRQESVKKLAPEVDVMIIIGGKNSGNTRRLYYISKELNPNTYHIETAEELQPEWFRGVKRVGISAGASTPDWIIEQVKSRIQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of (E)-4-Hydroxy-3-methyl-but-2-enyl Diphosphate Reductase, the Terminal Enzyme of the Non-Mevalonate Pathway.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-enyl diphosphate reductase
total genus 102
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 1.17.7.4: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase.
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02401 LYTB LytB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11270 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dnfA02
3.40.1010.20 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; domain 1 3dnfA01
3.40.1010.20 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; domain 1 3dnfA03
3SZLA 4N7BA 4H4DA 3KEFA 3UV6A 3ZGNA 3URKA 4MUYA 3SZUA 3SZOA 3F7TA 3UV7A 4H4CA 3T0FA 3KE8A 3T0GA 3UTCA 4MV5A 3ZGLA 4MUXA 3KEMA 4EB3A 3KE9A 3UV3A 3DNFA 4H4EA 3UTDA 3UWMA 4MV0A 3KELA
chains in the Genus database with same CATH superfamily
4DM4A 3H5OA 3L1UA 4BNYA 4N49A 4UU7A 3F8TA 4MB2A 1TF7A 2BEKA 3JQ7B 1NUTA 3IA7A 3NHYA 5HG0A 3ZHBA 3VZSA 1NLMA 2GHQA 4PC3A 4L9SA 3ZY4A 4F7DA 4E5UA 1M2HA 2BFWA 2YINC 2ZULA 4A8PA 4B75A 1E3MA 1B8UA 3JQGA 3BFPA 4N6OA 1U9IA 1Z5OA 4X6LA 2DLCX 4OXYA 5J2TA 5KNCA 1DCTA 1BMFD 5F1KA 1NNSA 4WOBA 4AJEA 3HPRA 4XX0A 3PA6A 3GJ4A 1IQ0A 2XKAA 3GGCA 1JQ3A 3GDOA 2PBLA 3SSOA 2VJBA 3H6GA 3VDXA 1O0SA 1OGJA 1WXEA 1YMUA 2B4AA 2QRVB 2EWVA 5GMOA 1UBMS 2QRUA 4S04A 1M0WA 1VZ3A 3A6KA 1G6Q1 4ND4A 5KVSA 4JLUA 3I64A 2YV2A 1KI3A 1Y1KE 3IV6A 5JBQA 3T0IA 3SEQA 1KIFA 1NW7A 1WSAA 2F64A 3V7UA 2QAGC 4CM4B 5JVDB 3A32A 5BYAA 3ZJ5A 2RHLA 4X1YB 1VRWA 1OWOA 2WHXA 5EZYA 2NU7A 2IDJA 5KTOA 2BFEA 4EZIA 2WJPA 2AR9A 5K3AA 3D8NA 1UMBA 4EFDA 2W48A 2CD9A 4DDKA 3EIWA 4KVGA 1TVKB 1YASA 2AJBA 4GP7A 4C2BA 4DJJA 2I8AA 3BHJA 3BMCB 2DSNA 2JS7A 4LSZA 2PBZA 1RFGE 1BXGA 3DQQA 2CUKA 2OO5C 4YJGA 3H5IA 3BGWA 1UJNA 4M6WA 1NR5A 4WN9B 2V0CA 1BS1A 3ZDEA 1NZDA 3DMGA 4OQ4A 4XAQA 4AP5A 2QS9A 3RU9A 2JFUA 1HF3A 1Q57A 2O7NA 3KXDA 4KRYA 4RZSA 4G36A 3N2KA 4UTOA 3ROKA 4A6XA 2PL5A 1TYZA 2G4CA 2R00C 5AP9A 1R6TA 4TKUB 4EUSA 1GT6A 1T5LA 4M0FA 4OD0A 4CKZA 1YRHA 5GGXA 5DNUA 4Q34A 3COYA 4L5JA 3REQB 2EVWX 2PH5A 3P9QA 5CPFA 3SZOA 2YWJA 3IVCA 5AW0A 5JFTA 1ZR4A 4K9OA 5DHSA 3U1TA 3ZIAA 1C8LA 3GPLA 3NHJA 4Q05A 1US8A 4QXPA 2OSBA 2R5WA 2V0NA 3FPEA 4WMLA 3D6NB 2Q2QA 3FMFA 1IZ8A 1DB3A 2PFKA 3GJ6A 3FH0A 2O7SA 3C7TA 2I87A 4Z54A 4C4XA 1ID8A 3LP8A 3R3WA 1ADFA 4NF2A 4AO6A 4G0OA 2GZ3A 1OTYA 3D2BA 1IXKA 2QUBA 1QFYA 4JLPA 4LYFA 1JBKA 4TMKA 2Q46A 3WLTA 2NUBA 2IOYA 2QRLA 2DQ4A 1SCIA 4DNXA 5CFRA 3FBTA 3ILSA 3PFFA 1A9ZA 2DXIA 3AESA 2FN7A 4AROA 3VSBA 3BH6A 5TQVA 3F7MA 3VPFA 1AO3A 4DWOA 1OXTA 2ENUA 2OHXA 3AB3A 3WG9A 4BO5A 1E9CA 4BNLA 4C3VA 1O97C 4QTXA 5IARA 1IZYA 2A94A 3I2IA 1YFJA 5DGIA 4MI9A 4UEJA 3KEMA 1BFKA 2ANBA 3VTKA 4JC0A 3LP6A 1D3AA 3OJ0A 1CQIA 2C8KA 4C89A 1WXIA 3DKPA 3FWYA 1Z0UA 4WY8A 3CEMA 4O4LF 5CITA 1MT0A 1E6CA 1V0JA 3AEQB 3QFSA 4GBED 3T1NA 1QU3A 2IX9A 4FGSA 2P6NA 1XZGA 1YK1A 1Y7TA 2V4MA 3PGA1 5LQDA 2CBGA 2B92A 2QAIA 1CY2A 4PINA 4O1IA 3ZS9A 4XGRA 7YASA 2DKFA 3JX9A 4B4UA 2X6QA 4K6FA 1N1GA 1YDEA 3HCCA 5EVCA 5DF1A 3C8MA 4PXAA 1OFUX 4JI5B 1EVIA 1BMTA 1YHZA 3I9V1 1QU2A 1NL3A 2QZ9A 3QBVA 3WLSA 3VR6D 3HXOA 3SSMA 1JBQA 1L1EA 3JD3A 4I1VA 3ZUGA 1SBTA 3L7JA 4HNAA 1L5FA 4YP0A 1TU0A 3TK1A 1K6IA 1CS4C 3T3PB 3IRVA 5DTIA 3U7QA 4N40A 3GLGB 6CHYA 3S2FA 4CTMA 5DMXA 3V42A 3X1DA 4BMYA 2WNSA 1VHJA 2HPVA 1PNOA 1SCBA 2AOUA 3G0GA 3M82A 3V4LA 4BO1A 4Q9KA 4KWTA 4N0MA 4MV1A 5G0VA 5F4BA 1P5RA 3B9BA 4HX2A 3C15C 2JAQA 3IAFA 4TMYA 4KZPA 2PFGA 2QX9A 1P7CA 3E3LA 3QVXA 4KB5A 2QIOA 4I4LA 4YJGB 3ZKAA 3ZNNA 3QXCA 4FU0A 1TW2A 2PPLA 2Z2JA 2E4ZA 3HL0A 4PQYA 4TS9A 1H2FA 2XYHA 2Z1NA 4N03A 4W1RA 5FUQA 3F7OA 3CW9A 2OGWA 1X8JA 2MYTA 5JRDS 3CCFA 4HLUC 1K7EB 4MQLA 2RSLA 1NMZA 4FHEA 4RTNA 4ZFNA 1FJXA 3IDOA 3P27A 4UTXA 4CMEC 1W4RA 2H31A 5EL0A 2D54A 4LRYA 3K5HA 1DPFA 5SY9A 1LSUA 1PWYE 5FPKA 1T9DA 3EC2A 3F3YA 3BEDA 3U6KA 3OU7A 1GSAA 1DTWA 2P5UA 3NVDA 5EI5A 3KBOA 1DKOA 5IP5A 5AW9A 4J3NA 3V8VA 1C7ZA 1CG6A 3DDNA 3MGCA 1I4EB 1L7QA 1RHQA 1MJ5A 5JCXA 4YONB 5K3BA 1M10A 1P8AA 1LUAA 4E46A 2BUBA 1FDTA 2O07A 3OICA 3G9XA 4FMDB 3TXYA 3E03A 3BX1A 4IJ6A 4KQIA 4E14A 1A9TA 4ZODA 4NG4A 3NHLA 2BGRA 4Q82A 4Y9TA 2VP9A 4QDTA 1QQ5A 5B2EA 1AQLA 1HQYE 2OCDA 2RKOA 1XQWA 3R5JA 4LJSA 4LVNA 2XTAA 3B9RA 3ITDA 2B3DA 4UTVA 4B3HA 1YB5A 4Y6QA 2RJNA 1V7ZA 5C8DA 2H2WA 1TQ4A 5I7UA 1NRWA 3JRWA 3L8GA 1F0NA 1OLXB 4K9PA 3TNFA 1L7NA 5TGDA 1G3MA 3WMFA 3ON5A 1DAKA 1FVXA 1PIWA 4LC0A 4LDJA 5FR2A 1MENA 1NOJA 1WR8A 2CWDA 2XUDA 4L57A 1P29A 3EVEA 4MYDA 5TSDA 4BU1A 4BWYA 5BW8A 1QRUA 3W9UA 1O58A 4IYJA 2HO4A 3EX7C 4YRGA 1M9NA 3MINA 4U7WA 4AS2A 1Z2NX 2QPTA 4MINA 3NW9A 4NPCA 4V0KA 5BN4B 4NJMB 3LOUA 5AW7A 2EGBA 4KQMA 3MS7A 5GM2A 2YN2A 2AQ8A 5SY6A 3ABSB 3SJBA 4LGVA 3QKSB 2OG2A 5K3FA 4FNMA 3KFLA 3PNYA 1CQJA 2XE8A 1V35A 3AGQA 4HYQA 4JIGA 4NESA 4PZZA 4PO1A 5L51A 1FMLA 3MOSA 1XJ0A 2W6JD 1T36A 1WUJS 2IPAB 2EJUA 3ZWAA 3K09C 4HCJA 3TW4A 