3DNFA

Structure of (e)-4-hydroxy-3-methyl-but-2-enyl diphosphate reductase, the terminal enzyme of the non-mevalonate pathway
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
MVDIIIAEHAGFCFGVKRAVKLAEESLKESQGKVYTLGPIIHNPQEVNRLKNLGVFPSQGEEFKEGDTVIIRSHGIPPEKEEALRKKGLKVIDATCPYVKAVHEAVCQLTREGYFVVLVGEKNHPEVIGTLGYLRACNGKGIVVETLEDIGEALKHERVGIVAQTTQNEEFFKEVVGEIALWVKEVKVINTICNATSLRQESVKKLAPEVDVMIIIGGKNSGNTRRLYYISKELNPNTYHIETAEELQPEWFRGVKRVGISAGASTPDWIIEQVKSRIQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of (E)-4-Hydroxy-3-methyl-but-2-enyl Diphosphate Reductase, the Terminal Enzyme of the Non-Mevalonate Pathway.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-enyl diphosphate reductase
total genus 102
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 1.17.7.4: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase.
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02401 LYTB LytB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11270 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dnfA02
3.40.1010.20 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; domain 1 3dnfA01
3.40.1010.20 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; domain 1 3dnfA03
4H4EA 3UTDA 4H4CA 3SZUA 3UV6A 3T0FA 3T0GA 4MV0A 3KE8A 3SZOA 4MUXA 3UV3A 3KE9A 3DNFA 3SZLA 4H4DA 3UTCA 3ZGNA 3F7TA 4MV5A 3UWMA 4EB3A 3URKA 3UV7A 3KEFA 4N7BA 3ZGLA 4MUYA 3KEMA 3KELA
chains in the Genus database with same CATH superfamily
1VLJA 3LY5A 3Q1LA 1GV0A 3PK0A 2EW8A 3Q40A 1T3TA 1PJCA 4UREA 2VNIA 4B4KA 4JUFA 3EMDA 1VIDA 3JTEA 3OG9A 4G89A 4YC7A 3U81A 3Q41A 4MVXA 3H4MA 4JIGA 5DW0A 2IP4A 5KOHB 1P1IA 3WLAA 4C04A 3I5AA 2FZGA 4WTOA 2F1JA 3QE0A 3QYAA 2JDID 3LNCA 4H31A 4P81A 1P0MA 2BFOA 4MVJG 1G3QA 1HRDA 3ABQB 4MSUA 5EVJA 1V8BA 1XQVA 4YACA 3D3WA 3O8OB 4ONEA 4PF1A 3R7SA 1RPZA 5KSWB 2WDZA 1NBME 4Y67A 1JDVA 3WSTA 2Y0BA 3MIIA 4XWWA 3J81A 2JL1A 2A0UA 3U3JA 2QLJA 1U0RA 5ALRA 4F5EA 1N6RA 1N57A 1RXIA 2ZJOA 2AV6A 3LZDA 5J5AA 4HI0E 4PHCA 1E2EA 5C1BA 3A9UA 3FHLA 1IVNA 3AF1A 4R1SA 3H13A 3WRYC 5BSUA 4F4DA 4G5FA 2QK4A 4Z5XA 2N47A 4LGCA 2C7QA 3TO5A 4W5RA 2PDAA 3WNQA 1K3TA 2PZBA 4KI7A 4FILA 5ETJA 4Y2XA 3I73A 1XSEA 3O2NA 1I13A 3E3OA 2OT3B 2X5OA 3G0BA 3WGYA 4E6PA 5EEHA 4HUJA 1DEAA 1MENA 1DLIA 3R7WA 5B58T 3TSWA 1WA5A 4EPXA 1IN7A 5L9AA 3GGGA 1F1JA 1R8SA 3ETCA 1FMJA 3OC6A 4GBGA 4MB0A 4LBWA 3W90A 1CYEA 4MPJA 3PVZA 3U44A 1C41A 4UEWA 1P2SA 1G8YA 3TLXA 1TOAA 4H3KB 3SC4A 1XRPA 1Z8DA 4BLWA 3H17A 4N4AA 1NUAA 2C97A 2R8EA 3FYTA 3HYCA 3EPLA 4Q00A 1EX6A 1PR4A 1XPJA 4IEIA 2FCAA 5LLSA 2A5YB 3R6DA 1MH9A 2P6UA 1DWOA 2JKZA 4UQOA 1DKLA 1J2JA 1I6MA 2W6IA 2WZQA 1UBCA 5G1OA 3F5MA 4X44A 5FEUA 3AONB 3QW2A 4WLOA 4U2GA 5JZSA 2GZRA 2AVDA 3FYCA 3P52A 1G4HA 5CIWA 3KWPA 3GK3A 3NUTA 3ZV5A 1GNQA 3HWWA 1FFXB 2ABWA 1RLOA 1RWOA 3NDBB 3I2KA 1W5SA 2H17A 2F1KA 1JKIA 3NHWA 1XZHA 4IILA 3ZWMA 4EQZA 2VJPA 3ZE2B 5L3SB 4BNFA 1ZIXA 4MW0A 2IYPA 2C7OA 2QM3A 4B4VA 1SCUB 1UBFA 4J0EA 4AUKA 1E2BA 1VJGA 1TGYA 4RS3A 5JNLA 1QDUA 2GBFA 2A9PA 3EYAA 1XJCA 5IM4A 3O8LA 1EBUA 1IYZA 2R96A 3ZWCA 4BIMA 4ZYVA 2EXXA 4G5XA 4ZGBA 4DDMA 1UIMA 1D2AA 4QUAA 5HUQA 1BCRA 3KOOA 1CQPA 4CQJA 1INLA 3LUJA 4WFJA 2OV3A 1MW9X 1RKXA 3PRKE 4C0AC 4HDRB 3CF0A 4ZREA 3ZXUB 3FI9A 3E81A 2OB2A 2I1VB 1U9JA 3DPIA 4C6TB 1HE4A 2AEJA 4EY4A 5I6DA 5IVIA 4RNCA 4DWVA 4UM8B 2H1HA 3JR3A 1E0DA 4BVKA 3LYUA 1Y63A 2YASA 1FP1D 3B2EA 4FXPA 4BNJA 5LMCA 1GCOA 5DM1A 3LT4A 2GUGA 1Z6QA 2IYZA 4BEJA 1Q6ZA 3EH2A 2C2GA 3HDVA 3QELB 4KXWA 1BQEA 3TFWA 3USCS 4RTKA 2EJKA 4KX5A 5E38A 2ZIVB 4BLRA 2O0LA 4KQGA 5T6BA 3CONA 3KOZA 1PQUA 1V95A 3AW8A 1EGQA 5DEIA 3NIGB 3TW6A 5I7UA 5J43A 1ZD3A 1Y8CA 3O8DA 4JI4B 3I9V1 1DAFA 1UBEA 2C9BA 3TIFA 3ZOKA 4OBWA 3T7RA 2NWQA 3DBHA 3EGOA 3GLIA 4LECA 4LDRA 5LC1A 5AM4A 1L6IA 5FPSA 4X65B 1W4AA 1DMRA 1RRPA 3VH3A 1W36D 3BE4A 4RV5A 1JFLA 1H8HA 1STOA 3PT5A 1E1NA 1M2FA 3RAEC 3HI4A 2BGKA 4HQ6A 2WF5A 4GDMA 3SHVA 2WSIA 4G4JA 1NVGA 3AHJA 3KXLA 1BX1A 2GHRA 4KPGA 3O1IC 1V9LA 3DJYA 4QU9A 1C8BA 2PSHA 3C24A 5TNXA 1Z4QA 4NK5A 4GOOD 3WSWA 1TLTA 2C5EA 2Q4DA 2BEJA 2ATIA 4CCAA 2I2CA 1NZDA 3DH0A 3IKLA 1VGVA 2ZB7A 3ZJ4A 2OA0A 3W6ZA 1X9GA 2C2BA 3D0RA 4O1IA 2ZUTA 1T9DA 2A9FA 4DJAA 4HBGA 1T15A 3KTFA 3GMTA 2QE7A 3A1TA 3O3MB 5LZ4A 2OO3A 2BMVA 3FYHA 1L3IA 2VCHA 1G16A 3FNQA 3VVMA 2BYTA 3CO0S 3SHWA 2GILA 3DWIA 2RJ3A 2YV2A 4FDMA 4K3VA 1BVUA 3WL7A 1B76A 3MBOA 1NVUQ 2IXFA 3TR0A 1HF3A 1A7AA 3MCZA 4INOA 5ICEA 4OIFA 4S1WA 1CHDA 1FW6A 1KXJA 1SAYA 3FSGA 3H5AA 3C41J 1G20B 5AHOA 4M55A 2C5HA 1GGJA 2JFGA 1T8TA 1ZOIA 3DHEA 3QKIA 2CL6X 2CLSA 2J0EA 2SCUA 3HABA 3OX2A 4DMFA 2CJWA 1Q0PA 1ZC3A 1YAHA 3X1DA 4I19A 1OXBB 4CQMA 2YWXA 2OAEA 3FCCA 4PR3A 2XSZA 1VHQA 3K5HA 2JGJA 4RIIA 1XPRA 4AF7A 2C59A 3BILA 3D8BA 3SYNA 5K0ZA 3AH8A 1OI2A 5JQWA 2GN9A 3TQCA 2C04A 1Z0UA 3ZXYA 4EPRA 5DB4A 4G65A 3FYSA 5H4HA 5HW4A 2IYWA 4GFDA 2E8HA 1SXPA 1N2CE 2JBAB 1I51A 4ROSA 4QWWA 4AQYB 3GCZA 1I94B 5CFNA 3DMDA 2NAFA 5HG0A 2CBFA 1D9XA 3EA0A 2OYCA 5B2EA 1P91A 3IRUA 5FTLA 2OV8A 1K4MA 1U6IA 3CEJA 3LAWA 2AZMA 5I9BA 5BV7A 1Z7WA 3PPIA 4HDQB 2DFLA 4YRQA 2FZKA 2GZ2A 5JYCA 4BNNA 1V2GA 3CCCA 2PS3A 4PO9A 4IL5A 3UB4A 5CH8A 3GFTA 