3DNFA

Structure of (e)-4-hydroxy-3-methyl-but-2-enyl diphosphate reductase, the terminal enzyme of the non-mevalonate pathway
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
b'MVDIIIAEHAGFCFGVKRAVKLAEESLKESQGKVYTLGPIIHNPQEVNRLKNLGVFPSQGEEFKEGDTVIIRSHGIPPEKEEALRKKGLKVIDATCPYVKAVHEAVCQLTREGYFVVLVGEKNHPEVIGTLGYLRACNGKGIVVETLEDIGEALKHERVGIVAQTTQNEEFFKEVVGEIALWVKEVKVINTICNATSLRQESVKKLAPEVDVMIIIGGKNSGNTRRLYYISKELNPNTYHIETAEELQPEWFRGVKRVGISAGASTPDWIIEQVKSRIQEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-enyl diphosphate reductase
publication title Structure of (E)-4-Hydroxy-3-methyl-but-2-enyl Diphosphate Reductase, the Terminal Enzyme of the Non-Mevalonate Pathway.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Oxidoreductase
total genus 102
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 1.17.7.4: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase.
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02401 LYTB LytB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11270 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dnfA02
3.40.1010.20 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; domain 1 3dnfA01
3.40.1010.20 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; domain 1 3dnfA03
4N7BA 3SZUA 3KEMA 3KE8A 3T0GA 4H4EA 3SZOA 4MUYA 4EB3A 3UV7A 3KE9A 3ZGNA 3DNFA 3ZGLA 4MV0A 3UWMA 3KELA 3UTDA 4H4DA 3UV6A 3UTCA 4MUXA 4MV5A 3UV3A 3KEFA 3F7TA 4H4CA 3T0FA 3URKA 3SZLA
chains in the Genus database with same CATH superfamily
4HRYA 4TLEA 1U6KA 4YWJA 4YRNA 3HN7A 1IIBA 2PTHA 4ZGWA 2F59A 2Q07A 4IHJA 2BELA 4TV8F 4TXNA 4EZIA 1FIUA 4B09A 4G0MA 3DQPA 1XL0A 1IK6A 1Y7HA 2WJPA 2O05A 1I6WA 4MS3A 4PW0A 2DECA 4R69A 2WJWA 5JARA 2DBQA 3S6JA 2BTQB 2GKGA 2UZAA 1MV8A 2YXNA 3WFIA 1GRVA 4ZCIA 3LWBA 2QD1A 4KE6A 5A4DA 2QQEA 1T9DA 1E3QA 1DE0A 4RD2A 4AS1A 5BSEA 4YROA 3NTUA 3BL6A 3AUYA 3M33A 3IQDB 5EUCA 3V00A 3MJEA 2MR6A 4WK6A 2FDCA 2HCFA 4MIEA 1NW9B 1BX1A 3DXXA 4GMXA 1KDVA 1JQAA 3SEQA 3GN1A 2VUIB 3MA0A 3R0VA 4NG5A 5DVZA 5H9VA 3ZDXB 4DDUA 1LBSA 2UZ1B 3K5IA 4K28A 4C5BA 4LF6B 1IQPA 2OC9A 5E4FA 2VUSA 1I6KA 5FBVB 2WF6A 3R74A 4CQLA 1SCAA 3RUIA 2WK1A 3SIWA 1YWGO 2DTDA 2DX7A 3OZCA 1KI6A 3R9IA 1VCNA 3V3KA 4B7XA 2JFPA 1A71A 3AESA 3V2HA 3PC2A 4EUHA 1PSZA 4C5AA 1A5ZA 5DN9A 4FXPA 5T7BA 3FOCA 1EFUA 1NG1A 2PLWA 1GZ6A 2P5FA 2PGXA 2JZNA 3WYFA 3R5JA 1PVVA 3PQ5A 1EDZA 1NP3A 1NBME 2GNAA 2Z6UA 1JXOA 3AGQA 1JHUA 5FF9A 1F2UB 4MVYA 3JQAA 4RK1A 3WJ1A 3SAJA 3EDCA 1U63A 4M1YA 2PBFA 2JASA 1LDBA 1CR1A 4UFOA 2VHWA 4MMXB 3DTVD 4KK4A 1ISGA 1E94E 2CLFB 3NDRA 5F51A 5TPZD 3UWSA 2A7QA 4DCVA 4DIEA 3EGCA 4EB6A 4QGSA 3T1TA 3GLIB 5LD2C 4FINA 5ECWA 5JY6A 3KSDO 5C1PA 2PK3A 3OFKA 3IAHA 4M1OA 4R7TA 3EN0A 5B4UA 1XVUA 3KT3A 3A9RA 1RDFA 3TX2A 3QVKA 3EDYA 3W34A 3FTFA 4Z8YA 1KIAA 3OJXA 4PAOA 4G0YA 3TNDA 3EXIA 1O77A 3NNDA 3EPPA 1PW5A 1N6OA 1RYZA 2CNLA 3HB4X 3HDHA 4HDNB 5BO5A 4BMCA 3EVTA 1WPXA 3RASA 4O4IB 3HGQA 1SIBE 3SHQA 2X0KA 3IFSA 5BSFA 3NHLA 1XJ5A 1M1YB 4K8OA 3AY3A 3QKTA 3ZWXA 4ALMA 3THXA 3CH5A 3ZGZA 4GX0A 2QLJA 3UXYA 1QZXA 3AL0C 3STXA 2NZYA 3C5EA 1UBKS 3NXSA 4CLHA 4BP8A 3PJRA 2FEOA 4UCXA 2O8FB 2C9YA 4BASA 3S7TA 5LIRA 5IHXA 5KX5B 2PWYA 4F46A 3QKSA 2CUKA 3CRRA 2GESA 3LY7A 4IHAA 4KW7A 1WO8A 2HOQA 3N6VA 2DWPA 1NBIA 3HLTA 1TQHA 1CUFA 2I3DA 1GUAA 4MYSA 2WFMA 4AICA 3E4CA 4P2GA 3UAXA 1T4CA 2I34A 4N3NA 3CLRD 1M1NB 4DHEA 4QJBA 4UVEA 1R4MB 2PT5A 3EGXA 2QLTA 3WGZA 1PL6A 2R47A 2YNMD 4WFJA 4BGIA 1M76A 3L46A 5EMJA 2Q8NA 4RW0A 1KZ4A 1R0SA 1I4OA 1XD9A 3L7CA 2ZBUA 4G6ZA 3WXBA 1NV9A 3TSCA 3BHJA 1GFZA 1TJ3A 3GELA 4XUCA 3IBYA 1N2IA 5D84A 1YB1A 4LNUA 1CERA 3A9UA 4EB3A 2UVPB 3NEJA 2A0KA 1RMQA 1GZVA 4RJIA 1UKZA 3UOGA 1FSZA 2A78A 1EFRA 5HKAA 1BH2A 4REMA 4RMGA 1P9RA 1VP3A 2CJXA 3BCHA 1PP4A 4HN4B 2BGNA 5FWNA 5JATA 2K4MA 3UJDA 3PRJA 4IHQA 1V25A 5K0JA 1ZNXA 2PV0A 3FFXA 4BB9A 4L07A 4EW2A 1DARA 4FKZA 2IDMA 1JR2A 1N25A 3A4LA 2QTLA 3U7HB 3ZD8A 2DE0X 1HQCA 1NXTA 4B8ZA 1E2FA 2E82A 2YR0A 2JVKA 2A6PA 4JI7B 3URMA 4OBXA 2Z2KA 5BSHA 1AQJA 1D1QA 3H9UA 4RPJA 4RK4A 1Z2NX 3LXXA 2QL7A 1G8AA 4GMDA 4RWEA 2H2WA 4IQ4A 4WN3A 4LZZA 2A94A 4REQA 1J09A 1CQXA 1GV1A 1NMXA 1V37A 3IC5A 5E0KB 3TRHA 3VGJA 4CIWA 4TYMA 4V3BA 3E9MA 4W9NA 4MUXA 4RMIA 2J32A 3B5IA 1XZNA 2HT6A 3MJ4A 4AI6A 2HUXA 2ZVBA 5BNZA 1WB4A 3P7MA 4EHAA 3TTWA 1TEVA 4TZ6A 4HHEA 2C2MA 4P4SB 4REOA 5CR9A 4F45A 4EYEA 1CXZA 1F3OA 2CCKA 1PJBA 1ZGGA 4Q3OA 2O5RA 5D3MA 1XTPA 2QX6A 2FETA 1UL1X 2AC2A 2MU1A 2X0NA 3BWMA 4FFNA 3D6TB 1E1RA 3ORHA 3BH0A 3K35A 1L5NA 1Z47A 2XYQA 3TOXA 2DTXA 2P5CA 1RTTA 1PGQA 2BZGA 4MS1B 4F5EA 4L08A 4ZI5A 3GT0A 1PZHA 1M2EA 3MINA 4I4TB 2VCYA 3HO6A 2K7FA 2OHOA 1U0OC 1ZVKA 4G84A 2WD7A 4QFCA 3ZLJA 1T5LA 1X86B 2CMHA 1W88B 3Q7SA 5C4GB 4TYNA 3WISA 4ZDKA 3TX6A 1UJ4A 3C3JA 4PLWA 5M3BA 3SF8A 1FW6A 3HEMA 1AMNA 1ODIA 3KZKA 2QYSA 3L43A 3GJSA 3NBAA 1GGKA 2V45A 5DRTA 2B20A 3AM3A 3IQXA 5DT2A 5IBRA 2P3QA 2VH2A 2L0XA 2YW2A 5AICA 3AV3A 3GY0A 3OJFA 1X1SA 1TF2A 2VAVA 4KNVA 3TWOA 1NE7A 2P6IA 3UB4A 4Q21A 4EMTA 3UW1A 4P0PB 4M8IA 1T5IA 3K0AA 4F1WA 2I22A 1C8VB 1AHPA 4HAIA 3TIXB 4U7DA 4TRJA 4IDOA 2ID7A 2J3QA 4Q9KA 4HZUB 3PNVA 4EL5A 2R62A 2WIKA 4KTVE 4ETMA 