3DNGA

Crystal structure of the complex between mmp-8 and a non-zinc chelating inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
163
structure length
163
Chain Sequence
b'MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil collagenase
publication title Extra Binding Region Induced by Non-Zinc Chelating Inhibitors into the S(1)' Subsite of Matrix Metalloproteinase 8 (MMP-8)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3dngA00
2E3XA 3LQBA 5I43A 2DDFA 5D7WA 3LJZA 1JAQA 3LE9A 1BKCE 1CXVA 4G0DA 2W0DA 1D7XA 1A85A 4G9LA 4L63A 1OO9A 2CLTA 2I47A 3EDZA 1K7GA 2N8RA 2OXUA 3LIRA 2XS3A 5D3CA 4PKUA 1QIAA 1SU3A 3LEAA 2USNA 4I03A 4GF1A 5I4OA 1WNIA 1R55A 1JIZA 4PKQA 4DPEA 3KRYA 1PWUA 3VTGA 3ZUKA 1JK3A 5B5OA 1G12A 1FM1A 2X3CA 4PKSA 2EROA 3KEKA 1O0QA 1EUBA 3KHIA 1XUCA 4A3WA 4DD8A 1BQOA 4WK7A 4H2EA 2O3EA 3O64A 4CTHA 1UEAA 1CGFA 1HFSA 1IAEA 1XFWA 2WO8A 3F19A 2E2DA 3P24A 1YQYA 3TSKA 1ZXCA 4H1QA 3LJGA 5B5PA 3AYUA 4DF9A 3ZVSA 2DDYA 3O2XA 1IACA 3TVCA 1RM8A 4GQLA 1CAQA 1GKDA 2RJQA 1XFXA 4GR8A 4JA1A 1Z3JA 2X7MA 3F17A 1BKCI 5L7FA 1BKCA 4GWMA 1KBCA 1JANA 1GE7A 2JNPA 5I2ZA 2WOAA 1GKCA 2OW1A 4HX3A 1GE6A 3RTTA 3I7GA 1CIZA 1B3DA 1SRPA 2JT6A 3I7IA 1ZXVA 2MZHA 4R3VA 3U1RA 3V96B 1JAPA 1C7KA 1YCMA 2D1OA 1G9KA 4L19A 1CGLA 4HMAA 1AYKA 4WKIA 1ROSA 5I12A 4PKRA 1HV5A 2DW1A 1PWPA 1XFZA 2JT5A 3K7LA 3MA2A 3LJTA 4ON1A 3EHYA 4JIJA 3P1VA 3BA0A 4FVLA 4ZR5A 1O0TA 3KMCA 4WKEA 5D2BA 3HBVP 2MLRA 4H76A 2OW9A 2AYKA 4FU4A 1R54A 3Q2GA 1ATLA 3EWJA 3AIGA 3SHIA 1UMSA 5I3MA 4GWNA 1ZVXA 3ELMA 3GBOA 1JIWP 2MZEA 1KUHA 3G5CA 3UVCA 2J0TA 3HYGA 1OS2A 5L79A 3HB2P 3WV3A 2OZRA 4GUYA 1I73A 2K9CA 3OHLA 1BUVM 3DPEA 1XFVA 4H82A 4GR0A 1GO7P 3KMEA 3CKIA 4JP4A 5D1SA 4XM6A 1BSWA 1XUDA 1GXDA 3TT4A 1OMJA 3LQ0A 4GR3A 1H71P 2X3AA 3KECA 2A8HA 1YP1A 2MLSA 830CA 2ERQA 3N2VA 1JKYA 4H84A 1CGEA 1EB6A 2J83A 3G42A 4FXQA 1QJJA 1IAAA 1AF0A 1OM6A 2V4BA 4EFSA 1Y93A 3ZXHA 1MMQA 1XURA 1J7NA 2FV9A 4H49A 1JH1A 3NX7A 2W13A 5D1UA 1ZTQA 1Y0VA 1GO8P 1HY7A 3TS4A 1SLMA 5CXAA 4ILWD 4QKZA 4XBHA 1I1IP 3DNGA 4DV8A 1K7QA 1I76A 5H8XA 5JMYA 1SMPA 2MZIA 4AUOA 1R1HA 4AYKA 4H30A 2DW2A 1CQRA 2W14A 1BQQM 1HTDA 5BOTA 1HOVA 2OVZA 2OW0A 2SRTA 3EDGA 1UMTA 3DSLA 2D1NA 3F15A 1OS9A 2KRJA 3Q2HA 5CUHA 3EDIA 4XCTA 1MNCA 3HBUP 1D8FA 1D8MA 4JPAA 1JAOA 3F16A 1D5JA 1UTZA 1G49A 2OXZA 1FLSA 1C8TA 2QPJA 4WZVA 4JQGA 1HFCA 1KUIA 3KEJA 3LK8A 1QICA 1QUAA 2JSDA 1FBLA 1PWWA 5I0LA 1BZSA 1BIWA 3LMCA 1C3IA 3RTSA 1G4KA 3LGPA 1OM7A 1K7IA 1ZP5A 1SATA 4IN9A 456CA 2WO9A 3B8ZA 1KUKA 2YB9A 1UTTA 4XM8A 1XFYA 1IADA 1R1JA 3EHXA 3LUNA 3LILA 1AKLA 3DPFA 2TCLA 5D1TA 1PWQA 4H3XA 2L0RA 4J4MA 2OY4A 4PKWA 1YOUA 4PKVA 5CZMA 1KUFA 1USNA 1KAPP 2Y6CA 4Q1LA 1S4BP 3WV2A 5BPAA 3F18A 1L6JA 3KWVC 3L0TA 1ASTA 4WF6A 3E8RA 1JJ9A 1IABA 2K2GA 4PKTA 3K7NA 