1BDBA 3CW9A 1LTHR 3NBYC 5SY6A 4JUBA 1V8ZA 1WQ3A 5GTDA 2W00A 2XWBF 4P4GA 3ADOA 3BXXA 1DX4A 3AY3A 1LTQA 1QYCA 2V7QD 3N8DA 4KIWA 1JBKA 1VFNA 4YJ3A 1E99A 3PL5A 4NZMA 4PFKA 2E8QA 2CZGA 4QXRA 4JUAA 4E6EA 3BFKA 4CF6A 1TAUA 3BG5A 3UJ3X 4M1ZA 4M8KA 4YUXA 2MSNA 1FMCA 2BFBB 2WEKA 2FX3A 3L4KA 2IIPA 1NUUA 4WY2A 2IH4A 1FYXA 2AOUA 1XZJA 3OCZA 4BNXA 4D4GA 2AMVA 1JEYB 2WTEA 1ZM3A 1ECFA 3HJCA 1PN3A 4OFXA 5ER6A 4D8VA 1K5DA 1W85A 1ZD8A 2A14A 5E1MA 4X94A 2BDEA 4LMPA 4JBGA 3J81k 2CL5A 2FF7A 4JUCA 3NFRA 4KPUA 1C14A 1ZRHA 3DR3A 3BJZA 4FB4A 3QV1A 4Y1GA 2EEQA 3TLMA 1T6ZA 1RRVA 2QP4A 4A92A 1EVIA 4O2RA 2PD3A 1F0NA 2WG0A 3AWDA 2IUTA 4C87A 3MJTA 4NQZA 5IH7A 4EMUA 4LBYA 3PUVA 5BNTA 4IGEA 3UM9A 5AQ1A 4AO7A 4AXBA 1IZYA 2VJMB 4B3XA 4DUYB 5JI3E 4S0ZA 4FYJA 4XM2A 4MVJE 1V3UA 1GY8A 2FN4A 3BIFA 1YRLA 1ZZEA 3W0LB 3UQYS 4AZSA 3AJ9A 1ESZA 1MCZA 2GD6A 3DOIA 3EHEA 2MINA 2DQYA 2RGAA 4RVFA 4ZTBA 3VU9A 4JJ8A 3H2KA 4S12A 3U2QA 1TADA 5U4XA 2OLKA 4LZWA 4EFMA 4QU0A 1HURA 1PFKA 3N74A 2E4NA 1XXHE 5AVYA 3BWCA 4ECEA 5DWVA 3D6JA 5I8PA 1TMGE 4DSNA 3FYUA 2Z9BA 3QXCA 1QG0A 2AF3C 3Q3CA 4P31A 4EIWA 2AUNA 1KRHA 1NI4B 2MINB 1R8XA 2XA1A 1J8QA 1Z26A 4RC9A 2JIMA 3KEOA 2IGBA 3FNRA 2ACKA 3ESAA 3KVOA 2PQ0A 1B14A 4O8ZA 4UPVA 4CIDA 1UDCA 1NW3A 3RABA 4MIOA 4DMKA 4J1QA 3VH1A 1E64A 1T8RA 5U4QA 2X86A 4R9SA 2V7GA 1GZDA 3BQ9A 3NWBA 4AO8A 5IN4A 1GA4A 3GGJA 2UYHA 2GOYA 4XB6B 3KR0A 4BKQA 3T1VA 5B58C 3OQBA 4LOKA 5JRDS 3OQOA 1C7QA 1FTGA 2ALJA 1EHCA 2RB5A 3CQ9A 3M6IA 3SIRA 1BOOA 2HUNA 3JRWA 2H3HA 4HR7A 2NYAA 4RTJA 1TEZA 1RPNA 1KVQA 1ORHA 3ESZA 1L0BA 4TMVA 2C5FA 3B53X 1PG5A 1RPAA 2I8CA 3OSUA 1N9GB 3TXXA 3VR2A 3ZTYA 1Y81A 3VHXA 5LA6A 3HSYA 2DPXA 1CQIA 3GUCA 3HJHA 1SIBE 4CLOA 5LQJA 1ZK0A 5IM5A 2IPNA 2OCAA 2W6MA 2YWBA 4OJKA 3GFSA 1CULC 1XE3A 2G71A 5J40A 4KNYA 1LEHA 3SYKA 4MV1A 2FKNA 3N2IA 3P4XA 2XT9A 1AGPA 1LDMA 2X13A 2C07A 1UDXA 2VDWB 4ZMSA 4D6XA 2FRDA 3UMVA 1VI5A 1A9QA 1TUIA 1OYYA 4ISCA 4ZOQI 5KBYA 3PIRA 4RLHA 1PZFA 4LHXA 1AGYA 3GDHA 3LQ4A 3GH1A 1N8TA 1LSUA 1UK7A 2D1FA 5BO5A 1CLUA 1O95C 4YV1A 4LEIA 3CXRA 3CISA 1MAUA 2C9OA 3Q8KA 2E4YA 5IMSA 3EZ9A 1XTKA 2FSGA 1Q0SA 3A9VA 1XHEA 1ZQ1A 5IP5A 1ZCZA 3B6EA 2KWIA 3UF0A 1E3JA 2EX1A 2HZBA 5TQ0A 4ZVPA 8GPBA 5FX2A 2ISQA 3EAGA 3P4YA 2PUHA 4M38A 5TT0A 4AVYA 4B48A 4ZT3A 3OHPA 1VKOA 1Z38A 1DQRA 1RSZA 4YLYA 4YVFA 2B69A 1SD1A 1LJLA 4H4EA 4HAVA 2VCYA 2CFCA 1WKVA 1P81A 3FRIA 4IJVA 1XQXA 4JT9A 1I2MA 1XZBA 2ZYRA 2IU4A 2Y6VA 3KUKA 5DLDA 1XT6A 3AXSA 5DW3A 4MYUA 3GLSA 1A4RA 2COEA 1I7QB 4UQPA 2QTHA 3F1KA 5EWLA 1R6XA 3AR9A 4KQKA 1KBZA 4OM7A 4YP7A 2HYDA 2FPSA 3PIIA 3ST7A 1LF5A 2ZE6A 4XIJA 5FIUA 1QGOA 3IUQA 3R5JA 4NYIQ 3FD8A 3E03A 3DEAA 2GCOA 2ZRNA 3AHDA 4RTRA 1GQFA 3PF8A 2L42A 4J0QA 4X3CA 5E2BA 1TQDA 3ZGYA 2L19A 2XNCA 3ZQ6A 1J90A 2OXIA 5L4SA 5EERA 3AI7A 3ELDA 3Q85A 3VSEA 1H0KA 3UK2A 2HA6A 4N5DA 5J63A 3N7AA 3K5PA 5FL7A 1PQWA 2NQ2C 3ETDA 3R5XA 1BGWA 2ZS9A 2EZ9A 1RCTE 4K2AA 5ECDA 5IFLA 2GBLC 5LZ7A 3BSSA 1SXJD 2GJ8A 2XDAA 3FPGA 3MG9A 3T7KA 4Z4CA 1CU1A 4R6WA 3HM9A 1C1DA 3WS7A 5DM2A 4Z4QA 1PR3A 4ALNA 2W8BB 1SRQA 1D6JA 3GNTA 3LVBA 4L95C 3QLJA 4TSKA 3SFVA 1A9XB 1QAMA 4DZZA 1MZVA 5EI5A 1DRUA 4D4HA 4H9GA 3FBTA 4TN1A 3E9NA 3KYCB 1WV0A 2NO0A 2PYZA 4LSZA 4PHFA 1E96A 3L4SO 3CF4A 3U7RA 3K3PA 1J8DA 2X4DA 2B1RA 3FNBA 3ILSA 4JJFA 4NMMA 2VHQA 3KQQA 3VZDA 2GJKA 4NZOA 3X1XA 3KYDB 3E7DA 3MJVA 4BMSA 2DV3A 3CV3A 2P3OA 3OU6A 4Q4JB 1SU8A 2JK1A 1QRRA 2EIHA 4H1HA 3B3FA 1YRBA 2DPMA 2RI0A 1OIWA 4C3OB 4M6WB 2WNHA 1H3EA 3MUNA 4H35A 1VB5A 2HQOA 2QY6A 2XA2A 3VZBA 5IM4F 3QELA 3DAYA 4OHWA 2XZDA 3UWDA 1F51E 4B8WA 4YMTA 1NXXA 2IA5A 1AK9A 2O4CA 5GQSA 3G8BA 2GHQA 5ECGC 4UU0A 2X9NA 3HN6A 3QU4A 1UAGA 1LBSA 2NTVA 2RHOA 2ZBGA 4UHHA 4B4WA 1F5SA 4RPIA 3LK7A 2C8LA 2QP9X 2FJPA 3L7CA 1PG0A 4N8EA 1JXAA 3IB6A 3VO1A 4H4CA 2IHUA 2B98A 2JH8A 3SC2A 5BRAA 1SWVA 3OQ6A 1PT8A 1QIFA 2RGXA 1U2DA 3G2HA 1ST3A 3ZGOA 3NEJA 5AK3A 3WL5A 1F8UA 3IR7A 2BTQA 5TF4A 2R5FA 3GLGE 1NZFA 4UJ5A 1V6AA 1JDZA 4HYEA 4TN5A 4CLRB 2PGOA 1RT9A 3N3AC 3THOA 3U4QA 2D1YA 1D6SA 1JXOA 4KEAA 5J58A 1Q0RA 1WUYA 2D0DA 1P2DA 3HADA 4BASA 1G6OA 4C0SA 3JQ9C 1CNFA 1JXMA 3PEUA 1CUWA 1CE8A 1SK8A 3K30A 3Q7IA 2ZBRA 5KSZA 2Y1LA 2VDNB 2HF7A 5CCXA 4ND4A 4MPPA 4D3YA 4ARSA 4RZ2A 1SIUA 1BDHA 1C7EA 1H4SA 4YRPA 5KREA 2VF8A 3WY9A 4O6VA 1Y33E 2P9DA 2C78A 4I50B 5EIBD 2AX3A 4P7BA 1NDQA 1GKKA 3QKTA 4V3BA 3M5PA 1UOOA 5GM1A 1LVHA 4CIYA 3R44A 2XOKA 4RKRA 1H5NA 1NTRA 3P0IA 2VQ6A 2JFNA 2J4CA 2QTGA 1EX7A 3GUHA 1X0VA 2Z83A 1SHKA 2VOEA 1MNQA 3G9XA 4RZQA 3L5KA 1F8YA 1M10A 5I5EA 4MKXA 4E4TA 1QLHA 5LCXA 4CTMA 4Q9KA 1ORTA 2C5LA 5KYTA 2HPAA 1Z82A 3DOOA 4RF5A 5D3KA 1QTNA 5EKXA 4PPYA 2ISSD 5LLTA 3TIGA 4DCOA 3DLAA 1NKVA 1G98A 3EC7A 5SZHB 1ZGZA 1YR6A 3WHLA 1YB5A 3E9ZA 2X9LA 5AVUA 5IZCA 5KVAA 4M9SA 1QS0A 4WZ6A 2F7SA 2WLSA 3FUXA 1G0OA 2Z2KA 1AQYA 2HO4A 2VH5R 2YQZA 2GH1A 2OWGA 3UQZA 4ER6A 1JHPA 4KE9A 4FW8A 4PRLA 1TE2A 4R1PA 4FIDA 2XR1A 1FZQA 1WXEA 4PG8A 2HJ9A 4KPEC 3WLIA 1JNXX 4UMDA 1JP7A 5EFZA 4F1KA 5HIJA 2IW3A 5AK0A 5HQJA 3H19A 1N34B 2BF4A 3KETA 1KJIA 4ER0A 2AXQA 1MOPA 1W5FA 3DA8A 3L4JA 4OLBA 1WDTA 1VA4A 1G7SA 3FVWA 3PICA 3F7OA 5FXMA 1QH1B 2FVXA 4OBEA 1E94E 4PNZA 5DNEA 3RC7A 4BCBA 4WZZA 5FOXA 3VR5H 