3DNKA

Enzyme deglycosylated human igg1 fc fragment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
209
structure length
209
Chain Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYDSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IGHM protein
publication title 2.8 Angstrom structure of a enzyme deglycosylated human IgG1 Fc fragment
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dnkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dnkA01
4HKBB 3KR3H 3LV3A 4G8GA 3UTSB 4H0HB 5CHNB 2KBGA 1C08A 4G5ZL 3TIDA 4ZD3H 1IAOA 4F9LC 35C8L 2DTSA 2H8PA 3EDKA 3FN3A 1NDGA 2H41A 2K3TA 4X7CC 3VH8G 4PRIA 2OSLB 4L4TD 4ZUUB 3HC4L 5HHXH 5LCVL 1ED3A 3CFCL 3PWNB 1KJ2L 1OLLA 2OJZL 4X6CF 1H3TA 3HE7D 3VDAA 4NKQB 1JN6A 1AFVL 1F4XH 3H9SD 1P4BL 3LS5L 4ODXB 2YSSA 3VE0A 5C0DB 2VABA 3LEYL 4PBXA 3FO2A 5KN5B 4JRYA 3TFKC 4U1KA 3ARFD 1WAAE 4JKLA 4QCIB 5DMGD 2EYTB 5BMFL 1SJHB 2A6DB 4JREB 3RGHA 3EKCA 5ISZA 4K94H 2N1KA 3CPLA 4WTZG 4QHLB 3MRFA 4X4XB 1G1CA 3VG9C 2K7PA 3QDGD 3AM8C 4F7TA 1S9YB 1BEYL 3VRJB 5M7QA 3ME0A 4XVJL 1RZKH 3TYFB 1T22B 1LE9B 4DZBA 1KPUB 3MRMB 4A6YL 2APTA 1QLFB 4JHZA 4JN2B 4CNIB 3B9KC 3IU3B 4YX2L 4DW2H 3DTXB 4LGPB 1RMFH 1OOAA 3QEQE 5BCAA 4OGXL 2BRQA 4XP4L 2P43B 4JKPH 3MBED 15C8L 4ZUVA 3TT1H 3HPLA 3WJJA 3WFHA 1LP9A 4UIMA 2NY5H 4PRDB 5LXGH 3U4BL 5K33A 5C0BA 3OBAA 3X12B 1RFDH 2UVFA 4UOW0 1J88A 1C16A 2VLKE 4LOUC 3MOBL 5HYEA 5KSAD 3WHE0 4JFYB 5BW7C 1Y6NR 2GITA 4RWYH 4OZ4B 4L9LC 1R0AL 3V7AG 1RURH 1FFOB 1BM3H 4DVBA 1CGUA 4FTVB 3WDIA 2CLRA 1HXYA 3BJLA 3CLEL 3FOMB 5D1ZC 1KNOA 4ZS7H 3PL6D 5IJKC 3ROOA 1KCSL 2JLLA 3ARXA 3D0LA 5J12B 1A9BA 3EYSL 1NLBH 1E4KC 3LCYA 2DIAA 2MHAA 4G7VH 1FZKA 3MV7A 1T66D 1E27B 4PTUA 3IJSB 2ARJQ 5CP7B 5FDWA 5HHME 4HV8A 1EGJH 5I8OL 4UINL 3FMGL 4P5TB 5HYJD 3FO9B 4QHKI 3RWEB 4PLJC 4HWZB 4N8VA 1RV6X 3QXWA 5FYKD 3TNMA 1TZGL 3QPQC 3H7LA 1P84J 1KJVB 4TSAL 3P4MB 4X98B 3PDOA 1UH3A 1Z5LB 2DQHH 3HCVB 3MYZA 4PV8A 5TH2B 3R0NA 3O6LH 1NUFA 2Y7QA 2YD3A 2Q76B 3CSYA 5K9KB 3V5DA 5E8EB 4S1SH 3ZO0A 5GGSA 2DD8H 5IB4B 5F7WC 1V7ML 3H42H 3E6FA 2CRYA 1QRNE 3ZT7A 1TZHA 4PJ8D 4GRLB 1LDPL 2V2WB 3FB8B 3EDDA 1RZFH 2E6PA 5J4MA 4JM2A 5IJVA 3ARBA 5JW5B 2EDXA 4OZFA 3LEXA 5ESVA 4HK3N 2AXFA 1CCZA 2X4UB 4JZNB 2E7LC 4X7SL 4ZFGL 3TPUB 1Y0LA 1OT1A 2YPLB 3IVKA 3MLYH 4QOKE 1U3HA 2ZNXA 1XGPB 4LVHC 3AVEA 1XIWD 1KV3A 4NZJA 5JR1L 5IW3A 3X13B 2HWZL 3GSVA 1CICB 3ZT6A 