5HG0A 3QBDA 4S0ZA 1GT91 3DGEC 4A2CA 4C0BA 3ZW8A 3B7GA 3MB8A 1DJNA 3CJTA 1ZGJA 1L7NA 2X15A 2CYAA 1U0LA 1ABBA 2WJJA 3IAS1 5EPEA 4H31A 1OJ7A 3DTNA 3AVYA 1SIUA 2HJ9A 3RHSA 1EUCA 3KKQA 3P71T 4Z1MA 3WYGA 1LKZA 2R7LA 4B3XA 1T2DA 4NZZA 4E5DA 5AVJA 3ODPA 4CNBA 1HOXA 1PZMA 3OLZA 3TQCA 3R2JA 2DKOA 3I05A 1TO1E 2O07A 2WIJA 4IH9A 4LVUA 5FBKA 1SMKA 3CONA 1KOJA 1YE5A 4MQEA 4CV0A 1B6RA 1OFGA 2NZXA 4HLUA 3VTZA 3FGOA 1S1MA 4MV4A 1U5BB 1KDTA 4FQ7A 1R0XA 2RI6A 3PYLA 4Z49A 1T0PA 1WXWA 4MP3A 3RC3A 5DBEX 4C01A 3CVWA 2MSLA 2EKPA 4JOSA 1DJQA 4KYTA 4DVGA 4RBNA 4PN3A 3FPHA 4H7PA 2W2KB 1XK7A 2CJPA 3VAYA 5K4HA 3NMUF 3WLEA 3W8FA 1SVKA 3WWEA 4AP9A 5IAEA 4YJ3A 3AUTA 3BDVA 2G7MC 4I7EA 5KYNA 2FWAA 1O96B 2HMUA 4KDRA 4MRPA 4TXLA 4YT4A 3G0HA 3V1TC 2X8AA 1Y8QB 3MS7A 4HGZA 1ODTC 1Y37A 3AOGA 4RM2A 4AG5A 1Z37A 2JLZA 2OV3A 3PHCA 2UYOA 2IF0A 4JFAA 4X64B 2EQBA 3ILHA 1XQWA 5HDQA 2EKBA 1OC4A 1IL0A 3WGUA 4C4OA 4M1KA 2QU8A 4JCCA 1THGA 1J8FA 1JPVA 2OCBA 3EQ2A 3EXG2 1D2EA 1NMEA 2V54A 1VBMA 2O52A 3ZXSA 1OB2A 1ISIA 1CUAA 4U00A 3WZMA 4MSUA 1YCFA 1ZLYA 2JW5A 4OATA 3JY6A 4JT4A 4ZFNA 1GZ5A 2WUVA 4YO7A 1CUYA 3TMAA 1N3IA 1USKA 1KPGA 1ODSA 2PZ8A 1EZ1A 4KZKA 3RTBA 4ENUA 3ELYA 3D43A 4LC0A 4J3JA 4MGHA 4WACA 5DM1A 4B87A 4MRVA 2PT7A 4C0LA 4MKFA 3TZEA 4WCVA 3UTCA 2W00A 2BVNA 3LLUA 3NOXA 2O0MA 4GZLA 4URUR 1NNLA 3NKLA 1PZNA 4EJSB 2CXQA 1I1HA 2BUBA 3DV2A 4YBRA 4BAGA 3BJRA 3RT1A 4MCHA 2OY0A 1RZRD 1DIBA 3DFFA 1SVMA 5EP2A 2RIPA 3KKEA 2V3VA 2RHTA 4MEJA 1NJ2A 1U31A 1JKMA 2QXTA 2BZ0A 3EG5A 3DLIA 1R8JA 1MD9A 3I6MA 3MBIA 1SXJE 5DI3A 4K1LA 4HB4A 2L42A 2X4IA 3UICA 4KHZA 2PXXA 2SECE 2CJWA 3HH8A 3FKQA 2R25B 2Z5VA 2ZE6A 2GARA 1PJSA 1LEHA 2X8BA 4KL8S 1L4YA 4N47A 1X7WA 2IUEA 2ZRKA 3N3BC 4TL9A 3IEUA 4U3JB 5D2CA 3I28A 4YR9A 1EWYA 1QWOA 1T43A 1YR6A 2GTHA 3E8SA 5FOXA 2HU7A 3WGLA 3SJCA 3HS3A 2P90A 4MAMA 2C7RA 4FDUA 3USZA 2QN8A 3FPBA 4MWGA 5SY6A 2PGAA 4HPJB 4IM7A 3RDPA 4EFMA 3KJGA 2IH5A 3P5BA 1VL1A 2J9FB 2PJZA 1THMA 2Q0SA 3Q2KA 4M36A 4K1XA 4OYLA 2BISA 2DQYA 4YJGB 5IAGA 5KNCH 3VX4A 3ZXUB 3EIFA 3HJHA 1CY1A 2FMKA 3EZ2A 3LP5A 1AS3A 4I50F 4FB4A 1Q1QA 2NTYC 1NT2A 2WJGA 1IMOA 4IGEA 1A97A 1XPJA 2O4CA 1JV2B 3BL8A 3JZAA 4W8GA 4ZWNA 3VI3B 4KE8A 4BEWA 1R6AA 2FPRA 3IURA 3RUEA 4EKYA 1D09A 1QB7A 4C2AA 5KTOA 1PBNA 2HJWA 3X1ZA 4IJ6A 3BE4A 4Q3KA 3W9YA 3ZYZA 3TUZC 1JDZA 3KRTA 1IOWA 4Q6WA 2EKDA 2JCXA 1SN7A 1N2JA 3HN6A 3P96A 5BR8B 4C7OA 2Q5HA 4KOEC 4MRMB 2O7VA 4PZZA 1G7CA 1LDYA 3UT0A 4XJVA 1EQ2A 2ZKLA 2CK3D 3TLZA 2AXPA 4RFSA 2WY2D 1YS2X 5TS2A 4TWRA 3MOIA 3QMWA 4C4TA 2H2FA 3WHLA 1TIBA 1GDDA 1N5RA 1CUXA 2LKDA 2P2NA 3CX3A 3EOAI 3OJWA 4INOA 3SD7A 1KY4A 3SDBA 1FUEA 2RH8A 4ZYXA 2J6CA 3UJHA 4IMJB 3KWPA 1V1MB 4BN0A 4EZEA 4KZPA 4PFJA 3TZCA 3MMNA 4E5SA 4F9GA 2BFCB 2ZROA 3UJ3X 4P33A 4ALLA 2W0MA 5ED0A 4NXMB 2AOUA 3WL6A 4MWEA 1GUBA 1KPIA 4L4UA 3ZI7A 1QYIA 4G0ZA 1G41A 2EX1A 1KEVA 4UDOA 5TQ2B 3KJHA 1PWEA 2X0JA 1SUPA 4MUIA 4BLSA 2BFBB 1EFAA 5I7FA 4LXHA 1Y4ZA 2R1UA 2R8XA 5HBGA 5IAAA 1CF2O 1KAOA 1OD6A 1NIJA 3G68A 4FFLA 5JXWA 3NKVA 4KUGA 3OKAA 2YBOA 1JN0A 4DLXA 5JQGB 4MPJA 4ZIRB 3H2JA 4MB6A 1GZDA 5KVAA 2YY6A 3W6NA 1XROA 1I32A 4MPRA 4OU5A 3VNVA 4JR2A 4Q3EA 1Y5IA 2FWPA 1ECCA 2WMYA 3F5QA 3LZCA 2V8BA 3RAJA 1Z7BA 5ERYA 4Z4CA 2WABA 2LBPA 3VR1A 3OZDA 1GGEA 2A0YA 2ZYWX 4LRTB 2PM8A 5IEJA 4FWBA 3IOCA 1AVTA 1YBFA 3FMPB 1J8QA 1W29A 1GZSA 4UEQA 4IXDA 3QQPA 5JXJA 2UYGA 2ZB8A 2W8ZA 1M34A 2JVJA 5LA6F 3TQTA 4GAEA 2PPVA 5KX5F 1NNEA 1N9KA 3UJPA 4C87A 4ERXA 4EHDA 6Q21A 1SKQA 1P4GA 4IQFA 2ADFA 1ZIXA 2RC5A 5KYVA 5A4AA 3UK2A 1VA4A 1PG0A 4NZNA 4WLUA 5SY9A 2OWUA 1GRQA 3HXMA 4QE3A 2OHVA 3RVKA 2BEWB 3EY9A 3NDPA 4ASUA 1LY1A 4QLAA 5T6BA 1RM3A 1U7HA 3P1JA 4FGWA 5KSYA 1NVUQ 4H1VA 1ZRHA 2MR5A 4URFA 1U0TA 3ZV4A 4D8YA 5C1IA 4HDKA 4UTZA 1GQQA 4YX9A 2YOGA 3R0XA 1GY8A 4F38A 2HSGA 3LFTA 5DXAA 1VLMA 2AR0A 1BWRA 2P4EA 1MOSA 2VWQA 3ACDA 2P5SA 2AX4A 3CZAA 3KUDA 4LXTA 4MV1A 5AQEA 4CQMD 2R8ZA 5JNRA 1I4WA 3E9EA 5KVVA 2IEAA 2F64A 4L8YA 4N18A 4IVQA 3TF5A 2QD3A 2QRJA 2VSYA 1QPBA 3R5FA 2NXNA 1TQ6A 1YB5A 4P58A 1N36B 2OXIA 3QFTA 4HXYA 1AE1A 3UJBA 3ZY2A 2B21A 5ALTA 4JB3A 4H6WA 5JD5A 3R5HA 1OI3A 1TL7C 4HK4A 2Q4BA 3IP1A 4IDNA 3UQZA 3VKUA 5AW6A 3DXZA 3RT7A 1XRMA 2IHKA 1EK0A 5DT9A 1RFGE 1SCUB 3EIUA 3KOUA 3AZQA 3K5WA 3O1LA 1G4UR 1TD1A 2PL9A 4DC9A 5BPFA 1DZ3A 2I29A 2DPMA 2X9NA 3GLFA 1M6NA 3LDFA 3N8KA 4BZZA 2E4ZA 2VNSA 1XEFA 1MNQA 2DYKA 2YJTD 1G16A 3IUQA 4OK3A 4M2LA 2QRVA 3H2BA 3HKEA 1ESEA 1YRAA 4JXKA 4WASA 4AN4A 3TW8A 5H4HA 1N7IA 2XODA 4L6AA 2VPWA 4U02A 4Y6PA 4E3ZA 4N41A 1RQXA 2NXWA 1Q95A 1SHTX 5EMLA 4JBWA 3A6ZA 3FTQA 3TPCA 1H05A 5DNUA 1XFDA 4YAOA 1UZLA 3H1FA 4JA0A 4OI4A 4ZHQF 2RCNA 2HYIC 3L8FA 2VYNA 3L4SO 3NEAA 4PX3A 1JBKA 1P4AA 1PBTA 1YQWA 2QZSA 3OETA 1UOPA 2FEKA 4GDMA 1GAEO 4XD7A 3NHKA 3COWA 4KIJA 4LEIA 2CV2A 2RGEA 3G8YA 3EVGA 1WXIA 2J4DA 2MSDB 2QMQA 3FPJA 4UOZA 4INPA 1C29B 1JKJB 2B4RO 1G3QA 5FYDA 2Z2YA 4Y2XA 1N5JA 2XYPA 4HEA1 2EZUA 4MLZA 4XIJA 3RB8A 5IFKA 3EXHC 1QMPA 1W0KD 5G0SA 5A6VA 1SRQA 3NJ8A 1ARZA 1Z8DA 3ONEA 3D3KA 1RQ7A 2XR1A 4RS4A 4G1FA 4BV8A 1LNSA 1YOBA 4V0NA 1VIDA 5DLPA 3WMEA 1SXPA 4AX4A 4HAUA 1MDFA 3LQ1A 3U16A 1V41E 1ZD1A 3FHCB 5EKTA 4F4HA 2BL4A 4MQBA 5K6RA 3QU7A 3LUFA 3N86A 