2ZTLA 3OSZA 4RK0A 3AUFA 2WAXA 1G3RA 4MRPA 2H4ZA 4RZ2A 3Q3HA 4M1SA 5DEOA 2DSHA 1I4WA 1PBNA 1PSZA 1FTNA 4MYUA 1QHSA 2I99A 1GA1A 2OENG 4K05A 2PZGA 1AN9A 5F64A 1J2RA 1SXHA 4EGCB 4YCMA 3GROA 3MQFA 4DBLC 4OTZA 2JIZD 4YPFA 3E5NA 4ZZ2A 5CCDA 3TECE 1TT7A 1MB0A 1XWFA 4ZCPA 4LECA 3WK4A 4HH3C 1R6BX 3C3XA 1NXXA 2XUKA 4NHEA 5HQJA 1XPOA 1HI9A 4G5QA 4UQPA 2FG6C 3DCNA 5FWYB 2WR8A 5KKCA 3DOCA 1ZMTA 4TXJA 2DAPA 4DYVA 2QZJA 3ROMA 4BP8A 3IALA 1IBRA 2FKNA 3CURA 4R0MA 4YR9A 3TG8A 3BMQB 4G4GA 3TOVA 1A8HA 3MWKA 5SV2A 1BMQA 2EFJA 2I3GA 1JHOA 1QGUB 5FL7A 4K87A 3FYHA 1L5KA 1PEDA 1OROA 3ESRA 3KD2A 3RRBA 1YOVB 1PG2A 2OFFA 1M73E 1WD7A 1ZNXA 2PMDA 1XVUA 2N0SA 3CFYA 3HRKA 5C52B 3UNXA 5FOTA 2PSFA 3HCNA 3THOA 4MK4A 3EDMA 4X20A 5EC8A 5JCOA 1Y4SA 3GLFB 1RYNA 5KDOA 2Q4DA 2HJGA 3FHTA 1UJCA 2E9SA 3K20A 1N2HA 4K9SA 1W93A 4B76A 4W1PA 4EDHA 4F21A 1QBGA 3S1AB 4KPYA 3WZMA 1KSFX 1Q84A 4E3ZA 3E7XA 2GAOA 4Q9IA 3KL4A 3OHPA 4XQCA 3WX0A 1CUBA 1R66A 4O6VA 3SSNA 4D4KA 5HS4A 2C29D 4HQOA 3L0IB 1M1ZA 3A0UA 3DMHA 1EM8B 1DELA 1NKSA 5AKZA 1ZITA 3EEOA 4XFJA 1JMVA 4UMFA 5EE3A 3TIXB 1J0AA 1NIPA 2CLOB 3MWYW 4TYPA 1F2TB 4IGKA 3TL6A 1QK3A 3VR5D 4ZU3A 3HB4X 3GOHA 4DCJA 4UM9B 5KNBD 1YI0A 1WETA 1M5UA 1TQDA 3JPYA 3Q41A 3VKUA 1FDIA 1L5SA 1L7BA 1OBFO 1B2RA 1UP7A 3HYRA 1EFVA 2MSNA 4G97A 2FPRA 2E07A 2R47A 4FD3A 2ZT6A 3L8ZA 3QYAA 3T4EA 2QL6A 2R7KA 5LA6B 5ALSA 4FOOA 5CMLA 4L6IA 4OPMA 1ZW6A 1JA1A 2G5CA 2VKTA 2F1HA 1I2DA 3OOWA 1OZGA 1M6VB 4HVCA 2HW8A 3R5TA 4ZT3A 3JALB 4UARA 2HXGA 1IBMB 1MC5A 4K6HA 1HDZA 4AUMA 5CVEA 1XGKA 2JEOA 1D5CA 2OESA 1Z5PA 4EA9A 1D6SA 1PE0A 3I45A 1X9GA 1P7ZA 1PHRA 3HUFA 1T2DA 1K5GA 3W7AA 4FFDA 3VR6A 4EEZA 4MV6A 4ZCTA 4MRSA 1D04A 2OVFA 4RXUA 4DR7B 1EFRA 2ID9A 1K6EA 2Y05A 1ZONA 2XYPA 4GMDA 4YCBA 1Y3FE 1N5MA 2ZRHA 5AHWA 4J1QA 1JYFA 3Q8KA 1SKAA 1VJCA 3D8UA 2EP5A 3CPSA 3VR6H 4E4RA 3UFXA 4ZDIA 1QAOA 3LZ6A 2O6HA 2VF4X 2WUWE 3TAXA 4B80A 1RWWA 5KQRA 3D5EA 3NTVA 1ZUD1 2IWRA 3VC1A 4EI9A 4GSKA 4ZHQA 3IBGA 3IKMB 3PE6A 4S05A 1MV5A 4J7AA 2NSYA 5A71A 4X91A 2OLEA 2HSJA 5DI3A 2VBIA 3MK31 1K4KA 2JZOA 2VRBA 3TPFA 1W1IA 4JQZA 2OZPA 4LHEA 4EHBA 3RD5A 2VQFB 3UBTA 1BVHA 3LW7A 3ABRB 1HZZA 3PEVA 2OP1A 5FPHA 3C5HA 1DS6A 1JEEA 3HB0A 1DI0A 3DLHA 4H7JA 1F2UB 3WL8A 4EFLA 4MAAA 1YZGA 2R8BA 4UXIA 3FRIA 3R8FA 2VI5A 2J3DA 5E3JA 2WHPA 3ILVA 4WGFA 5I5GA 1GHTA 2FN3A 1PT7A 1DKPA 3PKZA 4Q21A 4O4JF 1VJ1A 3UA4A 1M2OA 4KXYA 4TN1A 4ZGBA 4GKKB 2WNIA 4FJ1A 5DHPA 4Z9YA 1M2KA 2QV7A 1LK0A 1N8NA 2A0FA 2PZAA 1KVSA 3MWEA 2P5CA 4AX4A 3DZDA 1CR4A 2QZPA 4WK0B 3VKHA 3A70A 3ZE0B 2Y0EA 2MYNA 2P4QA 5BSMA 3QFFA 4LF9B 4X24A 2QQ5A 3FMPB 3TQIA 3VFDA 1KETA 4LCBA 3B2NA 2NVWA 1Q7CA 1K5HA 1ZNQO 3K9QO 4TYWA 4KQJA 5BSVA 2YDXA 4YJ2A 2BR4A 3K35A 3OT5A 4CTKA 1LZLA 3OZVA 5LLSA 1PZXA 3L6CA 5JNWA 2PCIA 2L2QA 3DHYA 4V0ME 3BFJA 4RLFA 2R6JA 4RA6A 1BQ3A 1EFLA 1UJ4A 5J47A 1KWGA 3CLRD 1R6VA 2Y0BA 3FOWA 1TCCA 1VJ5A 2B21A 4KU4A 4EG8A 1G21B 1GKKA 5FOSA 3O8QA 3EY4A 1EHCA 2OY0A 3BXXA 4UASA 1WZEA 1GL3A 2ABWA 3DR5A 2NZ2A 1NXVA 1POXA 2IYUA 5IABA 1VIVA 3E1SA 5ECWA 3IUBA 3UAZA 1ZM4A 5LQJA 1WZCA 2FPUA 1UK7A 5C1OA 2ZAIA 4Q02A 2AK3A 3IR6A 4IV8A 4N3BA 4WK2B 3E2PA 3HU1A 4YV7A 4H7EA 2NO9A 1B15A 3C6ZA 2DUNA 2PKXA 3OZSA 2ACKA 1A9XB 4Y2TA 2MCFA 1EWVA 5K8VA 4HRAA 1TKBA 4JA0A 3F3MA 1C1XB 2IPXA 3PQ3A 3H4IA 4RNDB 5LP1A 2H7YA 2UZIR 2YVUA 5AXBA 3TQCA 4PG8A 4FE7A 4L9WA 3ACDA 4C3OB 1XZQA 2PGLA 4QICA 3FJOA 3UH1A 4B43A 4CKWB 3SBDA 1D6NA 4I5FA 4MVJP 5F9FA 1D0SA 5KQGA 5T3UA 5CCEA 4YRFA 5AUQA 4YACA 1QRAA 2FPPA 3TTTA 2CHEA 3D0RA 5K0FA 1SPBS 3C8DA 1J99A 3EGOA 4UUMA 1OH5A 1JW9B 3BL5A 3DP7A 2LNDA 3UFXB 1NN3A 2DC1A 3ZW8A 5BR1A 1F8FA 1QTRA 3JZDA 1UOQA 2YMPA 3MMXA 3PDIB 5JNSA 4AJ4A 4ZHQB 1QQ7A 2EYUA 1R0ZA 5CBKA 4Y3UA 2IVFA 3J7AC 3SYMA 3J80A 1M34B 2AR7A 2UUOA 3EUFA 3R7FA 2I6SA 4EHKA 4CUKA 1LSOA 1E62A 1E61A 4XWWA 1W5FA 3RBVA 4ZVNA 1COZA 3DQPA 5AH0A 2DTXA 3IBTA 1RAGA 2PKQP 3NEPX 4MZXA 1HBJA 4BV3A 2E08A 1GQQA 3OTWA 4LZOA 1DIRA 1F0PA 2ZYUX 3PQ2A 5CDFA 2H11A 2OZLB 1Z3CA 1IZ0A 1CUDA 3JVDA 1AS0A 2GKOA 3V34A 2PB5A 1ISPA 1LJ8A 1J09A 4DEVA 3AVTA 4DMLA 5I4CA 3QVWA 1S3FA 1BXGB 3C3JA 3KQVA 4NCHA 5E4JA 4B32A 2GM4A 4PFJA 2EDCA 4B6GA 5JTTA 1W5TA 2VPQA 3TDKA 1WBJB 3LTEA 4M76B 1DVRA 4R1LA 1VBMA 5F35A 1O6CA 1TA4A 4A0QA 4C3ZA 1LQ2A 3D5QA 1AUVA 3AF3A 4BJHB 5BR7A 5I4KA 1HDRA 5KX5B 2DT8A 2PTGA 3L77A 4I1YA 4ETMA 3L1KA 1VL0A 2WTEA 3KBBA 1OW3B 4KRXA 1PHPA 1U9ZA 3AG6A 3UAYA 3WY9A 4YYEA 3FPGA 2XOXA 1NNUA 1MVLA 3QE3A 2J9XB 2Q0HA 3A3NA 1VI2A 3DEYX 3E7DA 3HA7A 1ZG3A 4GXNA 5AKIA 3AUXA 3W2EA 3HV0A 1PYDA 3ECSA 3B1FA 3LT5A 3U31A 1JR3A 3CA8A 3UWOA 3NBQA 3HI4A 5FOWA 4DTCA 4BATA 1PQPA 1GG8A 4TQUS 1TZCA 3O74A 4DEXA 1QS0B 5B4UA 1P4HA 4JZYA 2OD2A 3FM9A 3A0RB 5HKAA 2XCTB 3ETGA 1U99A 5BP7A 1RD4A 2GFIA 4QGBA 1TCAA 2C84A 4J75A 4O3FA 4ZVLA 2J6HA 5C4GB 2PTHA 2G0TA 3DO8A 2CF6A 4WN3A 4BIIA 1G5TA 3EMDA 4QAJA 1N6HA 3CO5A 4H17A 5EFZA 4CFZA 1M1UA 2Z30A 1JXMA 5UKDA 4DAEA 4X97A 4YJ3B 3UG6A 1C0IA 2REXB 5KI6A 1AVTA 4I1UA 3SFVA 5IHPA 3DVAA 2VJNA 4O4IB 3K3PA 1X7GA 3I6YA 1Q0LA 4IVRA 1PT6A 2XI4A 5EQFA 4RCVA 1JMYA 1U80A 5HFAA 5DFAA 3GPDG 1SULA 4YK7A 1GAWA 3I61A 2O3UA 4WOKA 4JI8B 2IW1A 