4PLOB 1P84K 1UA6H 4MXQC 4MD4A 4R8WH 5T1LD 1JI2A 4X6DE 3DIFB 3MUHL 4NJ9H 1YY9D 5JNYA 2PN5A 1QFUH 5CIPH 4K23L 5E94B 5DMIL 3MYJA 1KEML 2UWEA 4ZSOB 4YR6A 4P46B 4G9DA 4PJAB 3ARYA 2ZUSA 2D3VA 4Y1AB 3EO1A 3WIHL 2L7UA 1A47A 3VWKA 4N0UA 4JFOB 1MCRA 1YEHL 3STLB 2HYMA 4OF3A 4KU1A 1GGIH 1QSFD 3MMEB 1AQDB 5HHQA 3FRPG 4GBXA 43CAB 4XH2B 4YHOL 3AY4A 4L3CB 4U1SB 4LAQL 3RHWF 2P48B 4QY8B 2X4TA 5EUOF 4IRJB 3DUUB 2AK4A 5DZOA 2ICWB 5L88L 1MRCL 2AEPH 4LCWE 2NY0D 4RBPK 1U95A 3U6RB 1RZ7L 2EDNA 1B0GB 1LO5A 5E2WH 3I02A 4IIQC 4PJFE 3V8OA 1IT9L 3KPRB 1ZLVK 4YHZH 2G9HA 4CMMA 4MXVF 3QQNA 5IVNA 1JVKA 4CU6A 1B90A 4E42B 1FN4B 3NA9H 3U36B 5E1AB 1DDHA 4YJZL 2FEDC 3I6GB 3VFVB 1BVKA 2Z91A 3X14A 2XN9A 4S1DD 2WWMD 3UTZA 1MJJB 5D2LA 1T3FB 2IH1B 3SBWC 2LABA 2DRUA 3ZE0F 4BM7A 2JB6A 4HBCL 2VOTA 3QNXB 4OLYH 3D85A 3SJVD 3RDTA 2UWEF 3RKDD 3V6ZA 4Y2DA 2EEAA 3DSFL 1A3LL 5D70L 2XI9A 1RK0A 1U8IA 2FHCA 3L9RB 3O4LE 3GFUA 1KTDB 5DFWH 3ECBB 2WM0A 4NJAH 5EU6D 4DK6A 3NCYP 4DCQB 5L9DH 4IRSC 3QNZA 2I07A 5JZ7D 3PDDA 4PJDF 1D5MB 3WNNA 5DC4B 3SKUD 1D6VH 4WO4D 3T3PF 3QEHB 4G3YL 3Q6FB 5CCKH 1NANH 3QIUB 4HJ0C 5DVOA 4H1LH 3BZFA 4MJ5A 4N0CC 5B22A 4JFFA 1YMMD 5EDXA 3ZDXF 4Z7OF 1D5XB 3NZHH 1RULL 2NY6B 5GRJH 3BIBX 3OF6D 1JHKL 3G04B 4RMWA 5DJCB 2AV1B 3WE6B 3CMOH 3N50A 3ZLQC 3KNBB 4KZEH 1WITA 5DXWA 3VXNA 3BQUB 1CGVA 2VQ1A 4FQ1H 3MRKA 4IDLA 3FTGB 4F57L 2R0WL 2H3NA 3AB0B 5ITFA 4G9FD 4ENED 2IQ9H 3OGCA 3ZSSA 1DBJH 5D93B 3CCHA 4MA1B 2R1XB 1KGCD 3D25B 2W9DH 3F58H 3RNKA 1OTTC 1FLRH 1WZLA 3OR6A 5DHYA 4H0IA 1OQOA 1ZKAA 4NN6C 2CKBB 3MRBB 3IRZA 3HAEB 2DTMH 2NW2A 3DOSA 3ZTJG 4LSSH 3TCLB 3GNML 5EO0A 2CO6B 1KN4H 1KN2L 1RY7B 4FQ2H 4HPYL 1ADQA 3MUZ1 4P4RB 4KTDL 3WEXB 2W38A 2R15A 5J11C 3WBDA 1BFTA 3EJJX 3KLDA 3T77A 5CFHA 2I5YL 4OT1L 5KS9E 5ICZA 4NHCL 5DMKB 2PKDA 3GSOA 4EDXB 4HKBA 3HFML 3UTSA 1XCTB 3FQRB 5CHNA 5I19L 3RPIB 1RAMA 1C5CL 1EERB 3PG2A 2FWOB 2H26B 1S5HB 1OPGH 4UILL 2X70B 1JZ2A 5CJ5A 5I66B 25C8H 4TPRH 1F6FB 1Z3GH 4JGMA 4DN4H 2OSLA 4ZUUA 5D1XD 3PWNA 3MLXH 2FEEL 3TVMB 4RMQA 3BGFC 5M95B 1UM4H 2DYPB 4DAGH 4ODXA 3RVWC 5C0DA 1UWXH 3EYUL 4DKFH 4O58L 5KN5A 4XCFH 1IBGL 5DRZB 4LKXB 4QCIA 2X7LB 2EYTA 3PHSA 5TGBB 1OAKH 2A6DA 2BNQD 4WU7B 1A8JH 4NIKB 4QHLA 4X4XA 5BOPA 4UBDD 3P9WB 2Y5EA 5T3ZH 3PGDB 4XBGB 5E00B 2DKUA 1S9YA 2O5YL 2XQBH 3VRJA 1YZZA 3TYFA 1T22A 1LE9A 1KPUA 1HHJB 3MRMA 1M7IB 3DLQR 5ADPL 5JW4N 1E4KA 3GHEL 1QLFA 