1WW2A 4PXYA 1BDMA 3D6JA 2IXTA 1XDGA 4LHEA 2R5NA 1VI5A 2PD6A 2PN1A 4OFXA 3ESCA 4W99A 3HUDA 3R0ZA 1R5BA 3QLUC 4IF4A 3W3AH 2H31A 3BFVA 1Y89A 2OILA 3ZE6A 2HMAA 1DX9A 4RTKA 2JI4A 2IU4A 2ONYA 3MC1A 4NJEB 4IDDA 4JSTA 2XMCA 1NBMA 4CG0A 1VCMA 4E14A 7GPBA 2C88A 3KSBC 4LVOA 3IHWA 2KQUA 3B13B 3OFSA 3EW9A 4D4GA 1OFUA 4JWKA 2I91A 2P41A 1RU3A 4MCJA 1P5HA 4XUGB 2RAVA 2P7HA 1PL8A 5I8PA 1ZM3A 1F7UA 1NUUA 3GC6A 3TZQA 4F3TA 4Q19A 2OV4A 1IEVA 2WMNB 1NLZA 1PX2A 2VQSA 4HXEB 3M5CA 1P60A 3FCOA 3KUCA 2BBSA 5TT0A 3IIKA 2OORA 3T1YB 3V7YA 3Q8WA 3MCZA 3A9VA 4K5QA 2R751 4C4XA 5JU6A 4COKA 3UC5A 2XOKA 3DOIA 1XIVA 1LVHA 1QX4A 1TA0A 3A31A 3K0KA 4HWSA 2Q9AA 4AJOA 4BJ1A 2Q5EA 5KOYA 1EM8A 2AGVA 1A7KA 2VHCA 1C9JA 1I2BA 2J0SA 2XCOA 3HBFA 1L1RA 2ZRDA 2B5VA 1Q92A 3QKUA 3SSOA 1IZ9A 4DREA 3TM4A 4A4DA 3K6JA 1TRKA 2AXNA 4FZRA 4R3NA 1JW9B 3JRNA 1PYDA 5DK6A 4UHDA 1NJGA 4DV5B 1XDZA 2HCJB 4DE5A 2YQ5A 4MUKA 3QA9A 2QJFA 3U2QA 3GLIE 2EJJA 1P1HA 2R4UA 1ZRSA 1CEXA 2HWYA 4Y9TA 4LF5B 1OWMA 3Q8LA 3FRHA 1OX6A 2ON6A 4TVBA 1EGAA 1GPWB 2EKAA 2JHPA 4H60A 3U44A 1NN5A 4RVOA 4NU5A 3IMCA 1LLFA 1IUPA 3BB4A 3ZK8A 4C4RA 3O94A 1VLQA 3LCVB 2YC2C 2JLQA 5EIWA 1BGXT 1UXHA 3F5DA 4L50A 4X8HA 2HEIA 2RHBA 2HRRA 5BQPA 3PD7A 4XB1A 1D2AA 2JF0A 1V9AA 1RJEA 3E5RA 4ENVA 1YS4A 3TOSA 4PR0A 4MW4A 3KQTA 1HURA 5LMNB 4FFBA 3QW2A 4BWVA 3CZCA 3EXEA 2QAJA 4LX0A 5HKKA 3ROZA 1XG5A 3D5EA 3CZMA 5ES3A 1U8EA 1ISJA 1FJHA 1W46A 3AEQA 1BYUA 3QA3E 3I9LA 3LY8A 2DWQA 3KALA 3D2LA 1AH2A 5GVSA 4MR7A 3PNKA 2JA1A 4M9QA 4ARSA 3NVKI 2EBHX 4WNAA 2AUNA 3T5TA 3FPSA 1TOAA 5FOWA 4F21A 4DR2B 3MMXA 2V6FA 2ZIVB 1TW3A 5LMZA 1VOTA 3NJRA 1UZAA 3DVAA 1EQUA 4ZIRA 1TYBE 2LPMA 2QDXA 1D03A 2IYLD 3H5RA 1JA9A 2WNSA 5JAOA 2O6LA 5D86A 2X7JA 1P1BA 2ZETA 4TQUS 3COYA 5BMVF 4X85A 4YRKA 1HT3A 3BDAA 3C4JA 3PENA 4EUFA 2XNDA 5CG1A 3K9WA 5I9BA 4DLSA 3LIIA 3GQVA 2GXQA 4A8JA 1C5KA 3TB6A 2W4QA 2WSYB 1KFJB 1XZJA 3D0RA 1DKOA 2PZEA 3MAJA 2GZ3A 2E87A 1F0YA 1A7AA 2IOYA 3EFHA 3ER6A 4I4LA 4J6EA 4S2EA 5EVCA 5EJ6A 3H6HA 3ZUPA 1AUVA 3AEUB 1M8KA 4JI1B 3O7MA 1KERA 3GN2A 4OK6A 1A76A 3I61A 1M0TA 1GP2A 1Z56C 1E98A 3GGSA 2QD5A 1E2QA 3GQBA 2R6AA 4NFLA 1EWKA 4QXQA 3TLGB 3JAKB 3QXCA 2NYAA 3ZHUA 4HDAA 2VNJA 3HRHA 3RKSA 1IZ8A 2BZSA 2WICA 1TLTA 2FNAA 3D4OA 5K3EA 4P5PA 1L8AA 3RTDA 4EVSA 3EPHA 3SNHA 5BNTA 3RCBA 1RXWA 3EEIA 3T1QA 1WDWB 3B7WA 1WB6A 5L7WA 3RV4A 1SELA 3W0LB 5CB4A 5K20A 1T8SA 3LV8A 3N8HA 1GG8A 1L6RA 2BKLA 1C0IA 1WF3A 4RYDA 5CA0A 4NWIA 4B0PA 3MPOA 2AF4C 4QOFA 3U4HA 4NAUA 1T2NA 4PC1A 3AF5A 4DR4B 1N2CB 4G2TA 5LXTA 1PJLA 1DQRA 1R37A 2HGZA 1I4EB 1UFQA 3SBXA 3TLBA 3TUJC 1MC8A 1ZKDA 1RQGA 2R2AA 2OO5A 1FCJA 5BVHB 3DH0A 1TGVA 4L78A 3CR3C 5U9CA 2A4KA 1L5GB 3BD6A 3CBQA 3L8ZA 4K03A 1BW9B 5F3WB 5KWJA 3HDQA 3CY6A 1HRDA 1XLTC 2JIMA 3GDWA 2JD2A 3O4FA 4BFLA 1QP4A 3FMGA 5CVTA 2MIIA 3ACCA 2E85A 1TZ2A 4HLNA 2OXCA 2E89A 1XCOA 3VX3A 3FWHA 1X3SA 2HK8A 3V4ZA 1MZPA 2O3QA 4AS3A 2EGBA 1KYIA 3GUZA 4L74A 1IRIA 4ER7A 1A04A 2CWDA 2FZLA 1ADFA 4CG1A 1CJCA 1R1DA 4Q16A 3R3JA 4ZTZB 4RVHA 2P6DA 4X1OA 1SCDA 1B73A 2ONJA 3GLHB 5H83A 2GO1A 4XQCA 3NR2A 1JIQA 2Q2OA 1Z2EA 4WV3A 3L8YA 2QMEA 2ZJBA 4PC7A 4B6PA 4IUYA 1Z2OX 1E92A 4XJSA 4DWVA 3JRXA 1ZICA 3PYXA 1EP1B 5G4LA 2HLNA 3CISA 3DBVO 3OLCX 2EL3A 4ZCSA 4R31A 3UJ7A 1VLLA 4MKHA 4U7HA 2CVHA 2DSTA 2A30A 2EZ8A 5IC6A 4EUNA 2A9KA 1QHYA 2V6MA 1HR0B 1K75A 1A77A 1T3TA 1VIAA 1JH9A 4OGWA 3JYOA 1AUPA 5KOHA 2DERA 3L2OB 5LZ9A 3ESQA 3L1UA 2WJZB 3BD7A 4UMVA 2BJVA 2P0AA 2PX3A 5IKMA 2AX3A 4TKZA 5TF0A 1XTZA 2XB9A 3WWPA 4EPVA 1C30A 4UVIA 3ZN2A 1B15A 1T1EA 2CE7A 4WZAB 5CCXA 1DBWA 2VPTA 4X84A 2O2GA 4OIMA 4BLQA 4LHYA 1Y3AA 3IVCA 3GJ4A 4XPIA 3Q8KA 2XYGA 4RA9A 4K8RB 2I4LA 4G1BA 4C0HA 1H2WA 1UFOA 1YQUA 2H1VA 1FFXA 3CR8A 3JQ9C 3QHQA 3PNMA 4DNPA 2ZQYA 4G0NA 1C7QA 3L1KA 3F9CA 2XIQA 3D64A 4F8EA 5B2EA 3HZOA 1BSVA 1UXOA 2VF8A 3GJ3A 3JQAD 1NG9A 2G28A 2FR1A 4R81A 4DTIA 2GZ1A 5ALOA 3C85A 2PKRA 4HO1X 4JJFA 2F8TA 1MBZA 4B79A 2QUKA 5AVRA 4ETNA 3WWOA 1QIKA 4OHCA 4RIFA 1P1JA 3ZE9A 1FPMA 1LS1A 2J6IA 3PCTA 1UQTA 3KETA 2ZUTA 2JLRA 1Q0TA 1T9KA 1T3LA 3X1KA 4MB2A 4Q7QA 1RXVA 4BVHA 3NB0A 2QVLA 4BKQA 1N6KA 1PT8A 1DXYA 4R1SA 2PAAA 3D7LA 5K3CA 4B81A 3U4QA 3UG6A 3ZCPA 2XD9A 3H05A 1UIMA 2VJBA 1RAFA 1JKXA 2MWMA 3OD5A 2AD1A 5D01A 3ULKA 1ULHA 1QAOA 1Y1TA 3EF1A 3FXAA 4TMYA 4Z0NA 1SU8A 2P79A 1CQZA 3CSSA 4D8XA 4KR6A 1DFIA 3Q0EA 3WB2A 1B16A 1MDBA 3WLMA 2C7QA 3GLKA 5LQJA 1HDCA 5KYUB 4GKKB 4HPXB 1TK3A 1VE2A 1GT6A 1QV7A 3QG5A 5JUWA 4JSYA 4LOHA 2VH5R 4M1SA 1YA4A 3DR3A 1USVA 2J3KA 2NW6A 4G5GA 2OAEA 2FPIB 2I33A 1U6JA 1X77A 2J4CA 3H6GA 5HS6A 5FWYA 5IT9A 2XB8A 2GLTA 3NTVA 4F71A 2W0SA 4JN6B 3S5UA 4F92B 1R6DA 1YKGA 4JENA 2VUHB 4F2HA 3G9XA 3SPXA 2EQ5A 2FSVC 1X1QA 3DNMA 2YYYA 3IAUA 3JQEA 5A71A 4BTVA 1UANA 4O1IA 1P9NA 4QPDA 1UFKA 3QPWA 4PV7A 3DZ8A 4CKBB 1XU4A 2J3HA 1JLHA 2XMDA 5AK4A 1I4LD 1Z38A 1VCHA 1N0IA 1XVVA 1JQEA 3C3EA 3AFOA 4O4LF 4RY8A 4C76A 1O1YA 2HJSA 4EPWA 2IHYA 3KBOA 4GZ6A 2OSBA 4W7SA 4CCWA 4WZBB 3ZDBA 2JZOA 1ZL2A 3H13A 3RSLA 2DSIA 3BICA 2QTBA 1AO0A 4QUDA 2JI9A 2XCUA 4RPGA 3TCXB 1ZYUA 3E9QA 3T7EA 3NO4A 4TMTA 4AYWA 1EFRD 4BLVA 2PUAA 4I50B 3GEIA 1W7AA 2O3RA 2CVFA 1E32A 2C2HA 1G5FA 1KZHA 2Z1DA 3K05A 3O31A 3ZKWB 5JANA 