2DETA 1T25A 1VPTA 1HDCA 3HZOA 3UKDA 3AF5A 1DXHA 4OU5A 5AVKA 1U8YA 4Y6SA 2Y77A 3WAJA 2AUMA 1U9IC 2ISCA 2QXYA 2PXAA 3MUOA 3P9CA 4NLLA 2H52A 3CUYA 1V7CA 3EVAA 3M89A 4EUFA 4MEJA 4KBGA 4V1CB 1W7AA 1AH2A 2QNRA 4MUYA 3N8NA 1F60A 4OQXA 4UDOA 4CJXA 2H2GA 4LNAA 4TRNA 3RUCA 1WVIA 2QLJA 2XA9A 4QGFA 1HTTA 2NO4A 1UQRA 3BN3A 2F7SA 4MB0A 5GVRA 2QORA 4FI3C 2Q3HA 3H42B 3EC1A 1GNSA 1PTJA 1XMQB 4HMQA 2XJ4A 4QUKA 4KWCA 4W8GA 1DFIA 1H6DA 3ICCA 1J23A 3IVAA 4P4SB 1H1LB 1R88A 1WXQA 2AJDA 4YDRA 3MYRA 2C0CA 5K20A 2X3UA 4NCXA 1O8CA 1VG1A 4MUAA 1E8MA 3AZPA 5ILOA 1RHRA 2VDPB 2H1LA 3WWZA 2O0HA 1UMCB 2X4IA 2CXRA 3P2YA 3CLHA 5F2EA 4OL0A 3SAJA 4D8UA 5I7HA 2X6TA 2JH8A 1ZGGA 5AJUA 1EDEA 3HCBA 2D5CA 5JQGF 5J2UF 1DJPA 2L69A 3I3OA 3WSTA 4DA4A 3CRRA 4IX1A 4KKVA 3G1WA 2BM8A 3MILA 1N0VC 5CR9A 2RAFA 5AHKA 3WA7A 4Q9AA 2OO5A 3LVBA 1UMDA 4MVJE 2D6FA 2W6CX 2CYCA 2HA3A 2QN8A 2B3TA 3LSYA 3W78A 4H4CA 4TV9A 3EWNA 5C7IO 4MPJA 5L6LB 1YULA 4PIVA 6AT1A 2VTVA 4Q7EA 5JAMA 5LXTB 1MQ9A 4LC1A 4QUBA 4UAUA 4UAGA 3L4KA 1K8ZB 5I3CA 2CNWD 1CTQA 3JZIA 5FAXA 3WLEA 5K0GA 4HYYA 1DIOB 4E2ZA 3GP3A 2P6LA 4L27A 1YV9A 4RPGA 4TWBA 1W4BA 1X1BA 2HL6A 2HWKA 3NBFA 4TZKA 4X7RA 1PZNA 4WWHA 3TGPA 4JLWA 4QGSA 3N0RA 2ZRCA 1COWA 3UAXA 2XUIA 3T1HB 3OH8A 1P5HA 3DTTA 2OPHA 2GI4A 4II7A 1TZKA 5H4HA 1KE2A 3TB4A 3TO5A 3E6AA 5I9SA 2DUMA 1SCJA 1VB3A 2AI2A 1JEQA 2ZRQA 3GMIA 2JJMA 3H97A 3LC2O 3Q5DA 1VYUA 4POAA 1JIXA 1Y3AA 2DMRA 4I7EA 4ZWNA 3KQMA 5LP6F 2IELA 3MTDA 2YWDA 1XPJA 3EOAI 3IE2A 1DEOA 3LIPA 4IXDA 1GFZA 1SXJD 4BQFA 3TQQA 3N0VA 2WHEA 2QTCA 4R81A 1MJFA 3T35A 1CJCA 4A23A 5ARDA 3UMYA 4D3FA 1ILWA 4BAGA 1AC5A 5TPZA 1YC5A 2WPNA 5BV1A 3FPKA 121PA 2EZ8A 3B7WA 2GD1O 2JFBA 3AY3A 2ZR0A 5EE1A 4NNOA 4RVCA 2H5EA 3L8EA 3OQPA 1WHSA 1SXJB 1ZAYA 2QVYX 3QHAA 1JI3A 1BMDA 1Z62A 5I5EA 1BXRB 3F9CA 2HSZA 5BNTA 2VTDA 3JYHA 5FPSA 2VYQA 3ZWBA 3QSYA 1SVLA 4IUBS 4C4YA 5DP1A 1XAIA 3KB6A 4AECA 5C7OO 5HKBA 1N7JA 1QSGA 1Z5NA 5I51A 1ZEMA 2ADFA 2X14A 2Q0XA 1YB1A 3M6FA 4HK4A 4OLHA 3G7NA 2EKZA 3DOJA 3O82A 5JAHA 2BZGA 3M8KA 3ICPA 2FOIA 1GG2A 1GPWB 1HFKA 4PAQA 3UJPA 1W0KD 1S9HA 3MB5A 4BMPB 5JO0A 2R6FA 2PV7A 4X61A 3T5CA 3T7TA 1GQ2A 5DH9A 2CK3A 3DM5A 2R9VA 3GCZA 4K1XA 5D00A 1FYDA 4ZCLA 4CODB 4QT4A 2YJTD 3O47A 4O0MA 4ALIA 1Z6PA 2XCRB 2ATIA 3KZVA 1L4KA 5BXYA 5C9ZA 4G1MB 3E0XA 4UBKA 2R5NA 4H7KA 1Z2PX 2JRLA 2X7XA 4MIEA 1Q95A 2B0JA 2OD9A 3GJ3A 3RSZA 1E79D 4D8TA 2BBTA 1IVSA 1NDHA 2C00A 3HLKA 1BEEA 4EG3A 3PNLA 2IXFA 1OREA 3D4NA 1FF9A 1SHKA 2FH5B 4LXYA 4JP2A 3L92A 2HBRA 4PPQA 3A2NA 3UICA 5K3EA 3OAAD 4DCTA 1TJYA 1Z4MA 4B3MB 2EH2A 3C7CB 1GDHA 2CUTA 4GWLA 4N7JA 1KYIA 4CT4B 2C5FA 4F3YA 4B6FA 1O87A 3H3XA 1Q21A 3Q6NA 4LBZA 3PFGA 3JVEA 4R2JA 3VR0A 4LWPA 1XTPA 3KWFA 2IIPA 4OBWA 3C6MA 1E89A 3QUTA 3PHLA 3U7IA 3EE6A 3DA8A 3EDQA 4PLWA 5E8RA 2E5WA 4ARAA 4ACBA 1BCSA 1MX1A 2EF0A 4QO8A 2VJDA 2YJNA 1ZJ6A 3AVUA 2XQKA 2DJ5A 3HABA 1JHUA 2Q9BA 4MAMA 3UCXA 2FFQA 4C0KA 3ZHCA 4H1VA 2V8BA 4HEQA 3RODA 1EFPA 3M33A 1UK6A 1F2TA 4IGFA 4B1FA 1VL6A 1PG5A 1E96A 2ZYHA 4HN4B 4W99A 2JLYA 3KAQA 1MW9X 5FOQA 2GZAA 5LD2B 1N2SA 1MJGA 4RF2A 5CT8A 4ARCA 5H82A 4X62B 5F98A 4HYTA 4LTDA 4C08A 3DVQX 1C4WA 5AKYA 3DD1A 5DBHX 2JGDA 4PS1A 4Y30A 1QB7A 3T4XA 4TKVA 3KP1A 3WMGA 3JVUA 3ITEA 4NL4H 5ER6A 5FEUA 2BHNA 3BRQA 4TTPA 4QBKA 1N1EA 1Z74A 2ID7A 2F6RA 5EY5B 2HY7A 5C4MA 2IHNA 1AF4A 2QRHA 1EEXB 1GUFA 2QG6A 4JNCA 4P7KA 1F3OA 3CR8A 5IX8A 4KNYA 5L7YA 1VJTA 4RDCA 2QV0A 3I1YA 1ZXXA 3RIGA 1UL1X 4WBNA 3VJKA 4F1KA 4QC2A 1OIVA 4FN5A 4KIGA 2C2WA 4QXQA 3HFGA 5BQ5A 2WKRA 1HNWB 2FEMA 2H1HA 3AEQA 3H6HA 2COEA 4MIYA 1ECCA 3FMVA 4M1QA 3DE3X 4U6NA 3UV6A 2K7FA 4DV3B 4DIFA 3OX4A 1PS8A 4Q39A 2AG1A 3BK2A 1YRQA 3PUYA 3T41A 5B5SA 1UPBA 4X3PA 4NULA 3VNQA 2ZAOA 3BULA 5T41A 1KGSA 5BUQA 3HADA 2FGKA 3MGKA 2QB5A 1USVA 2B6HA 2FWPA 3TZ6A 1FFSA 4BGVA 2QR5A 3OIWA 2JVJA 1DJQA 5KOYA 4BCCA 4ER6A 4ZANA 1KA9H 4RKFA 3AR7A 4XSGA 3WISA 4BLQA 3UWMA 1T2FA 4HDNB 3D7RA 4OM8A 5FJIA 5DI3B 4EY4A 3IPCA 3R3JA 3IIMA 3WKAA 3EC7A 2X5OA 1V47A 1RSZA 2YHUA 1ZLYA 2O8BA 3MVEA 2AOUB 6ABPA 2AQHA 3GIDA 1DDIA 5EN4A 1TEHA 1D1SA 3S68A 4ASUD 2CNWA 5FBKA 1XUOA 1MX5A 1U3FA 1RRPA 2BCJQ 1EX6A 4I6JA 3O84A 4O8ZA 4F46A 3U4MA 2H2DA 3BIWA 2OAGA 3E22B 3UENA 3IPXA 4C07A 3OFVA 1SELA 1KR5A 2JBAA 1VKHA 1Q7TA 2BR5A 4ZV4A 4CKBB 2XRFA 3HN6A 3IHLA 4GYWA 4TUYB 3W5IA 3EZ6A 2AOTB 3KX2A 1TAQA 3GVCA 4RJTA 5IUNC 1GGHA 3B9PA 1AZLA 2C7QA 1LF5A 1DIAA 1K1EA 4OUDA 4V0LA 3KFXA 2A5YB 5IVHA 4HXYA 2F1KA 4YUZA 4YJ2B 3L82B 3HUTA 2LCQA 4AF7A 1FTQA 1C50A 1LJLA 1NVKA 1Z9BA 4UKDA 4E88A 1W29A 4EKIA 5D3MA 4OI2A 3KCNA 4GYYA 4EVRA 2R4QA 5K2MA 1E4EA 4EYSA 3T3OA 1JKJA 1RS0A 2HA0A 3OEEA 3WL6A 4KBFA 5BSWA 1O97D 1OBHA 1Q7GA 2P75A 3EGIA 4NDZA 3SIXA 3P9YA 4OVKA 5HKKA 1NR1A 1KO7A 4G26A 4U5XA 3AONB 3DEKA 1GUBA 1GGFA 2FPKA 5BYBA 3B1JA 3SE7A 3HVUA 3GUCA 2WPDD 5YASA 3CH5A 5KYXB 4PTLA 2KLBA 5DHRA 1GL7A 4Q4DA 3SDSA 4R3UC 5LDHA 4J0GA 1FEZA 2VDRB 3PC8C 3IKVA 2REBA 2C2XA 2C82A 2JC3A 3HB5X 1A95A 1SNYA 1AOXA 3E84A 4ZC1A 2ZYSA 3P26A 4URWR 2UYHA 2Y9MB 4GZ6A 3G5LA 2QPLA 1U31A 2AXNA 4Z4CA 3I05A 4Q48A 5FI5A 5L3ZA 3BT7A 4JEHA 4UM9D 2QJTA 3HCOA 2E4NA 5KDDA 1ZDMA 1MO6A 4OJMX 4X1OA 