4Z7WB 4OFKA 4CNIA 1IM9B 3IU3A 4XNQB 4POZD 1K85A 2DQDH 1CBVL 1JPSL 3DTXA 3DYPA 2IJ0C 1SHMA 3FB6B 4W4OC 4ZYKA 2Z8SA 5CLTA 3UTTE 3WS3B 3I3BA 1PDKA 3QIWB 4PRDA 2OXGA 3M45A 2J6EH 3X12A 3GSUB 4OF6A 3OWEA 4OKVB 4J3TA 1J11A 1S78D 4KV5E 5DFTA 5C0CA 4JFYA 4YZFF 1X3DA 4P5MB 4OZ4A 2ZUTA 1MAKA 2GK0B 4FTVA 1L7TL 1N64L 3ARDC 4YFLI 3HI5L 1FAIH 1JNHB 5IVXE 3ZYIA 3ZZ1A 3O8XC 1FC2D 1IGIL 2DJSA 3MV9E 1FSKB 5B21A 3MPCA 1X7QB 3W2DL 2HAZA 1CWVA 2VQUA 5J6GB 1E27A 1FNSH 3IJSA 5CP7A 4XX1G 2EC9U 3BD3A 2VXTL 2JCCF 5E9DE 4P5TA 3FO9A 3RWEA 4PJGB 4E9LA 2XICA 2XT1B 2EE9A 3IFNL 4HWZA 3U9PL 4ELMF 2I60L 5KBNC 4XC3L 3I84A 1KJVA 2F5AL 2IADB 3P4MA 4X98A 1VFAB 1Z5LA 3HCVA 4PRID 3MUGB 5MEND 4Q7DA 1Y18B 2AJYL 4LF3B 5TH2A 1ADQL 3F5WB 2Q76A 5K9KA 2MQ0A 5E8EA 5E6YA 3D3VB 5B8CC 4EDWH 2W91A 5DQJB 5IB4A 4NQCB 2I9LB 1H5BC 1GIGH 4PJHE 5T1KD 4GRLA 2V2WA 1WWWX 2PTUA 1S9WB 4M6NH 5C86A 5D7IB 5FA4B 1D5IL 2W59A 1EH9A 2LTQC 4N0FB 4Z7UB 1FQ9C 5IBUG 1BGXL 5JW5A 5DMJB 4HT1H 1D3CA 1OAXH 1MHPL 1F13A 2X4UA 5CZXC 3TJHD 4KMLB 3T3MF 2FGWH 3TPUA 2YPLA 4OZIA 5D7LB 1XGPA 2X4QB 4PJBB 5EWIL 4TSBH 3WSQH 4MGXA 5SWZE 4OGAC 3MRHB 2C3GA 3VGGA 4BSVB 3X13A 4HWUA 3O3DB 1OTUC 5E2UL 5F7EH 3QAZB 4Y2OA 3NIFE 5FYKH 3DARA 2R1YB 3DUHA 2FHBA 4XWGH 4DN3H 3HRPA 5E94A 4ZSOA 5TE4L 4P46A 4PJAA 5FGBA 3H7BA 5FYJH 3LZFL 3WXVH 4Y1AA 1MQ8A 3RU8H 1OARH 3SDYL 2HLFC 4YGVB 5F9WC 4CBPA 2MTPA 3O45B 2DQIH 4PB0H 2FRGP 4JFOA 2YEZB 1JHLH 3H2WA 3QUXB 4OTXH 3STLA 3T2NL 3TGXA 1LDSA 4KMTH 2D4DA 5DR5L 3MMEA 1AQDA 3L5JA 43CAA 1VB9A 3MLUL 3TPKA 4LSRH 1PG7L 1J5OL 3UO1L 2PO6B 3QCVL 2HN7B 2YKLL 3HZMA 4L3CA 4S0TD 5D72L 1HKLH 5IHBA 4PY8I 5DEFB 4QY8A 1F58H 2P1YA 2DI8A 5JA8B 4IRJA 3DUUA 4YC2C 2VKWA 3MACH 4TVPH 5FFLA 2ICWA 2FBJL 4LSPL 1TMCB 2VDRH 5IGXL 2Z93B 1CT8B 1UKTA 5D6CB 2RQ8A 1A14H 3U46B 3C6LC 3KPRA 5I17A 1VACB 5F8RC 4P4KC 1LO0L 3DROB 4E42A 1FN4A 3U36A 1F3JA 5E1AA 2RHEA 5I1AB 3VFVA 2B0SL 3I6GA 3WFCH 3NAAH 3GHBL 1EO8H 3O2WH 3QDMB 5CZKA 3KXFB 3EBAA 1MJJA 4Y19E 4JFQB 1T3FA 2IH1A 1A9EB 1N6UA 5HI5D 4JFED 4IMKA 1NFIB 5AWNL 1P4LB 3QNXA 2YMXL 1T1ZB 2F54E 3QWQB 3WKML 2EH7H 3GM8A 2ATPB 4PJAF 4KJYB 1JTTA 3KYMB 5C0AB 4DWHA 4DGVL 3QEQD 1I1FB 3X11B 2NXYB 4KI1A 3OAYH 3L9RA 5DT1L 2APXA 1KTDA 3ECBA 4R4FL 4FQXD 4DCQA 3Q3GB 4ONFL 3MQIA 5TJWK 1U2CA 1CVRA 4PJIE 4O02L 2BVYA 5I75B 1D5MA 2B1AL 1O0VA 1FGVL 3QEHA 5FV2A 3V4UL 1EBAA 2XZAL 3Q6FA 3QIUA 4B50A 2VLKD 3RIAF 