5KYXB 4BBZA 1E58A 4L5CA 5HRCA 2VBFA 4E94A 2WKQA 4B4OA 3UAZA 2Q1WA 4PS0A 1QOPB 3TW6A 4XLLA 4IDQA 3HCPA 1NLYA 4WLVA 5BQXA 3FPCA 1FTGA 3DQZA 3LP6A 10MHA 2EKZA 4BO4A 1I01A 1NAHA 1ZDMA 4LRSB 1GKUB 4NPHA 4R9UC 5FBHA 4B17A 4LIPD 3EPKA 3IP3A 4Z4EA 1CR0A 3GJ6A 1W2WB 4E12A 4F84A 4MDEA 2B1RA 1ZITA 2NT3A 4QXPA 1DXQA 5TMBA 3AO0B 3M6WA 4WN9B 1UMCB 4L3OA 2N75A 1BDIA 4HGQA 3FOZA 3OX4A 4ND8A 2PJRA 4EMSA 4ND6A 1E7YA 3KNZA 3LAWA 3EFOA 1MH1A 1F1BA 1P6UA 3KJNA 3I9NA 1UMDB 2IOHA 4CFZA 5FX2A 4CKYA 4P93A 2P4HX 1XQYA 3F7NA 2VTDA 4HS9A 1VKZA 1E1RD 3UCEA 5A7GA 3RHZA 3ER8A 1PDVA 3QV2A 2C31A 2C7OA 1UC9A 1H3EA 3SMQA 4LY3A 3O4GA 4S24A 2YHSA 2DLNA 5AHOA 3VTFA 4GBED 1FRVA 2NSJA 3M4XA 5JTUA 4JLNA 1WHSB 1T3SA 4X1YA 2X8WA 1PCXA 1W44A 2R7AA 4IRXA 5EXSA 4KUEA 5JPIA 3WJ7A 3ZHOA 2IYWA 4MVJH 1KY5A 2EXXA 1AZWA 3AJ9A 1A88A 1GL9B 3JQ8A 3FYSA 2MJLA 1P77A 4XIFA 4U0JA 1EVYA 1G7SA 3KL2A 1BDHA 1XK6A 4B74A 4M86A 5DULA 3NHAA 1Y8AA 4JLJA 1B14A 3SC3A 3BGSA 2CDCA 5FUVA 2A58A 4GQAA 5BUQA 1L4HA 4YHHB 3UENA 1YE8A 1KE1A 3QXJA 3MQ4A 5IANA 1MQ8B 3T5CA 1PSWA 1OWOA 2CHQA 2C3YA 1CQWA 4QGGA 2Z3ZA 4B4VA 2YVQA 3CG0A 3CPHA 3E15A 3I5MA 1K7EB 1ZMXA 2G72A 3PNOA 3TQFA 3A4IA 4I08A 4DNFA 5HRUA 4PNHA 1XHFA 1B76A 5DTMA 2A33A 1RRGA 2IA5A 4YRPA 2C9ZA 3DWFA 3TQSA 4A03A 3QE4A 1FQJA 1JHMA 1T29A 2ZEJA 3CE6A 5AKZA 5LA6B 1U9IC 1CY0A 2VHZA 3Q2OA 4O08A 4KJXA 3H9JA 4ZA2A 3ZLBA 4KWTA 4PCAA 5JAQA 4DB4A 3I2JA 1L4FA 2Y0DA 1J7KA 4MWOA 3ZD6A 1QC5A 1EXMA 1XEXB 4H0NA 3RI3A 5AKJA 1E1KA 3WYNA 3WYBA 3F7TA 4BC1A 3S81A 1XNQB 5AKXA 3QMMA 3AUXA 1G60A 2W83A 3HU2A 3RUHA 1R0BA 2CB0A 3ICCA 1NVEA 4UHJA 1YA6A 1YBMA 5GVRA 1U04A 2W70A 4B3IA 4DJAA 5UKDA 2GM9A 1VXRA 5H68A 1BHJA 2I76A 3VR4H 3IELA 3OWHA 5K0BA 1FDWA 2BM1A 3ESYA 3HM2A 3OX2A 4BU1A 4J9UE 1RWPA 2F43B 5DWDA 4XWWA 2GM5A 1N5IA 2IOFK 1VYHA 4MCAA 2NMVA 3E3NA 4KODA 2ZREA 1DPGA 1KH1A 1EDBA 2HXYA 2VJLA 4Z4HA 4CG3A 5CIWA 1T8TA 1XAJA 2VA9A 5FR1A 4QEDA 5DOZA 1JEOA 4D7AA 1I3NA 1QHFA 1IUOA 1U3TA 3NBUA 1V3VA 4NBWA 4MPPA 3FHOA 5LQKA 4IEFB 4PGAA 5EE1A 1MCZA 3OCUA 3E2IA 1BEUB 4MTCA 5ETJA 1LFAA 4FPXA 3EX7C 5I48A 2X4LA 1KJIA 1N5DA 2ASVA 4XDZA 1ZH0A 4Q4CA 4H1WA 3W79A 5CVEA 2HIAA 1RRFA 4BNXA 2ODWA 1KK1A 3FZGA 1ECFA 2EHJA 4F6LA 1L0BA 3TL6A 2FMIA 5EWLB 1JYFA 2FXIA 3EQ9A 3ELBA 4UM9D 3LY9A 1H2BA 2SNIE 5ECDA 1E4EB 2PWAA 4ZAWA 3KAQA 4DV1B 2PS0A 3I76A 4MVJP 2FZKA 2Q41A 1UUFA 4UM7A 2V7EA 3SJAA 2K87A 1NMYA 1GAXA 4N5MA 2EYUA 5D5PA 5J5CA 4OMCA 3RS3A 4RAOA 2VRWA 2WM8A 1GKYA 1MOQA 1RAAA 3M6UA 3TCNA 1IOLA 2Q27A 3MT9A 2OFFA 4YONB 2O57A 1ITZA 1T24A 2GKSA 1J8VA 3DLTA 3EPRA 2YHBA 4RPCA 4W6ZA 1U3VA 3VJLA 3KM0A 2H7CA 4UFNA 4DJFC 3AR4A 3JYLA 1EP9A 3JR3A 3TE6A 2XLBA 4GGPA 4YXFA 3VSBA 3NHFA 2ZJZA 1KE2A 4KO4S 5A9RA 2W2QA 4MIKA 4R6XA 4JL5A 3ABIA 2PL3A 4HG2A 3RFUA 4J7AA 1R9NA 3OI7A 5DHTA 3CO0S 3M3DA 4NBSA 1MGPA 3PUHA 2WAOA 4AJEA 2JFHA 5FI3A 4X3CA 2BTQA 1G20B 1XRQA 4QOIA 1QQ5A 1UT8A 3PD0A 2GH1A 1ADGA 3SLKA 1L3BA 1QOQB 1PW7A 4YLYA 2EK2A 1XZHA 4HKTA 4FYXA 4HVAA 5DBFA 2YWJA 3GLRA 4KVAA 2D0DA 4FMBB 1QHGA 1XT6A 2O2SA 3NTLA 4EY8A 2DB3A 4FYJA 3KKMA 2BN4A 4Y7CA 3PDUA 2AZXA 1E3EA 2VK2A 4ZXPA 3TR5A 3BG5A 2FSSA 4IRUB 2UZ1A 1J24A 2PLFA 4PLHA 3VU8A 4UBLA 1C0PA 3B3JA 2HUTA 4KP7A 3RRYA 3QG1A 1EWQA 4ZICA 3ER9A 2I1QA 4ZVOA 1J8MF 1E0KA 5F7OA 4EG4A 1WUHS 3ZE2B 2PH5A 4FNMA 3ABOB 5TGTA 4PO9A 4F1JA 2YS6A 4PXSA 1V6SA 1C4OA 3BE5A 1YFZA 4V0RA 1Y7PA 3F5FA 4V0LA 3RJ9A 3FCYA 4PF1A 5DLEA 3ANXA 4X6LA 1D6SA 3GGCA 5AJXA 1R00A 2GRAA 5KHOC 1QSGA 3I9FA 4IQ8A 3KSMA 2J45A 4QYWA 2ZIXB 3BMOB 4OQNA 2NYVA 3NRCA 1F2UA 4CM1A 3EHEA 4AF6A 4NYIR 1Z75A 1XFAA 2JRCA 2PSFA 3W90A 5CIYA 5FI0B 4X44A 2AMVA 5KQRA 4YMUA 3IIIA 4FEAA 1SKBA 5IBCA 3SKXA 1PQ4A 1D6JA 1KEKA 4DTCA 4RK6A 1NP7A 1VRVA 1CV2A 2C54A 3P0FA 5IAJA 5L51A 2GM4A 4EF4A 4H7HA 1IG0A 3C7TA 4XYLA 1C4KA 1E4OA 5TARA 2NZJA 4A16A 1X2EA 4AP6A 2WJ6A 3ZZTA 2WTXA 3FYDA 2BZ1A 4JUIA 3FIJA 3MUFA 1KYYA 1XNGA 3F4LA 4KMMA 4KX5A 2XCRB 3E82A 4O4JB 4HDNA 3TTUA 2DSHA 2D0OB 5JO0A 2ELDA 3FA2A 2VFAA 1MB4A 4O4IA 4OYYA 3AETB 3MMSA 1VE9A 4YRIA 4UCWA 1YVEI 1M1YA 3C1UA 2PY6A 4H7KA 4NY1A 4ZT6A 3G8CA 4G67A 3C1TA 4JYBA 5CBPB 3Q5DA 4G4JA 1OXSC 4URXR 4NRDA 3LT2A 1FVXA 2O8FA 4KQ2A 2IIVA 1LTHR 1P62B 2Y68A 3NASA 1DIAA 1OI2A 3WRXA 2O19A 3V1LA 4PIPA 3RG2A 1YHNA 3D7SA 4UTNA 3SVZA 1BXRB 4DA9A 3K72B 2PMFA 3LQYA 3ROMA 4BO2A 3EC7A 4CDMA 1CY7A 3LRPA 3PRKE 3CPJB 4WEQA 4H9GA 2H1CA 2X2OA 4JCOA 4YH1A 5AJVB 4KIFA 5ALLA 2R79A 1M1NA 3D7RA 5LP1A 4AMYA 2FPSA 1R4MA 3MELA 3LE8A 4MICA 3TNFA 1ECBA 2EL7A 1E1QA 2D3WA 2ZBPA 2QX4A 3PQ4A 4HWOA 1CUCA 3T3NA 3MHTA 2EN5A 5KMGB 4JD5A 1DG3A 4ZT7A 3RAGA 3CWZA 3CZPA 3WA6A 1RJ9B 5JWOA 4MI6A 1UZNA 4RHUA 4BJ6A 4I6GA 4OGGA 1TM3E 4YFYA 1YQDA 4MUMA 2HQBA 1TEHA 2OMKA 4HDRB 4EX6A 1RPZA 1JH8A 3GL9A 3A1WA 4ZOLB 1A9XB 1FPQA 2UVPA 2VDNB 3DAFA 2QAGB 4L57A 4LOLA 1EWTA 1YQGA 4R3WA 5L3RA 2FUKA 1TECE 1WXDA 3EIEA 1FMJA 1SNYA 1RLJA 3N59A 2E0IA 4PG5A 4WXHA 4WADA 1R5JA 5C52B 3CEPB 3G9UA 2BKUA 5C5EA 1ZW1A 3QPUA 2PUBA 1TUEA 3AW8A 4AW9A 5EL0A 5A3QA 1HG0A 3PPVA 3IKVA 2B37A 5CVCA 2ZPTX 2D1SA 3B6IA 5F9HA 2H2GA 1UADA 2CXTA 4JODA 4ASUD 1MJGA 1DWQA 2X13A 4Z7QB 3FDIA 1F8YA 1EJ2A 1OXUA 3R7AA 3EPLA 4ND7A 2OBBA 2V9CA 1WUKS 5EIAA 2VJAA 3AF3A 3IR5A 