4AIGA 3EDHA 1IAGA 1Y8JA 2W15A 4XM7A 5BOYA 1XFUA 3HDAP 3B2ZA 1A86A 1RMZA 4AXQA 4IUWA 2JIHA 4A7BA 1EAKA 1CK7A 3VI1A 3HY7A 4L6TA 1ZS0A 1MMBA 1QIBA 1MMRA 2Y6DA 1GE5A 2CKIA 2PJTA 3DL1A 4FXYP 1OM8A 2OY2A 2XS4A 3LUMA 2Z2DA 2POJA 2HU6A 2ERPA 1PWVA 2OVXA 3USNA 1SLNA 2OI0A 3HDBA 3F1AA 4IJOA 2RJPA 2YIGA 1ND1A 1BUDA 2W12A 1DTHA 1B8YA 2X3BA 5LABA 1G05A 2O36A 3WV1A 1QJIA 3OHOA 1Q3AA 4I35A 3LIKA 2OW2A 3L0VA 3B92A 3AYKA 966CA 3LKAA 2OXWA 1R1IA 1MMPA 2AIGP 1BM6A 3N2UA 2FV5A 3HY9A 1KUGA 1DMTA 3DWBA 2DW0A
chains in the Genus database with same CATH superfamily
2E3XA 3LQBA 5I43A 2DDFA 5D7WA 3LJZA 1JAQA 3LE9A 1BKCE 1CXVA 4G0DA 2W0DA 1D7XA 1A85A 4G9LA 4L63A 1OO9A 2CLTA 2I47A 3EDZA 1K7GA 2N8RA 2OXUA 3LIRA 2XS3A 5D3CA 4PKUA 1QIAA 1SU3A 3LEAA 2USNA 4I03A 4GF1A 5I4OA 1WNIA 1R55A 1JIZA 4PKQA 4DPEA 3KRYA 1PWUA 3VTGA 3ZUKA 1JK3A 5B5OA 1G12A 1FM1A 2X3CA 4PKSA 2EROA 3KEKA 1O0QA 2YUFA 1EUBA 3KHIA 1XUCA 4A3WA 4DD8A 1BQOA 4WK7A 4H2EA 3DTIA 3O64A 2O3EA 4CTHA 1UEAA 1CGFA 1HFSA 1IAEA 1XFWA 2WO8A 3F19A 2E2DA 3P24A 1YQYA 3TSKA 1ZXCA 4H1QA 3LJGA 5B5PA 3AYUA 4DF9A 3ZVSA 2DDYA 3O2XA 1IACA 3TVCA 1RM8A 4GQLA 1CAQA 1GKDA 1XM5A 2RJQA 1XFXA 4GR8A 4JA1A 1Z3JA 2X7MA 3F17A 1BKCI 5L7FA 1BKCA 4GWMA 1KBCA 1JANA 1GE7A 2JNPA 5I2ZA 2WOAA 1GKCA 2OW1A 4HX3A 1GE6A 3RTTA 3I7GA 1CIZA 1B3DA 1SRPA 2JT6A 3I7IA 1ZXVA 2MZHA 4R3VA 3U1RA 3V96B 1JAPA 1C7KA 1YCMA 2D1OA 1G9KA 4L19A 1CGLA 4HMAA 1AYKA 4WKIA 1ROSA 5I12A 4PKRA 1HV5A 2DW1A 1PWPA 1XFZA 2JT5A 3K7LA 3MA2A 3LJTA 4ON1A 3EHYA 4JIJA 3P1VA 3BA0A 4FVLA 4ZR5A 1O0TA 3KMCA 4WKEA 5D2BA 3HBVP 2MLRA 4H76A 2OW9A 2AYKA 4FU4A 1R54A 3Q2GA 1ATLA 3EWJA 3AIGA 3SHIA 1UMSA 5I3MA 4GWNA 1ZVXA 3ELMA 3GBOA 1JIWP 2MZEA 1KUHA 3G5CA 3UVCA 2J0TA 3HYGA 1OS2A 5L79A 3HB2P 3WV3A 2OZRA 4GUYA 1I73A 2K9CA 3OHLA 1BUVM 3DPEA 1XFVA 4H82A 4GR0A 1GO7P 3KMEA 3CKIA 4JP4A 5D1SA 4XM6A 1BSWA 1XUDA 1GXDA 3TT4A 1OMJA 3LQ0A 4GR3A 1H71P 2X3AA 3KECA 2A8HA 1YP1A 2MLSA 830CA 2ERQA 3N2VA 1JKYA 4H84A 1CGEA 1EB6A 2J83A 3G42A 4FXQA 1QJJA 1IAAA 1AF0A 1OM6A 2V4BA 4EFSA 1Y93A 3ZXHA 1MMQA 1XURA 1J7NA 2FV9A 4H49A 1JH1A 3NX7A 2W13A 5D1UA 1ZTQA 1Y0VA 1GO8P 1XAXA 1HY7A 3TS4A 1SLMA 5CXAA 4ILWD 4QKZA 4XBHA 1I1IP 3DNGA 4DV8A 1K7QA 1I76A 5H8XA 5JMYA 1SMPA 2MZIA 4AUOA 1R1HA 4AYKA 4H30A 2DW2A 1CQRA 2W14A 1BQQM 1HTDA 5BOTA 1HOVA 2OVZA 2OW0A 2SRTA 3EDGA 1UMTA 3DSLA 2D1NA 3F15A 1OS9A 2KRJA 3Q2HA 5CUHA 3EDIA 4XCTA 1MNCA 3HBUP 1D8FA 1D8MA 4JPAA 1JAOA 3F16A 1D5JA 1UTZA 1G49A 2OXZA 1FLSA 1C8TA 2QPJA 4WZVA 4JQGA 1HFCA 1KUIA 3KEJA 3LK8A 1QICA 1QUAA 2JSDA 1FBLA 1PWWA 1TVIA 5I0LA 1BZSA 1BIWA 3LMCA 1C3IA 3RTSA 1G4KA 3LGPA 1OM7A 1K7IA 1ZP5A 1SATA 4IN9A 456CA 2WO9A 3B8ZA 1KUKA 2YB9A 1UTTA 4XM8A 1XFYA 1IADA 1R1JA 3EHXA 3LUNA 3LILA 1AKLA 3DPFA 2TCLA 5D1TA 1PWQA 3DTEA 2L0RA 4H3XA 4J4MA 2OY4A 4PKWA 