3FNRA 3LQ4A 2CVHA 4IXWA 4BJ6A 1W0KA 3KZCA 4IV0A 4PG5A 1H0SA 1O94D 2DHQA 2ZI5A 3SMVA 5ELXA 4XYBA 1J56A 3MUFA 2A4KA 1HM5A 4INOA 3UFBA 1USIA 4CKWA 4CR7A 1TZJA 4L4SA 1OAAA 1AQUA 2DWCA 2KSQA 4M98A 3TPCA 5IBCA 1HDOA 2PSHA 2HMSA 4RTPA 5A3JA 2HZ7A 2O57A 4MW6A 2Z2YA 1WF6A 4ZAZA 2VK2A 3RU2A 3EXHB 3ADOA 2RAVA 4C7BA 4RTRA 3FTDA 3ANMA 2RH8A 3DDHA 4PAWA 3ZCSA 2ZAYA 3BB1A 4LYHA 4NDNE 4HY3A 3MRTA 1FS4A 1K98A 4GLOA 3LF2A 1PZFA 3CO0S 1ZC4A 2Z2KA 5C8XA 1OI3A 2H63A 5JS7A 4YCNA 3SM3A 3QYPA 1A7KA 3TSZA 3LC7O 3O4IA 2A33A 3K5IA 4J43A 1A2KC 3C8HA 4ZT4A 4KYIB 1GQOA 2XCOA 1JUDA 3GCXA 1YUMA 4H7HA 3GXOA 4OXIA 3S1SA 2HYDA 4CLOA 1RI2A 5KMGA 5BWOA 4CIAA 2HIGA 4R0NA 1OHHA 1EAMA 3SOZA 5L3QB 4WLUA 1PN3A 2WJIA 3ZDQA 1K89A 1KK0A 3NEAA 4FHZA 1UAAA 5C37A 3ZWPA 1FS5A 4QLAA 3IFSA 3ZHSA 1NW5A 5HFJA 2PEZA 3CSUA 2PS3A 3NPAA 1CU1A 2C9MA 2H0RA 5FAKA 5E2IA 2DYKA 1H65A 1X39A 2RHDA 3EA5A 3FVQA 3F98A 2MR6A 2NIPA 4PBSA 1UANA 2PMFA 3UMCA 3RYTC 4QG3A 4GNKA 4PVDA 1E6KA 5CTAA 3IEUA 2GZ1A 1C2TA 2EL1A 4RLHA 1FP1D 2QD4A 3ZVNA 1TJNA 1AKEA 2AFHE 4MLZA 5EVJA 4QJ3A 4IH4A 3BPSA 4U1RA 4DUGD 3LHSA 1CX9B 2HUPA 5JISA 4JXJA 1R0WA 2BHSA 3DOIA 3HKBA 2PQ6A 2HFKA 2AZ4A 1TTPB 1P60A 2JI8A 1SUSA 1HTWA 4MS1A 4DSAA 5JH7A 1HE5A 1Z38A 3V5NA 4MQEB 3OX1A 3VNRA 1ZMBA 2D1QA 3JYOA 5EPEA 2NUAA 1KYQA 4UEWA 5FFNA 5ALLA 1U0JA 2HLNA 4UQOA 2Z3VA 4LK2A 1R16A 3IA2A 3NO4A 2DKOA 4B2PA 1THZA 1FRNA 1G64A 2FFHA 3HWRA 3QLUA 4JOBA 4CF6A 1Y4UA 2ZQ5A 4PF1A 1E1KA 2P9FA 3KSDO 1Q83A 1QANA 3UB2A 1LLUA 4HJRA 3U9LA 3KYCA 3OD1A 3EVNA 3WWEA 1NVWQ 4CEJB 5B37A 4A2PA 3KWLA 5FB3A 3W05A 2WDPA 2ZSUA 4ZQFA 4M1YA 2E87A 5LA6A 2O2HA 1PAUA 1U2ZA 1Y6RA 1YCDA 3A27A 1VIYA 3IB3A 2QSJA 2RH9B 3PPYA 4L7QA 5PGMA 3FVRA 3CWQA 3TL3A 2ILTA 2BGIA 1LBTA 4XM2A 1W0CA 1N7GA 4OXXA 4G09A 1DOAA 5KNCD 1P44A 1WMBA 3ROZA 1E92A 1QF6A 3OP1A 2UXBB 1KJ9A 2BHRA 2OQIA 3M7IA 2ZBPA 3W4KA 4HPWA 3ZHXA 1ZI6A 5TMPA 3WRXA 3UXMA 1GT91 2V45A 4DDVA 1PK8A 1ZVJA 1C41A 2XDWA 3ICEA 4DZZA 4DN6A 1T5IA 3ND9A 3M3DA 2PWPA 2B7CA 2C58A 1SUWA 4MQ5A 2AG8A 1BN7A 4RPKA 2BSQA 1EHYA 3C70A 3I32A 2EGHA 1TF2A 2OAEA 4ALMA 4CFYA 3PXEA 4YGYA 2W4MA 4OQZA 2QRVA 3K9HA 4RWZA 4BX9A 2RJOA 3F90A 4HQFA 4XJVA 4Y1GA 1U5AA 1DBVO 1YDFA 1YR9A 2QUHA 4Z3DA 1CDDA 4DADA 3BKXA 2PSEA 2QL9A 3GLSA 3OQHA 1IONA 1VRCA 2QAGB 5IKEA 4K9NA 2EV9A 1RC0A 2NXJA 4NKRA 2W2MA 1CQPA 1QKKA 4MR8A 2XDQB 1L4FA 4MSUA 2HQBA 3D8HA 4RM3A 1EGQA 2Q99A 2ZUBA 3NHMA 2J1LA 5IAOA 3ZWNA 4ABTA 4KXXA 3L93A 1HY3A 4FGWA 4PX2A 1M1YA 1YS7A 1JEDA 2EH5A 2ONKA 3RK0A 1OLSA 3GJXC 3QY9A 3EHDA 5I9LA 3LQ2A 1G6KA 1QB8A 2YIDA 5JI3E 1AMOA 5HJEA 1TRKA 5BN1A 3IKTA 3JWHA 1HWYA 4AF8A 3ODGA 4WN9A 4RQUA 3AJ8A 5I8PA 2YVLA 2VDWA 1DPGA 2YS6A 3ACCA 2EDAA 3UJ6A 2ROQA 4DJTA 1H2ZA 5B30A 3PX2A 5CEJA 3IDFA 1L7OA 2QTLA 3JYQA 2NPNA 1FE8A 2B94A 2C03A 1EI9A 1AGPA 1X3LA 1K5PA 2B4QA 2VDQB 4OYYA 3BXOA 3T0GA 3UPDA 3ZW7A 4ZAFA 4U7PB 5B55A 5HM8A 4P3YA 2R66A 5AXAA 3SE0A 1A82A 3DXXA 3V1LA 3C5EA 1T10A 2QTGA 1CF9A 4Z4HA 4PC1A 1XVTA 4PCUA 4P33A 2HLPA 5LP6B 3PHJA 3ADCA 2GWHA 3CONA 4GX0A 4BO2A 1X3SA 2VA8A 1LFDB 3PQ7A 4FEEA 3PUVA 3W2HA 3QM1A 3QW2A 2VN8A 2RHHA 5FXMA 2GM5A 5JMWA 1EDBA 4YH1A 2XCSB 2ZUCA 2XMPA 5BQOA 4OQFA 3B13B 4KG7A 5DLYA 4O2AF 1CDOA 4KZKA 3OOHA 4ESEA 3M4NA 4Q66C 1RM3A 3KTDA 3NBXX 2Q4TA 3WNZA 3NWPA 2FA9A 4CEJA 2X4GA 1U7HA 3PU6A 3N2GB 2HR8A 3JQ8A 3HA3A 2VDKB 1D9ZA 3OIGA 3H8VA 5KKAA 2PXCA 1CKEA 4PQRA 4QXOA 4R71A 4BL5A 4OX9Y 3S2SA 3OQBA 2FWAA 1OH8A 4UHEA 3VDNB 2I55A 2HLHA 1DQZA 1L9XA 1PEYA 3JXEA 3L0OA 2G70A 3SR0A 4JMLA 5HQ3B 4AKTA 2OWEA 3C4QA 1YFZA 4DB4A 2HRBA 3BQ9A 1SXJA 5TB5A 3PQEA 3ZDZB 3I0MA 1O5TA 5THXA 1NJSA 1OA0A 2E49A 3LCVB 4YAEA 3SZ3A 3FCOA 4RDHA 5IMSA 4FQ8A 3SF8B 4O8CA 3ASYA 3KVYA 2VF7A 1Y8AA 3NHRA 3T6KA 1I4DD 4IVQA 4ZU6X 1E7RA 1OFUA 4MLDA 4WH0A 1EUDB 3H7AA 1ZOPA 3Q3EA 4LCJA 4B48A 3M2PA 3GBVA 2P40A 3B51X 4DLPA 2XDYA 2GEFA 1T2UA 3SR4A 2GN9A 4YA6A 2WIFA 3RT1A 4CLRA 1WCYA 3ZJTA 5ESDA 4NAHA 3OE7A 1GO2A 3AKZA 1JH9A 2NACA 2D2XA 4WKPA 4D56A 1FS6A 1Z56C 1EWQA 3BRWA 8ADHA 2Z8YM 2WFLA 2VYFA 1TLFA 4HQLA 1X92A 1BJKA 1BKYA 2O3RA 5JYDA 1NJ8A 3BD9A 3UJ8A 5LB2A 4W5HA 3J7TA 4DM7A 4M9XA 3IGFA 4HFJA 3K53A 1JQBA 1WQ3A 3BK1A 4IJKA 1OFVA 3W5BA 1OLSB 2B5OA 5GONB 3DBVO 3BA1A 4TSFD 2HUTA 4HPXB 4QYTA 4RPHA 5IDWA 3T99A 3CTPA 3DNFA 3H1EA 3I92A 2XECA 4LNHA 1W75A 1RYBA 1J70A 2P2DA 4M3NA 4BJ3A 4UVIA 1Z36A 1KI8A 4ND7A 5FADA 2EKAA 3GJSA 3ZKWB 1N6OA 1E94E 2DY1A 1N32B 2BTQA 3K0FB 3C74A 2NUPA 3CJQA 1QG6A 3E15A 2A3RA 4TZTA 4KHPB 4IIVA 4GPBA 5TMEA 5ICSA 1JEYA 5BSKA 3K8YA 3AMVA 4CN9A 3D81A 1NJ6A 2ZR9A 2YIVX 3NS7A 3KSUA 3UWDA 4UNIA 3QEOA 4N3AA 1BKSB 3TKAA 1E63A 3PC6A 3CIOA 4RAQA 1I32A 1E2MA 1RDFA 2J87A 1KSJA 1M67A 2VHXA 2ZI6A 3JQ6A 3TOZA 2PCAA 3AYXB 2ATEA 3DAPA 4BOYA 1X14A 2X0JA 1B2LA 2XKJE 3S3TA 4B47A 1GADO 1H6CA 1R50A 5EZ5A 3GUHA 3R24A 3L7YA 3ZI4A 4AYXA 1FUKA 1YDHA 4G8DA 3SQNA 4FMCF 5KSPA 3KJFA 4TL9A 2PG3A 4RLSA 1YRLA 3LXMA 4FOTA 2FZ5A 1PYOA 3E3AA 3WYFA 4UC0A 2BTOA 1SQFA 2ECQA 2TMGA 2Q4RA 3AV0B 3EXEB 5G1OA 3RBXA 5ALYA 2MSCB 2WJAA 1B43A 3KT0A 3L6BA 3ZWVA 1UIRA 3GWGA 4EL5A 2TYSB 2OM6A 3HBLA 4S0ZA 4KAXA 2BGLA 4K9MA 2JL1A 5BV2P 1T8PA 3BMNB 1OLXA 3K0SA 