1YULA 3QSGA 1SKUA 2HTEA 3DWEX 2OHHA 3IDAA 4JVNA 1OUMA 3U7GA 2G6TA 4LBYA 3SKYA 2G5TA 1IWOA 2WAXA 3TTXA 2E4AA 3PPIA 4ZVRA 3ZQ6A 3WBFA 3CVOA 2O8CB 4KSYA 4PZPA 4LW8A 2VJDA 3NOOA 5GM1A 4CL0A 3O47A 3P2YA 1VPLA 1Z0FA 2CF6A 2QPLA 1JSZA 1H5QA 1G8KA 4KR3A 5H82A 2V03A 2RAPA 3RJZA 5JD4A 4YRQA 4MKZA 1D2NA 2UXDB 1S8NA 4P4SA 4P32A 5BT8A 1TVEA 1GG9A 2DWCA 1IJKA 2YY5A 4WFQA 4TL6A 2GUWA 2JS7A 2Y8EA 1JTFA 2IV7A 3WNZA 4EENA 4JK3A 1WJGA 2CUNA 4UVHA 4MO9A 3BJMA 2JKYA 1MC5A 5KAPA 1MXFA 1KFEB 2LXNA 4MS1A 1N2XA 2O3SA 3S4YA 3WO0A 4DFDA 1IK4A 3O9VA 1X0XA 2AFRA 4I4TA 4DXDA 1U94A 4WTOA 1XN4A 2TSYB 1KAQA 2OFXA 3OM9A 3RVDA 8ABPA 1W88A 2F8LA 3O4VA 3ZEAA 3RVOA 4K9LA 1JWLA 3E9CA 5ADUS 1DKUA 4DQDA 1BS2A 3COSA 1UPBA 3CRZA 4B3DA 2D0IA 3N8IA 3QWIA 3A2MA 2YCLA 4CM3A 3I8XA 2Q7OE 2II6A 2YV3A 2OHXA 4DMKA 5HSGA 2P9BA 1S8AA 2QUAA 1P74A 3M1LA 3R41A 3UNXA 1CRZA 2H4JA 2I3BA 1P1IA 1OTXA 2VYND 4ZCPA 4ND1A 1ZCFA 1TO2E 4FXOA 1OROA 3USES 1ULBA 1HM5A 2ZU0C 2FQWA 3K7EA 4GICA 3KG2A 4R8VA 4XD7D 4EBBA 1ZR4A 1XA4A 2FLVA 2KPOA 2Q3FA 2XZDA 4KQJA 4HZUA 4OMDA 3Q3HA 5EWJB 4IIBA 3UF0A 4YCCA 3S2UA 1I2AA 1XXLA 2DUNA 3H1TA 4FGLA 1GJRA 1D7OA 1YTUA 1EU1A 1ESMA 2C9BA 2CF5A 3C14C 1QK5A 3N6RA 5DHSA 4OHYA 3LYHA 3T8YA 1PNQA 2GDZA 4JQZA 1WTAA 2YVLA 3VYSB 2H7VA 5JEEA 2RGGA 4G4SO 1JU3A 3SDZA 2NO6A 4QNNA 3RH0A 2WNIA 1VBFA 1O89A 1ODKA 1R15A 4L8GA 2C4MA 3QGMA 3W9UA 4DCOA 4CF7A 4FQ5A 4EF6A 1MUUA 2O2JA 3GLHE 4QRHA 1V96A 2XUPA 1WZEA 4BJHB 4CRWB 5KC9A 5HCIA 1FFBA 1IH8A 4EFLA 1VMKA 4JMLA 5IMBA 1U11A 2GNPA 1UP4A 3FDZA 1B6TA 1U5BA 2R9VA 3OUUA 5FOVA 4D9KA 2RI1A 2DBYA 2HSZA 4QOHA 4DA4A 4GYJA 3DD5A 1EXWA 5CDUA 1GM5A 3SZ3A 3CEJA 4MKIA 2EOAA 4CLDA 3RSQA 5IX8A 1W5AA 4R2JA 2E15A 1GGFA 3GEBA 4MWSA 5EZYB 4DCJA 1JIXA 1QYDA 2W2KA 1NXWA 3GJ7A 2FFAA 3P0JA 2EL9A 4GSLA 3KQVA 4EO9A 3E9ZA 2XCLA 1G9TA 4N3AA 2HUPA 1JZSA 1H6DA 4KAJA 1FFWA 5HFNA 4P7GA 3W2HA 1FX1A 1T6YA 1O96A 3BYZA 1TI7A 5K1ZA 4RTRA 5FJJA 3HUUA 1Y8QA 1ISRA 3A3KA 3A1SA 4LNAA 5KNBA 3VHRA 2BC9A 2P5UA 1BD3A 3QBEA 1X1RA 2XOKD 3OJEA 4NCHA 3S40A 1AC5A 1VC2A 3KQOA 1Q2XA 5GOTA 2IEDA 1V8PA 4AN1A 3AJRA 2EK3A 1I33A 4J1TA 5EZQA 1BS1A 2MYUA 4GMHA 5TRTA 4HJXA 1UJNA 3B9BA 3CVJA 3DTYA 5U1PA 4ENRA 1KDRA 4F9TA 1P2BA 1T2CA 2N47A 2VC2B 2YZ7A 3HYRA 3IV6A 1QV9A 5EQTA 4DZZA 2QG9A 4HNQA 4BNKA 4U1RA 2J41A 1S2IA 4PR3A 1S3GA 2EV9A 2GJKA 5ALSA 5LWHA 2IX3A 1Z9BA 3CUVA 5K0FA 1HEIA 2OA0A 2PUFA 1QE0A 2IIQA 4B7CA 4BQFA 2ZRNA 3PC7A 3CLSD 3IMKA 4C14A 4U5QA 3S2GA 3K6RA 5AUPB 5IBQA 4J4BA 1H4TA 1JA0A 3W2FA 4V03A 4YQEA 5HPYB 2C4TA 3ZV5A 3KYCB 1HKHA 1L7AA 1R4AA 3KD3A 4EJSA 2ZANA 1JHZA 1O94C 2QTRA 3CN9A 3FCXA 2RHGB 1YUMA 2EQAA 3DYVA 2QS9A 3Q72A 1FYFA 4BATA 4D41A 2L2QA 2WP8J 4C03A 4KR7A 1CVRA 1OFIA 2JANA 2RH5A 4J3NA 1WBDA 5JLAA 5FTMA 1UKBA 1N6RA 4QUIA 3ADDA 5FNVF 4LTDA 1QWSA 1I14A 3CVXA 2Y1KA 3GGJA 3QVOA 2Z5FA 2NXJA 1AV6A 2DEKA 4JNKA 2Y0CA 1QXSA 3H5TA 1JUDA 5HKKD 1J0CA 4TXJA 3R3ZA 4PZ9A 1GSAA 2F8MA 4ZQFA 3G0DA 4ZT2A 3VDRA 2F3PA 1NKSA 3LOPA 1FUUA 1CBUA 1RHQA 4U3JA 4O25A 1L9XA 1KYVA 1U2SA 2QUIA 2ZRIA 3BCUA 4RHFA 3ZVNA 3IE0A 1JTEA 4PFKA 2C03A 4WWHA 3VZRA 1TVKB 4MV7A 1NQAO 2XUDA 2ZUWA 1F06A 2Y66A 5IM4A 3ZS9A 3FYHA 2ECOA 2ZRFA 3TQRA 1ZNQO 2EX0A 1CY4A 1G55A 3M4YA 1J5EB 3HVIA 2J9FA 3VR6A 3UK7A 4IGIA 2BRUA 4YJGA 3T41A 1E96A 2C07A 5DHFA 1SUWA 4H7EA 2Y05A 1TUGA 3OFVA 4IJKA 5JCXA 2E1RA 2ZVPX 4RHYA 2VUTA 4KX3A 1DVRA 4MR8B 5HA5A 3OZFA 1Q44A 2OWEA 3AF0A 1KJ8A 2JGMA 3O26A 5CVUA 1YQ9A 3P9PA 4YRCA 5L3VA 2CFTA 2HMYB 4UMEA 5EJIA 2XQGA 3F8SA 2PUVA 4ISCA 1C8BA 1XO1A 2J5QA 4L3WA 4BMYA 2EH2A 3NAZA 1WB5A 4BEBA 1ICIA 3L8GA 9ABPA 4P31A 4J0HA 5J2UF 4XASA 3G7UA 3LI2A 4N5NA 4LMRA 3ELDA 1RWWA 4MRMA 1RAHA 2E6KA 3S3TA 4QDZA 5DYGA 4BRSA 4W5RA 4TTVA 2ZRMA 1OX4B 1A72A 4QJIA 1BE0A 1HE2A 2XE6A 4M46A 2IQ5A 1U3CA 3OX1A 3BUSA 4TVSA 1ZOOA 1LLUA 3PI7A 4KSCA 3WWZA 3EG9A 2DV5A 1GQOA 2OK8A 1Z08A 1P33A 2ZFUA 3M9WA 3IEKA 2LE0A 2GAJA 1SG9A 5EJFA 1V1MA 1N2EA 1U6IA 3H5LA 1K66A 4G8DA 2AOWA 3MXTA 3NBXX 2BFCA 3NBYC 2AOTB 4UC0A 3VVMA 3OF5A 1MKYA 5A9SB 5ICEA 1J0XO 3IP7A 1N2SA 2AJCA 3DEIA 4G23A 1VHLA 3NKFA 3HHPA 2X0DA 4P08A 5BSRA 4N7JA 2BFBA 2Q9UA 4I5IA 4BNDB 4D4IA 1A5SB 1EE1A 2H52A 2FSIA 4FW8A 2WUEA 4X97A 3VTKA 4MVJF 2UYCA 1N6PA 2QN6A 4Q24A 1J20A 2WU8A 4IIJB 1KVTA 4ATNA 4D98A 3SE7A 4CG2A 5JQGA 2AOXA 4QOJA 1YF3A 1P7CA 3CRW1 2HX1A 5EJMA 2EIXA 3PC4A 4FYKA 3B3FA 2E18A 2RH9B 3RROA 4E0BA 3ZH2A 1NLMA 3R3YA 1L7MA 1TKRA 2GCNA 4RJKA 3ZCQA 1HG1A 1DUSA 4ZPJA 4S05A 1TEZA 1K63A 1F5NA 2OXEA 3MERA 5DCYA 1E2PA 5HCNA 3LW7A 4AK9A 3KT6A 1QONA 1EMDA 3SC4A 3ZK7A 4Q7EA 1W4LA 1IE3A 1B8OA 4G81A 2A0XA 3B5EA 4N8SA 4RCVA 4UD6A 3HJNA 2FQXA 1MENA 2VDOB 3AZOA 5ARCA 3WIBA 1GPKA 1PU2A 3HPQA 4HDCA 2P77A 1CIVA 1HNXB 4NV0A 3VAAA 4XGIA 1F8FA 3PICA 1XRRA 4RQAA 3VTAA 4EO7A 4ME6A 3KE8A 3ETLA 4J0IA 3FETA 5L6LB 2YXPX 3ZR4B 1P2GA 3DEHA 3K4QA 1PK9A 1ZL0A 2PVPA 3WLFA 2C1XA 2CD7A 2H9AA 1ORDA 1SA0B 5DLDA 1RWQA 4EJ2A 4I14A 1L5ZA 2I2AA 4YBZA 5K8IA 3FHTA 2JIZA 1JL3A 4G86A 3ST7A 3LUBA 2VOJA 4U2EA 2GJ4A 1U0SY 3UHPA 1GQYA 1CR2A 2I66A 5CFOA 1ADBA 4FFDA 3R7FA 2B5WA 4ADSG 2IS1A 4RJTA 3JSAA 3ZQKA 4I9FA 3BL5A 2ZYRA 5AM3A 2J0UB 2Z83A 1VJRA 1S96A 3DW1X 1CIPA 1EK6A 1NPDA 2VPIA 3E7WA 1KYQA 1HYHA 1IATA 2VO1A 