5J1AA 4PB9L 4PBWD 4GLRH 1GZQA 1XMWA 3O2VH 1D5XA 5T5NF 1IAIL 4HKZB 1KFAH 4YXHL 4BFEA 4MNQB 4Z5RB 5GGVY 1KG0A 5DJCA 3G04A 3GMMB 3WE6A 3VGBA 3SDAD 1GC1H 1MFDL 3ARWA 5FIEA 3S88L 3KNBA 3JV0A 1Q8MA 3B5TA 1OWRM 3BQUA 5HVFB 3CVIH 3T1WA 1QP1A 3IAGC 4YEEA 5FF6B 4EI5D 3FTGA 5IIEB 4NQDE 3VD9A 3CLFL 3SDXB 1HYRC 3FZUD 5ETUB 3HHRB 4LDLB 3DX6B 3GK8H 4XP1H 1HN1A 5HHMD 4K3JH 3WLBB 2R1XA 3D25A 4IDJH 4U0RB 3LN4B 5IFJB 3GBNL 3QB7C 4JJHA 1ZLSL 2KQNA 5F6IC 4CVXB 2VLJD 1DQLH 5GRVL 4XNMB 2CKBA 3MRBA 1SEQL 2FCBA 1FIGH 2BVEA 3HAEA 5TDOB 5CINH 3TCLA 2XQYK 1CFSB 5E2VH 3UDWC 4PRPE 1RJZB 2EIEA 2UZIL 4OD1H 4MNGE 5FYLD 5BV7C 3B8SA 4APQB 4P4RA 4LVNB 4WUUE 2F58H 2Y1VA 3WEXA 3EOYG 5E99L 1Z9SA 2O5XL 1P9MC 4OF5A 4UB0L 3ET9F 2X2YA 1WZKA 2FX8L 5DMKA 2YUZA 3K4ZA 4EDXA 2VMFA 3GKWL 4M7KH 1EXUA 1DBAL 1XCTA 3AROA 3FQRA 1QRND 2D03L 2VIRB 4JHAH 2QADC 4ZO9A 3BMVA 3DGCR 5BS0B 1KB5L 5C2BH 2V7HB 5FM4A 3CH1B 2BOBB 4TULL 4W4OA 2XN9D 4JHBA 4KKAC 1HDMB 3DVNB 2X6MA 2X70A 1WV7T 3WXWH 5I66A 4MJ6B 3C60B 2D9CA 4WEBL 1OM3L 5CUSH 5JOPD 2ZKHL 3WO3B 1LILA 3TVMA 2Z92B 1NGQH 5DF0A 2DYPA 3IYLW 3MR9A 1PEWA 2F5BL 3ARZA 2E7BA 4HCRH 2OZ4A 4QOKD 5FKAB 5DRZA 4LKXA 4EBQH 1PFCA 3B2VH 2X7LA 1E6JH 1HSBB 5TGBA 1A5FL 3FQNB 3GJEA 5FUZH 4WU7A 4JAMB 4NDMA 2DL2A 4Q74A 5JIIA 3BGMB 4FQHB 3PGDA 4I0CC 4XBGA 5E00A 1CDIA 3JWNC 2PYEE 3CD4A 1OGAD 4E5XB 1RIHL 1TLKA 2AJXL 1MRDH 1HHJA 4M1GH 4ONGH 1M7IA 2NW3B 3LVEA 5A3IC 1IM9A 5GGQH 4XNQA 3BWAB 3MRQB 4MS8D 5I1CH 5JXAL 5B4MC 4ZXBB 3FB6A 3B5HA 2W1NA 3C8HA 4UT6H 1OSPL 4ZPVB 3S9DB 1MVUB 3WS3A 3HG1B 1MLCB 1BFOB 4BH8B 2VLLB 3QIWA 4PGEB 1YN7B 1F4HA 3BKYH 2NY3C 4PGBB 5DHVB 4J3UA 5TPWH 4WW2F 1CL7L 3GSUA 1I7UB 4OKVA 5T33H 3E0GA 4DTGH 5GRUL 3TH3T 4P5MA 3T1FB 1PEZA 2GK0A 1CD8A 3ZDYF 3HLAB 3W5NA 4LCWD 4UT7L 1QPPA 5IESL 4I18C 1JNHA 5C9JB 3TFKD 3JWDC 3NCYS 4HIXH 1FL3B 4JGUA 2OS7A 1A7PH 3ZT5A 4OCXH 4ZG1A 3GMNB 4GXVL 1OAYL 2LAAA 1X7QA 3EYOB 2X1XR 4JO3L 1Q0YH 4R97C 4P3CL 1NEUA 5J6GA 5BRZB 1FBIL 2IF7A 3B9KD 4NQXB 4JPIA 4PJGA 4AIXA 1N5YH 4NCC1 4XCNB 2IQAB 2I25N 3CVHH 1SVZA 5J9PB 1BVZA 1SY6H 3TO4B 1YMHB 4HUVA 1A6TB 2CKBL 2DQJL 5FECB 2KZWA 4KQ3H 2VSDA 1TJGL 4Z7WF 1VFAA 4HUUB 5DK2B 4P59H 2OR7A 4N8CL 3MUGA 5DVLA 1Y18A 3RWCB 4LF3A 1E28B 3F5WA 3MCLL 5GGVH 4N8VG 5EUKB 1J18A 3T0EB 4LOUD 3D3VA 1NCAH 5DQJA 4NQCA 2ENSA 2I9LA 4P9HL 4P57B 3H9ZA 3MCG1 4GRWB 1IGCL 4URTB 2BSRB 3T8XB 5DD3H 1S9WA 1NBZB 5D7IA 