1PRYA 3EGDA 5BSEA 1E2NA 4R54A 1KQFA 2NVUA 2V6GA 2V6IA 5KTTA 1X8KA 2IGBA 2QQGA 1KJWA 3H8SA 5A62A 4LJRA 1X13A 1NP6A 2ZIAA 4Q7LA 4RQBA 4DUZB 3LUDA 1YS2X 2Z98A 4DDWA 2GZDA 2YIJA 4WASA 2XR1A 2P6DA 2XUQA 3O7WA 2ODNA 3UAVA 5EIBD 5JYEA 5BNWA 4I99A 4NE9A 4WEOA 2JIZA 1V95A 2Q8QA 2Q21A 1Y9DA 5KB3A 2IYOA 1MDFA 3QMWA 2HSGA 2O2EA 4ZRMA 5FT9A 3SN6A 1IBSA 2Q3JA 3E5MA 3LXUX 3PNKA 3T7RA 4KFRA 4N1AA 1F4VA 1CUIA 4NBSA 4QGGA 5KOIA 1KHTA 4OV6B 1OBCA 5AXDA 3X1JA 3PYXA 1WCWA 2WEKA 2J0VA 3I1JA 2ZXEA 4ZT2A 3KB1A 2X8BA 1IWPB 2HPAA 5FLXA 1AN0A 1NY5A 1LWNA 2J9FB 1CFZA 4BQPA 1UM9B 2FPXA 2WFLB 2AX3A 4DMCA 4M0KA 4Q3DA 4XWGA 1BTOA 1W2GA 2GN0A 3QA3E 4CM4A 1ZVQA 1JKMA 1C3LA 2WKWA 4CIWA 4GVXA 2W2TA 3EXIA 4Z3OA 4PN7A 4FFSA 2O8BB 1EGMB 1OKKA 1XU7A 2PGIA 5FWYA 1WLYA 1HFJA 2WF9A 4TT8A 4Y6OA 1UMBB 4DVGA 1L4NA 1OLUB 2OHOA 2WIAA 3DOEA 4J16A 3F9RA 4K8OA 4F5WA 1R12A 3DAYA 3EFHA 3LT1A 4BO6A 1FQKA 1MGPA 4JT8A 5B3KA 1FNDA 4REQB 5EMNA 621PA 2FR1A 4B09A 3ELUA 1NWHA 4MW5A 2IIBA 1PFKA 1R9MA 1XTRA 2JEYA 1UJ6A 2WSBA 3N7UA 1SURA 4LV5B 5KYKA 3E9RA 1YBFA 1UXKA 4LZLA 1QKIA 2C5HA 3EG5A 1DE0A 4AY4A 2XXBA 3QKRB 4K6KA 1PNQA 1SOVA 3GRFA 3BMOB 4ICIA 3IP1A 2C7OA 5KNBA 4Y8VA 3OM1A 2OTCA 5TMBA 4GS5A 2QUJA 3UT5A 4U2FA 1HDIA 4YT5A 3VR2D 2I6QA 4EUEA 3EOBI 1RM0A 2Y8EA 4KOAA 4BV8A 1XRPA 3CF4A 4EQZA 2GKSA 2BMVA 1AKVA 1CJVC 4PZAA 4E1BA 1HPLA 4GM4A 1AMUA 2PCLA 1AZTA 4L3OA 3CVYA 3R7NA 1DWUA 4ZREA 2R8XA 4PLTA 2WY2D 1P19A 2PQ0A 1EA5A 1WMEA 2JFWA 2RKBA 1LTHR 2XYVA 1V3UA 4YHHB 1FU7A 1U8EA 2VHYA 3TOCA 4L4UA 5DK6A 3TZQA 4F1JA 3TQRA 5HUJA 5FBQB 1EBFA 2YRWA 1R3DA 3N7TA 5JJ5A 2NZWA 3H9BA 1SBHA 4ZU1X 4RETA 3DMPA 1D2CA 2GPAA 2J41A 4IUCS 1DG9A 2RDMA 3PUHA 2E8HA 1DUSA 5KYGA 1NY6A 2F8SA 4I5IA 3QTTA 5KTRA 1X7HA 3AP2A 2HADA 2NVUB 4N18A 5FI0B 4G1FA 4JX9A 4OJYA 1MO4A 4JSTA 4GI5A 1VTKA 2P7IA 4IIYA 3W5UA 4BO9A 1XEFA 4E5PA 3KV3O 5DNDA 1P9OA 4FDAA 1JB1A 1LB1B 3F74A 4W7HA 4IRMA 2ZP1A 3GJRA 4FYIA 4CIDA 1QYXA 3AOEA 1HG0A 5JH7F 1ECFA 2NSJA 3WI7A 4PZ9A 5AI0A 3VSEA 1MTOA 4BKOA 3KOUA 1XZ8A 3AUSA 1BYIA 1AIPA 4FFMA 3KWJA 2O4CA 4LJ8A 2H1RA 3UMBA 3W8NA 4G8JA 4K28A 3JATB 4WNYA 2RKWA 5TS3A 1TDJA 1J2UA 2QI9F 3ZLVA 2I2DA 4XD7D 1EGVB 2BJHA 1LPMA 4D9IA 3UK6A 1XEWX 3ZWDA 3R4CA 4AKEA 1NBEA 4G0NA 4IRUB 1R4NA 2QL5A 4CR8A 1EFUA 1BJTA 2A88A 4TKMA 4N01A 3KSZO 1KKMA 4FZJA 4MWTA 5DBFA 5JBNA 1DEAA 3R0VA 3ZD6A 5B36A 3MQ4A 1H66A 2E7RA 5HF6A 3REGA 1L5MA 5GP1A 2BRUC 1ULHA 1UZUA 3G82C 4PYRA 1TFUA 4AO7A 4Z86A 5CDUA 1G0NA 3U3ZA 1W5SA 4KX5A 3UAWA 3EDRA 1QTNA 1XF9A 2R6GA 4FHFA 5K8LA 2DSGA 4IHQA 1N3YA 2X4LA 4FFRA 4IQFA 2EP7A 1E0KA 4LRTB 3VNAA 4P34A 4UTZA 4CT0A 4EECA 4RY2A 1DXQA 2TSYB 3BZBA 5EEGA 1PYGA 4ME6A 3RRNA 1U0HC 3U4DA 1YKSA 4NMMA 2ZIXA 4KXQA 1ONOA 3H1TA 2V98A 1JXAA 3T1YB 5CVDA 4DR6B 2BBSA 1TMKA 4KO4S 1Q44A 2HT6A 3BXFA 4JJ6A 2P4HX 4OYLA 4CF3A 2VEOA 1WB6A 2HF7A 4UPDA 1A72A 1UBSB 2WUEA 2J3LA 2PSJA 3ZU4A 3IR5A 3QKWA 4D0LB 4YQYA 5MFPA 4KPGA 5TV2A 1E5TA 4Q15A 4QDJA 3THWA 3ZDFA 2PKYX 2G71A 2NTYC 1VE1A 3IP8A 1YBVA 1QFXA 3VNVA 1XCGB 2Q3LA 3QX9A 3IDQA 1YH3A 2HIAA 4KSCA 3UN1A 2DH6A 5FI3A 4GX1A 5CVCA 4BRWA 4AN0A 5JSHA 4GX2A 4BMNA 4R1SA 4Q9NA 1OI4A 4N8DA 1NRJB 2P8SA 1XZBA 3AY6A 1OF1A 1J8YF 5IVPA 5FTMA 3VO1A 1F17A 5E9AA 3WGUA 4ECAA 4FGUA 1E5LA 3FLEA 3PEFA 2SBTA 3LDFA 1ZXLA 5K3CA 4DBZA 2AYZA 2ZAMA 3Q4GA 4GPD1 1KAOA 3EZGA 2ZRBA 1R0YA 4C2UA 4KE6A 1A77A 2ODWA 5AW5A 1W73A 1T4BA 2WV7A 4YHBA 1E7WA 1L5NA 3RM3A 3RS7A 4CMIA 1KU6A 4AX8A 2LTAA 3V4SA 2BP7B 2GK4A 4GM1A 4Q16A 1GAXA 2C4MA 3RT9A 5IWCA 1Y6FA 3IULA 2O3TA 4YWHA 4Q9LA 1CQZA 1JQJC 2JDIA 2X22A 3RTAA 3Q7IA 1PFGA 2Z1DA 2Z6AA 1VYHA 1Q1BA 2FK8A 3L0ZA 2HK6A 4FEAA 5TS2A 1Z12A 5LMNB 4XYMA 1BZYA 3MINB 1XVVA 1ZAKA 2Y1GA 2WUDA 3FTPA 1MBZA 2ZVJA 1ZUNB 5CM9C 2DUJA 5I4BA 5HTKA 3WK9A 2XVZA 4IUDS 4ODIA 3DNMA 5FWNA 4AC9A 1KJZA 4M1MA 2ECOA 2JIPA 2QRGA 2ZBRA 2QX7A 2Q29A 4AUKA 1GTL1 1EBUA 1I2ZA 3NANA 4II2A 4Q3EA 3TSAA 3QEKA 1GN8A 1ULZA 4I1OA 3C4VA 4PGGA 3E0QA 2LV8A 4F9TA 5K01A 2GPTA 1X87A 3GT7A 3MMZA 4BB5A 3ZLJA 1N7HA 4J1TA 4XUDA 4JVLA 2IZ6A 2PVSA 3CF4G 3DJFA 3OJEA 3OLXA 4QNMA 3SX4A 3PWSA 1ADGA 1H3NA 3M6WA 4BNWA 4DF3A 3LUHA 4PZDA 3OECA 3RYIB 3ILXA 4R68A 5BVGB 1ZGBA 1YACA 1N5LA 3OQIA 2BEVA 4E2XA 3MFYA 3H8JA 4BFUA 1I4OA 1D2AA 2VWHA 3UXEA 3BSSA 3ESQA 4RE6A 5HR5A 5HIMA 2J07A 4ZN6A 3BUSA 3ERCA 2GXUA 3QXHA 4P93A 3WLLA 2RIPA 2FX2A 4HNHA 1UP4A 1ECPA 1NUPA 3QU5A 4OCZA 4NXNB 3RBAA 3C0KA 3FOFC 1GUYA 1IATA 4UM7A 1PJCA 1IY2A 3HK2A 2QDKA 2V1XA 1EMDA 1G5QA 1V6CA 3LBIA 1CR1A 4KMSA 3U0BA 4ARSA 1PGQA 4DPKA 2I1WA 4H3KB 5PNTA 5JTUA 3A6HA 4CKCB 2B36A 1G5FA 1Z4IA 4L08A 4CLDA 2NXCA 3FR8A 1UBCA 3WYAA 4C1BA 4B8YA 2BE9A 4EI7A 4L85A 3UTDA 5JWOA 1T5TA 1N92A 1XMVA 2V7VA 1GVHA 2ODQA 4MPPA 5EMHA 4QOJA 1QFMA 2YZ2A 2AT1A 1S3GA 3K4PA 2GH1A 1IG0A 2PLNA 1STOA 2NUTB 3O4GA 5F23A 4XJXA 2B20A 3BVPA 1O5OA 5IXJA 3E48A 5B7PA 3PBKA 4ZVVA 1W9MA 3F3KA 4HVTA 4EPVA 3H1PA 3ZLBA 4HBZA 4HS4A 2A35A 2UZ0A 1ABBA 2JLZA 1LPSA 2GTPA 1JQKA 1ADBA 1JHYA 1N1MA 1KYWA 2G1UA 2Z9DA 3I6ZA 2JFQA 3FDJA 1JZTA 2ZM5A 3RTDA 1UWVA 2ZPUA 4LBYA 5K2OA 3RQIA 2FV8A 4RD2A 3NJ8A 1W5AA 3KG2A 1RM4A 4RD0A 5DJ5A 2A5DA 1MEJA 2NU6A 1XU4A 3BAZA 3MD0A 