2HO5A 1UADA 1MRSA 4B6FA 2AUMA 4BJ6A 4CIVA 5JMWA 1UWLA 2H1LA 2V7WA 2AZ4A 1DAEA 3M9LA 4G2NA 4II7A 4B71A 4ZCMA 2VNSA 4WINA 2F8TA 4P4NA 2VK4A 1OJLA 3O2QB 3WJAA 5AM1A 3E8SA 4CWAA 5KMGB 2PXAA 3CLTC 3VU8A 4OB6A 1JKJA 4Q4AA 3RHFA 2Y9PB 3PPVA 3JZFA 1UK8A 1HY3A 3E53A 2XVZA 4MVJH 1VM6A 5EWMA 3SQLA 4UNRA 4U2CA 2EU8A 2AJ8A 2ORIA 3FTPA 5K3FB 4CFYA 1A98A 1ISMA 1SC6A 1DBVO 1BN6A 3I76A 1R6UA 4RZ3A 4BVGA 3HYRA 5D3MB 2JIZD 3Q11A 4XTRA 2X14A 5TF0A 1KI4A 5BYJA 2WJAA 1NI4A 2AWNA 2WJIA 4Q39A 3ROXA 3AV0B 4PTYA 2J3EA 3I04M 4LQDA 4MS1A 4C6TA 3MRSA 1RZUA 1U0TA 1ZGJA 4MWCA 4N5HX 4KXLA 1OLSA 1GG8A 4MS4B 2W6NA 4N3GA 5CVCA 4A5SA 4YMIA 1UT5A 1TK9A 1H2HA 2R00A 3BZUA 4WT7A 4EJ2A 4NNOA 2P9GA 3R75A 4EHJA 4MWDA 3PFKA 5EKDA 5FCDA 2G4CA 3TFOA 2C0QA 1J0XO 3DVAB 4GOXA 1RKQA 4X64B 1MJNA 3IQFA 3PQ6A 3LGSA 4LHEA 4RDXA 3KAJA 2BEWA 1N2HA 4FU0A 2OBFA 4QTUB 4DTCA 3JATA 1VYVA 5TSDA 4PAOA 1GPH1 3TN7A 3AM3A 2MSWA 1A69A 1PQPA 1VI2A 1WY7A 3EEFA 2W2MA 3F5DA 4R69A 4S1PA 3FCXA 1E6EA 3UMSA 2RBKA 4WQMA 4C20A 1XJ5A 3CPJB 4I50F 4NZ9A 5D3ZA 4YYEA 3OZTA 3ZHUA 1FFWA 4HJRA 1DB3A 2OHHA 3DDOA 2ENUA 3DV0B 4JAVC 1FIUA 4BXOA 4EKDA 5A9SA 3EZNA 4DDTA 2ZR8A 1G8GA 4RVDA 3TSOA 4KGZA 3C3WA 1GG9A 1MLDA 3V8RA 2Q7XA 5LR6A 3HVRA 2IPLA 2R8XA 4DSAA 4RJ2A 1KVSA 3OZBA 1BDJA 5CA0B 2I3AA 2COKA 1MU0A 1KDOA 1MHPA 3D0KA 4N3BA 3S2FA 1XMPA 4CLXA 3HB5X 3H75A 1YBAA 4F3RA 4UATA 1JU9A 3EEQA 3K05A 1YZLA 4H16A 2F59A 4IG9A 4EUNA 4HDMA 4TYYA 4AJ9A 1EK2A 1QHFA 1ZJYA 3N58A 4ZDKA 5C8XA 2X4IA 4U7FA 3V5NA 3O1HB 2XXAA 5JCJA 1GUBA 3ES9A 3ASVA 1P1BA 4XQGA 4H18A 4PLWA 4IGIA 4KQ9A 5CD1A 1BWRA 3LTNC 2HIHA 2P9FA 3UFXB 2CD7A 4IR7A 4FNAA 1PIWA 3GYBA 3U60B 2QLNA 4DDKA 1T3ZA 4PX3A 5C52B 2YXLA 4PLTA 4WCVA 2J7KA 5DGCA 1XCMA 1IIRA 2JFOA 4TWBA 2P8SA 3THYA 2R44A 2E82A 1G2QA 2CT8A 2CLOB 2HLNA 3IE2A 3L8GA 4G4SO 4ZANA 2Y2UA 1YQWA 2NPNA 1FK8A 2WAOA 1DWQA 3AEYA 4BPRA 3UO8B 3BMNB 3R3VA 4NAUA 4PC1A 2I4LA 5JZOA 1Y6FA 5C7LO 3UC5A 1B0AA 4CKBB 1RD4A 2HDWA 2HJGA 4X61A 5GGYA 4XI9A 4KN9S 1V25A 3V46A 2UZIR 2WG1A 1QZUA 1EK0A 2PNFA 1CUDA 3BL8A 1FPQA 4PNHA 4JEIA 5JW6A 2O48X 1T6XA 3T7SA 5BRNA 1IUOA 2JNWA 2O2YA 4PS0A 1WRBA 3UMCA 4CQMB 5E6UA 2CDAA 4WK6A 3MC1A 3K0AA 4AWBA 2D0IA 5KSPA 1E3DA 1ZKMA 1JHDA 2DPYA 3MMSA 5ALUA 4IDHA 5EXPA 4CPDA 4N49A 5SYNA 2BLNA 5LBTA 3RAFC 2AFIA 1N9ZA 3LRXA 4NY1A 4RVOA 4GMHA 3ZGLA 1UPFA 3JAWA 4BPBA 4K6KA 3RVPA 4BEBA 3M33A 3TLGA 3VUEA 3IOBA 5LQRA 2Z98A 3OZAA 4RZIA 4EZBA 4LF7B 2C29D 5ALPA 2ZB3A 2H48A 3R3WA 3BB3A 1OWNA 3HCRA 1JN0A 2ZI4A 2C3UA 3WKCA 1HORA 1RXEA 4MK4A 4Y9SA 1DTEA 3GZNA 1SU6A 2XUFA 3NQ41 1RZ3A 3NC1C 1M1YE 3QG1A 4OFBA 1C3OA 3QFSA 1DJNA 4ZRNA 3ONDA 2XW6A 4EUSA 1NP3A 1PP4A 1DHTA 1PGJA 1QC5A 2ZBPA 3MOIA 1XJQA 3ZV6A 3NHLA 4INJA 4OHYA 3FCAA 3LPMA 3M6MD 3D5QA 1J8MF 3IPRA 4NKRA 2RIRA 1PVVA 5J5VA 5LDGA 3H0KA 3K1AB 1BMQA 1TL7C 1G7RA 3INNA 4OA5A 1VHWA 3D7SA 3N87A 1J2EA 4DLUA 4ZQCB 2Y77A 4M46A 3DULA 4R8MA 3NDPA 5AKLA 2BKVA 5I7EA 1NMZA 3DUWA 1H66A 4KWIA 3KE8A 3MWKA 5ENVA 3WLFA 2G1UA 5HYVA 2Y0DA 2C7PA 2I62A 2QXTA 3FY4A 1AUPA 1JFVA 3L1IA 3PUJA 2BGUA 2JK0A 4E94A 1P9NA 3RASA 4C5AA 5FV4A 5JS1A 3PWKA 4EZIA 4WVFA 3GH3A 1JIQA 2GPYA 5I7AA 1E7YA 5DK6A 2IEAA 5A62A 4KQHA 3ELBA 1L9XA 4J7CA 1KZ4A 4WZAE 5GVRA 1AA9A 3VTAA 3WR5A 3PCTA 4R1UA 1SUIA 3UEOA 1CR4A 2PFKA 4MTCA 4RQBA 4BVBA 3ZDAA 3FF1A 4RLSA 1AZWA 3W7AA 3OQHA 2HLDA 1SBCA 5E2AA 1U0SY 3U3MA 4UULA 2QKYA 2BFDB 2YV4A 5KDLA 4E5VA 2UYCA 1MBZA 3LXRA 4UE3S 3KJGA 2VK1A 4X8HA 1SVUA 1VJ0A 4ZIRA 1MNAA 5KX5F 2CUKA 4WLVA 3L40A 2V6BA 4EG5A 2GSDA 3MWGA 3TXAA 2W48A 2LUOA 2O59A 2JKVA 3A3YA 3ZVKA 5C7IO 2BGRA 3K9WA 1WDEA 4ZYWA 3NBUA 4J8PA 4KXUA 4U7JA 2EZ8A 1QYWA 3I01A 2GZSA 4HAWA 1KFEB 4GVLA 3IV9A 3MUOA 4QD3A 4ZEWA 3W2TA 4BV2A 4MQUA 4QODA 1G59A 3ZC3A 1NGSA 1P6XA 4TTIA 2I29A 3TNFA 2GM4A 2WJYA 1VIAA 1M1ZA 2P90A 2BONA 5KTOA 4Z4IA 2FOXA 5KNCD 3FM9A 4M0MA 5DGXA 4KOEC 1WB6A 1PCXA 1FLDA 3IILA 3ONWA 1X80B 1FE8A 3IDQA 4UEKA 4M8LA 2J85A 3KXPA 2AN3A 1CJKC 3EB9A 4NC9A 4CL8A 4DMRA 2XGOA 2BSXA 2VAPA 4FWIB 4W7IA 4UDYX 3U1BA 3D02A 4KYUA 3HRIA 2GWHA 1WE2A 5ALNA 5TMEA 2PX2A 5DGHA 4DLWA 3VBCA 4FDAA 1G9TA 3GFQA 1TZJA 2EFHB 4LWQA 3WGHA 2RKBA 3ITDA 1L5YA 2PS0A 1KSHA 3NRJA 2VHTA 3UAXA 4L07A 4YJ3F 1W8IA 5LWQA 4OLJA 3IIKA 4YCMA 2OGUA 3K8QA 2HK6A 2ED5A 1V35A 3ZBQA 1H4QA 3WIVA 2H31A 2F3RA 3R7LA 5B1SA 5JFOA 5B7NA 2Q1WA 2YFKA 5LJIA 3HJNA 4PPNA 2B30A 3OPYI 2E6KA 2ZPTX 2P3LA 1EVEA 1K68A 2P5UA 3EDMA 3IQEA 4I2NA 4N0QA 3OQJA 1CUGA 2FN3A 2JLAA 3N5CA 3E0XA 3ADCA 1I30A 5EP3A 3RSQA 5KWJA 1Y42X 4JI0B 4Q3KA 3FSJX 3VYVA 3OHSX 1RXWA 1ZH6A 3AESB 5AW4A 1XNQB 1QFJA 3WK7A 5TJ9A 1M6NA 5JO0A 4D9HA 2VP0A 1UJBA 2JHAA 3H16A 3SYTA 1ORRA 1E2JA 1CQIB 2G67A 2IF2A 4QPCA 2BBOA 1DC7A 4WNIA 4Z0HO 4CLOB 5TS2A 4UUNA 1F17A 4KR9A 1EG2A 1XC7A 3OA2A 4DNQA 1G42A 1WAMA 1WMAA 3SJBA 4BNWA 4EPYA 5L4NA 2A5GA 4EI8A 1CZRA 4FIZA 4ME6A 4O3MA 2CF5A 3WL4A 2YINC 3H8JA 3OURA 2IPMA 5C0OE 5P21A 3Q6MA 4QKQA 3CINA 1PEDA 3GAAA 2IKSA 4TL9A 4KAFA 5MN4A 3H8SA 1FJ2A 3L4BC 2VBGA 3H65A 3IALA 4HMQA 2GBCA 1NIJA 3IS3A 2GPAA 5DNAA 4K40A 4KN6A 4C9BA 3DMHA 3GELA 2CXQA 3PYXA 4EDFA 2GGSA 1QRUA 3C1OA 4EGSA 3KBBA 2PPVA 3I0ZA 4YDQA 3MXTA 4CU2A 3FFTA 1BD3A 1CQXA 1NP7A 2QAGB 3I30X 1RMTA 4J1TC 