5FA4A 2A0LC 2FX7H 4X5XB 4E41D 4X4ME 5I8KH 4N0FA 4Z7UA 5D1ZD 4MJIE 5T5FH 4PREB 4L8CA 3MJ8B 2DDQH 3HC0A 3CFKB 2EXWC 1Q1JL 5EIIB 4M3JA 2BHZA 3RX8A 5KJRL 3BJ91 4Q9QL 3INUH 1A7QL 3SE9H 2WUCH 2QSVA 1MREL 2MSPA 5D7LA 2OZ4L 2X4QA 4NZTH 4PJBA 2R0ZH 3CK0H 1AGDB 5IW6B 1CIUA 3MRHA 4OZFG 4PLJD 4BSVA 3O3DA 1WCBB 3QPQD 4U1GC 3BAEL 4KQ4L 1MJ7H 4MXWL 3UJIH 4I3SH 4HULB 2AJUH 4AL8H 1AGFB 5ICYB 3LKPB 5KANI 5ISZE 4TSCH 5C0CD 3NVQA 1DQJB 2MCPL 3FQXB 1V8HA 3WYRA 1QFWI 2DQTL 3L3IB 4YGVA 1UM6L 1X5LA 3O45A 2QHRH 2JIXB 4P2QD 4LRIC 3GO1H 2YEZA 5DJ2B 1CD1A 4KTEL 2CO7B 2VDLH 3QUXA 3L3HB 4JVPA 1T0MB 3B9DA 1JGDB 5D1QB 4M6OH 2ERJB 3C2AL 5IF0B 2PO6A 1TQCB 3RGVB 2HN7A 1EHLL 4X83A 4OGYH 5DEFA 4KHTL 4EI6B 3SCMC 4X8JA 1DTUA 5GS1C 5AYUH 3SQBA 1WICA 2C3XA 4NHUA 2Z93A 4L3AA 1G7HB 2QQNL 5HYQB 1IFHL 4GW4B 1CT8A 3S35H 5D6CA 4HKXA 3U46A 2VZ1A 2Y72A 3L6FB 4XPTH 3TBWB 4P2RB 2R29L 3MXWH 1H8NA 1VACA 3LDBB 1LO2H 3WLWC 3S36H 3C6SB 5DUMH 5DVKA 1MFNA 3LPGA 4MXQD 4KZDH 1DLFH 4C57C 5JTWA 1G6RB 5I1AA 3ULVH 2VDNH 4O2FB 2Z31C 4G6JL 5JQ6H 3QDMA 1KCRH 3EYVB 3KXFA 4PD4J 2R0KH 4JM4L 3VFMB 3MODH 1ZT1B 5EU4B 2UZYB 4YUEL 3W39B 1A9EA 4XHJC 4XMKH 1NFIA 4K3DH 1P4LA 1BD2B 3VW3L 1T1ZA 4HQQL 3QYCA 4FZEL 3V95A 2ATPA 4KJYA 4XVSH 5C0AA 3KYMA 5JXEA 3KS0J 4EXKA 5CZVH 2AS5M 4ODBD 1U41A 1JMZA 3X11A 3HZVB 3SQOH 4D8PB 3HC3H 3OKLB 3UTTD 5EBMB 2BOCB 4Z78B 2XOTA 4X9IA 3Q3GA 1V05A 7FABH 4G6KL 4J7RA 1NGWB 2DQCL 2CGRH 5F7NC 3MJ7B 5BVJB 5T1DL 1MCWM 1U93A 3RHWK 3ZE2F 1TJIH 1MWAH 5C0NC 5I9QB 2HT3C 3DRTB 3U83A 5C3LD 4ZTPH 4G6AC 1UG9A 4NRXB 4HKZA 4XPAL 2IALB 4X5LA 4MNQA 4Z5RA 1B6UA 3HMWL 1A3LH 1MI5B 2FB4L 4S1QL 3GMMA 1T5WB 2XIDA 5EUOE 2FEDD 3ROLB 3I2CL 1GOHA 2JK5B 3MV9D 4TUKL 1YEFH 5FF6A 4PD4K 3SDCC 1IGML 1PSKL 5IIEA 3SDXA 1I1RA 1QZ1A 4RMUA 1GRWA 4NQED 5ETUA 4MXVE 1YEJL 3DX6A 4XPHH 3WLBA 5I1KL 1X5ZA 3LN4A 2EDLA 5E9DD 3S36X 5IFJA 3QA3B 1KBGL 4LSTL 5D71H 4OCWL 5HI4C 3WNOA 1HINL 4XPBL 4CVXA 4XNMA 3NTCH 3T0DA 4O9HH 3HN3A 5HHNB 1VFUA 5SX5K 5TDOA 3GIZL 1RJZA 4IRSD 1IVLA 3H3PH 1H3GA 4APQA 3QXAB 4K8RC 5D7JC 5GRXG 2UWEE 5DSCB 4G42B 4HJ0D 4KHXH 4FXKB 4KPHH 4N0CD 1G9EA 5L6YL 2COQA 5F9AC 5JHDA 3DVGB 1NAKH 2XY1A 3IS0X 2VIRA 1MF2H 4GKOA 3GMLB 4QXUH 5BS0A 4KVCL 1E4WL 5CSZB 4PJ7F 2VDQH 1K4CB 3QHFH 4NRYB 3CH1A 4GSDH 4U1NB 4CRPA 4PJDE 3NACL 3DVNA 4FFZL 2P47B 3T3PE 5FGCE 1MQKH 2WBKA 4CJ0A 3WHXB 4MJ6A 3C60A 4M9PA 2NCMA 4RX4D 4PY7B 4PP1C 