4GQIA 5JECA 4CETA 2GJ9A 1C0EA 4DV0B 4RSMA 3A05A 3QLUC 1QZZA 3AR2A 1Z4KA 1DC5A 2HV8A 1I7NA 2IPNA 4G1BA 3OZRA 4Z7NB 3H05A 1R27A 4EY7A 4DLZA 4YFYA 2ID8A 2WTUA 1UEXC 4TLEA 3H9CA 2AFHB 2WHYA 2IYNA 2I1LA 2BP7A 4UNPA 3IOCA 2IYSA 3AW8A 3SJCA 1MD9A 3QTLA 1ZD9A 2YIMA 3DUFB 2D4HA 3CZRA 5JAIA 2KMLA 3MCZA 1ZA1A 3FFTA 1XMSA 1YQQA 4KXNA 3WDKA 1MAWA 3UBMA 4N5NA 3PHIA 3SFTA 4D74A 2GTIA 4ZQCB 2QTAA 1WPGA 2CUZA 1IK6A 5JHGB 5JASA 2G04A 3VVCA 1KRWA 1E1RD 1WW2A 2XODA 4P7GA 4NCKA 4QHSA 2IOFA 3OZUA 1LDEA 4MYHA 2P6IA 3ZQUA 3SF8A 4FFWA 3WV4A 3HU2A 2VG8A 4LDQA 4FHGA 2YWRA 4HG2A 5EWJA 4C6TB 4EHLA 4F85A 9LDTA 3JQGB 4HNTA 2HSEA 4XFDA 4QYIB 1IM2A 1L4GA 3EUWA 3EYWA 3PE4A 4W63A 1EUDA 1F14A 1Q0SA 3O8DA 4DJFC 1E8NA 1I5EA 4FBGA 1JPVA 5J2TB 4B3TB 3AEKA 3N8DA 2ZREA 1E7MA 2DLDA 4KODA 4L5AA 4LJ5A 3R7DA 3MNFA 2VJMB 1ZVVA 1XMJA 1DU4A 3PJRA 3B7PA 1MIOA 2OB1A 1CRWG 1HQKA 2WJ6A 3CNNA 3L41A 4L8WB 4R1NA 4EZEA 1RRMA 1CUYA 4KNVA 5AKLA 2ZYWX 1U8TA 3KHSA 3KTAB 2F48A 2WAOA 3PWZA 5FA8A 3RABA 3W8FA 4EA7A 1OVMA 4NAVA 2YTZA 4JLVA 1NONA 4B7XA 3STXA 3WZLA 1UINA 2PU5A 3EF3A 1ZCAA 1EVEA 3LFUA 4CLOB 4HDSB 2MSEB 3UVEA 3TW8A 4EW2A 1YA6A 1XMIA 1L0BA 3LLCA 3K0HA 1PUIA 2IYLD 1KAHA 3BMCA 3URMA 3ZCVA 4BNHA 3K92A 1EJ2A 5HFNA 2C4VA 1OWPA 4HGOA 3QZUA 1ORDA 1CRLA 3O8BA 1EXDA 1TNDA 4GF5A 2AOVA 4RW0A 3WMRA 5EKTA 1DC7A 2ERCA 3FDFA 3NMUF 3FOBA 4HH0A 4CQLB 4D6PA 5E6UA 3AKCA 4X54A 3LQQA 1DX9A 4ON9A 1Y89A 2NYVA 4H9GA 4Z0NA 4DCVA 1ORIA 2P9ZA 1F8GA 5AOVA 1IUPA 2Y1DA 2BKAA 3IP7A 2YQ4A 3ZH2A 2P1RA 4LV8B 4FMBB 2C92A 2CFIA 1FTYA 1Q0PA 2J45A 5AFSA 3P20A 4DIDA 3UMSA 2D13A 3JARB 4YTEA 4TSFA 2WVAA 5FNVB 5ICGA 4OX9B 4KGDA 3ANYB 4JBHA 3HDGA 5T6MA 2RB4A 2L18A 3QVLA 5HILA 2BYTA 3MPUA 4O33A 1VMDA 1Z6TA 3H65A 3LPNA 4WLVA 4ZOAA 4X44A 4BNFA 4DJ5X 3G3EA 3V9PA 5INTA 4JI7B 4ILKA 5KNCH 1NTRA 3SI7A 4YT4A 4X41A 5DW0A 1JEQB 2OC9A 3UTCA 1IWOA 1ZOSA 4DB2A 4Q37A 1UJMA 5F33A 2K2WA 1JDZA 2LCIA 2IHJA 2P77A 3KYCB 1IH8A 2HXYA 4ENWA 5JLJA 2REQB 4U2GA 3WQSB 4URXR 4YQEA 1XWWA 4MWBA 2X5XA 1U1CA 1U90A 2WG1A 3FYUB 3ZCXA 1TGYA 2FZKA 3VU9A 1T1EA 2PH7A 5AM3A 1D4FA 5ITSA 2B78A 2XNJA 4QU5A 3WGTA 4JUIA 7MHTA 4LAFA 2OXEA 2Z5VA 2AMJA 1BYUA 4FOLA 1MEOA 4MVJF 3OTQA 3E53A 4PIPA 4HFMA 1PEAA 4DV4B 1HFEL 3PPWA 5T8KC 4DREA 1PWEA 1QQTA 1AHNA 5I7EA 5IJAA 1SXJC 3RVPA 1VLQA 4G5OA 5DWQA 4JN6B 5P21A 1BXRA 1W44A 4DC1A 2AR0A 2W6IA 2XMSA 3VKFA 4Y1EA 1TAUA 1T8UA 1R5OA 2JKZA 4BWVA 4BFLA 1P39A 4EG6A 1XAJA 2C3YA 1WTCA 4H1TA 4GYJA 1WMDA 1VE3A 3SC2A 1GZHB 1Y7HA 1NASA 1XRSB 4V1CI 2HRCA 1LVUA 2ZJ1A 2CMHA 4O4HA 1NI5A 4MXDA 4RJJA 3V46A 2Z6RA 2R44A 2BFPA 2J67A 4XXHA 5DISB 3DBHB 3FUWA 2Q5FA 4M60A 4OK5A 3T7CA 3TMYA 1UBLS 3C97A 2FMHA 1I13A 1ZD8A 1WOMA 4QD3A 2Z43A 2J9FA 2XITA 4ZAVA 2ZI7A 4QELA 1BFDA 4DBLE 1I94B 4YIKA 3OHMA 3PC2A 3G2JA 1NUHA 4JD5A 4UHCA 5IKMA 4NOKA 4TMWA 1D09A 4DWJA 3D0KA 3ZGYA 1CS0A 3X1XA 4WHMA 2IPLA 4A8JA 1NV9A 4R8LA 1N25A 5JXHA 1CJBA 2OO3A 1KI7A 3GN1A 4L0QA 1DAHA 5HVNA 2F8TA 5JJIA 4M9RA 3IEXA 4D4MA 2YV5A 4ZCMA 3Q7EA 2FDRA 3CWZA 3PXGA 4REQA 4HDCA 5F78A 1G8GA 3T8YA 3W6UA 4XYEA 2YYSA 2VUHB 5A5GA 1C81A 1UOEA 3HEAA 4IOJA 3H5VA 2Q1UA 5AW4A 1GPAA 3R6LA 1CLUA 4LYEA 4NCIA 3FAKA 3K2EA 1FRZA 1RRFA 4RV5A 3STWA 1V25A 1FLDA 2AFIB 2MSLA 4H7IA 1IHXA 1JR4A 1MO5A 5A05A 2HUQA 2Z2IA 2WJ4A 3MWJA 3RSFA 1U98A 3HDJA 4EGFA 1FLVA 1GPDG 2ZUDA 3GFTA 3QELA 3T9EA 2XNDA 5EPOA 4JC4A 1XA0A 3Q3VA 3V7NA 2GXAA 4LF7B 3VJRA 2Q7OE 2G08A 2JHPA 4X6XA 2RIRA 1W4ZA 3U40A 4XGKA 2YUIA 1VKRA 4H7FA 4F71A 4QBIA 2CNLA 1BJRE 1FB5A 1W48A 1O95C 4XWKA 5JFOA 2DWPA 2O0LA 2VDMB 1YS9A 3ORQA 1JLHA 2I6TA 4ZEMA 1QO9A 5E6RB 2B7BA 2G80A 2O1XA 4JIMA 1W8DA 1RRKA 3WOVA 1XQ6A 1EZ4A 1Z15A 4YRLA 1SEPA 2LIVA 2YYYA 4MYTA 2HF2A 3NBMA 3LG2A 4UUOA 4Z9BA 3OD5A 3VISA 4C0XA 3UJCA 1GRRA 1MU0A 5JCJD 2WKPA 3K0AB 2E21A 1QMPA 3BFXA 4OHUA 1Z0ZA 5BR8B 3ZDCA 1YAHA 4JYMA 4R6WA 3U39A 2XADA 4QBFA 4WIAA 1IY8A 1ZUWA 2PEYA 2XRMA 5FTJA 2HAEA 1NIJA 2ZSIA 3BTSA 3RVBA 2OB2A 1QAMA 4E5KA 2B30A 2BH9A 3ISTA 2AW3A 2MIIA 4X1IA 2APJA 2JCGA 4HXGA 5AK0A 1DEXA 3GEPA 1TD9A 5IZ4A 4UE2A 1KH2A 5GOZA 4GI2A 4F2HA 3T5PA 5BN4A 2E48A 3NFYA 4OHPA 3GYBA 2I65A 2ZUVA 2A3NA 2ZKLA 4LI3X 3JWPA 5M34A 3X1MA 1JLMA 2XQIA 2LRHA 5K3FB 3ZJUA 4TROA 4DG8A 4OK3A 3UUFA 2J3QA 2YZNA 3M1IA 1UUFA 2JLQA 4KIFA 3L18A 4M7PA 3UOAB 5FHQA 1HORA 5MHTA 2F59A 2HH9A 4UEOA 2GEDA 3TBHA 3VNSA 2OC4A 1CY1A 2Z1MA 3VVLA 3RFUA 3EN0A 1JQAA 3DBHA 4XA8A 3B36A 2CNDA 2GN6A 5HW4A 2IYAA 4UUQA 4ZO4A 1CHNA 1OXUA 1QYRA 3KKOA 3KHKA 4DW8A 3GLIE 4U2KA 3QI7A 4P4SA 1JV2B 2GNAA 5CG1A 3EQ9A 5CCXA 4IZ6A 5BQFA 1KYTA 3QKIA 1XD2B 1XCLA 4M55A 3D31A 4EY3A 3W7VA 3MMSA 5ED4A 4M1WA 5TEWA 1G8MA 4JFAA 3IQEA 4OSOA 4UREA 2JJ1D 3TB6A 5KIAA 2ZRLA 4J16C 4EY8A 1FDVA 4HRVA 4NV1A 1XYYA 1VGQA 1LSJA 2X8JB 3HWWA 4TMFA 1UFQA 4ZVTA 1OSNA 4MIKA 4S12A 2XQVA 2CW5A 1P4RA 2MYPA 1SD5A 1IIBA 3T3EA 4G0VA 4IMPA 2DZDA 1XTSA 2I7XA 3E22A 4GZMA 5BSGA 2P3SA 4G8BA 3ZKWA 4DMMA 2Q27A 4LY9A 3CKYA 1UJ5A 2YJ6A 3NIDB 1K06A 1L4YA 3IVMA 4NVRA 4R98A 4OJQA 4FLEA 4HLUA 3QHPA 3AI1A 3Q0TA 1RE0A 1PF7E 1V8OA 4A73A 2XGSA 4RA9A 2Z4RA 2D5LA 2H07A 1G5PA 5HF9A 2QMOA 5E7QA 4JJ4A 3N75A 5EA2A 4H15A 5IKPA 3SVLA 3EK2A 4V3CA 