1YOUA 4PKVA 5CZMA 1KUFA 1USNA 1KAPP 2Y6CA 4Q1LA 1S4BP 3WV2A 5BPAA 3F18A 1L6JA 3KWVC 3L0TA 1ASTA 4WF6A 3E8RA 1JJ9A 1IABA 2K2GA 4PKTA 3K7NA 4AIGA 3EDHA 1IAGA 1Y8JA 2W15A 4XM7A 5BOYA 1XFUA 3DTKA 3HDAP 3B2ZA 1A86A 1RMZA 4AXQA 4IUWA 2JIHA 4A7BA 1EAKA 1CK7A 3VI1A 3HY7A 4L6TA 1ZS0A 1MMBA 1QIBA 1MMRA 2Y6DA 1GE5A 2CKIA 2PJTA 3DL1A 4FXYP 1OM8A 2OY2A 2XS4A 3LUMA 2Z2DA 2POJA 2HU6A 2ERPA 1PWVA 1OZ9A 2OVXA 3USNA 1SLNA 2OI0A 3HDBA 3F1AA 4IJOA 4L7AA 2RJPA 2YIGA 1ND1A 1BUDA 2W12A 1DTHA 1B8YA 2X3BA 5LABA 1G05A 2O36A 3WV1A 1QJIA 3OHOA 1Q3AA 4I35A 3LIKA 2OW2A 3L0VA 3B92A 3AYKA 966CA 3LKAA 2OXWA 1R1IA 1MMPA 2AIGP 1BM6A 3N2UA 2FV5A 3HY9A 1KUGA 1DMTA 3DWBA 2DW0A
chains in the Genus database with same CATH topology
2E3XA 3LQBA 5I43A 2DDFA 5D7WA 3LJZA 1JAQA 3LE9A 1BKCE 1CXVA 4G0DA 2W0DA 1D7XA 1A85A 4G9LA 4L63A 1OO9A 2CLTA 2I47A 3EDZA 1K7GA 2N8RA 2OXUA 3LIRA 2XS3A 5D3CA 4PKUA 1QIAA 1SU3A 3LEAA 2USNA 4I03A 4GF1A 5I4OA 1WNIA 1R55A 1JIZA 4PKQA 4DPEA 3KRYA 1PWUA 3VTGA 3ZUKA 1JK3A 5B5OA 1G12A 1FM1A 2X3CA 4PKSA 2EROA 3KEKA 1O0QA 2YUFA 1EUBA 3KHIA 1XUCA 4A3WA 4DD8A 1BQOA 4WK7A 4H2EA 3DTIA 3O64A 2O3EA 4CTHA 1UEAA 1CGFA 1HFSA 1IAEA 1XFWA 2WO8A 3F19A 2E2DA 3P24A 1YQYA 3TSKA 1ZXCA 4H1QA 3LJGA 5B5PA 3AYUA 4DF9A 3ZVSA 2DDYA 3O2XA 1IACA 3TVCA 1RM8A 4GQLA 1CAQA 1GKDA 2RJQA 1XFXA 4GR8A 4JA1A 1Z3JA 2X7MA 3F17A 1BKCI 5L7FA 1BKCA 4GWMA 1KBCA 1JANA 1GE7A 2JNPA 5I2ZA 2WOAA 1GKCA 2OW1A 4HX3A 1GE6A 3RTTA 3I7GA 1CIZA 1B3DA 1SRPA 2JT6A 3I7IA 1ZXVA 2MZHA 4R3VA 3U1RA 3V96B 1JAPA 1C7KA 1YCMA 2D1OA 1G9KA 4L19A 1CGLA 4HMAA 1AYKA 4WKIA 1ROSA 5I12A 4PKRA 1HV5A 2DW1A 1PWPA 1XFZA 2JT5A 3K7LA 3MA2A 3LJTA 4ON1A 3EHYA 4JIJA 3P1VA 3BA0A 4FVLA 4ZR5A 1O0TA 3KMCA 4WKEA 5D2BA 3HBVP 2MLRA 4H76A 2OW9A 2AYKA 4FU4A 1R54A 3Q2GA 1ATLA 3EWJA 3AIGA 3SHIA 1UMSA 5I3MA 4GWNA 1ZVXA 3ELMA 3GBOA 1JIWP 2MZEA 1KUHA 3G5CA 3UVCA 2J0TA 3HYGA 1OS2A 5L79A 3HB2P 3WV3A 2OZRA 4GUYA 1I73A 2K9CA 3OHLA 1BUVM 3DPEA 1XFVA 4H82A 4GR0A 1GO7P 3KMEA 3CKIA 4JP4A 5D1SA 4XM6A 1BSWA 1XUDA 1GXDA 3TT4A 1OMJA 3LQ0A 4GR3A 1H71P 2X3AA 3KECA 2A8HA 1YP1A 2MLSA 830CA 2ERQA 3N2VA 1JKYA 4H84A 1CGEA 1EB6A 2J83A 3G42A 4FXQA 1QJJA 1IAAA 1AF0A 1OM6A 2V4BA 4EFSA 1Y93A 3ZXHA 1MMQA 1XURA 1J7NA 2FV9A 4H49A 1JH1A 3NX7A 2W13A 5D1UA 1ZTQA 1Y0VA 1GO8P 1HY7A 3TS4A 1SLMA 5CXAA 4ILWD 4QKZA 4XBHA 1I1IP 3DNGA 4DV8A 1K7QA 1I76A 5H8XA 5JMYA 1SMPA 2MZIA 4AUOA 1R1HA 4AYKA 4H30A 2DW2A 1CQRA 2W14A 1BQQM 1HTDA 5BOTA 1HOVA 2OVZA 2OW0A 2SRTA 3EDGA 1UMTA 3DSLA 2D1NA 3F15A 1OS9A 2KRJA 3Q2HA 5CUHA 3EDIA 4XCTA 1MNCA 3HBUP 1D8FA 1D8MA 4JPAA 1JAOA 3F16A 1D5JA 1UTZA 1G49A 2OXZA 1FLSA 1C8TA 2QPJA 4WZVA 4JQGA 1HFCA 1KUIA 3KEJA 3LK8A 1QICA 1QUAA 2JSDA 1FBLA 1PWWA 5I0LA 1BZSA 1BIWA 3LMCA 1C3IA 3RTSA 1G4KA 3LGPA 1OM7A 1K7IA 1ZP5A 1SATA 4IN9A 456CA 