3AEZA 1A8SA 1TQ4A 3T7KA 2WTBA 3IV9A 2H1FA 4DL9A 3NGMA 2IBTA 4G5RA 1H66A 3ADPA 1OPXA 3RU2A 4UXJA 2CLCX 3E3LA 2VR1A 5LP6A 2HNBA 2P62A 3ZGOA 4ND5A 1GCAA 2HCTA 1TM4E 5H0IA 1L4MA 2HU2A 2R84A 3BTUA 5ANRB 1BOOA 3PJEA 4Q7MB 4HGRA 4RD6A 4RVGA 2AJTA 3U4AA 5CB6A 1RS0A 5D1NA 1SCUA 2XADA 1RMTA 3BTVA 5JISA 3DLHA 4LZNA 4PBSA 2A84A 1U4NA 1AXRA 2BEJA 2NVOA 2VPXA 1XYYA 3O82A 4ZTUB 1H8HA 4KGDA 3WWCA 2BYTA 3OLYA 2XZTA 2XDYA 3DFKA 3GHHA 4J4TA 4GVXA 5AOBA 4WY2A 4H3KB 3O3CA 3VO1A 1JXAA 4WDRA 3T3GA 1H2EA 1QIJA 5CLHA 1YOVB 3D1JA 3PNSA 1I1QB 1HZZA 3DVSX 3G7SA 3DOFA 2PUTA 4OAOA 4WESA 1NATA 5DNVA 1Z4PX 1HNNA 3R4CA 3REOA 4GS5A 2ZBEA 4UKDA 3U1TA 5JFTA 1AF7A 3F8WA 4DV6B 4NE2A 1XCPA 4FI3F 2TMDA 2I4TA 4JGBA 4TTIA 2V7BA 2RK4A 2PIAA 2QTCA 3G5TA 3QFSA 5BT9A 4OI1A 3I30X 2BE9A 3C3XA 3CV3A 4LJ8A 1YDHA 1SG6A 3RYHB 3NG1A 1JKJA 2J3JA 1JPJA 2NLOA 3UGQA 2Q4OA 3TR6A 3SSAA 2R7NA 1WB9A 1ML4A 5DK4A 1XA3A 1VZ2A 5D6OA 6YASA 3O90A 2R00C 5CEEA 1CUUA 4Z6KA 2OM2A 3OEHA 2GBFA 2I2XB 2JHGA 5EYPA 5I7VA 2VHVA 4WCDA 2HK9A 4N3BA 4V0ME 2ZUFA 3UBTA 2FV8A 3OZGA 4EPTA 1ZJYA 1L4GA 3HZZA 3RWBA 3C2QA 4D97A 4DQUA 1YRBA 2PX6A 1PVOA 2O06A 4L4SA 5JQWA 4C7MA 2JCGA 2G6BA 4JVSB 1P2VA 4DMFA 1ZD3A 1PT6A 1REQB 2EGLA 1AKWA 1SXIA 5ALMA 4F06A 2QZ4A 1OILA 2PX5A 3BJIC 1PX0A 4QQKA 2J48A 5B5SA 2IY9A 4ZQGA 3KQLA 3QX7A 3RK1A 3PQEA 4L2IB 4FDAA 3KC2A 4NYJQ 4ZI7B 2QG6A 1XTUA 1DAMA 4Y0NA 5EJAA 4DEVA 5LKRA 4NJEA 3N0TA 1ZLXA 1WCIB 5IXJA 2C7PA 1VIVA 5D00A 4W1SA 3ASYA 4INJA 2ZVQX 3PFKA 3R0JA 2FR8A 3OHPA 2R8YA 2GHQA 1V4VA 2CL7X 4GFDA 4QG7A 4XXHA 1SVLA 2BSQA 3M4ZA 1P8AA 1QRSA 4GOXA 4D3XA 5JBQA 4KC0A 4N3GA 4JB0A 1EUZA 1X1AA 4M38A 5DM2A 3SXPA 4BFCA 3IKJA 1F4PA 4LJLA 1C8LA 1PK8A 3STHA 4PO3X 5ADVA 1KKUA 1PT5A 2HH9A 3AWDA 3NGXA 4LWPA 2Q7DA 1AGRA 3DOOA 1JFRA 5FRDA 2PJDA 5HIIA 4OH1A 1CPYA 3PF9A 4K6GA 2FWMX 2WHPB 2HL6A 2OV1A 5KZMB 2WIAA 1NM5C 3CX6A 5B53A 3ANLA 4O1HA 1E1MA 1EDEA 2AZMA 2YJGA 3F4BA 3HPRA 3OC6A 4S1OA 4WY5A 3KDAA 1W47A 2IZ6A 3P94A 4OVKA 1U2DC 2ROQA 2B1JA 4NMMA 2XVYA 4BMOB 5HW4A 1V1JA 5DE3A 2BEUB 4D46A 2ZJ2A 2AR7A 1DZIA 2ORWA 3BIWA 4RHXA 4BJ5A 3DLBA 2QM7A 1Q7GA 1UMBB 1D2CA 3CVUA 2JGJA 1GQSA 5CA1F 3HDJA 4M0MA 4U6NA 3LNTA 3U4IA 4GEKA 4M0DA 3EA5A 3SR4A 2CNDA 2E4VA 3QEJA 2AQ8A 4BS9A 3QENA 4WXPA 5AW8A 3TLMA 4CLOB 2REBA 1P2SA 3DBIA 1AQUA 2PKXA 4GYWA 4D9EA 1O6GA 3JQDA 2I0FA 3HA5A 3HA3A 4QYSA 5JZVA 3QVSA 4AMUA 3H1AA 4EGQA 3OOEA 3Q7QA 3R09A 2Y1WA 5KOIA 3T3PB 1J33A 2OQRA 4ROTA 5LM3A 1E2KA 2B1QA 2DGDA 4PVCA 5C3UA 4V1CA 4LE1A 4CODB 4XVUA 3D5TA 3UMRA 1N6LA 1Z6ZA 1FXSA 2JIBA 2NTEA 2QJOA 1EVIA 1XHEA 1Z0IA 1LWOA 2OM6A 4OL0A 3S5JA 1QP7A 5JAPA 5K3AA 1N3LA 4AKEA 5HX7A 4I1YA 4BNJA 1GQFA 4QWWA 5ICGA 2C8VA 2H57A 3V9AA 1JHVA 1Z4QA 2ANCA 4WK4B 4EKGA 1YI1A 4N7RA 4FOPA 3M81A 3HDYA 3JQ6A 3W6ZA 5T4HA 2B8EA 1H3FA 4HFJA 4NCAA 3W4JA 1KMNA 4B76A 4UATA 3LJKA 1JHDA 4G4GA 5JW6A 1RWVA 1RD4A 4Y6RA 621PA 5KKCA 3FPFA 2Q2NA 4FE3A 4LG1A 1CRLA 2GYUA 2V7VA 4KQHA 1DJPA 5IYZF 4XYMA 2DR0A 5ILOA 2PB4A 2H2IA 2XTJA 1RKVA 2I7XA 4X1IB 3I01A 5IVPA 1Z6QA 5LQCA 3G2LA 2EJUA 2QTWB 4ZQBA 2PGIA 2JA2A 3OPMA 4QBHA 2DT8A 3QLEA 1L5RA 2Z1NA 1DRVA 4C7VA 3BWBA 1I7LA 1E0SA 3G2JA 4NMHA 3TSOA 5LQUA 3U7FB 4E3WA 2YWFA 1IPHA 2C5BA 3KEGA 1OA0A 3T12A 2PH7A 9LDBA 4WCFB 3E1KA 3F78A 5KOJB 5JJIA 4QATA 4EHBA 4WJLA 3TYXA 5EHGA 3AEUA 3SHTA 1R16A 3B85A 3FG9A 1NNSA 1YMQA 5AHXA 1UK6A 4NL4H 4PYJA 1Y9DA 1RZUA 2Q3BA 3TXXA 4AJKA 1K7XB 2WT4A 3VC3A 3TLGA 4QOSA 3JAKA 4Z9XA 1M2GA 3O92A 4R01A 2FWIA 2AG6A 1R4ZA 2ELEA 4LRUA 4AUEA 1GSIA 1P5ZB 1SCQA 3MG9A 4MGKR 5B1YA 2E5FA 1D1PA 2PCGA 2VDPB 3VPHA 4UXHA 1J9ZA 3GD5A 2DSNA 1DKNA 4MUAA 4TM7A 2WYUA 3FRJA 2Y1EA 3GJ0A 3QNUA 4ZOEA 3ETNA 4YP6A 1FC0A 2P69A 2HSDA 3ZHXA 5FUMA 5K01A 3VMMA 4TS1A 1JPNA 3L7BA 3KWFA 4E16A 3N1UA 4O1MA 3OZVA 5DEOA 1RP7A 1YMVA 4GGMX 4P54A 4GPZA 1RYFA 5M34A 5IJ0B 4NE7A 1N2CA 3I2YX 3RHFA 3JTEA 3IS3A 4GT1A 4X20B 1ZHHA 3NH9A 5T67A 4R3UC 3WIEA 2KSQA 3WTCA 2G36A 1VYUA 4KG7A 3ZIAD 1F38A 1BXGB 1XVAA 4GRDA 4HAWA 3AG6A 5BVHA 2IHVA 2H1LA 3F97A 4TX1A 3NM6B 3JQRA 3JVIA 4M9UA 4MHOA 2C7VA 1BW9A 2Y27A 3MTQA 4B80A 3FJYA 3IAS6 2V6IA 3A6GA 1UM8A 8GPBA 5CDGA 2BFWA 2VDUE 1OH5A 2ZUBA 1T9CA 1TIPA 2FWBA 4A2PA 5JCZA 1C9NA 1UBGA 2QVGA 4KTTE 3QEOA 5GJVC 3U7RA 4ARUA 4CM4B 4N0PA 3DMNA 3SHFA 4ESHA 1WXHA 2D06A 1CP3A 3CT4A 1D4ZA 3AB8A 3N53A 4NVRA 4YNBA 4I2VA 2BE7A 2RGCA 4M21A 1X7DA 2JLCA 1XI2A 4DRXB 4DIKA 1V3QE 4NATA 4EECA 8LDHA 3R9WA 1RHRA 3IBGA 3LX4A 3OIYA 4U8HA 3ZXYA 3PR2B 5EJ5A 2F4VB 3NI2A 4GKVA 1EGMB 4L16A 3EARA 1UF9A 1RVDA 5HJ7A 3GLHA 3ZI4A 3S7ZA 1CJVC 1Q77A 4IFBA 4K2AA 4JDUA 1AKYA 1Z6GA 3BPSA 3QPCA 4ZV9A 3ZTYA 4JVLA 2ATCA 3H2ZA 4JZKA 1ZJWA 1PN3A 1USWA 1ZMBA 3ISJA 3JQ7B 3H2SA 1IMJA 1M6EX 4S2UA 2P6PA 4U2KA 1QIFA 2GXUA 3UMCA 1YZTA 2PL5A 2ES4A 5CHYA 4YFVA 1VL2A 4HQLA 4XUDA 1XZ8A 1BJKA 2VP5A 4F5WA 5A4JA 1BGVA 1N5KA 1Y3FE 2H16A 5EP3A 3IBFA 2IEBA 2JFXA 1DC7A 1U1GA 5E2AA 3RS4A 4COOA 4D1YA 5KU7A 2WDZA 1E3IA 5K0NA 3SEFA 4OFWA 2V0CA 3NWOA 3WMWA 4DV0B 3M34A 4YACA 2HBQA 4OXQA 4WZAA 2ZLBA 1DIHA 4ZT5A 4L6IA 3PQFA 1DC8A 1YZFA 4ZYYA 3JQGB 2I7DA 2J5RA 1YC5A 3CWCA 4FGZA 4HSGA 1V45E 3EEQA 4RGYA 2MSNA 4YMWA 4EJMA 5CLFA 2R5WA 2FW9A 3VQTA 4B31A 4QQRA 2QIPA 3MRVA 2YFYA 3DD1A 