4ZZIA 4CDNA 2HDNB 4P2BA 5FKJA 3T5MA 4QBKA 2M1XA 4EQ6B 4N1AA 1LBHA 3VJRA 3KSMA 3OM9A 4OI0A 2XNSA 4JS0A 2AZXA 3KQNA 5H3LA 1TIBA 3BAFA 2OFFA 2EBFX 1PFVA 3M9WA 2P78A 4LYGA 5C8DA 1SXJE 1YDWA 1Z5PA 3C8ZA 4J3JA 4TTAA 1LDEA 2LDBA 2HTFA 5CK5A 1CEXA 2A5LA 3FKQA 4NHEA 1LQ2A 1RJEA 2E4XA 2CD9A 1QIGA 2CUZA 4P34A 2WD7A 4HNTA 4O08A 5KYYA 2FJ0A 1Q0TA 3ESQA 2QMZA 4DKXA 5J2TB 5HE9A 1AUXA 1YKGA 4TRJA 5CT8A 2P4HX 4GZ6A 1Q50A 4X3PA 3S1SA 3PIDA 2ONKA 4PLZA 1P0QA 2O7NA 3QPUA 3ZX4A 1TJPB 2CFIA 3JALB 1A76A 3MT7A 5M34A 1UOPA 3WLHA 1IHPA 5HKBA 1SZPA 5K2MA 4OX9B 2VDRB 4ZICA 3IBSA 2D0OB 1AK2A 3U7GA 4DCSA 3E82A 4MRPA 5A6SA 4QFDA 3UMJA 4NV3A 5FPPA 2SKEA 4BFUA 1FYWA 3AC0A 3ORHA 4RE5A 3R7AA 4JZKA 3W5IA 2M2IA 3ZOZA 4PNEA 3L7JA 1W76A 2X0DA 2YR0A 3QUCA 4ENVA 3MT0A 4QBIA 1K08A 2I6QA 5LB4A 2IZ0A 3VNUA 3HYNA 3RIEA 3H87A 3S29A 1NX9A 1CUSA 3VDNB 2IL1A 2YOHA 2O5VA 2VF4X 4Y9TA 3L4EA 2O8CB 4KK3A 1TZMA 4LTNA 5CLLA 3UAGA 4PN7A 3IIMA 4KI0A 5AO9A 4P3OA 2D5AA 2IYUA 2AWOA 2P65A 5ISMA 2QD3A 3K8OE 5JAPA 1P4AA 3E5MA 3KEFA 1JTVA 4RDIA 4I9HA 1SVMA 3F67A 4AJ1A 2LPMA 1NDHA 2ZK7A 1EQAA 4NIMA 1KS2A 1B00A 4Y2UA 2ZTUA 1Z0JA 4MKHA 1N2JA 2CKMA 1MC1A 1SC3A 5EG5A 1DS6A 1UPCA 2CB9A 1K66A 1B41A 3IESA 4DIBA 4HDOB 2A92A 1H0RA 4YH1A 4CMEA 2BM0A 1UEXC 2XTMA 3DZJA 1FQKA 3GPCA 3OZIA 1JSCA 2ZJZA 2XWJI 3DW3X 3R20A 4HLDA 2P6RA 2HXYA 3IXLA 5T3YA 3QM1A 5UKDA 1TZBA 2VXYA 3KL4A 2BMEA 1J07A 4JNCA 2OSBA 2A9RA 1BKYA 2I87A 1W0JD 2NO4A 3KYJB 4G4SP 4KZKA 1BXGB 3HO8A 1ZN2A 2ZYVX 4KQMA 2AFHB 1TM7E 3GAFA 5HGJA 4OM8A 1EWTA 2DXXA 3DNPA 4ZARA 4EATA 5EHZA 1DBPA 3JVEA 2G9UA 4FZVA 1ENZA 4FFVA 1USIA 2OGTA 3S2GA 4R01A 3U7QA 3AJDA 3B6JA 1DL5A 4OQQA 3WV5A 2R7MA 1W9HA 4LKOA 1TT7A 1O94D 1P2FA 2CK3A 2PBLA 2QNRA 1AV6A 1Z12A 3INRA 4UM7A 1DIRA 5IXJA 4KIFA 5K20A 1GADO 2DR0A 4ZAFA 4LF5B 4QFCA 1JDSA 2OSVA 3MRVA 1J2RA 3W05A 3GFVA 1UODA 3L0PA 1RQGA 3CVWA 2O8EA 2W6PA 2W2LA 2EP7A 3DL7A 4BX2A 4K0KB 4N6OA 3QSGA 5G0VA 3TBHA 2J5XA 2QAJA 4E2XA 4JR1A 5ELXA 5CB4A 1D4ZA 4PAGA 4AJ4A 2I91A 2F3QA 4L3OA 2WAMA 2EZUA 2ZJFA 1FF9A 5GY7A 3EVGA 3RTGA 1LSSA 3PX7A 1NNLA 3CZ4A 4P9NA 1FTYA 3PS9A 5CXUA 1QK5A 1SIWA 1Z17A 3JYPA 2AZDA 1JTFA 1KQFA 1ABFA 1QHGA 2BMAA 3Q12A 3AB3A 3GJ3A 3F3YA 2WKPA 1Y6GA 1TW2A 5DWQA 1ZLYA 2PH3A 3A31A 4CTNA 3JARA 1MV8A 3CLSD 4DLZA 1LSOA 4CQLB 2I4OA 3OTHA 4Y0NA 4FD3A 1IBLB 3ZJVA 1YS1X 2E21A 2LR0A 3T38A 1G291 4R1OA 2AA3A 3SJUA 1VOTA 1QKKA 3R9WA 2CMKA 4BKMA 3FOAA 3NHRA 4CLHA 3KTAB 4ICIA 1HNWB 1ZM2A 3QUAA 3OF5A 4DT1A 2PKQP 3E5HA 1QIJA 3CUUA 3ND8A 2PL9A 3HKDB 3TL6A 5EIFA 4CFSA 3GLIE 1O94A 4CIAA 4WOCA 1YE5A 1QH1A 5H1YA 5LP6C 3CT6A 2BZ1A 4RZXA 2PUEA 2DRIA 4GR5A 2DMRA 1WYZA 2G5CA 1ZBDA 2V3WA 2NO1A 2C7GA 3LYLA 1DIOB 4O5OA 2OORA 9MHTA 4DYDA 1HDZA 5F76A 2P9ZA 3L8YA 2X2EA 3X1YA 2NUAA 1RHUA 4LQCA 4U9HS 4X1YB 3SSNA 4IIJF 1P77A 2PZKA 2KBEA 3K09C 4YT8A 3H5NA 5I4BA 5JBQA 1JPJA 3F46A 4OATA 4B5LA 3ZWAA 5A3VA 3MINA 1KJJA 2XECA 1BZYA 4YJDA 1RBYA 2DSIA 2Y05A 2PSSA 1UOEA 3D6TB 3LFHA 4G09A 4R4JA 1SD2A 1U04A 3TNJA 2GVDC 4B82A 3OM8A 5F1YA 2IQIA 1Y5LA 3A1SA 3O4VA 5JDIC 1XVLA 3BL6A 2HA3A 2ZTHA 1OC2A 3B36A 3F9IA 1ZWLA 3QBEA 1ZIYA 4L5IA 4CDMA 1VPEA 4QATA 3U7HB 5LD2B 4TROA 3QF7A 2VTBB 2QX9A 1L7QA 1UDBA 4B3CA 1M75A 1OLUB 1XTQA 2HYIC 4RD2A 4AS2A 2PVPA 4O0MA 4DC9A 3J7AC 1H2BA 3F5SA 4WCDA 3VYRB 3FW1A 5AW3A 2ZP1A 2ZSBA 3T3NA 4FX5A 4OSEA 1N5DA 4UUBA 2PUBA 2AOXA 2YW9A 3VPCA 3Q9LA 2K2QB 4PRYA 2VEOA 2WM2A 5THQA 2YWHA 4UVDA 4YA6A 3RRJA 1OBFO 3FZGA 3LOUA 3PA6A 3CVOA 4NMWA 1XWWA 2GAJA 3A4NA 4I7EA 2QU7A 3TQQA 1NTOA 2PX0A 4IJWA 2FPWA 3PQ7A 5IDXA 3FLEA 1JB9A 4RPHA 1RBMA 3GLGA 3FOEC 4PZCA 2WV7A 1I7SB 2EEZA 4GYYA 4DDWA 4PBRA 1A7JA 4NDNE 4TYQA 1L4GA 1HDIA 3HKCA 4V24A 2EZTA 4K9OA 5G4LA 3VH4A 1Y5MA 3QH4A 4MJ7A 2R6ZA 4R2WA 3ICVA 3N8NA 4UUAA 5KUTA 3F73A 3O38A 1AU9A 2B0JA 2WYOA 4LJAA 4LRYA 3W2IA 2B8JA 1W96A 1OI7A 3Q7EA 1T36B 3OVMA 3WGZA 3HB9A 3DVRX 2WTNA 1KVRA 4AROA 3B3GA 4OSOA 4EHAA 4RO0A 1DZ3A 4N7BA 2ID8A 4ZIRB 2ZQYA 2C31A 2J41A 4QDOA 3SC2B 3TPZA 2BEUA 2DUMA 3P0FA 1CT9A 3FI0A 1NQAO 1X14A 3KXIA 4P54A 4PLGA 2DVMA 3OT1A 4QOJA 2O7QA 3TDMA 1HNNA 4AURA 4FN4A 3ZUGA 5JIBA 1GUDA 3ET5A 1WB9A 3CE6A 4H17A 4KO2S 4PS1A 3EMKA 1E79A 3MOSA 2EKBA 1DU4A 1KNQA 3ZVNA 3R9KA 3H9CA 3RTAA 3T3OA 1M2GA 1YVEI 4LC1A 4RIHA 4GI1A 3SSMA 3AVXA 4B2IA 1T5LA 3UPTA 2Q3CA 4N12A 1MC5A 1QH0A 1X1QA 5BR1A 4M7WA 1U0EA 2WNSA 4I4TF 1BMFA 1IC6A 2LP4Y 2P2GA 3KQTA 4GIBA 4HB3A 1EZ1A 4PGAA 5JJIA 4B6GA 3D7LA 4KTVE 5A5VA 5JAIA 3K1YA 1BGXT 1FLAA 5H82A 4AO6A 4N3NA 2HSEA 4XRGA 5HTOA 2LCIA 2P9EA 3GP5A 3M3PA 1FUEA 3K1ZA 2J3JA 4Q19A 1R5OA 4YHHB 3W5VA 1OFGA 4UHBA 5IJZA 2JGMA 3L41A 3CRRA 2O2JA 1E5LA 1K3UB 3U4GA 1IZZA 1C7FA 4R8RA 5FBZA 1ZI8A 1DDIA 2FOIA 2BJVA 1QH8B 1E4OA 2VHVA 3C4VA 3LLUA 1X1DA 3PBKA 2Q46A 3PNBA 4BZZA 4GF5A 3N9IA 1DXOA 2H59A 3ZZMA 1KTIA 5B12A 2NAPA 4CKEB 5C1PA 3QF4A 1E9CA 4HMOA 4NJEB 5JARA 2QJOA 1M66A 1PJ3A 2GEVA 2P41A 3SIPA 2CCKA 2NYUA 2IZ1A 2IYYA 2XSZD 3PFHA 2V8OA 2OV2A 3ORYA 1W52X 4HDRA 4Q93A 4QLOA 2WHXA 2G9QA 1A4UA 5C4GB 4NBWA 2G6BA 2W2VA 3PVCA 3U7JA 5LDDC 4L6AA 4Z2AA 2MT9A 1JDNA 5TQ2A 3DMRA 4MDHA 5CGZA 5DXFA 3FFWA 4BDTA 1OV4A 3BEDA 1QIKA 5LYJA 3I0MA 4GPEA 3DOHA 3T52A 1G8MA 1P3JA 3OUTA 2V0GA 3GA7A 