2WO9A 3B8ZA 1KUKA 2YB9A 1UTTA 4XM8A 1XFYA 1IADA 1R1JA 3EHXA 3LUNA 3LILA 1AKLA 3DPFA 2TCLA 5D1TA 1PWQA 3DTEA 2L0RA 4H3XA 4J4MA 2OY4A 4PKWA 1YOUA 4PKVA 5CZMA 1KUFA 1USNA 1KAPP 2Y6CA 4Q1LA 1S4BP 3WV2A 5BPAA 3F18A 1L6JA 3KWVC 3L0TA 1ASTA 4WF6A 3E8RA 1JJ9A 1IABA 2K2GA 4PKTA 3K7NA 4AIGA 3EDHA 1IAGA 1Y8JA 2W15A 4XM7A 5BOYA 1XFUA 3DTKA 3HDAP 3B2ZA 1A86A 1RMZA 4AXQA 4IUWA 2JIHA 4A7BA 1EAKA 1CK7A 3VI1A 3HY7A 4L6TA 1ZS0A 1MMBA 1QIBA 1MMRA 2Y6DA 1GE5A 2CKIA 2PJTA 3DL1A 4FXYP 1OM8A 2OY2A 2XS4A 3LUMA 2Z2DA 2POJA 2HU6A 2ERPA 1PWVA 2OVXA 3USNA 1SLNA 2OI0A 3HDBA 3F1AA 4IJOA 4L7AA 2RJPA 2YIGA 1ND1A 1BUDA 2W12A 1DTHA 1B8YA 2X3BA 5LABA 1G05A 2O36A 3WV1A 1QJIA 3OHOA 1Q3AA 4I35A 3LIKA 2OW2A 3L0VA 3B92A 3AYKA 966CA 3LKAA 2OXWA 1R1IA 1MMPA 2AIGP 1BM6A 3N2UA 2FV5A 3HY9A 1KUGA 1DMTA 3DWBA 2DW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3X A;  3LQB A;  5I43 A;  2DDF A;  5D7W A;  3LJZ A;  1JAQ A;  3LE9 A;  1BKC E;  1CXV A;  4G0D A;  2W0D A;  1D7X A;  1A85 A;  4G9L A;  4L63 A;  1OO9 A;  2CLT A;  2I47 A;  3EDZ A;  1K7G A;  2N8R A;  2OXU A;  3LIR A;  2XS3 A;  5D3C A;  4PKU A;  1QIA A;  1SU3 A;  3LEA A;  2USN A;  4I03 A;  4GF1 A;  5I4O A;  1WNI A;  1R55 A;  1JIZ A;  4PKQ A;  4DPE A;  3KRY A;  1PWU A;  3VTG A;  3ZUK A;  1JK3 A;  5B5O A;  1G12 A;  1FM1 A;  2X3C A;  4PKS A;  2ERO A;  3KEK A;  1O0Q A;  1EUB A;  3KHI A;  1XUC A;  4A3W A;  4DD8 A;  1BQO A;  4WK7 A;  4H2E A;  2O3E A;  3O64 A;  4CTH A;  1UEA A;  1CGF A;  1HFS A;  1IAE A;  1XFW A;  2WO8 A;  3F19 A;  2E2D A;  3P24 A;  1YQY A;  3TSK A;  1ZXC A;  4H1Q A;  3LJG A;  5B5P A;  3AYU A;  4DF9 A;  3ZVS A;  2DDY A;  3O2X A;  1IAC A;  3TVC A;  1RM8 A;  4GQL A;  1CAQ A;  1GKD A;  2RJQ A;  1XFX A;  4GR8 A;  4JA1 A;  1Z3J A;  2X7M A;  3F17 A;  1BKC I;  5L7F A;  1BKC A;  4GWM A;  1KBC A;  1JAN A;  1GE7 A;  2JNP A;  5I2Z A;  2WOA A;  1GKC A;  2OW1 A;  4HX3 A;  1GE6 A;  3RTT A;  3I7G A;  1CIZ A;  1B3D A;  1SRP A;  2JT6 A;  3I7I A;  1ZXV A;  2MZH A;  4R3V A;  3U1R A;  3V96 B;  1JAP A;  1C7K A;  1YCM A;  2D1O A;  1G9K A;  4L19 A;  1CGL A;  4HMA A;  1AYK A;  4WKI A;  1ROS A;  5I12 A;  4PKR A;  1HV5 A;  2DW1 A;  1PWP A;  1XFZ A;  2JT5 A;  3K7L A;  3MA2 A;  3LJT A;  4ON1 A;  3EHY A;  4JIJ A;  3P1V A;  3BA0 A;  4FVL A;  4ZR5 A;  1O0T A;  3KMC A;  4WKE A;  5D2B A;  3HBV P;  2MLR A;  4H76 A;  2OW9 A;  2AYK A;  4FU4 A;  1R54 A;  3Q2G A;  1ATL A;  3EWJ A;  3AIG A;  3SHI A;  1UMS A;  5I3M A;  4GWN A;  1ZVX A;  3ELM A;  3GBO A;  1JIW P;  2MZE A;  1KUH A;  3G5C A;  3UVC A;  2J0T A;  3HYG A;  1OS2 A;  5L79 A;  3HB2 P;  3WV3 A;  2OZR A;  4GUY A;  1I73 A;  2K9C A;  3OHL A;  1BUV M;  3DPE A;  1XFV A;  4H82 A;  4GR0 A;  1GO7 P;  3KME A;  3CKI A;  4JP4 A;  5D1S A;  4XM6 A;  1BSW A;  1XUD A;  1GXD A;  