1G9ML 3T2QA 3GUTB 1I1CA 1RHFA 1J0ZA 2V5SA 4Z7OE 3GSRB 1QLEH 2GFBB 4NO2B 5TDNB 3O6KH 3OL2A 3IAPA 1OAUL 5FKAA 3NGBC 3D0VB 3QDJE 5SWZD 1HSBA 1OTTD 1FO0B 3FQNA 1PKOA 4JAMA 4G80B 5CJBA 3WFBL 3BGMA 4FQHA 4UILH 2OM5A 1JGEA 4N68A 4E5XA 1SQ2N 4LHUB 4Q97A 4YDKL 5FYLH 2NW3A 2V2TB 1EDQA 1I75A 4EEEA 1S9KC 5EBGA 1C7SA 1TITA 3BWAA 3MRQA 3ULUF 2ZUQB 1KXVC 4LLAA 4ZXBA 1F6AB 4LP5A 4GMSL 1A6PA 4ZPVA 5FUCC 3IDMB 1MVUA 4K7PL 3HG1A 3UC0H 1MLCA 1JZ4A 1BFOA 1P5UA 2VLLA 4PGEA 1CFVH 1YN7A 4PGBA 5DHVA 3CH8A 4LCCB 4ODSH 2V5TA 3M17B 2CR6A 1JFQL 1I7UA 2P8MB 5CJQH 5DUPL 4FQCL 5FHBH 4QXTB 2FR4A 1AGEB 1A1NB 3HA0A 4XC1H 3NCBB 5GISL 4GFTB 3RVWD 1KIRB 3HLAA 5DRWB 3R1GH 2E8ZA 4OM0H 4R0LB 3RZCB 5C9JA 1RD6A 1XF4B 4GMTH 1FL3A 1KELL 4JFFE 5ELIA 3N9GH 5EG6C 2JJVA 5E56A 3LN5B 4AYFA 2IPKB 4U6VH 1HHHB 3EYOA 2DBLH 5CEYB 1M4KA 1UQSA 4ONHB 1FNHA 4F9PA 3UJTL 1CDUA 5BRZA 3WN5B 4AIZB 3FT2B 4NZRH 3HRZB 4NQXA 1BQUA 3MTRA 2XWTB 4Y19D 3ZSTA 4TRPL 3J7HA 4XCNA 2IQAA 3HUJB 5DJYB 5J9PA 4L9DA 3RL1B 3TO4A 5IG7B 1A6TA 3TBYB 2ED7A 4GW5B 5FECA 3JV4B 5CWSB 3BP6B 1ZTXL 5EO9B 4HUUA 5DK2A 4Q9RH 2BP3A 2IMNA 1E28A 2GY5A 4XGZB 5SWSB 4U7SA 1JNLL 1VA9A 4LARL 4NUGH 5EUKA 3T0EA 1Z2KA 2G5BB 3QULB 1ODAA 1MH5B 2HKHH 1F5WA 3AREC 1XR8A 2G60L 1AI1H 1WEJL 3ARDD 4OZHA 3T8XA 1NBZA 4X5XA 1HQ4B 4QWWC 3OG4B 1MPAH 1I8IB 4PREA 3MJ8A 3O8XD 2LAGB 3CFKA 2IBBA 3UTSE 1I4FA 4OV5B 2OI9C 5EIIA 2FH6A 1S3KL 4JVUA 4YZFE 1ZSDB 5D7SL 1E0OB 3I6LE 1MIEH 4F58L 3QI9B 5C0GB 1ZLVH 5AAMA 3GGWB 4Z95H 5C0RH 1S7TB 4XNYL 4Q0XL 1PZUB 4RMRA 1AGDA 2CRMA 1G7LA 5IW6A 5LWYH 1QBML 1TVDA 4D0BB 4NQDD 3WD5L 2WP3O 2J3SA 1WCBA 2I27N 4U1IB 2J4WL 5C6WH 4LEXL 3H0TB 1AGFA 5ICYA 2VDPH 4FA8A 3LKPA 3OJDB 3KHOA 3THML 1AJ7L 1CK0H 2BY3A 1DQJA 3DMMC 4P5KB 4PFEA 1ZVHA 1ZLUK 3FQXA 4XBEH 3RBGA 2Z31A 3L3IA 1QEWB 4NKIH 1X4XA 1CFNB 3CFDB 5E7BA 2JIXA 5LQBH 4D9QD 1HYSC 5FO9B 5DJ2A 2YD4A 3L3HA 3RWGB 1T0MA 4XPFH 4TNWK 5DD6B 5FK9B 1JGDA 1UKQA 3K46A 4XNUH 5IF0A 1AO7E 4ZOAA 1FORH 3HNTL 2J7LA 4O00A 1LK3L 3RGVA 4CN6A 4HF5L 5CZXD 2YPKB 4EI6A 1NC2B 2D0FA 1T2QL 4Z7NE 3OKDB 4MA8H 4H8WL 1NCCL 3HB3C 4F7CB 5JA9A 5KSVB 1G7HA 1ND0B 4F8QA 5HYQA 3O6FB 4OGAD 3SKJL 4O4YL 4GW4A 3I9GL 5F3HB 1KC5L 1WBZB 4PRHD 1A6WL 1YN6B 3L6FA 4OZGB 4RGMC 5GJSL 3TBWA 1OTUD 1T0PB 4P2RA 4R3SB 1VGEL 5F7UA 5T5NG 2ZCHL 2PF6A 3KJ4C 3C6SA 1PY9A 4FTVE 4I77H 2VWEC 3X3FH 1P4IL 1G6RA 4F15C 5DO2C 1SYVB 4O2FA 1BIIB 3LAFA 