2YKGA 1B0ZA 3UMGA 1E3DA 1VLMA 1AQ6A 2PIDA 4FIZA 1AV7A 2SHKA 4WI1A 5I8ZA 1Q19A 3SHTA 3H5RA 3A3KA 4MW9A 2Y92A 3I0NA 2BGGA 1KOJA 1G5HA 4CTOA 1UDCA 3R5HA 2JI6A 4JJZA 3I04M 2DQYA 3HKDA 3BE8A 3HJTA 3ND1A 5ES3A 3K71B 4U9UA 1IY1A 2N46A 4FBLA 1J8MF 1M76A 4I4NA 4REMA 3DE4X 1GA4A 3EXEA 2JLSA 3GRCA 2IZ7A 3NTRA 3ADKA 1EA7A 4QUIA 3OKPA 5EQJB 4AG5A 1JFFB 4X94A 3QE9Y 4CG2A 2W6ID 1JU3A 4BVAA 1XTTA 4E4TA 1VXOA 5HIJA 5M7EA 2WT9A 3W77A 3KOMA 2FXIA 3BJRA 2H08A 1NSYA 2OQ2A 4HNRA 3NUZA 2W2QA 3IIKA 1M6NA 1O6FA 2EBHX 3C45A 4OAQA 2Q2NA 1JHZA 1RBMA 4LOIA 2G7ZA 4R40A 3FE2A 4Q1BA 4V0QA 1NI4B 3TGLA 1WXGA 4NQZA 4B40A 2Y1LA 3HLTA 3AIIA 4FSXA 4J0CA 4MPTA 5AD1A 1NLFA 2NPOA 4FCWA 3TIGA 1MAAA 4AXXA 1RWPA 2FI1A 2VJKA 4N9WA 5CCBA 1SQGA 4YJDA 2JDID 2UYQA 2WE7A 3R3YA 4N5MA 1Y3DE 3FFWA 1ZU4A 2ATVA 3A1NA 4WZAB 2FPMA 3ZV6A 4BFSA 2ALJA 1U1GA 4Y1RB 2DCUA 3O93A 3QUSA 4L73A 5K1ZA 3UB4A 2ZBUA 1P2VA 1Y1PA 4D3SA 2HREA 2FRDC 1Q0UA 2OFPA 2P3OA 3DO5A 3FYDA 3BIFA 2BVNA 3L1HA 3O4HA 3O2JA 4QNNA 1DFGA 1Z4NA 2ICAA 4FHDA 4B73A 1KK3A 1C30A 4F5EA 1R9GA 4RY8A 4WXMA 3FN4A 5FL7D 3AFNA 2A14A 3CCBA 1OA1A 2OV3A 3IQDB 1Z8NA 4PSKA 1CUAA 3L0YA 5ULLA 5BRAA 2E8RA 1FNMA 4FWTA 3OF2A 2YHBA 4B9AA 3DB2A 4HTFA 4AJKA 2QZ4A 3OFKA 4JYAB 3H75A 3KE8A 4II3A 4DANA 1AZSC 3ZGLA 2OT3B 3F6EX 4A4DA 4HATA 1LX6A 1IUOA 4ZIRB 4EPTA 4Q18A 3Q8LA 3TCNA 5B3LA 1E2DA 2IF2A 3FUCA 2M1XA 1U8AA 2HUNA 2C9OA 2FP4A 2VJYA 2P6MA 1S8FA 4J4HA 3EQZA 5DV9A 1IJFA 2IDZA 1DHRA 4J90A 3MCVA 1K3FA 3LTNC 1ONSA 1VMEA 3PR1A 3MWDA 1N9KA 3GG9A 1BH6A 3HYNA 5DSZA 2A5JA 4COOA 4EENA 2WSYB 3N6RA 3N2EA 1E3IA 3IAS1 4ZYVA 1ORVA 5AI6A 3VUEA 2AGVA 1CXZA 1ATZA 2OBMA 1OBVA 4W6QA 1L5VA 3FYCA 3WHPA 3EB9A 2DFNA 5G0SA 3UMJA 4LKRA 2H1CA 2R60A 4YO7A 3ZD9A 3TTXA 4XM1A 3S27A 4G3XA 4LOLA 5HGJA 4CDMA 3WIUA 4KMRA 3ZDYB 2OUIA 1A76A 4F91B 3QF7A 1YZQA 2E16A 5BWNA 3TQTA 4JYCA 3DB1A 1AS2A 1T6BY 3WRVA 3WLIA 3BE5A 5DW3A 2QRZA 1G6OA 2YQZA 4JP5A 2ZCVA 3W9BA 1JAHA 2JATA 1E6LA 1HZJA 1OZHA 4BNGA 4F3KA 4FYYA 4C0WA 4UHDA 5D84A 3KKEA 2PCJA 4OK6A 4P81A 5EZQA 1YVEI 5B58T 1U2DC 3WGZA 3EG9A 2WJGA 2ZRNA 1X0XA 4G8CA 3GR6A 5AUOB 4MMXB 1ZHFA 4MMYB 4RELA 4L4YA 3GY0A 4HQ0A 3AHIA 4HX5A 4PLVA 5J2TF 3RNOA 2WWFA 4TWZA 3ROEA 2WDZA 1NLZA 4EO7A 3HKCB 3KETA 1KZYC 3HFSA 4PPYA 5IFLA 3W3AD 2XZLA 2GD0A 1LS1A 2GCNA 1GLNA 1W47A 1RQ2A 4YVFA 4ZZ3A 3R41A 2C8JA 3PHBE 5JZBA 2WE8A 5FPTA 3TD6A 3BAFA 4ERNA 3PT5A 1VKNA 2TECE 3BFKA 4YT2A 1HNZB 1WNFA 1FX0A 4J1TC 3AEKB 4YAFA 1H23A 5EFOA 4BVKA 4DJDC 1F8YA 1PNRA 4W5NA 3AL2A 4GG1A 2IYTA 2VT2A 3NAQA 3KFVA 1L8QA 3A1VA 4O0LA 3HDTA 1E1RA 5DCUA 4C4ZA 3TAHA 3A6FA 5K51A 3HP4A 3U7JA 3E9NA 1R00A 4D82A 2FMFA 3D3WB 3M3PA 4UBMA 4XCQA 1YIAA 3WGJA 4HBGA 1DAEA 3PNQA 1U2PA 2R8PA 4JVNA 2AN3A 3NZEA 1R0RE 1AZWA 2PH3A 4KN6A 4NYJR 2FLVA 1KMHB 4OA5A 5FUYA 3QBEA 2EMUA 5DCLA 4WLOA 3DONA 1M6HA 4D6XA 2GCOB 4F97A 4X7BA 3LE8A 1KDRA 3GLKA 4DR5B 1TIKA 3ZDAA 4YBRA 4BGDA 4N5HX 4WV3A 2IXBA 2QVBA 5T4FA 1HRKA 1N2IA 2ZIEA 3RUIA 1UBJS 1J2YA 4KAAA 1AQJA 5FORA 4BO8A 1YXMA 3WXMA 4R3WA 1T6ZA 5IULC 4CQMD 1FA9A 4UUBA 1RHUA 2VQ6A 2QP3A 3OM9A 1UCFA 2G83A 1IYZA 2GBGA 2HWUA 1F7UA 4EFNA 2WA1A 3TLGA 4A92A 2WABA 4DRXB 1P81A 3P96A 2PE5A 2XMDA 4QUDA 2FHSA 1XK7A 3LOPA 1BG6A 3JARA 4EG1A 3MWDB 4CEHA 1H9CA 3VYWA 1KEPA 2FEKA 3L7IA 4A6EA 1N3BA 2PGOA 2Q62A 2W0MA 3MBOA 3QIVA 5TR9A 3WA6A 1K86A 5LP6C 4KHZA 1XDUA 4B4VA 3K4HA 3A4VA 3Q5EA 5JEDA 1Z0IA 1E1MA 2VA9A 1CUZA 4FSHA 4TVSA 4ZMBA 4K9RA 5H3HA 2ADOA 2HD4A 1ESCA 2E5FA 3E3OA 4AO8A 3I4TA 3A37A 5EXXA 1HEIA 3HCDA 2XMRA 3O1IC 4MAFA 4DNOA 3WL5A 4AJHA 2ZBVA 3E9CA 5L7WA 2Z5FA 2NW6A 4JITA 5MDHA 1RM5A 4RWEA 3ADDA 3QJGA 4MX8A 5K3DA 2ZJ0A 4S2EA 5ECGC 4YXWD 2WJJA 1ZD1A 3FYUA 1IDN1 1P2SA 1PUXA 4XLLA 4MVJM 1AJEA 3KZKA 1LLFA 2NZ8A 1ST3A 3P0IA 3LUKA 3FSJX 4H35A 1L8XA 1T3SA 2NZVG 4F3CA 1UFRA 1ZOLA 2Q4EA 3IAS6 1P77A 3LCRA 1C1HA 1QFZA 1F8UA 3T5GA 5DMHA 2WFAA 1T8TA 1P8JA 3QKUA 1OBOA 3CPJB 4FFVA 1QWSA 2G5PA 4UBJA 3ICOA 1WUHS 3OEHD 4N7MA 2ONJA 4RVSA 4YAWA 1M34E 4O4IA 4QGHA 3PQ5A 3UZUA 2HCFA 5KHLB 5FFFA 3V80A 5DNCA 2X1LA 3U7GA 2GNOA 1GPMA 4QPPA 1Q7RA 5JLAA 2PJDA 4YY3B 2ZS7A 3OPQA 1QHEA 4GAEA 4YB8A 5DDIP 3RRZA 3NKFA 1KNXA 1M1XB 2ZB2A 1NLYA 4B6PA 1I1OA 2POCA 3AETB 4RCYA 1BA2A 4O1HA 1I1HA 3G0BA 2VPTA 3ZI0A 2HQ1A 2IV7A 3SC2B 3WYBA 4YMGA 1WZ2A 4JCOA 1A9YA 4F06A 1PK9A 2OWUA 4Q9JA 3RUPA 4V1CA 4Z4FA 1ONBA 1UBHS 1E8DA 2CVOA 2O2JA 1Z75A 3EOZA 3VC3A 1KOLA 5BVGA 1VBFA 1MOQA 4UE6A 1J7KA 5H8WA 3U62A 3T7SA 3V2GA 2EHLA 4U00A 2CL7X 3DMRA 3RB8A 3ADBA 1MC1A 2CT8A 3T4PA 5CFQA 3K9BA 2XCUA 5CJ2A 5BT8A 1E5QA 1Y34E 2H48A 3KRTA 5JD5A 4IHJF 4M8SA 2G67A 3A1FA 3H3FA 4AY2A 1Z4OA 2C3MA 2JAWA 3VX3A 3QVOA 4CKEB 1AK9A 4G01B 2OMEA 2PM8A 2WVGA 3ZHRA 2D2FA 4CWAA 1F2VA 2GZMA 1NMQA 4GI1A 2ECFA 2O8NA 4NFYA 2K7ZA 4BKMA 1O96B 4CPDA 3AY0A 5GONA 1UWLA 4H4EA 5F7JA 2BH2A 2J09A 4UVDA 1UZNA 3KAJA 5AI4A 3SX0A 3T3IA 4ZKDA 4KMMA 5DYNA 1KTIA 1TM4E 2AXPA 4RS3A 3WAGA 3DKRA 5ED0A 3ONNA 2P11A 5ILQA 4Z2AA 1TYDE 2Y2VA 3P32A 1OI7A 4BU0A 1JDTA 1EUZA 1DARA 1PQYA 3GFRA 2HMAA 2FW1A 2N42A 2QZZA 5C18A 1L5HA 5JZSA 3FI9A 1K8YB 4I5DA 5E4FA 2ONZA 1MB3A 1N2ZA 3A6GA 3EVBA 2YR0A 4QXAA 4WW0A 1X1TA 3SSAA 