3TT4 A;  1OMJ A;  3LQ0 A;  4GR3 A;  1H71 P;  2X3A A;  3KEC A;  2A8H A;  1YP1 A;  2MLS A;  830C A;  2ERQ A;  3N2V A;  1JKY A;  4H84 A;  1CGE A;  1EB6 A;  2J83 A;  3G42 A;  4FXQ A;  1QJJ A;  1IAA A;  1AF0 A;  1OM6 A;  2V4B A;  4EFS A;  1Y93 A;  3ZXH A;  1MMQ A;  1XUR A;  1J7N A;  2FV9 A;  4H49 A;  1JH1 A;  3NX7 A;  2W13 A;  5D1U A;  1ZTQ A;  1Y0V A;  1GO8 P;  1HY7 A;  3TS4 A;  1SLM A;  5CXA A;  4ILW D;  4QKZ A;  4XBH A;  1I1I P;  3DNG A;  4DV8 A;  1K7Q A;  1I76 A;  5H8X A;  5JMY A;  1SMP A;  2MZI A;  4AUO A;  1R1H A;  4AYK A;  4H30 A;  2DW2 A;  1CQR A;  2W14 A;  1BQQ M;  1HTD A;  5BOT A;  1HOV A;  2OVZ A;  2OW0 A;  2SRT A;  3EDG A;  1UMT A;  3DSL A;  2D1N A;  3F15 A;  1OS9 A;  2KRJ A;  3Q2H A;  5CUH A;  3EDI A;  4XCT A;  1MNC A;  3HBU P;  1D8F A;  1D8M A;  4JPA A;  1JAO A;  3F16 A;  1D5J A;  1UTZ A;  1G49 A;  2OXZ A;  1FLS A;  1C8T A;  2QPJ A;  4WZV A;  4JQG A;  1HFC A;  1KUI A;  3KEJ A;  3LK8 A;  1QIC A;  1QUA A;  2JSD A;  1FBL A;  1PWW A;  5I0L A;  1BZS A;  1BIW A;  3LMC A;  1C3I A;  3RTS A;  1G4K A;  3LGP A;  1OM7 A;  1K7I A;  1ZP5 A;  1SAT A;  4IN9 A;  456C A;  2WO9 A;  3B8Z A;  1KUK A;  2YB9 A;  1UTT A;  4XM8 A;  1XFY A;  1IAD A;  1R1J A;  3EHX A;  3LUN A;  3LIL A;  1AKL A;  3DPF A;  2TCL A;  5D1T A;  1PWQ A;  4H3X A;  2L0R A;  4J4M A;  2OY4 A;  4PKW A;  1YOU A;  4PKV A;  5CZM A;  1KUF A;  1USN A;  1KAP P;  2Y6C A;  4Q1L A;  1S4B P;  3WV2 A;  5BPA A;  3F18 A;  1L6J A;  3KWV C;  3L0T A;  1AST A;  4WF6 A;  3E8R A;  1JJ9 A;  1IAB A;  2K2G A;  4PKT A;  3K7N A;  4AIG A;  3EDH A;  1IAG A;  1Y8J A;  2W15 A;  4XM7 A;  5BOY A;  1XFU A;  3HDA P;  3B2Z A;  1A86 A;  1RMZ A;  4AXQ A;  4IUW A;  2JIH A;  4A7B A;  1EAK A;  1CK7 A;  3VI1 A;  3HY7 A;  4L6T A;  1ZS0 A;  1MMB A;  1QIB A;  1MMR A;  2Y6D A;  1GE5 A;  2CKI A;  2PJT A;  3DL1 A;  4FXY P;  1OM8 A;  2OY2 A;  2XS4 A;  3LUM A;  2Z2D A;  2POJ A;  2HU6 A;  2ERP A;  1PWV A;  2OVX A;  3USN A;  1SLN A;  2OI0 A;  3HDB A;  3F1A A;  4IJO A;  2RJP A;  2YIG A;  1ND1 A;  1BUD A;  2W12 A;  1DTH A;  1B8Y A;  2X3B A;  5LAB A;  1G05 A;  2O36 A;  3WV1 A;  1QJI A;  3OHO A;  1Q3A A;  4I35 A;  3LIK A;  2OW2 A;  3L0V A;  3B92 A;  3AYK A;  966C A;  3LKA A;  2OXW A;  1R1I A;  1MMP A;  2AIG P;  1BM6 A;  3N2U A;  2FV5 A;  3HY9 A;  1KUG A;  1DMT A;  3DWB A;  2DW0 A; 
#chains in the Genus database with same CATH topology