3SY0B 3EYVA 4U49A 3MA7B 3VFMA 1ZT1A 5EU4A 5ILTH 5I1DA 4K3HA 5AZEL 4FN0A 1ZVYA 4HWEL 3W39A 1J0IA 3MC0A 2HLFD 1U9KA 4OCRH 4NBYB 1BD2A 4PJ9B 4KROC 4ZFOB 2Y6SC 3SDDC 5TQ2H 1GGCH 3F12B 4FQIL 5EORH 5DRXB 1RIUL 1J8HD 5IQ7H 3HZVA 4D8PA 3OKLA 2VISB 5EBMA 2BOCA 3EHBC 3IDNB 3K8KA 3WNKA 4Z78A 1Y6MR 1NGWA 3Q5OA 4TVSa 3H6JA 5BVJA 4YNYB 3ARSA 3OKNB 2V7NB 1DBML 3Q0HA 1J05B 5TE6L 1JZ6A 3AU1B 3DRTA 4OQTA 1A7OL 3LQAC 3WKMH 3C6LD 3CGTA 4NRXA 4JY5L 2IALA 4P4KD 1MI5A 4TNVF 1T5WA 3OZ9L 5DT1H 2HFGH 4R90H 4WW2C 4GG6A 2JK5A 4I0PB 5E5MB 3VXMB 1NL0L 2P5WB 3NOIA 4L5FL 2ICWJ 1LO4L 4NN7B 3OPZH 5JOFA 4OSUL 2EO1A 5DA0B 3VXSA 5FKPB 3FN0L 1U8OB 4AQ1B 1T7VA 2MNUA 1IAKB 4F37F 4PPTA 1OW0A 2KUTA 4R2GB 3P0YH 3QA3A 3HNSH 2R4RL 3O6ML 3H8NA 2AQ2A 4XP6H 1PG7X 2Q8AH 3BKML 4RAVB 2NXZC 1ERNA 2Q6WA 2Z4QB 5HHNA 4M6AA 4YWGL 4QXGL 5EOQL 3RX7A 1QTYT 5CIPB 1YNLH 1HQRA 2Q7YB 4J23A 3GMRB 1AGCB 3QXAA 1OY3B 4KVNH 2WLZA 5HVHB 2P5EB 1YEGH 4NM4L 5DSCA 5DJ0A 4ZSOE 4PJAE 3BRFA 4FXKA 2BNUB 2HTLC 2YD8A 4NUJB 4MQSB 1YNKH 4WI6A 3VFGH 4Y1AE 3HAEG 1I9IL 3DVGA 1ULVA 2JB5L 3RWIB 5E5RB 4FP8H 2CJUL 3BX7C 2ZCLH 3GMLA 2IG2L 5F96H 5CSZA 3VXUB 4NRYA 1K4CA 3JWOC 1CDJA 4U1NA 5DJ8B 1KENH 1AE6L 4MJID 4ODHL 1SVCP 3WHXA 1ZS8B 2IH3B 4PY7A 4FABL 1BAFH 3GUTA 2DN7A 2QSQA 1MIMH 3GSRA 3RWJB 2WW8A 2GFBA 4NO2A 5D7KD 5TDNA 4OCSL 3WL9B 1XFPA 3F7VB 4JRWA 3F7RA 3D0VA 1QSEB 1JZ7A 1FO0A 1G6RL 2AJSL 1NBYB 4WFHE 3JZ7A 4G80A 4FS0A 4X9HA 2F8OA 3KPRE 1H3PL 1TNNA 4XNZB 1IZKA 3QG7L 5KVEL 4LHUA 4HLJA 1EJOL 4OF7A 1DSFL 2K1MA 2I26N 3E2HC 5C6TH 1A3RH 1PLGH 1I9RL 4Z7VB 3RVXC 5L2JB 2V2TA 4R26H 1QKZL 5D5MF 4YHYB 5GPRA 3IDYC 2GUOB 4CW1A 1UYWH 1CGTA 2P8LB 1IJ9A 3QQ3B 4AQOA 1G9NL 5DURB 4CVWA 1F6AA 2R69H 5FV1L 2QADD 3IDMA 5E5UB 4KKAD 3SE4A 4M4PA 1PX4A 4LCCA 4DEPB 1FFPB 3M17A 3R8QA 1IC7L 5KAQG 2ENYA 2P8MA 1RIVL 3RY6A 4C56B 1CXLA 2D7TH 4ERSL 1G0YR 1YYLL 4QXTA 3A6BH 1AGEA 2FEEI 1A1NA 4OQTL 2C3VB 1KIRA 5DRWA 4H1LB 4NRZB 3QFJE 4OFDA 4R0LA 3RZCA 1RUPH 4ZO8A 1XF4A 5GHWL 3ZKXB 2HLAB 3RPKA 2LQRA 2CRZA 3GI9H 4RCAA 2XTJC 1DL7L 4Q2ZB 4U6YB 4UAOC 3RVUC 3OR7B 5GS2D 1T5XB 3EFDH 3LN5A 5E1HB 2X42A 3HS0B 2IPKA 3QUZC 4I1NB 1HHHA 4NQTA 4AMKL 5CEYA 3G08B 1A4JB 4ONHA 1B0WA 5F72S 4Y5XB 4EQ3A 3WN5A 3O0RL 4AIZA 3UTQB 5JHDD 3FT2A 1UWEL 4LGRB 2OR8A 3HRZA 1QBLL 1V3MA 2XWTA 1P7QA 3HUJA 4LPUA 2CSPA 3IGAA 5B4MD 1B4JL 5LKNA 3F6LA 5C3TA 4OFYD 4BFBD 3RL1A 5ALCH 5I1IL 1NFKA 