3U1VA 3GPLA 3E3MA 2HBZA 4DBVO 3T1NA 1FRQA 4RGBA 4XCQA 5J43A 2RAUA 5AIAA 4W5NA 4XSHA 3MGGA 3GGDA 1YZQA 4LBWA 4MIYA 3TNJA 3W2EA 5DNCA 4FP9A 1ILWA 2C96A 1HKUA 4OAQA 2ZYDA 5DNDA 1Z0DA 1EJ6A 1BVRA 2WUFA 1ZD4A 3F9IA 3OUZA 4MWDA 1IULA 5KCMA 3V4RA 3T94A 3GAAA 4QGFA 1U8AA 3RVRA 4CQMB 4WXRA 3UAWA 2C58A 1CT9A 4MJLA 5IT5A 1DADA 1E2IA 3G6KA 4MUBA 2R2GA 3KOOA 4UDYX 2VQEB 4OMFG 5A0VA 2HU8A 4XIIA 1NX6A 1X1TA 1PR4A 5LU9A 3QSYA 2F6RA 3KB1A 5LB2A 3UMMA 1TNDA 4DC1A 3AB3A 4WXEA 3OQBA 1KHTA 3I1YA 2G1JA 4B9EA 3KYIB 4O4HF 5GM2A 4TKVB 5F21A 4BQOA 3TI9A 3MLBA 2HZ7A 5IJ9B 4R5HA 3VO9A 3VOBA 3Q8XB 3ZWDA 2BMDA 4EGJA 2QPOA 2O8CA 1TT5B 4FCTA 4PBTA 3HB1A 3AR3A 1NY5A 4FEEA 5CM2Z 3FMVA 1E7SA 1SBTA 2ZE5A 1SBQA 4DXAA 3V4VB 2DPXA 4KMOA 4C6SA 4GL2A 5FUBA 2CCGA 3W8DA 2Z6QA 4QIHA 3S27A 4BLUA 1LZLA 1K6MA 2EDCA 3T7IA 4D9HA 3LBHA 4CM8B 2MHCA 2AMLA 4MTLA 4CGYA 3ZJVA 1A3CA 1DU4A 1M8JA 4E21A 3KOZA 4WBXC 4J2HA 1TM1E 4PLVA 5EMNA 3DW3X 1MVLA 1Y4UA 5JMWA 3BORA 1SEPA 1E1QD 4AY3A 5IHPA 1Z4LA 2BMVA 2RHMA 3AKCA 1TD9A 2KW5A 4RV5A 3PTAA 2W2MA 4CKBA 3CUKA 3MBOA 1C9MA 3ZE1B 4TT3A 5HIJA 1QVZA 4BO1A 5JCPA 1AKEA 3QJYA 1CRPA 1DOHA 4WLFA 1V11B 2C59A 2PZMA 2V58A 4BMSA 3QVUA 5ADWA 5HF5A 5KPDA 2VTBA 3JD2A 4EEXA 1YDWA 2DHCA 2R66A 1EDDA 1OAOA 4LDAA 4TSFA 4WZBA 3RAEC 4YJ2F 4YRAA 4IXWA 1QF9A 2HLDA 3GH3A 2QYTA 1RRPA 2XI4A 4V38A 5C37A 4BE9A 5AI6A 2WRZA 3B2QA 3BA1A 3OCZA 3V7WA 2BLNA 2ETXA 1AMOA 4I50A 4D80A 3A28A 2NU8B 1TC1A 2P1RA 4LI0A 5KYXA 3ZKWA 1KRWA 4DQXA 1SQ0A 3LVQE 4MRSA 4MP8A 1WS6A 2CXNA 5DGTA 1XQVA 4EI8A 4UULA 2ZTSA 4TN5A 4C89A 3L02A 4MS4B 3FYUC 3GWGA 4CBVA 1CETA 4IDFA 1RJDA 2DFKB 3TRFA 3I5UA 5J2UB 3IR6A 2GNOA 3GDFA 3BSYA 2JLXA 1M2HA 1ZZGA 2W6ZA 4TMWA 2FRVA 4B6FA 3IMFA 3DKIA 2VEOA 1U7UA 3PX2A 1GO2A 2PIDA 5DMHA 4J3FA 3GP3A 1Z0SA 2DR3A 1PS9A 4M3NA 4WN9A 5CNIA 3O8RA 5DH9A 1IXKA 4C3OB 5L8VA 1PJ2A 3C48A 3IPCA 1KVRA 4MYTA 2BMEA 1ZMRA 5F64A 3UMFA 1ADYA 2WFLB 3AP3A 2PGLA 4YRLA 3MEQA 4DHWA 1VJDA 4TYQA 2OXTA 4N9QA 4UOQA 2AK2A 3QIVA 5EMKA 3VZQA 2WTNA 2PX8A 4J1NA 2Q9CA 4IZHA 2QB5A 1BFDA 1O03A 1Y3BE 2JFWA 3AK4A 3F3KA 3IT3A 3K0CA 1UMDA 4IQGA 4UUBA 4DXHA 5KWEA 3BB3A 3BFJA 4TZKA 2PKEA 2ZIZA 4ALJA 2QEQA 4TQAA 4WXYB 3VKGA 3U7QB 3CEAA 3B89A 3L7KA 3AI3A 2P9CA 1F5SA 3B20A 1E3WB 4PINA 2JJMA 4UE6A 2XH8A 1XSEA 5BV1A 2PCKA 4OGFA 3PFHA 4EM6A 1WHSA 1X7YB 5TE9A 3ZWYA 4EGSA 3GFGA 2WZDA 4PYKA 4P3YA 2QIOA 5DSZA 4F5YA 1LBQA 3T7CA 5BSWA 3HG7A 2X5KO 2H3EA 3BXGA 3D3QA 5EJ7A 1XOIA 3F6CA 4DBLE 1APBA 3PT5A 1PWHA 2UAGA 4EHNA 1W94A 1HT0A 3ETCA 3TVDA 3K0HA 3BEOA 4UUOA 3E9YA 3SFTA 1MZVA 2B78A 4B4KA 1AGYA 2VQ3A 4BKRA 5J3JA 2G88A 4W6QA 1DKMA 5A5VA 2JFVA 2O9JA 3H8SA 3KEQA 3ZGNA 4HY3A 2H2AA 1NR7A 3B1VA 3DVQX 2WM3A 5DSTA 3WNDA 1SPXA 1OLUA 2CNKA 3DHWC 4YECA 4CLRB 3NV7A 3ZCVA 4B82A 3VDQA 3T7TA 5LA6A 5KX5A 4LVNA 1NL3A 3T7SA 1P3JA 1KZ7B 5ELMA 3WOHA 3I4TA 3LUHA 2H3HA 4XI9A 3UXHA 1GEGA 1Z88A 3RTCA 2GEUA 4KKVA 2WYVA 1I3LA 1XVTA 3E53A 3PFNA 3QYPA 3GRRA 4P38A 4W4TA 5TB5A 1XEXA 4D8UA 3RFFA 3WL7A 3A4NA 2R1TB 5TC4A 4GPEA 2PG3A 3W8EA 2L69A 4B8WA 1FYWA 1JRLA 1XEAA 1F3LA 3QKWA 5AM4A 2F4NA 2IODA 3FLBA 4EYSA 4P92A 4JLDA 4BMZA 1O0BA 1NYQA 4U7WA 3VO2A 4D0NA 5EHXA 3OQIA 4LGMA 4RD3A 1PR2A 3ZNOA 2JGNA 5L45A 3PEYA 1MF7A 4N6NA 4RTMA 2BLLA 1NJ1A 2BF7A 3FUTA 1MEOA 4X45A 5CLLA 1XC7A 2F43A 2XMRA 4AWAA 5AW1A 5IDQA 5DTIA 1CS0B 2DFNA 2WSMA 2EF1A 4C0WA 1U8TA 5IDXA 1QH1B 1SUFA 1E3MA 3VKFA 1UKEA 3HC7A 2GD0A 3WDLA 1IJBA 2WIBA 4DM7A 5H8WA 4E46A 1UP6A 2ZJ0A 4U39A 3U17A 3N2GB 2AV6A 4ZMRA 3LT5A 4IUDS 4S1TA 2YJ6A 5AJTA 4PG4A 5IW8A 3VSCA 5I8ZA 3TN7A 3NC4A 5BR7A 4ODIA 5KNBD 5KQPA 5SYMA 5KTYA 3G2HA 5D3ZA 4OFZA 1P80A 3GFFA 2WMOB 3RVPA 4CIDA 3OQNA 4L51A 1ONNA 2ZUDA 2YUIA 3HY4A 2NV6A 1K7YA 4M99A 1H8EA 2B82A 2YRFA 1ZG3A 2OB1A 3VHXB 5JO9A 1OBFO 3E23A 3R24A 5EWLA 3ZE0B 1QS0B 3C41J 3CUYA 2VLIA 3O8BA 4YJDA 3DZDA 5G1PA 5C0OE 3AJAA 2I2WA 1E4EA 4HEA6 3OWOA 1N4AA 5DGDA 1IJFA 1XRLA 3GO4A 3MMPA 2RG1A 1EIWA 1S2OA 1XZLA 3ISVA 2CLOB 2P9YA 4IO1A 5J4LA 4X9XA 1ULTA 2H4YA 4LPSA 1W87A 3WYDA 2HHHB 3PVZA 3CIOA 4Q4AB 3BGWA 2VRBA 3LT1A 4MKXA 2J5BA 5CEFA 3ASVA 1LRKA 2AKYA 3DE5X 2F3QA 2XNKA 2X5OA 2PPLA 4JNCA 5K0CA 1YAHA 4DDWA 1ZNWA 3ILSA 2NUBA 4HDMB 1Y34E 2GRUA 2N42A 3DZGA 3OE1A 4S35A 5EZ6B 3WQQA 4QUBA 1RLMA 3I2KA 3V3TA 4ALNA 5HDBB 2C04A 1SVSA 1SD2A 4UZFA 4V0MA 1M75A 3EC1A 1HE4A 1RXYA 1JT9A 1K4MA 2PT9A 2G9VA 2QVZX 3AYXB 1WLSA 4AZ0B 2J0QA 4EG5A 5E95A 1TM7E 4WOBA 2VATA 3IMGA 2C98A 1RHUA 3OZEA 1FUYB 1R4NB 1UK7A 2ZAYA 3OZRA 4GQIA 4O2AF 4RZQA 1UINA 5AH0A 5KJ1A 1G20A 3VDMA 1RWOA 1F7VA 2PUCA 2HUVA 2OV8A 1OU4A 1GU0A 3D54D 4HMQA 5A4KA 3B1JA 5B2FA 4NI5A 3O4RA 1KMQA 3NHRA 3BSSA 2POCA 2W6QA 3NJ4A 1RTKA 4N40A 3STUA 3GLQA 2WTUA 4G97A 4Y2HA 2HRDA 3K2BA 4HVCA 5BR4A 1GGHA 3I5AA 1D2MA 2H1HA 4RTNA 2PXHA 1PNRA 1JLLB 2BM8A 3BK2A 4NPCA 3G5UA 3QMVA 2XE4A 3AIIA 5JJKA 1HDYA 2PMEA 1A9QA 1T0IA 4LMPA 4E5PA 2V74B 2LCFA 5CMLA 4BGDA 1G8YA 2CZCA 2IXDA 3HACA 3LLSA 4DJJA 3NAQA 1FSGA 4K9MA 4TLAA 3EYWA 2Z9BA 3LC1O 4LE2A 4P82A 1N2GA 3RS0A 3SR3A 2H2HA 3T52A 2SKDA 4CM5A 5DDIP 3VR6D 4BVKA 1GTG1 2P40A 1A9ZA 3A3NA 3FGZA 1WXQA 3EWIA 1ONBA 3OPYA 4HTAA 1PG2A 2Q3EA 2UYHA 4D9MA 4D57A 2HSEA 4RF3A 4HGYA 3NPAA 2ZIXA 3BMOA 1ZHFA 5FOSA 