4KREA 3OLVA 1R66A 2R8BA 1Q1BA 3GLTA 4GE3A 2BM8A 2CHGA 4LJ7A 5EAIA 4RVSA 4ABTA 4X7PA 1HXHA 1ICEA 3W3AD 3IPCA 3LV8A 3OQPA 4RNDB 2BN4A 4HV4A 3OD1A 2D59A 4NMLA 5FTKA 1E6KA 3L7KA 1YFLA 3N70A 3BTOA 1ZUD1 1N1EA 2B2XA 2WHPB 1T9AA 2EX0A 3IBCA 3NBFA 1F60A 1RRKA 4BMCA 2WPNA 4E22A 2Q6KA 3OM1A 2KE5A 4NABA 4EFNA 1OC4A 5ILQA 5CDTA 1KK1A 2WF7A 4ZVMA 1JDPA 2I3BA 3R5TA 4YNBA 1M0EA 2PRJA 2REBA 1L1FA 5DNWA 3WB2A 3B1FA 3AKYA 3F8WA 3IT1A 4XB1A 1M2WA 4D0RA 1CJMA 1A9OA 4O2AF 3WOVA 2WB2A 4OXQA 1USUA 4RCVA 3QFRA 4O59O 5CCBA 3O74A 1AURA 4QGAA 2VK8A 3N0XA 4HTFB 4JBYA 3BDVA 3WQSB 2HWXA 4HNGA 1XKQA 4MRRA 5BP7A 3FN4A 1B6GA 1VLZA 2D1RA 1ZGAA 2XMPA 2IEGA 1VE1A 1GNRA 1IJBA 1DAMA 3MTAA 2EFEB 4COOA 2WSBA 4W5HA 3C6KA 2FMXA 1YZFA 1B8PA 1R5BA 1T2FA 1E92A 3PKIA 4JC0A 4QDTA 1H5QA 3OE7A 4M2LA 3ROTA 4BQSA 4ETMA 4DR7B 2QW0X 1XTTA 3L0BA 2CJYA 2Q3LA 3HE3A 1XOIA 2BJWA 3SJ7A 5B3AA 4ITUA 2XKKA 1U8CB 3AR3A 2H0AA 2YZNA 2Q4OA 2EP8A 4QUHA 1SY7A 3R8CA 1XGKA 4TL6A 5LU8A 4W99A 1KDRA 1N5LA 3JYHA 3OPYB 2I2WA 3JAKB 2RHCA 4YREA 2Q62A 1BKSB 3UB2A 5BR8B 3GRVA 3RS5A 2VTKA 1E2QA 4V0ME 2BR5A 5GINE 2YX1A 4JYAB 1TF5A 2EHDA 1Y8RA 2DT5A 3B5EA 1A2OA 1U1DA 5IARA 4FYYA 4M0PA 1GAXA 1YQXA 3UMGA 2A9QA 3HKEB 2JAWA 1PSDA 4Z7NB 4WW0A 1NSYA 3H4TA 3QOYA 5EE5B 5HUJA 4D42A 1TO6A 4XQ9A 1N8KA 3HWX1 4FUQA 5CH5A 2X9GA 4UEOA 3E9YA 1YDFA 2FLWA 4OB8A 5F52A 1BKDR 1MO3A 3F2VA 1DBSA 3D6MA 2AOVA 4IXNA 2WWTA 4CQNA 4DY6A 1RI4A 1JHZA 4H0CA 2QXUA 3EA4A 4TUYB 4ZYUA 4OQNA 2QMYA 2WVHA 3OT1B 4TQGA 1NJ2A 4MZXA 1JHRA 3FGPA 1UMCB 2FG5A 2QHXA 4OP1A 2AN9A 2GF9A 1PJAA 4O4LF 4TTRA 4ZU1X 2V96A 4DYHA 1CW2B 3R77A 3QI2A 5H02A 4WADA 2WUEA 1CRPA 1FP4B 5E3HA 4QUEA 3SKVA 2H16A 3GC6A 2BCGY 4Q3DA 1PNRA 2AD5A 2X2OA 5EPOA 4DR3B 1JWBB 3I28A 1RQNA 1UBOS 1Z4NA 3X3HA 5IS2A 4KYVA 2WHRA 2GLXA 2IYRA 4Z1OA 3ZJTA 3NBXX 1XRSB 2HCTA 5C46F 5AVZA 3BE6A 4PSVA 5G0WA 3GJTA 4L3VA 4FKMA 4EB6B 1O5TA 2J3HA 4EVIA 2CVZA 3L1UA 4BZXA 4TMFA 3C74A 2IUEA 2RHWA 3RB8A 2EK4A 2GAAA 4BQIA 4PLYA 3CY6A 3QYJA 1EXMA 2VP2A 2HSDA 1XCPA 4MWEA 4RK7A 3UNXA 1ZCFA 2RBEA 4A2WA 2NM0A 3L7OA 3DWEX 1T35A 1X1TA 2P5TB 3LF1A 4QPZA 1F2UA 3LOQA 2G06A 3HXKA 3C4QA 1AZSC 3WK9A 1V7PC 1Y4UA 3ABOB 3WLRA 5TR9A 4E5YA 1L7PA 4NEQA 4CKBA 3DMTC 3H05A 1P3DA 2WOJA 4LBVA 2B7BA 1YMQA 3WGIA 4Y1FA 4B7UA 1P44A 4IJQA 4MA0A 3WQHA 2WLTA 5C80A 3SQWA 1OWPA 3L07A 4BKUA 1GQRA 4MKGA 2O07A 4FMPA 4IHQA 1FVXA 1FTQA 1FTWA 3L7NA 3KU4A 1YS6A 5CHEA 4E13A 2WJJA 4G5GA 2VKQA 4TGLA 2BKEA 4XX0B 4HVTA 2PT6A 4DRXA 4NONA 3CNHA 1TF2A 4QSHA 4LRWA 4DUGD 3AEQB 4QM6A 4KG7A 2VAXA 4W8HA 1ODCA 1Q74A 3ZCVA 3PQ3A 4WZAA 1WZIA 5FOWA 1L7MA 3T1NA 3ZBPA 1IEQA 1RBQA 2QTVB 1Y9ZA 5FOTA 4BP8A 2CV1A 3V8PA 1SXQA 3HJUA 5HFJA 2BMJA 1ZMRA 1XU7A 4OHOA 4PR0A 4ZTZB 4K9QA 2RARA 3IE1A 4HDSB 5BWNA 1XEFA 4IXWA 1U99A 4BMNA 4OFWA 1MGOA 1G5IA 3CH6A 4PZLA 5FPHA 4DIOA 1YFJA 4I1YA 4EO9A 1L7DA 2XHZA 3CLHA 2C0PA 1QNFA 1KBQA 2OVFA 4D9CA 3DAPA 3I5YA 5HP4A 1BWPA 2Q8PA 5SICE 2IP1A 3RU7A 3TINA 3B2NA 1MD9A 4G0OA 3DV0A 4BXOB 1NF2A 5DI3B 3DAHA 1KYQA 3BE8A 4Z7OB 1Q7EA 3QKRB 4FJ2A 4URUR 5E6RA 4YBZA 1ZYUA 2PNJA 3FSRA 5JPCA 1U4OA 1VE9A 1UXJA 1GPDG 1E79D 5FO0A 1TKCA 3VU3A 2QDKA 2XF2A 3RADC 4ETNA 4NBSA 3W6NA 3ZWWA 2BTQB 4F86A 1Z07A 1HZZC 1CUZA 3A1CA 1H3FA 3IXQA 4TTQA 4MYDA 5DNVA 3V7NA 4C7JA 1ZAYA 1G3MA 1NT4A 2YOGA 5CNKA 2Q1YA 2CNOA 4ZI7B 1KMHA 1YS2X 2PUWA 1QVVA 1AZLA 2Q3FA 5JZMA 2NZVG 5CGQB 3IX7A 1NXQA 4NLLA 4UE6A 5CX1B 5D6NA 5FR1A 2PVSA 2B99A 1H4TA 1J1UA 1X7XB 3IXMA 4QOEA 1DRJA 2YWJA 3E9MA 4WKOA 1K2WA 1YJXA 4TUYA 4XR4A 4ZMRA 3VX4A 2PD4A 1AQIA 3WIDA 1DWPA 3RG8A 4KFSA 3OOWA 4FDTA 3W8NA 4Y9UA 5IKXA 3MBKA 4GO1A 1SUAA 1C7JA 4YDRA 1VIMA 3TG8A 3QK7A 3RDPA 2XQIA 4Q7QA 2QM0A 4R8VA 1YA6A 2BMWA 3IAEA 2XRMA 1U3VA 1V1MA 3IDFA 3PTZA 3S2IA 3W5DA 2V7BA 1XJ0A 4HGPA 2LBPA 5MFPA 4RDHA 3E1KA 1TB4A 1M7GA 4E15A 5CG1A 4WUTA 1GO2A 3BJEA 2Q0XA 2B9VA 1OYOA 3RYIA 2B2NA 1NJ1A 4JWTA 1GGHA 2P5SA 3QXHA 2CUTA 4JLJA 4JLUA 2HHAA 3PQ5A 4FE7A 3VGPA 3QFTA 1WETA 5KI6A 2AFVA 3WGMA 1RI1A 2QTFA 3GEIA 2NZ2A 3DYBA 5CA0F 1OX6A 1Z6ZA 2W58A 4QG7A 1A9XA 4E88A 2IHBA 3O0TA 2WTAA 3ZZ1A 5EXXA 5LIRA 5JNVA 4IZHA 1XHLA 1I2AA 1ODIA 1Y82A 2CJXA 1CDDA 1ZVMA 2POCA 3EXHA 3H9BA 3ZH2A 3T41A 4LDAA 2C57A 1YVPA 2RG7A 4L9SA 4E09A 2QLTA 3EVAA 3IQWA 5FYQA 2BFFB 3MW8A 2RKWA 1JMYA 3GD5A 4Z0TA 5COAA 2J48A 5EHIA 5HQ3A 1I1HA 5TQVA 3ZY2A 2CN1A 1X3LA 3QYPA 1A2BA 1KMNA 3UOGA 3HNOA 3OCUA 3X1WA 4PTLA 1YZNA 3C70A 1JQ5A 5TPWA 1GFZA 2B1IA 1PNTA 3EF1A 1SG9A 4JK3A 4YAOA 4FB5A 3DE2X 5MFZA 2FPMA 3WWCA 1QTIA 3LSTA 1KFKB 2EIXA 2X0NA 5JY6A 1SEVA 1HFEL 3TGPA 1QHEA 2EL2A 1KETA 2CYAA 2PWAA 2RCYA 3FCUB 4J0FA 4AZ0A 1I4DD 1LBTA 1QOQB 3Q87B 1NLMA 3A0UA 3AVOA 3WLMA 3DGFC 3WOHA 2CXUA 2NXCA 5AMXA 2M6KA 4WJLA 2A78A 4GXRA 4PG7A 5CT5A 3RFCA 1AGNA 3FOWA 2VSFA 3R0IA 4J43A 3BBPA 3GB9A 4HY3A 4M0UA 1XMVA 3VJKA 1U3UA 5LOVF 1CIPA 3PGVA 4W7HA 4Q3OA 1FNBA 1X38A 1P18A 1C1XA 1X3SA 3FFXA 3H04A 5ENDA 3RAGA 3E9DA 1WXGA 2VVTA 2YBOA 2HI0A 1J00A 3W3AH 4PZPA 1WDKA 1Z08A 3IHLA 2MSCB 1C4XA 2ZPAA 1C80A 1NF9A 3CU5A 3LW7A 4DEVA 1TUGA 1JRLA 3KKLA 1E1CB 3C5EA 3HU1A 3SEFA 1XZQA 3RJ9A 4TLAA 3TLAA 3CH5A 3RV3A 3KT8A 4BMPB 5B3LA 1RRFA 2GYVA 1O96A 1KIAA 1USWA 5I47A 1SM4A 1EM6A 1XVTA 2ZYGA 3K5WA 