 2E3X A;  3LQB A;  5I43 A;  2DDF A;  5D7W A;  3LJZ A;  1JAQ A;  3LE9 A;  1BKC E;  1CXV A;  4G0D A;  2W0D A;  1D7X A;  1A85 A;  4G9L A;  4L63 A;  1OO9 A;  2CLT A;  2I47 A;  3EDZ A;  1K7G A;  2N8R A;  2OXU A;  3LIR A;  2XS3 A;  5D3C A;  4PKU A;  1QIA A;  1SU3 A;  3LEA A;  2USN A;  4I03 A;  4GF1 A;  5I4O A;  1WNI A;  1R55 A;  1JIZ A;  4PKQ A;  4DPE A;  3KRY A;  1PWU A;  3VTG A;  3ZUK A;  1JK3 A;  5B5O A;  1G12 A;  1FM1 A;  2X3C A;  4PKS A;  2ERO A;  3KEK A;  1O0Q A;  2YUF A;  1EUB A;  3KHI A;  1XUC A;  4A3W A;  4DD8 A;  1BQO A;  4WK7 A;  4H2E A;  3DTI A;  3O64 A;  2O3E A;  4CTH A;  1UEA A;  1CGF A;  1HFS A;  1IAE A;  1XFW A;  2WO8 A;  3F19 A;  2E2D A;  3P24 A;  1YQY A;  3TSK A;  1ZXC A;  4H1Q A;  3LJG A;  5B5P A;  3AYU A;  4DF9 A;  3ZVS A;  2DDY A;  3O2X A;  1IAC A;  3TVC A;  1RM8 A;  4GQL A;  1CAQ A;  1GKD A;  1XM5 A;  2RJQ A;  1XFX A;  4GR8 A;  4JA1 A;  1Z3J A;  2X7M A;  3F17 A;  1BKC I;  5L7F A;  1BKC A;  4GWM A;  1KBC A;  1JAN A;  1GE7 A;  2JNP A;  5I2Z A;  2WOA A;  1GKC A;  2OW1 A;  4HX3 A;  1GE6 A;  3RTT A;  3I7G A;  1CIZ A;  1B3D A;  1SRP A;  2JT6 A;  3I7I A;  1ZXV A;  2MZH A;  4R3V A;  3U1R A;  3V96 B;  1JAP A;  1C7K A;  1YCM A;  2D1O A;  1G9K A;  4L19 A;  1CGL A;  4HMA A;  1AYK A;  4WKI A;  1ROS A;  5I12 A;  4PKR A;  1HV5 A;  2DW1 A;  1PWP A;  1XFZ A;  2JT5 A;  3K7L A;  3MA2 A;  3LJT A;  4ON1 A;  3EHY A;  4JIJ A;  3P1V A;  3BA0 A;  4FVL A;  4ZR5 A;  1O0T A;  3KMC A;  4WKE A;  5D2B A;  3HBV P;  2MLR A;  4H76 A;  2OW9 A;  2AYK A;  4FU4 A;  1R54 A;  3Q2G A;  1ATL A;  3EWJ A;  3AIG A;  3SHI A;  1UMS A;  5I3M A;  4GWN A;  1ZVX A;  3ELM A;  3GBO A;  1JIW P;  2MZE A;  1KUH A;  3G5C A;  3UVC A;  2J0T A;  3HYG A;  1OS2 A;  5L79 A;  3HB2 P;  3WV3 A;  2OZR A;  4GUY A;  1I73 A;  2K9C A;  3OHL A;  1BUV M;  3DPE A;  1XFV A;  4H82 A;  4GR0 A;  1GO7 P;  3KME A;  3CKI A;  4JP4 A;  5D1S A;  4XM6 A;  1BSW A;  1XUD A;  1GXD A;  3TT4 A;  1OMJ A;  3LQ0 A;  4GR3 A;  1H71 P;  2X3A A;  3KEC A;  2A8H A;  1YP1 A;  2MLS A;  830C A;  2ERQ A;  3N2V A;  1JKY A;  4H84 A;  1CGE A;  1EB6 A;  2J83 A;  3G42 A;  4FXQ A;  1QJJ A;  1IAA A;  1AF0 A;  1OM6 A;  2V4B A;  4EFS A;  1Y93 A;  3ZXH A;  1MMQ A;  1XUR A;  1J7N A;  2FV9 A;  4H49 A;  1JH1 A;  3NX7 A;  2W13 A;  5D1U A;  1ZTQ A;  1Y0V A;  1GO8 P;  1XAX A;  1HY7 A;  3TS4 A;  1SLM A;  5CXA A;  4ILW D;  4QKZ A;  4XBH A;  1I1I P;  3DNG A;  4DV8 A;  1K7Q A;  1I76 A;  5H8X A;  5JMY A;  1SMP A;  2MZI A;  4AUO A;  1R1H A;  4AYK A;  4H30 A;  2DW2 A;  1CQR A;  2W14 A;  1BQQ M;  1HTD A;  5BOT A;  1HOV A;  2OVZ A;  2OW0 A;  2SRT A;  3EDG A;  1UMT A;  3DSL A;  2D1N A;  3F15 A;  1OS9 A;  2KRJ A;  3Q2H A;  5CUH A;  3EDI A;  4XCT A;  1MNC A;  3HBU P;  1D8F A;  1D8M A;  4JPA A;  1JAO A;  3F16 A;  1D5J A;  1UTZ A;  1G49 A;  2OXZ A;  1FLS A;  1C8T A;  2QPJ A;  4WZV A;  4JQG A;  1HFC A;  1KUI A;  3KEJ A;  3LK8 A;  1QIC A;  1QUA A;  2JSD A;  1FBL A;  1PWW A;  1TVI A;  5I0L A;  1BZS A;  1BIW A;  3LMC A;  1C3I A;  3RTS A;  1G4K A;  3LGP A;  1OM7 A;  1K7I A;  1ZP5 A;  1SAT A;  4IN9 A;  456C A;  2WO9 A;  3B8Z A;  1KUK A;  2YB9 A;  1UTT A;  4XM8 A;  1XFY A;  1IAD A;  1R1J