1SC4A 4C7KA 2D5AA 4LSWA 1VJTA 3TG8A 2OLEA 2ED5A 3D4LA 3I42A 3FM9A 4P3XA 2Z6VA 4NONA 1L6IA 1K86A 3GG9A 1Y1LA 1OWLA 1EA7A 2CVZA 1OZ0A 4YAEA 5ESWA 3WK4A 5IRCD 1SU6A 4JI8B 4DADA 2GEDA 2OHFA 1TGYA 2G5CA 2X58A 3ZX5A 2GYVA 5HE9A 4C6TB 5CDYA 3U3XA 2OZLB 3I0ZA 5C9ZA 3BMQB 1LK0A 1QZ3A 1G98A 1KI6B 1PWZA 1Y42X 4EW6A 3IHLA 2HV9A 2J1LA 3RRNA 1ZPDA 5DNEA 4ZI2A 2HQOA 3WK6A 2EWWA 3R3HA 4LSMA 4JAVC 4HTFB 4EGAA 4H4EA 3KK0A 3DDWA 3I6YA 4W9NC 4IXMA 4GO1A 4OQMA 4O4JA 4O02B 2SICE 1VKNA 4YMVA 4PC3A 2IH2A 3HH1A 1IHOA 3NAMA 4XSGA 3G49A 3QLVA 4M83A 3BZUA 4A0GA 2R1ZA 2WPDA 2UXCB 3AETA 3WGQA 2F3UA 2KMLA 1T26A 5DLQC 4ZU3A 3LHKA 5G41A 2DUJA 2O4UX 4KFUA 4I4NA 1HEYA 3QE0A 4FSDA 3ROPA 3AIMA 5CBPA 1FX0B 2HHCA 3UGTA 3KHTA 1GLVA 5IUJC 3C8MA 4XAQA 2OV6A 2P1ZA 1QE3A 1BCRB 1DBSA 3FFAA 3IQHX 4R2MA 5GGXA 4E1AA 5BY2A 2BKVA 1I1NA 3R3WA 1T3HA 2EGGA 4JLAA 4OQZA 1BXRA 2P2YA 2ZB2A 3DZIA 3TKLA 3CUUA 4EY3A 2G82A 3H4IA 2LNDA 2OQIA 1IDOA 4QDUA 1F60A 4BNWA 1Q74A 3HB9A 5SYAA 4CL3A 5KTTA 3U4MA 1PE0A 5FB3A 4GUAA 4C0JA 4EA9A 5JE8A 1BAPA 3H4MA 3VJKA 1ZAYA 1A69A 3U48A 3ZU4A 2XVMA 3O6VA 2DFVA 3K8QA 1MOPA 4NG4A 3UB3A 4BWYA 2FZ5A 2ET6A 5KMGA 1WPQA 4A15A 1RJ9A 2GWHA 2BKXA 1GLNA 2CJFA 2PWBA 4LHZA 4DARA 4UMDA 4X3PA 2H59A 1Y1PA 3C5VA 5CRIA 4JX9A 4A0FA 3LXRA 5EE0A 4JUAA 2BGMA 4UNPA 4HDRA 5CH3A 1J1UA 1D2GA 4ZOLA 3MAAC 3WQRA 4RQUA 1A9XA 2QAGA 2C2XA 3HYSA 4ITUA 1Y7IA 3SYRA 2B25A 5KJEA 5DX1A 4CIBA 1XYVA 3P9NA 1GDTA 4JJKA 3OZSA 3RKRA 4XYBA 4UPEA 1A8PA 3LH5A 3C7CB 3S8EA 2IPXA 3O0DA 5DTEA 5E7IA 2JIQA 4IV5A 1YSCA 2JBHA 3QP9A 3GFVA 2JIZD 1MVNA 5B1EA 1V6CA 1X8JA 4BV9A 3UJ8A 5FULA 2IJGX 5I9LA 4JELA 4QU9A 1BQEA 1N5OX 2DXVA 4HLUC 5HFJA 2GHRA 3VU0A 1ZNYA 4X66B 1T3ZA 3R4VA 4PS1A 4TS3A 4GI2A 1GSHA 4JBLA 2EHLA 5AXDA 4PBRA 4JI6B 1EZZA 3IB6A 4MGZR 4R6WA 3WRWA 2K6GA 3KYJB 1RRVA 2GGSA 3OURA 3VVLA 4ARBA 5HFAA 1WXXA 2XJ9A 4XDHA 4OKIA 3O4JA 1ISPA 1EJ0A 4F56A 3HCCA 3ZUGA 4YB8A 2ADMA 3KKOA 4QA9A 1KOFA 5IZ4A 1BU5A 4GX2A 2VNHA 4TPKA 2HRBA 5I45A 1YVUA 2CKMA 4JXJA 4TUYB 2PGJA 1U3FA 2DKNA 5E1MA 4H7FA 5DCWA 4AJNA 5GTDA 1OT3A 4MO2A 2YWHA 3F1KA 2PE5A 3BF8A 2BGIA 2BDTA 3IQZA 3NW9A 4PFQA 3ROTA 1UAAA 2BPOA 5TJHA 3HL4A 4BN4A 4U2GA 2XXBA 3IOEA 1GV0A 2WKSA 2J85A 3GRPA 3GVPA 3ROKA 1H8HD 3K0BA 2GN4A 2VT2A 5G4KB 3NETA 1D4OA 2ZDGA 3RRBA 3OU7A 3VR3A 3DYBA 4Y9UA 2JK0A 1E2GA 4MLDA 4ZYVA 1FSFA 1SKYE 1XAHA 5D3QA 4OB8A 2CT8A 4YTEA 4WKGA 2YQZA 3FTEA 1X2BA 2X9VA 4CL8A 4M7WA 4HAOA 1NXXA 1US8B 4OTZA 5FOQA 2JGLA 3PFFA 1XRNA 4CKEB 1PWXA 2IK8A 4N39A 1SBIA 3TG2A 4AKSA 2J87A 3JD3A 3RSGA 3MIIA 3G8DA 1Q7EA 2WU4A 4IH4A 4M7PA 1XD2B 3AI1A 3GBPA 4XOUA 5WRFA 4BB6A 3WKEA 4P80A 1O57A 2XOEA 3WNVA 1DEAA 1L4BA 5I3CA 4P8RA 1Y4AE 2HV8A 1UOOA 3DEZA 3PX3A 4L73A 4LS3A 5EWJA 1HL3A 2CMFA 3ZV6A 2OCPA 3F7OA 3T4XA 4PLPA 1INLA 2P68A 4MIOA 3NIBA 1X38A 1HSOA 4OQ4A 3WIOA 3AP2A 3SF8B 2DWUA 3EIOA 2CUZA 4RH0A 1LVGA 5A05A 4A10A 1COWA 2Z43A 3BIFA 3EC2A 3EWSA 3NYWA 2H18A 2XY4A 4WA8A 5F3DA 1E7QA 2JIPA 3LCRA 4Q3AA 1E1LA 1E61A 2DFTA 3W6PA 5BYJA 3L05A 1JDSA 4QLOA 4QTXA 3QX9A 5CCBA 2AFIB 5KOJA 1KI8A 3DB2A 3K2QA 3ZBTA 4AM8A 3G8AA 1BWQA 3FOEC 4FM9A 2C92A 4L9WA 1JDNA 3BJZA 1FVOA 2I87A 4CR7A 3IODA 5JAZA 3QVTA 4S0XA 3SBOA 4PAQA 3U6BA 2YWBA 2XXAB 4OXYA 3HN2A 2Q1SA 1NKTA 2HA0A 3MGBA 2FPLA 4C43A 1AHNA 1XZEA 2W90A 3N9IA 4ZVNA 1PV4A 4XW2A 2IBSA 1BE1A 5EZYA 1MPTA 1NV8A 2VNKA 2ACWA 1RYEA 4MULA 4EFDA 2NM0A 1T3GA 4YXWA 4Y6OA 1J22A 1MB2A 3IRUA 5TQ0A 1KZ6A 3PGLA 3PITA 4OBEA 4PNPA 5F52A 1R0KA 5LQSA 5K6AC 3OWXA 5I3ZA 4FDLA 1GD1O 1N1EA 2P9DA 4BKPA 1L5KA 4H0CA 4MMYB 1XYGA 3S2FA 2QTZA 3QKRB 3KPJA 3L0SA 5FV7A 1C2YA 4PY2A 4RIHA 1WSWA 1EINA 5M29A 3JARB 1GR0A 3HEBA 2JGRA 5G3YA 3R76A 3IT2A 4UHHA 2M98A 1SOVA 1WZNA 4A0QA 4TT8A 4YV1A 5A5DA 3H8VA 3NDCA 2B94A 4K26A 3OCWA 1QR2A 1BRTA 1GFSA 2PBZA 3KCQA 1W2GA 2QTGA 1NDQA 4PRZA 4DV7B 3CVYA 1XMSA 4BP9A 3N2IA 2B5OA 1ELOA 1P81A 4AF8A 4L15A 4DDMA 5IU6A 3A9CA 5AVYA 4NAHA 4YJ3B 1AF4A 5I4IA 4IW3B 4QC2A 3S44A 1VL5A 4ZO6A 3R5TA 5F7XA 3D2CA 1G8GA 3ENVA 4O4HB 1TPZA 1CUBA 5B58T 3R40A 2WM9B 3CPEA 3SLGA 4DLTA 2JCBA 3I1JA 1UQRA 2Z9DA 2P2SA 3GIWA 3UMGA 1OXVA 1T8YA 3IDQA 2G7ZA 3O1HB 4ZO4A 1K7FB 4EPRA 1IN1A 2RD2A 1NU6A 3KU4A 2CV0A 3FKJA 1TU3A 3KYCA 4CV3A 1JF8A 3KJIA 1MJGM 121PA 3DMTC 3EVFA 4PLCA 1NZFA 4CR8A 2LIPA 3LT4A 2VHQA 1WVIA 1WX1A 4QFBA 4WK0B 2VRNA 1ZJJA 3HU3A 4MH0R 1YIAA 4EG1A 5CG2A 3PA8A 5JH7B 2JHAA 2YJZA 1HBJA 1EHYA 2C4KA 2Q3MA 4JI2B 2O2ZA 5DBOA 1Q0RA 3R77A 4C0AC 4GR5A 1DOZA 3L4KA 3O91A 2JHFA 2E4WA 1NJFA 3OCCA 5GAJA 4WINA 1O6CA 3OQ1A 3S29A 6LDHA 1GRCA 2BJHA 4GI1A 4RETA 1BHO1 3VPCA 2YL2A 3FOAA 3BKXA 2C7BA 3I37X 2C4UA 4ZGBA 4Q1BA 3QE3A 3DEJA 4TS4A 1RLTA 3LNCA 2IVZA 1SRRA 2Q0QA 2LIVA 2YRXA 4MV3A 4UEJA 3PE3A 2QMUA 3VH2A 5HS4A 2BTOA 3H65A 5BNWA 4V0KA 4YJ2B 1TVKA 1ENYA 1HDEA 3UJAA 2VYCA 1JA1A 2B83A 3AM4A 2WSBA 4D0RA 3FGPA 4XQEA 4IYRA 3A06A 1Z28A 2YYSA 1OYOA 2XF8A 5KNCA 4GI7A 4LA4A 4D6PA 4FNAA 5EG5A 1ZS9A 2B92A 2RGYA 4G0OA 4KPUA 1YBVA 3DXFA 4R8SA 4L02A 3ZJ4A 1HLFA 3FI0A 5BRNA 1C50A 2O1WA 3H99A 1P4RA 2PRJA 1DAPA 4WEOA 5COQA 1XWFA 2OVFA 2Z2ZA 4MR8A 4TLDA 5BUCA 1XXHB 4R84A 2R8EA 2EJCA 1YR8A 3IH5A 1U2PA 2OP0A 1WMAA 1SB9A 3SS7X 4DV2B 4D3ZA 2IS2A 1MB9A 5ISMA 3TSAA 5EWMB 1VP