2P4SA 4FHGA 4UKDA 4YQEA 5T57A 1ULHA 4H1VA 3P71T 2BFCB 4AP6A 2DBZA 5JH7B 4RJJA 2GBPA 2M98A 1LPPA 5LBIA 5JWOA 3GA5A 1UP7A 3DFIA 3UBTA 5EIAA 4UNNA 1ZP6A 1D2NA 4DRZA 4R1TA 4CLRA 4QRHA 4B33A 4XSGA 1COWD 1Z0AA 2JJ1A 3UJBA 3CUVA 4REMA 3WRXA 4G0WA 2FWRA 2GAFA 2JJ2A 3TTSA 4PIPA 2E2WA 2Y3IA 2XBMA 3EVDA 1N2CB 1M67A 1VL1A 1FXWA 3GAZA 3ZCPA 1RP7A 3ENQA 4RF4A 6YASA 3MWYW 5KU7A 1HUQA 5DHTA 3U3DA 2NXWA 3LSYA 3H5TA 5AW9A 1VBNA 2A1TS 3R5HA 3WQRA 2HRQA 4BLVA 1OFUA 4DIKA 1W8DA 4K03A 1ISFA 1Q20A 1KI6B 2O0JA 4KODA 5DTRA 2D8MA 1NVDA 1OHHD 1OGIA 3AKCA 3KJFA 3EZ2A 4JSYA 1M34E 1XTZA 4R2KA 4RKFA 5CVEA 3HXLA 3CVXA 3VOBA 2OWKA 1TEVA 5AHWA 2JIRA 3V8NA 3ECCA 4ER5A 4GKBA 2WSSD 2BDUA 4FSDA 2PQMA 4LISA 5ALGA 1EFPA 4NAVA 4XSHA 3OZFA 3BKWA 1DCFA 3HCOA 3ELWA 2E4UA 4ZVRA 1XMXA 4PIVA 3CX7A 4Z6KA 4RXMA 5TX7A 2XYQA 3RJMA 3GLHE 5KQRA 1Y6JA 1PR2A 3AM1A 3NBAA 2R00C 1T3LA 2I6TA 4JZYA 5TVKA 6GPBA 1FDSA 1T8PA 1ZVVA 4R7GA 5I48A 3PQ4A 3PHCA 1PHRA 3EE6A 4J2HA 3RKUA 1R6VA 1XEXB 5JTTA 2ZT6A 1JJIA 1Z6TA 2VA8A 4DZTA 4FZ5A 5KU1A 3DVQX 1M5TA 1OWLA 3SDBA 4CIBA 4HGOA 4IZ6A 2XITA 2OHJA 3EFOB 3DZGA 3HSSA 3OWHA 4H6XA 2RHLA 7MHTA 1P3Y1 2J9GA 3M1YA 1GR1A 4AJNA 5JZBA 3B13B 4GYJA 5CNMA 4YCDA 3PSAA 2H8KA 5TDHA 1KZHA 1EP1B 1QYXA 1VPLA 4RA6B 3DO5A 2O8BA 5BN5B 1L1QA 4JLWA 4GOKA 3RBXA 3TW8B 3ZHBA 1N4AA 2L0XA 4C4OA 2QOEA 3G2PA 2QSUA 4YMWA 3CX8A 4PICA 4AS3A 5AM2A 1N3LA 1UL1X 3KOUA 5KQLA 1M34A 4OP2A 1PTJA 2VF5X 3DEHA 2BOVA 2J7PA 4X1IB 1Z37A 2PMWB 1PV1A 1NP6A 1ZAKA 2LD4A 1N2BA 2VFAA 1Q17A 3OQNA 5H9WA 1RTTA 1UBKS 4D3FA 4YK7A 1QKJA 2QM8A 3OTIA 4DB4A 3W06A 2HSGA 1EVZA 1XG5A 2EG5A 3RYTC 1LVUA 3DDCA 1TO2E 2J0VA 4GRDA 2DU8A 1Z06A 1M1YA 5JEEA 3EIHA 1P6UA 2JGDB 2PH5A 4OHVA 4M1OA 3R7NA 1IPHA 2BFCA 4PYRA 2JFHA 2J0QA 3T9EA 3LHSA 2HGSA 3U37A 1TRKA 3MZ0A 3VU1A 3W7BA 4PG5A 2ZI3A 4KP7A 4URYR 2XRFA 3GEPA 3NV7A 5HRCA 2VHYA 3UKJA 3OTQA 4DMUB 1XELA 1W88B 1EQ2A 3AR2A 4B4OA 3FIUA 3M5WA 4Q6BA 4PNPA 1SUEA 1EX1A 1ZNWA 5K8LA 4KPYA 5EZ6B 4GNKA 3OOSA 4P4TA 1H69A 3RVSA 5IDQA 3EAQA 4B43A 2OOSA 2I3ZA 3GLRA 4JBIA 4LZAA 1JAYA 3EW7A 1QCDA 3AU8A 5C3UA 2WFAA 3TCXB 5JY1A 1J06A 2CGEA 3N2NA 1JYEA 3ZG6A 2X2FA 5EQTA 1UFVA 4E14A 2QBYA 3PHHA 4X20B 1RI2A 4POOA 1LI4A 3H97A 3RC8A 1J5PA 4X5OA 1A8HA 4ZI2A 1DEHA 1GT6A 2C1ZA 3C8HA 3UT5B 2PRIA 4P82A 1JKFA 4PSDA 1AF7A 3MINB 3O1JC 4LGMA 3C0KA 3TUZC 1XZDA 1NZJA 1UQTA 4EUHA 3D4LA 1E4YA 1I2ZA 1CWUA 2ZYTX 4CI0B 1F4VA 1X7ZB 1E2IA 2WIBA 4X54A 1U3FA 4LGVA 3EGCA 2RDMA 4PG6A 3WZ2A 2NNWB 2X19A 1B7GO 2NNLD 2X0IA 2Y1FA 1KQGA 1BVHA 4J03A 1Z2CA 3ZDBA 4FFBA 3BGIA 3I62A 3I6BA 4GLFA 1UJNA 1A0OA 1KHTA 3KPUA 5KWEA 4GZ3A 3REFA 3SZUA 1C30B 2OCLA 2QJRA 4L4YA 2F3PA 2J07A 4H27A 2NACA 4IVRA 1PDVA 5BSRA 1U1FA 4PM4A 2B36A 4BLSA 2WR8A 4MKFA 3TMAA 5F9HA 3T5GA 3B60A 2C2YA 5KYNA 4EJMA 5TPZA 4OG2A 1AVTA 2E7ZA 4DSOA 1VGQA 2H7XA 3NWEA 2O1SA 4MV7A 4YRJA 1T91A 4D8YA 3G3EA 2YN4A 2GCIA 3IP9A 4Q4LA 1FTSA 4G5HA 5C34B 1UDAA 1I4OA 4L4RA 4BVAA 4EK9A 1R9NA 1YTLA 2UAGA 3DBLB 3MTQA 2IK8A 3MAAC 4FUTA 4KQIA 4PONA 3MILA 3PP8A 4NDZA 4Y7CA 2O3SA 2IEIA 4P33A 1L8QA 4C0WA 4DSUA 3CCBA 1LDNA 1YCGA 4JSTA 4TYMA 4WKNA 3GP3A 3TMYA 1DV1A 2WSLA 2HQRA 4F71A 5KYXB 1ZVQA 2XD4A 1QYDA 1XK7A 1C9JA 3LECA 3OE1A 3P19A 4QXAA 3H2GA 1YR7A 1VKHA 1UMCA 1R9JA 2CE7A 4OVKA 2GX6A 2PX4A 4MGIR 1R0XA 5JH7F 4DMCA 3AWIA 2HK9A 2NU9A 3V2HA 5BV0A 1O0BA 1USVA 4MQFA 4ZO8A 5ICGA 4AKHA 2ZR9A 5J4KA 3C14C 4Y2QA 4EH1A 3W5SA 1O0CA 8ADHA 10MHA 3I8SA 1K63A 3GNQA 1XWIA 4A73A 3QOXA 4N0DA 1RAIA 5JRJA 1VI6A 3HVJA 1U63A 1U2DC 2P75A 3DZDA 3QEAZ 4UFNA 5DZSA 4WDRA 5CDFA 2PK3A 2YMMA 3SXUB 5FD8A 1QGED 3PWSA 4UXHA 1RYNA 2O3RA 2PEYA 2QN9A 3H1GA 4B3RB 4TWJA 5AH0A 3AX6A 4LOLA 2YJ4A 4HQFA 5F9MA 2HT1A 1G21A 4R5MA 4RHXA 1SZCA 4AT1A 2Y6UA 1PEKE 4F5WA 1N2EA 3BRQA 3MVEA 3OFVA 3KEGA 3TUJC 1ELOA 2OUKA 1Y1LA 4X00A 2ZUCA 1YBVA 1BXGA 5ALOA 3UXMA 4Q21A 1WMDA 2C8VA 1EE9A 3M8KA 2Q2VA 1M83A 2FR8A 4LNUA 4FOLA 4PX9A 5FOUA 1T9GS 2X0FA 3VR4A 2QTBA 1L5LA 3A37A 4Y18A 1TQ8A 2EMRA 3OFKA 4RQUA 4ML3A 5F77A 5K3BA 2FFAA 3C3KA 5DLPA 3U0VA 3M83A 2V5AA 3HLKA 4QDZA 1U9YA 1NBAA 3NKVA 5DOZA 3RVLA 3TVYA 4AQDA 4BFWA 5B2FA 4MQ4A 4YMUA 3I3OA 3OMWA 4JJIA 2ZS8A 3AMVA 4RIEA 1M2HA 4BGDA 3ZE7A 3LQFA 1QPZA 1FXWF 3G0CA 3E22A 3S2EA 2DWPA 1G3UA 2Y1DA 4BC1A 4M0CA 5IT5A 2EWMA 3FPHA 3MWJA 1D8TA 4MB6A 1PFYA 4V0NA 2WMOB 4XSVA 2WJHA 1Y3HA 2H29A 1PSWA 3OZ7A 4GC5A 3M4JA 5LFAA 4HDKB 5K51A 1BSVA 3RSSA 3IP5A 4I9FA 3U9TA 3GLVA 3UZUA 3EEOA 3CUTA 4QSMA 4LVCA 1O3YA 2HV9A 1GAQA 1WU8A 1NW6A 4JLOA 5DIZA 3SR3A 3RWMB 3AUUA 2GZAA 1W5EA 4G1EB 3A4IA 3M81A 2R8OA 3W8FA 5AQEA 2G7ZA 2D2IA 2V74B 5ELLA 2XKAA 4NOJA 3FLBA 2QR2A 1APBA 5GZ6A 4W5WA 5FLEX 4XFKA 4N5MA 3EWIA 4JOSA 4KQXA 2WVJA 1AXEA 1A1VA 2H1SA 2UUBB 3EEIA 1PYOA 1ZUIA 1NN5A 3TQTA 5DOVA 2HQBA 5BN4A 1FNCA 1G0NA 4UDNA 4JVNA 3KFVA 4FOPA 3SAJA 4WBNB 1VZ3A 2FPPA 3QEKA 4FMCB 5AJXA 2HCJB 1NPDA 1OTYA 3QW4B 2PCHA 1G20A 2XVAA 4FVTA 2XMQA 1GSAA 1VSQA 2FLVA 2GPNA 4PX2A 3UKOA 1GNSA 1J25A 4QTXA 1MO6A 1J70A 2ZYSA 4KK4A 5E0KB 4P84A 3G5LA 4FZJA 3HDYA 5EJFA 5J9FA 1WP9A 1SUPA 4LJRA 3SYLA 4CCWA 1S01A 4RK0A 4AUMA 3WK8A 1V3VA 3M4YA 2VPWA 5FFNA 3C8UA 4BU0A 5IJ0B 3W04A 5DT9A 4GR4A 2RHTA 4EKEA 2X40A 2XDWA 3ELYA 4MVJP 1PGNA 1YQUA 2ZM5A 1MZPA 3IUMA 4LOAA 2G0TA 2M1ZA 4KGXA 1JR4A 1P2VA 2FW8A 3RUEA 5HOEA 5F3WB 1K88A 1HDOA 2WUDA 3L7LA 5JU6A 1W9MA 2W6JD 1NBMA 5AW2A 3C97A 3B7GA 1Y8ZA 4LN1A 1HG0A 4XFJA 2XZOA 2XB4A 1UC5B 2YWCA 2VJOA 1BYIA 2P4QA 5BN1A 1RLMA 2BEVA 3KWFA 1SA0B 1WUKS 1JSRA 2O2IA 3E3MA 1I6LA 3E5NA 4IIDA 3KAPA 4PYJA 3OETA 5EJ8A 5C4MA 1YQDA 1TT5A 1BVYF 3VZRA 2NZJA 1KI2A 1US8A 5DCWA 3U7IA 3NHSA 3KYCA 3LG2A 3G59A 5AIAA 5ALWA 1UCFA 1UFRA 5LZ5A 5ADWA 4NOKA 1T34A 1VLHA 1ID8A 2D1SA 3GOQA 3VI4B 3WNVA 2IBMA 2Z8XA 5EZSA 1GFSA 1VG0B 4BZQA 2BE7A 2DUUA 3TTTA 5KNCH 2BISA 1JTEA 3N2YA 4HWRA 3M9XA 2PSDA 1E5XA 1V6CA 1T9HA 3STVA 3ZLJA 2BE9A 3V48A 2R1ZA 3Q5DA 5GMOA 1EK6A 2DFKB 2PGAA 3UANA 4B9AA 5B1DA 1PT9A 3TAUA 1PDWA 1ZFNA 4GPAA 1UPBA 1RQPA 1WXDA 4JGGA 1T8YA 1YVDA 4RD4A 5CPBA 4YUVA 2I4RA 3SSAA 3BB4A 2YKGA 5AVVA 3UMYA 2UUCB 2VXBA 3OQ1A 1ONNA 1AE1A 5FFFA 3EW9A 3W5UA 3NUZA 4FW9A 3YASA 4HCJA 1Z8FA 2Q1TA 2QTNA 4RW0A 4Q7MB 2GRAA 1HX7A 2CDBA 3VU0A 1EGVB 3IEPA 4JBWA 5BW4A 2ANBA 1QIHA 2XVXA 4Y2PA 4Y2RA 5EUBA 2YWRA 4DNPA 2FW6A 3IEXA 3RYHA 2ECPA 3ZU4A 3THSA 5LNK1 1H23A 1GKLA 3GQBA 2XAUA 3KV3O 5E9AA 3JQRA 4WNCA 5EZ5A 5CVVA 4WY5A 4LCJA 4ABYA 5C5IA 4ZAZA 4BO6A 1HWYA 1QG2A 1WY5A 1HEYA 3KQWA 3HHEA 3QKWA 3LKVA 3PQFA 1CY1A 4PWZA 1R64A 1UZNA 3BWDD 3ZWOA 2JFZA 3TOVA 1KOGA 4B17A 2WHPA 4LWPA 4BUZA 3ZQJA 3PJRA 1L7XA 5E8JA 3WWPA 1DLJA 1PZHA 1LB1B 1AUQA 5E4TA 3AR5A 1SHTX 2GBLA 1XDGA 2XB8A 3K0KA 2DUNA 5DSTA 3VYUB 4JYPA 4CM8B 1U4NA 4RFVA 4BCDA 3CXUA 4LRQA 1H5UA 4B45A 4CMJA 5EIWA 1MB3A 2PUAA 1KQ3A 2K6GA 1E18A 4Q9IA 4WDQA 3BS4A 2QBUA 3SK0A 3V9PA 3OX1A 4DMHA 5JDIA 3RE1A 3K4HA 3NBKA 4QEZA 3CBQA 1J2UA 3TX2A 3OLCX 1KVUA 4LI0A 1ECCA 2WYHA 4PXYA 3VKWA 2H1RA 4EG8A 2JFXA 2XNDA 5B36A 3WGJA 3E7WA 4N5IX 1GA6A 4JJGA 2QTTA 3GOHA 3EWSA 1G6KA 4HRXA 2C94A 4I08A 2R48A 4FI3C 4NPCA 2QGZA 4MKRA 3DBRA 3TW0A 4DQXA 4F8YA 3F3SA 4M8IA 4LJ8A 2WIFA 2QQGA 1KORA 4ZQGA 1DTSA 4MYCA 1K5HA 4ZZ3A 1RWQA 2Q45A 4KIUA 5FWAA 3IKMB 2PHZA 4Q9HA 1P2UA 2X1LA 4HGYA 3H4IA 4ESOA 3OEWA 3WP0A 1BU5A 1V8DA 3HYTA 2AKEA 4MRNA 1WCXA 1TEHA 3CIOA 2J09A 4KVAA 2X8JA 4LVNA 5DO9A 1L4HA 4U8GA 1TMOA 3NEIA 2J3QA 1MIOA 2BHSA 4DY4A 2N1BA 1IN5A 1OA1A 3FVVA 4RM2A 1R18A 5D3QA 2R3SA 2B6HA 2DG2A 2G5TA 4B47A 3ZD8A 4FMBB 5DHAA 5A4IS 4OHXA 3FTFA 1NNEA 2CL7X 3IUNA 1BIFA 1KDVA 2Q0SA 2WZDA 1QYRA 2VHXA 4UU7A 3TQRA 3UY4A 1B15A 2BIFA 4OKSA 4TRMA 3AUAA 3W8RA 1TA9A 1NRWA 1WPRA 1FVHA 4QTTB 3VNRA 2IRWA 3TUIC 2LCFA 1ULBA 4QT0A 1YJCA 5FI3A 1EUZA 1BH2A 1QANA 3IHWA 4ZVSA 1KAEA 1OH7A 5AXBA 1Y4DE 2QVLA 1R0ZA 5HIAA 1R0RE 4JXJA 1GWNA 1ULUA 4OFZA 4X71A 2RGDA 3COZA 4CG1A 3FWZA 4JN6B 4PYLA 2YJNA 4G63A 2HSZA 2ZB8A 3RK4A 2C42A 3AIIA 1XMSA 5LDHA 1WBDA 2F90A 2IOQA 2WT8A 3GN2A 3O91A 2O0MA 4Q1FA 1UXHA 3DFUA 2G25A 3ML1A 1K4YA 2CXPA 2N9UA 3E1SA 4R2HA 2NU9B 4OGKA 2V0NA 4FR0A 2BZSA 4MV6A 1X7GA 2GEKA 4QOHA 4G1CA 1C3OB 1KI8A 4MULA 4PZ9A 5FUXA 1IY1A 4GKVA 2X8WA 4RA9A 2ZJ2A 4Z86A 1L4EA 2DV7A 2FG7C 2PL5A 3TZHA 2EQAA 2RBGA 3HNPA 4DCGA 2FEKA 2EJBA 2X8AA 1B6RA 3A1NA 2J9ZB 3L8ZA 4NU5A 2R68A 4CM4B 1IL0A 4HB0A 3T5AA 2P6KA 2F48A 3E27A 1SOMA 1DT5A 1Z5NA 3IQXA 5JE8A 5L40A 3MMXA 2BAGA 2X7JA 1Y5NA 2VTEA 1NUSA 1OT3A 3BGOS 4LSWA 4L78A 5A4DA 2LZ0A 2D4AA 3IAM6 2VUHB 3BSWA 4F93B 4U7DA 1OA0A 4MA5A 1TA4A 1X1CA 4FT4A 3D8TA 1Q95A 1U2QA 3GLHA 1DTWA 1TA0A 2QI9C 5TEWA 4DQVA 4XEUA 2RGUA 2BW0A 3AJAA 3DMFA 5JSZA 1XLVA 4J91A 3G2IA 1AN0A 1TVKB 1TX4B 3F96A 2WU0A 3AQ4A 1G1MA 1XP8A 2X42A 4FFRA 2WYVA 3NCTA 4LY0A 4RFSB 4W5NA 3RKSA 121PA 1REQB 2VRBA 2ZWAA 4N6GA 1OX4B 4HDNA 1W48A 4WEOA 1C2TA 2PKQO 4IHJB 3SBEA 2I8LA 3REQA 3UTDA 4BB5A 2Q4BA 5FJJA 4FI3F 1R12A 2GFIA 3IAS6 1N1MA 1AIPA 3STUA 5ICFA 1SB9A 3VPAA 4GM0A 3W7VA 1GA1A 1P0CA 3PE3A 2GUWA 1BD4A 4J9UE 1VCHA 5A06A 1BS9A 1ECBA 4MIKA 2PPLA 5CM9C 5D7NA 4YRZA 4FJ1A 4RSHA 1F14A 1IEWA 2I22A 3D6UA 4FQ8A 3GQVA 3R0XA 1LK7A 3JD3A 4O1MA 4EWLA 5C8YB 4DA8A 4Z54A 3NOQA 4YMSA 5FT9A 3BTSA 4XGRA 1I7NA 3UT5A 3CEPB 4W8GA 3NI2A 4U7PB 1IOLA 1ST2A 2WM8A 4RMGA 2EGUA 4FZRA 1M8KA 5D1HA 3V1MA 3KD3A 4TRRA 1FUUA 5DCYA 3PUHA 1RABA 3M6XA 2KJQA 4ESVA 2QVXX 3D4NA 2OYSA 4YJ2F 1FRNA 4X1YA 4D8UA 4XUEA 1WCIA 1I7DA 3U7FB 1QG6A 4DSTA 1KZGB 1PD0A 3I6QA 4H7FA 4MJLA 3F5QA 4MO2A 1JMKC 2DTEA 4ND5A 1A9YA 4KN5A 2ZJ6A 1D5CA 1I0IA 1TQHA 4MDFA 3VKGA 1B1CA 4QPPA 2VBIA 4R8LA 2HBQA 4KR0A 1ZCJA 3JQAA 4H7PA 2YZKA 3U4IA 2X3FA 1LD3A 1WUIS 4HWPA 5HCNA 4C6SA 1N92A 3DB2A 2JG3A 3ZDXB 2P40A 1LU9A 3W5BA 1DJLA 5IAJA 2DQKA 9GPBA 4S1OA 1QVRA 2IXAA 5EP1A 3TAHA 1RWPA 4LRSB 4A23A 5KOJB 2YC2C 2X6QA 3A4VA 3BRWD 2AK2A 2X3UA 3P2YA 4HH4A 3G2JA 3BXOA 1FP2A 1FVOA 3HRHA 4QJBA 1Z3CA 4JHXA 3U6BA 3DB1A 2GXSA 3H9GA 3NIBA 4IOMA 1I14A 2X23A 2ZE8A 3I01M 4KMRA 4AFNA 5AVSA 4LZZA 2R2AA 2PY6A 5HMMA 1QV9A 2QWXA 2IW1A 3L9WA 3N39C 4X62B 3UUEA 3O8BA 3ED5A 3EUWA 1VYHA 4XW2A 2J9XB 4EFKA 3WGGA 2GCGA 4HF7A 3ETLA 2NLOA 3WIBA 3M2TA 2HSWA 2F43A 3A6LA 1KZ9A 4XVHA 5L6MB 4J90A 2GETA 3JYNA 3UATA 4EKYA 3WXMA 1S02A 5CB0A 3G8DA 3EARA 3KB8A 1AS3A 2GZ1A 4Y0VA 1HLFA 2QTAA 3GDGA 4E2FA 4YTEA 1EJ6A 3HTXA 1WBJB 1W1IA 3DM9B 3G13A 1IOWA 1LPAB 3O4JA 5FBWB 4EFLA 4JI2B 4L51A 2Q4EA 5F33A 3BAZA 3I2IA 3QU2A 1HPLA 3Q3GE 4HN9A 4JB8A 5JATA 2OUIA 3IMCA 5AVOA 2YRFA 2PWYA 4C1NA 