2GAJA 4Q7MB 1US8B 4F8JA 3E9QA 4YS6A 3LBYA 2F1JA 4RZHA 1JSLA 4MQMA 4DCUA 3RC8A 2YNMA 1PJ3A 3UA3A 3PPXA 1V5WA 3LBNA 1N2OA 1QDUA 3WBFA 3FIJA 1A5TA 4BB6A 5DSTA 3ZNOA 2GFQA 2FG7C 3PTLA 1P4GA 2NM0A 3MT9A 3TH5A 2Q1YA 3BQNB 4OQEA 2XBUA 2HHAA 3OIVA 2NPFA 3KTFA 2KE5A 1NM5C 1QHNA 1AURA 1WUTA 2PV0A 2ESRA 4L9RA 3G5MA 4RJIA 2AFHA 4B87A 1GAJA 1RC1A 3M70A 5EERA 3ELDA 5EJMA 1V39A 3WL4A 3ET4A 1EJ6A 1I3NA 4FDVA 4D79A 4F4JA 2GBPA 5AIAA 2GAAA 2H4WA 2DBVO 1G8YA 1LC3A 2O2YA 2PZMA 4FKMA 4OFWA 3TTVA 3JWEA 1H94A 3T54A 4Q3OA 3RHSA 1UWCA 2E8QA 3NOOA 4BMVA 3DLTA 3AG5A 4PM4A 3LQFA 1OH6A 5KWSA 4F5ZA 2Z0MA 2AA3A 3H2BA 3L0DA 2ZE8A 4Y9RA 3UM9A 5K8JB 1D1PA 2E0KA 4YC7A 2G9UA 2RK3A 2V96A 3JVVA 4N5LA 3IPAA 3KC2A 2QVLA 4CGYA 3I37X 4AS1A 2B4YA 1IHYA 1X1EA 2BL4A 1K6JA 3O95A 1ESDA 3Q9LA 3A31A 1K8RA 3OM0A 4UNQA 5FPPA 4QQNA 2ZSKA 3RSQA 6PFKA 4JBNA 2XTJA 4NICA 4EPYA 3UQYS 4YAIA 3OOEA 1ZEJA 4JVOA 4ETWA 1FIUA 3GA7A 4TTAA 1PWHA 2A92A 1Y8ZA 1FYWA 3L8DA 3GVHA 4TV9F 1WEHA 3GD5A 4WKOA 4IDAA 4E21A 2FWIA 3E35A 1FP4B 1XP8A 2CEKA 4RCZA 3BXEA 4ZI2A 2FUG1 2VFAA 1BS2A 3FZYA 4WLFA 4IFBA 3T5BA 2H51A 2OOSA 1D2GA 2VSYA 4ZQBA 3K6SA 2WD8A 4PNEA 5FWXB 2AUNA 3OKFA 4FN4A 1GARA 4MWCA 4NPHA 1KFBB 3U4IA 1E3EA 1Z2AA 3EGWA 1PTJC 1KPIA 5IDVA 4EJFA 1XTZA 4L4RA 4YCLA 2E4VA 3TXXA 4RJKA 1D0IA 1BQ4A 1DG1G 1Q1NA 3K0KA 4HGQA 2Y6VA 4W5JA 3QVTA 3U3MA 2HX1A 2Y76A 3QUBA 2FFRA 2H0AA 4RHUA 5BN3B 4A8JC 4CKEA 4D6YA 2XGJA 1DX4A 1O6ZA 4LBWA 2H57A 4UHKA 1Q3HA 5EG5A 2R3SA 5E0KB 1KI6A 4G56A 5H81A 2P5SA 2QSZA 3GB9A 3TBFA 4QL3A 2VHZA 5HPYB 4Q1EA 5LQRA 1QH9A 2XEDA 4ZJYA 1S01A 2C83A 2A9OA 4YLYA 1YF3A 1R5BA 4EGAA 1COWD 5KSWB 4OHVA 1ZESA 2XUPA 5ITZB 3W06A 4CRWB 4R2IA 3C5WP 1WUIS 2WINI 1BHSA 4MJLA 4RA9B 2CCJA 2JEZA 3HSKA 1XZLA 3NBAA 1G7RA 3DFFA 1PDVA 3V8PA 2CJYA 2NU9B 4GIBA 3IKJA 1GOTA 1YZNA 4JU8A 3HV2A 2IX3A 4S1NA 4EG4A 4AY5A 4L0DA 1ZNWA 4LJ9A 3DHNA 3PKIA 2JGNA 5CB4F 3EVZA 4C03A 3HZHA 2Z08A 1ZQ1A 5H02A 2LPMA 1ZSNA 5KKNB 2Q49A 2I62A 3OM8A 2AFVA 1EG2A 3BSWA 1KQGA 4J0FA 1GQSA 2H5IA 3JQ8B 1RRVA 1W0JD 4G0MA 4WE3A 1MA0A 1NVUQ 3O26A 1GRVA 4BCDA 3ZJVA 3VNUA 3EA0A 1PQUA 1H2WA 3V33A 4AQYB 2HJVA 5HQ3A 4DLNA 2VP3A 2C2KA 4OAPA 2K6GA 3R0IA 2CE7A 3ZGOA 2FWMX 5AW1A 5JO9A 1AXRA 1GL9B 2I7DA 3PDHA 1ML3A 3BHNA 3ABZA 3G89A 3RVKA 3U3JA 3IJRA 1YD7A 3FMIA 1ZH6A 2YBQA 3FNBA 3WKBA 2FW7A 4YYZA 2H29A 4K1LA 4HV4A 1YR2A 1FJHA 2X9LA 4KE9A 4UM8B 4OXKA 2R6AA 3AWIA 3OKAA 1VSQA 3USZA 3T5DA 3V7WA 5ERYA 4PNPA 5CDTA 1II0A 4UEKA 5KSOA 5BXQC 1I3OA 2H1FA 3PXAA 3D0OA 2AD5A 3Q7QA 5JDCA 2FW6A 1AGRA 2GT1A 3E3NA 3TLBA 1J2JA 3KVOA 1ODFA 4NK4A 4XUEA 2XUHA 1P4AA 3ONDA 3X44A 2QBYB 3H5AA 1Y37A 1HT0A 2NGRA 3G9QA 4C6RA 1HE8B 4X3CA 1JLRA 4TM8A 3M6LA 1W1WA 3ACBA 1V2GA 1WD5A 3EEFA 2BZSA 2WRZA 421PA 4BBJA 3P5BA 1EESA 2OVBA 2Q0QA 2QE7D 5JARA 3V4PB 4IIGA 4WGGA 1RLMA 4C20A 5DM70 2VSOA 4D92A 2Z6QA 1HO3A 4BP9A 1QIIA 4IJ5A 1SRRA 2AKYA 1BU5A 1T0BA 3FF1A 3HHPA 1NQOA 3VYVA 3PSAA 4BNTA 5LU9A 3P2KA 4QU0A 3FCYA 1D7AA 1UPCA 2QRPA 4I55F 3OT4A 2ORVA 4LGCA 1HKHA 1T1GA 3CNOA 4Q4JB 4RKEA 1XZMA 1ND6A 4ZV9A 1J8DA 2B8TA 5A06A 4UCQA 1KI9A 5E3IA 4UVHA 4CKBA 3OVMA 4TUYA 4E15A 1L7VC 2PZLA 3F47A 4MV9A 2GJKA 4OXRA 3N8GA 4RK5A 4RHYA 4XYLA 2RMKA 5B7GA 4BEBA 3ORFA 1XQVA 1SC3A 4UFOA 3D7MA 2ZRFA 3PD7A 3QK7A 1RFLA 4DLLA 2O8FB 2OCGA 4DC0A 2ISQA 2ZS9A 4ZYXA 1Z06A 2QY9A 1SBIA 2FSPA 3DVSX 4NARA 4FR5A 1GLGA 1ZK1A 4BNUA 1JKJB 2VS1A 3ADPA 1XTVA 4MV8A 5DYYA 2VWQA 1U3WA 3DBLA 5FUXA 4KV7A 1XALA 1Z5GA 1GJRA 1SHLA 2ZJAA 1Z37A 5I3ZA 2C99A 3P52A 5IJ9B 1QCZA 1JDSA 4FJ2A 1UT5A 4A2QA 4KQCA 3NAGA 4CQNA 3AR5A 5ES4B 2HFJA 3TE6A 3V2UA 3INGA 3QPCA 3P4UA 3TVYA 5FNVA 4IDNA 4EATA 3FF4A 4CKYA 4QAQA 4RZIA 5A3QA 3A6PC 1O95D 1CZNA 4NZMA 1YZYA 3EH1A 1NQ5A 1JLKA 2HNAA 4GZ5A 5G4LA 4MWEA 1CJMA 3IX7A 3VM6A 4H4DA 1KY5A 3GEBA 4X1IB 3S1LA 2KPOA 5C5DA 1QYVA 3WSVA 3UC9A 3VZRA 1ISIA 1CZHA 1AE1A 2FCAA 1ODJA 2W2LD 4WAUA 1YL6A 2HDWA 4MS3B 1RPAA 4NHOA 1CQXA 1H4VB 2CVZA 2QT9A 4M0MA 4HDRA 2BLNA 1NTOA 2E17A 2P1ZA 2ZYIA 2DLNA 5KYYA 3DAFA 4RULA 1RYDA 1W87A 2VDUE 4Q3CA 1LNQA 4EYEA 2VHWA 4YREA 2PD3A 2GVZC 1JDBC 2R7LA 3EVTA 4CFSA 1TC2A 2B1QA 1G8KA 1ZHOA 2FSVA 4HVLA 2QW8A 1JKFA 2CDNA 4RXTA 3SX2A 1E1CA 2WUGA 2O8VA 3G8DA 3W1VA 3RF6A 5IVDA 1XL1A 1LNZA 4YJHA 4FKBA 4BHTA 1RMTA 3DWEX 4YRJA 2NU8B 2IHVA 3DFZA 3H2IA 4M0LA 3C39A 3DF9A 4RD3A 3UIEA 4WUTA 2G1JA 1D8TA 1ODSA 2YY7A 1IOWA 5JU6A 5EMMA 4F8YA 3L0CA 5JAOA 5DM0A 1SBNE 3L0BA 5DTMA 1CBUA 1F2UA 2W8ZA 2I22A 3KSRA 5J23A 4ITVA 1DRUA 2XIJA 2ZSHA 3CZ9A 2KB0A 2YWGA 3ECAA 3GLHE 3NALA 4LOJA 4BB0A 3U3OA 1M0SA 4MWSA 1X7DA 4IWXA 1W49A 1RLJA 2ZB7A 1G17A 2QN2A 3IBSA 3NWOA 3R6WA 5IUKC 4PQEA 1WUKS 3MG9A 1JLLB 4JB2A 3WGVA 1TVCA 1L4BA 4HLQB 1AKTA 1S8OA 2J8ZA 1WABA 4U6SA 2I71A 4ZZIA 5BSTA 2C88A 1HX7A 1A8IA 3NIBA 1M8JA 3DL4A 4E32A 1OKKD 3MA0A 1P0IA 1VCOA 1YDWA 1I5RA 4JI1B 3V00A 2EARA 5K4HA 1M8PA 2QTVA 3Q2IA 4MV7A 2IEGA 3G23A 5A3RA 3OP4A 1UJ2A 2QGNA 2DULA 3ITKA 2B5WA 1T26A 2OV1A 3IBFA 1ULTA 3BQMB 2OGTA 2FRXA 4YUVA 3L1JA 4H3VA 1KO1A 1VPWA 2QVGA 2O20A 1TD1A 2PRYA 4XGNA 3A4IA 3TFWA 2P67A 2QSYA 3IUNA 4NI5A 3VR5H 3BWDD 1ZMOA 4XJTA 2NUAB 4ZGGA 3LQKA 3NEIA 2R4TA 1OIXA 3ER6A 1JP7A