A;  3EHX A;  3LUN A;  3LIL A;  1AKL A;  3DPF A;  2TCL A;  5D1T A;  1PWQ A;  3DTE A;  2L0R A;  4H3X A;  4J4M A;  2OY4 A;  4PKW A;  1YOU A;  4PKV A;  5CZM A;  1KUF A;  1USN A;  1KAP P;  2Y6C A;  4Q1L A;  1S4B P;  3WV2 A;  5BPA A;  3F18 A;  1L6J A;  3KWV C;  3L0T A;  1AST A;  4WF6 A;  3E8R A;  1JJ9 A;  1IAB A;  2K2G A;  4PKT A;  3K7N A;  4AIG A;  3EDH A;  1IAG A;  1Y8J A;  2W15 A;  4XM7 A;  5BOY A;  1XFU A;  3DTK A;  3HDA P;  3B2Z A;  1A86 A;  1RMZ A;  4AXQ A;  4IUW A;  2JIH A;  4A7B A;  1EAK A;  1CK7 A;  3VI1 A;  3HY7 A;  4L6T A;  1ZS0 A;  1MMB A;  1QIB A;  1MMR A;  2Y6D A;  1GE5 A;  2CKI A;  2PJT A;  3DL1 A;  4FXY P;  1OM8 A;  2OY2 A;  2XS4 A;  3LUM A;  2Z2D A;  2POJ A;  2HU6 A;  2ERP A;  1PWV A;  1OZ9 A;  2OVX A;  3USN A;  1SLN A;  2OI0 A;  3HDB A;  3F1A A;  4IJO A;  4L7A A;  2RJP A;  2YIG A;  1ND1 A;  1BUD A;  2W12 A;  1DTH A;  1B8Y A;  2X3B A;  5LAB A;  1G05 A;  2O36 A;  3WV1 A;  1QJI A;  3OHO A;  1Q3A A;  4I35 A;  3LIK A;  2OW2 A;  3L0V A;  3B92 A;  3AYK A;  966C A;  3LKA A;  2OXW A;  1R1I A;  1MMP A;  2AIG P;  1BM6 A;  3N2U A;  2FV5 A;  3HY9 A;  1KUG A;  1DMT A;  3DWB A;  2DW0 A; 
#chains in the Genus database with same CATH homology
 2E3X A;  3LQB A;  5I43 A;  2DDF A;  5D7W A;  3LJZ A;  1JAQ A;  3LE9 A;  1BKC E;  1CXV A;  4G0D A;  2W0D A;  1D7X A;  1A85 A;  4G9L A;  4L63 A;  1OO9 A;  2CLT A;  2I47 A;  3EDZ A;  1K7G A;  2N8R A;  2OXU A;  3LIR A;  2XS3 A;  5D3C A;  4PKU A;  1QIA A;  1SU3 A;  3LEA A;  2USN A;  4I03 A;  4GF1 A;  5I4O A;  1WNI A;  1R55 A;  1JIZ A;  4PKQ A;  4DPE A;  3KRY A;  1PWU A;  3VTG A;  3ZUK A;  1JK3 A;  5B5O A;  1G12 A;  1FM1 A;  2X3C A;  4PKS A;  2ERO A;  3KEK A;  1O0Q A;  2YUF A;  1EUB A;  3KHI A;  1XUC A;  4A3W A;  4DD8 A;  1BQO A;  4WK7 A;  4H2E A;  3DTI A;  3O64 A;  2O3E A;  4CTH A;  1UEA A;  1CGF A;  1HFS A;  1IAE A;  1XFW A;  2WO8 A;  3F19 A;  2E2D A;  3P24 A;  1YQY A;  3TSK A;  1ZXC A;  4H1Q A;  3LJG A;  5B5P A;  3AYU A;  4DF9 A;  3ZVS A;  2DDY A;  3O2X A;  1IAC A;  3TVC A;  1RM8 A;  4GQL A;  1CAQ A;  1GKD A;  2RJQ A;  1XFX A;  4GR8 A;  4JA1 A;  1Z3J A;  2X7M A;  3F17 A;  1BKC I;  5L7F A;  1BKC A;  4GWM A;  1KBC A;  1JAN A;  1GE7 A;  2JNP A;  5I2Z A;  2WOA A;  1GKC A;  2OW1 A;  4HX3 A;  1GE6 A;  3RTT A;  3I7G A;  1CIZ A;  1B3D A;  1SRP A;  2JT6 A;  3I7I A;  1ZXV A;  2MZH A;  4R3V A;  3U1R A;  3V96 B;  1JAP A;  1C7K A;  1YCM A;  2D1O A;  1G9K A;  4L19 A;  1CGL A;  4HMA A;  1AYK A;  4WKI A;  1ROS A;  5I12 A;  4PKR A;  1HV5 A;  2DW1 A;  1PWP A;  1XFZ A;  2JT5 A;  3K7L A;  3MA2 A;  3LJT A;  4ON1 A;  3EHY A;  4JIJ A;  3P1V A;  3BA0 A;  4FVL A;  4ZR5 A;  1O0T A;  3KMC A;  4WKE A;  5D2B A;  3HBV P;  2MLR A;  4H76 A;  2OW9 A;  2AYK A;  4FU4 A;  1R54 A;  3Q2G A;  1ATL A;  3EWJ A;  3AIG A;  3SHI A;  1UMS A;  5I3M A;  4GWN A;  1ZVX A;  3ELM A;  3GBO A;  1JIW P;  2MZE A;  1KUH A;  3G5C A;  3UVC A;  2J0T A;  3HYG A;  1OS2 A;  5L79 A;  3HB2 P;  3WV3 A;  2OZR A;  4GUY A;  1I73 A;  2K9C A;  3OHL A;  1BUV M;  3DPE A;  1XFV A;  4H82 A;  4GR0 A;  1GO7 P;  3KME A;  3CKI A;  4JP4 A;  5D1S A;  4XM6 A;  1BSW A;  1XUD A;  1GXD A;  3TT4 A;  1OMJ A;  3LQ0 A;  4GR3 A;  1H71 P;  2X3A A;  3KEC A;  2A8H A;  1YP1 A;  2MLS A;  830C A;  2ERQ A;  3N2V A;  1JKY A;  4H84 A;  1CGE A;  1EB6 A;  2J83 A;  3G42 A;  4FXQ A;  1QJJ A;  1IAA A;  1AF0 A;  1OM6 A;  2V4B A;  4EFS A;  1Y93 A;  3ZXH A;  1MMQ A;  1XUR A;  1J7N A;  2FV9 A;  4H49 A;  1JH1 A;  3NX7 A;  2W13 A;  5D1U A;  1ZTQ A;  1Y0V A;  1GO8 P;  1HY7 A;  3TS4 A;  1SLM A;  5CXA A;  4ILW D;  4QKZ A;  4XBH A;  1I1I P;  3DNG A;  4DV8 A;  1K7Q A;  1I76 A;  5H8X A;  5JMY A;  1SMP A;  2MZI A;  4AUO A;  1R1H A;  4AYK A;  4H30 A;  2DW2 A;  1CQR A;  2W14 A;  1BQQ M;  1HTD A;  5BOT A;  1HOV A;  2OVZ A;  2OW0 A;  2SRT A;  3EDG A;  1UMT A;  3DSL A;  2D1N A;  3F15 A;  1OS9 A;  2KRJ A;  3Q2H A;  5CUH A;  3EDI A;  4XCT A;  1MNC A;  3HBU P;  1D8F A;  1D8M A;  4JPA A;  1JAO A;  3F16 A;  1D5J A;  1UTZ A;  1G49 A;  2OXZ A;  1FLS A;  1C8T A;  2QPJ A;  4WZV A;  4JQG A;  1HFC A;  1KUI A;  3KEJ A;  3LK8 A;  1QIC A;  1QUA A;  2JSD A;  1FBL A;  1PWW A;  5I0L A;  1BZS A;  1BIW A;  3LMC A;  1C3I A;  3RTS A;  1G4K A;  3LGP A;  1OM7 A;  1K7I A;  1ZP5 A;  1SAT A;  4IN9 A;  456C A;  2WO9 A;  3B8Z A;  1KUK A;  2YB9 A;  1UTT A;  4XM8 A;  1XFY A;  1IAD A;  1R1J A;  3EHX A;  3LUN A;  3LIL A;  1AKL A;  3DPF A;  2TCL A;  5D1T A;  1PWQ A;  3DTE A;  2L0R A;  4H3X A;  4J4M A;  2OY4 A;  4PKW A;  1YOU A;  4PKV A;  5CZM A;  1KUF A;  1USN A;  1KAP P;  2Y6C A;  4Q1L A;  1S4B P;  3WV2 A;  5BPA A;  3F18 A;  1L6J A;  3KWV C;  3L0T A;  1AST A;  4WF6 A;  3E8R A;  1JJ9 A;  1IAB A;  2K2G A;  4PKT A;  3K7N A;  4AIG A;  3EDH A;  1IAG A;  1Y8J A;  2W15 A;  4XM7 A;  5BOY A;  1XFU A;  3DTK A;  3HDA P;  3B2Z A;  1A86 A;  1RMZ A;  4AXQ A;  4IUW A;  2JIH A;  4A7B A;  1EAK A;  1CK7 A;  3VI1 A;  3HY7 A;  4L6T A;  1ZS0 A;  1MMB A;  1QIB A;  1MMR A;  2Y6D A;  1GE5 A;  2CKI A;  2PJT A;  3DL1 A;  4FXY P;  1OM8 A;  2OY2 A;  2XS4 A;  3LUM A;  2Z2D A;  2POJ A;  2HU6 A;  2ERP A;  1PWV A;  2OVX A;  3USN A;  1SLN A;  2OI0 A;  3HDB A;  3F1A A;  4IJO A;  4L7A A;  2RJP A;  2YIG A;  1ND1 A;  1BUD A;  2W12 A;  1DTH A;  1B8Y A;  2X3B A;  5LAB A;  1G05 A;  2O36 A;  3WV1 A;  1QJI A;  3OHO A;  1Q3A A;  4I35 A;  3LIK A;  2OW2 A;  3L0V A;  3B92 A;  3AYK A;  966C A;  3LKA A;  2OXW A;  1R1I A;  1MMP A;  2AIG P;  1BM6 A;  3N2U A;  2FV5 A;  3HY9 A;  1KUG A;  1DMT A;  3DWB A;  2DW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...