3ZNOA 2X6TA 2I76A 1WB5A 1KPGA 4M1TA 3A9SA 3K6SA 3DLBA 1RQXA 2H3EA 3CF2A 1C9NA 3F1LA 5J59A 5HRAA 1AQLA 1JLSA 5KC8A 3TSCA 1WOMA 4Z0PA 4OXYA 2FHPA 4URXR 3ZV4A 3RRNA 4YT5A 3A2NA 2ZWOA 3PC6A 4NJMB 3DE3X 1JLLA 4XGIA 4AL4A 2RH8A 3CUEF 2XQGA 2CMFA 3GEHA 4V0MA 4XYEA 4M0KA 4CCSA 1GVNB 2XCOA 1L4YA 1S6YA 1GCIA 2BR3A 3ACCA 3JWIA 3Q15C 4IFTA 5F78A 4BNTA 4YPOA 3VOAA 3U09A 3IV6A 3BH0A 4B40A 2JJQA 3VDRA 3E9CA 5LMNB 4G8CA 2AXPA 3RGGA 1ZH4A 1HBJA 3T5BA 1G4UR 1S2DA 3TZCA 2D3TA 2VP6A 1ZU5A 3H4VA 1G8PA 3HUFA 4UZFA 1X7YA 4ZVNA 3L2OB 1PZEA 3AYZB 5A0VA 1WXHA 3QJYA 1MPTA 2Q21A 2IS2A 3DBRB 2WOOA 3GPIA 2FU5C 1RIFA 4OYYA 3TJZA 1ZEMA 3FGZA 4RVCA 4ZALA 3Q3IA 3E0QA 1J8VA 1Q1EA 2QRUA 2ZXEA 3DR5A 4MLCA 2OBMA 4RPCA 2BGMA 1B74A 4GKJB 1P8JA 1VYTA 1VRVA 4OQ4A 4H7EA 3L77A 3GJRA 3M7IA 3KLBA 3SZLA 5C9ZA 1T3GA 4JLBA 5JZVA 4ZI5A 3JD1A 3QLVA 2B5WA 2IC5A 3H2ZA 4YWHA 1IHXA 2A0FA 4AN4A 1IJEA 4IFBA 1C8VB 1TI7A 3KFLA 3DMTA 4FWBA 1U8AA 4OHCA 2FDCA 5B5SA 1JQDA 4OLAA 3P9XA 1PF7E 3STYA 2LV8A 4MV4A 5T67A 4E1VA 2ORYA 1G7TA 3SZ3A 3ZDYB 3ACBA 3BJRA 1C9KA 1FA9A 1RVV1 1W88A 4FFWA 5EP2A 1WQ4A 4MWZA 3PGJA 3IVCA 4O4HB 5G40A 4F5DA 3N5KA 2X9VA 1S8FA 4KXMA 1UPTA 2VATA 3B9PA 2R6R1 2YZMA 1N6PA 2ZANA 1CE8B 2ZIGA 1NJ5A 4HADA 4ID3A 4YAUA 5CITA 4O4JA 4KXNA 5CLGA 2GR9A 4ZXPA 4RK1A 5KB3A 4M86A 2JGDA 3MUFA 2ARKA 3KOXA 5K0CA 2OESA 4YP9A 3WDSA 4PYOA 3IH5A 2E87A 3D7KA 3OF2A 4GEKA 5J2TA 3IA7A 4V2UA 4B87A 1RS0A 5IFKA 4J16A 4IVQA 4UTVA 2A5DA 1LLUA 1RWVA 2HMSA 2YWEA 4AJHA 3SVLA 3T1QA 1F0YA 1OV6A 1T1IA 4DGQA 3PUYA 3NEYA 2CNBA 2XUIA 1QQ5A 4JQCA 5TPWB 2HHLA 1KU0A 3H11A 3HDGA 2Q5OA 1IE3A 4BP9A 3ESBA 4Q82A 2F9FA 2LKCA 4B3DA 1TAQA 1K98A 2JRCA 4Q24A 4TM7A 3LNTA 4KYIB 3T7IA 3DOFA 3L7DA 4PZUA 1DO2A 1Z3IX 2VRCD 1V4BA 3BDIA 5BN5A 3OECA 3FPCA 4PYMA 2G80A 4O1HA 1NVKA 3JX9A 5FOVA 3W1EA 1DXHA 1H3NA 1ACMA 1YKSA 2GN6A 3CLUC 1KFCB 5LP6F 4J0IA 4BLUA 3H5VA 4ZV4A 5CFOA 2MSDB 1YH3A 4G2TA 3AEUB 4KGVA 1T13A 3IUYA 3TH5A 4AJPA 5JNWA 1MT0A 3A1DA 4AUNA 1AHIA 1UMBA 4INPA 2YYAA 2GBIA 1JAHA 2E85A 3K32A 2HQ1A 3QX3A 2HMVA 2NVUA 3DNFA 2VHZA 1NASA 4PGFA 3VFDA 3LPLA 3K73O 5BRJA 4D43A 4EB8A 5PNTA 2P9YA 3PJFA 4OHFA 3M82A 5DNYB 5L8VA 5BSHA 1E20A 1W2WB 4O2BA 4PLPA 2KS6A 2GRJA 4M36A 2DY1A 3AL3A 2GPWA 2QRVB 1XXHB 2WFLB 3ON5A 4MYHA 3GXOA 4NH4A 5A02A 5GIPE 2I78A 5AK4A 5B1EA 3CPHA 4YRIA 1PZNA 4L2IB 4B7CA 5JALA 5HEKA 2AVNA 4BN4A 2IXTA 4I5EA 3ASZA 2F9LA 3PQ2A 5KTYA 1OMOA 1LW7A 1PGOA 2ZREA 1ZW1A 4MCIA 4N6NA 3QE4A 2IU3A 2FTKE 4ARZA 4ZEXA 2H4HA 3ZZUA 1E3SA 1B6SA 5ALYA 4JELA 4KKXB 4F6RA 5E9WA 2FNAA 2ZWIA 4TT8A 5FA5A 1JX6A 1QH9A 4CGYA 3OFNA 3VHRA 4A4DA 2ZUBA 2W93A 4CV1A 2E0IA 5GADl 3BXHA 3MOGA 1IM8A 1Y8QB 1MOZA 2B35A 3AI3A 2AIRA 1IY0A 1FMLA 4U39A 3KKNA 3KSBC 2BFWA 1NIPA 4RABA 2GK3A 4BX0A 1YC5A 3TR5A 3BFXA 2HNBA 3PDIB 3ZHSA 3M6VA 3K15A 2X7XA 1O96B 3W4KA 1TCVA 1U7TA 3COPA 4DOMA 2J9FB 1NRIA 3MLAA 3PX3A 4XTCS 3RS0A 3K71B 1VPDA 3LQRA 1Q0UA 3WK4A 4AMZA 2H57A 2WG2A 3KJZA 3H9QA 1DSSG 4OMCA 1FFXA 3RVNA 4KQEA 2P5CA 3AY6A 1Y7IA 2W9XA 3CLRD 4RUKA 2G5PA 1J2TA 2XMSA 3TNDA 4OAPA 5J47A 3UENA 5JDCA 3ER8A 5ARCA 3Q7QA 3RNLA 1W35A 1A8IA 3NC4A 2X77A 4M9RA 2H08A 4IRMA 1C9MA 4FOOA 4NECA 4PU0A 4QC2A 4UNSA 5AKJA 4QREA 5ALMA 2ONJA 1QVZA 3HB1A 1P5RA 3THYB 2HFJA 1E1QA 4Q7JB 1K6MA 2RHMA 3ESCA 3PTAA 1UFKA 4BB9A 4EJSA 4O33A 3A2MA 5ITWA 1FSZA 5JFGA 3QE9Y 5JPIA 2QS9A 3IHKA 3AZQA 5L6LB 3A04A 1N2SA 3BCHA 2BLLA 4G8JA 1QQBA 4OQLA 2OCIA 4PYQA 1QV6A 4I3HA 3ZQKA 1IB0A 1I6KA 5K0EA 4G9GA 4QPNA 5DSZA 4NNJA 5B3KA 2OHGA 1PJRA 2I2FA 4MVCA 2WHYA 2LNDA 2ST1A 3ZVMA 2AN5A 2MR5A 1E4EB 1VP9A 2QZSA 3TQSA 4QUIA 4BZWA 3PQCA 3A1EA 3OQIA 2A0XA 3WICA 2CLCX 3FA2A 3BD8A 4YHBA 5IXYA 3QBJA 3OQVA 1EFCA 1C0IA 1GQQA 1GT91 2OGWA 3DSRA 3IPLA 3MFQA 4YBRA 4A3SA 4BNHA 3PEEA 2BSQA 2HTEA 3WLNA 4F5ZA 5BSVA 2KW5A 2ZRDA 2O20A 2J8ZA 3OICA 3T1TA 2RGYA 1E9SA 3AERB 3AFHA 1RBZA 3NEPX 3OFND 4NNPA 1WO8A 2FFQA 3P8ZA 4FK8A 2AR7A 5H59A 5JI2E 5HK9A 1EIWA 4DM4A 4W9RA 2Z8YA 4R8SA 5IAAA 2D13A 2R25B 5IX8A 2Z6QA 3DBVO 3U0BA 2VPZA 3KHSA 4D97A 4XDZA 3I4CA 1PYGA 2GM3A 1IXKA 2W2KB 2XUAA 2Y76A 3PSHA 5AKKA 4BMOB 2WTMA 1A88A 1NBWB 2GMWA 3FPSA 5JSYA 3RJ5A 3VNQA 2O1XA 2ORVA 2ZJBA 1CRLA 1XWFA 1X1EA 1W46A 2C9ZA 4ND1A 3QVTA 3D5TA 3SBDA 3QVGA 4OH1A 5KPDA 4JODA 3S4YA 2EL0A 4JROA 5CTAA 4B5KA 5HM6A 1WU7A 2H5LA 1E3QA 4R9RA 4MUMA 1Q2UA 3HJBA 1UBNA 1OH8A 1XQ6A 3K2BA 3G9QA 3HXOA 1HDEA 1DAGA 3EVCA 2X1MA 3KZVA 2AJBA 5BNIA 2VT6A 3CG0A 3GN1A 3WQQA 4ZQHA 4D3SA 4IWNA 2IUFA 2YICA 1CUFA 1AKEA 1T2AA 1U8TA 1R8QA 2G40A 3IJPA 4GWGA 5LMUB 2D2EA 3EPPA 3OT4A 5C3MA 4JBNA 1OLSB 4HGNA 4MS4A 2XXJA 3PUWA 2WJGA 3ZBTA 4WESA 3I45A 3VTZA 4J7UA 3GLFB 2BGTA 3RYFB 1S5PA 1GEGA 1KOLA 3EG9B 1IBRA 5EHNA 3VZSA 2BB3A 3C4JA 3GFFA 4IKOA 1LLDA 2J1LA 4BVLA 1Q7RA 2RAFA 2BGLA 3L7YA 4P5EA 3UV7A 2PB4A 2SICE 3R0ZA 1GL7A 3SZMA 1MDBA 5E9JA 3B6MA 3M89A 1O6CA 5EWJA 3LE8A 2P79A 3OJOA 5I7FA 2J5KA 3K6KA 5KJCA 1VCEA 5FTJA 4RXTA 1PT6A 4LYDA 3LUAA 4YCSA 5DV9A 4TKVA 1F6WA 2AW3A 4Z3DA 3CRVA 4RMIA 3WYAA 3TNYA 1T1EA 1K0UA 1JYSA 8LDHA 2X5JO 1E2MA 1EXDA 5FL7D 1Y8RB 3CLRC 1EGHA 4UBIA 4MUFA 4B6QA 1SKQA 2I65A 2VUSA 3A9WA 3FRJA 3S2ZA 4KAJA 4PCUA 2QGNA 1L1EA 4UHFA 4J3NA 1C30A 3IODA 4BE7B 1GPBA 1KI1A 4U2DA