5IG7A 1J0YA 2O61B 3TBYA 4GW5A 3JV4A 4HXAL 2NLJB 1BP3B 2VYRE 4S11A 5EO9A 5J3HC 2W60A 3WNMA 3STBA 2B4CL 2NY3D 1FNGB 4XGZA 5HPMA 5SWSA 1NBVH 5I2IB 3SE8L 1U3JA 2DQEL 2W9LA 4LVEA 4M7JL 4JPVL 3OKEB 1PVHA 2AGJL 3SE3C 1MCOH 2H9GB 3QULA 2FD6H 1MH5A 5CD3B 2FLRT 4ALAH 1IMHC 1MCIA 5ESQB 3UCRA 3W0WD 5CP3H 1HQ4A 3D5OF 3M07A 1I8IA 3OAUH 3QWOA 4MA3B 1IEBB 5ECJE 5B38B 2B39A 4OV5A 1MUJB 2DBJA 4N9GB 5C7XL 1YJDC 5CBEB 5I1HL 4JG1L 5FHAL 1ZSDA 3V52L 5IMLB 4XP5L 5C09A 3UTPD 2KH2B 1AY1L 3QI9A 3QR2A 5ACZB 5C0GA 4S0SD 3GGWA 3KPMB 2E9WA 5DLML 1S7TA 3C5ZB 4WTWA 4JFZL 4D0BA 4G6ML 2VN4A 1FO0L 3VA6A 2MMXA 5A2LH 4AENB 4U1IA 5CEZE 3QCTH 2EDQA 4QYOB 5ANMB 1I8LA 1NMAL 1HWHB 3H0TA 4XMPL 4NZDA 2QQLL 4UV4L 1I8MB 4LU5L 3BT2H 4P5KA 2QQKH 3NCEB 4OLWL 4YHIB 3TJEL 2FIRT 5EO1B 1NFDB 4M62L 1A4KB 3ZL4L 4JFXA 1QEWA 3O9WB 4JFDD 1CFNA 3CFDA 1F3DJ 5FO9A 5F7DB 3LRGA 1HOCB 4MJ4A 1IGFH 4KAQH 1GGYA 4WFEE 3RWGA 4Z7WE 4FFYL 1EEQA 1INEL 2A0LD 4L8SB 5DD6A 4HC1H 2AABH 5AYQA 3ZKQD 1MNUL 1NQBA 4ZODA 3PP4L 3PQYE 2EXWD 2ZPKL 3ZKNC 1CR9L 3MV8D 2F19L 4HUXA 1MSPA 4JE4B 2YPKA 1JNNH 4RDQG 1FFRA 1NC2A 3E8UH 4CGTA 5JPMB 4YDIL 4R4BB 4FNLH 3OKDA 2C4XA 3QSKB 4GQ9L 1QSZA 3K7UA 4F7CA 4L4TB 2VC2H 5KSVA 1ND0A 4EVNA 3HE7B 1TZIB 3O6FA 1M6OB 1BOGB 5F3HA 1WBZA 4OZGA 1C5BH 1YN6A 5FGSA 3H9SB 4R3SA 4ACPA 1AXTH 1A0QH 1KSRA 4Z77B 2IC2A 5J1SC 3ARFB 4YHNB 3QDJD 2BMKB 4DK3A 5DGQA 4H26B 1SYVA 3BSZL 3UMTA 3HI6L 4WV1C 4HLZG 1BIIA 4IOFC 1A6VL 3SY0A 3QDGB 5HYSB 3MA7A 4KKLC 4XI5C 5CD5C 4JDZB 1Q0XH 4NWTL 5I1JL 3P77B 3QHZL 4OF8A 1EGJA 5IBLC 2DQGL 4PJ9A 4L4VE 4ZFOA 3PWPD 1U92A 4M5ZH 3F12A 2GK2A 4HW6A 1QYGL 4PJGE 2R4SH 5DRXA 1HXMB 5I15L 1ZANL 3MBEB 1WAAF 5CKAA 2VISA 4OM1H 1FL5A 3IDNA 4JHWL 5MERB 4N90D 3SCMD 4NNXB 2XWBB 1AKJD 1RUKL 2CIKA 2L4OA 4XAKE 2QJDA 4YNYA 3ULUC 3OKNA 2V7NA 1IC4H 2V9QA 1J05A 3AU1A 5CJXA 3KR3L 3D3VE 5I8CB 2YA1A 3DVIA 3QIBC 3VFSB 1F90H 5DK0B 3WLWD 4ZD3L 5E6IC 2B2XH 3PL6B 5CSBA 5D7IE 4CVZB 4YXKH 5A2IH 1F97A 2VUYA 3LIZH 2RCSH 2Z31D 3DPBA 3U4AA 4I0PA 3IXTB 3OKOB 2QR0B 1UJ3B 4HGWB 5E5MA 3VXMA 2P5WA 2A74B 1YQVH 1IKFH 1P6FA 5HHXL 3RUGB 3QEGH 5FKPA 1U8OA 4XHJD 2EECA 1F4XL 1Z9LA 1IAKA 4OV6F 2PR4H 5D7LE 5HYJB 5HDLA 2XACC 4PJBE 3C09B 3QDHA 1B9ZA 2WINB 3EJYC 4K94L 2X9WA 2F53E 4RAVA 5ALBH 2Z4QA 3NCJH 2C26A 3PUCA 4IJ3C 1T89C 2F74B 5CIPA 4S1RH 2EDWA 5C0FB 1RZKL 2Q7YA 1BQHB 1KOAA 3IFOA 3GMRA 2HTKC 4KXZH 5C08A 1AGCA 1D9KC 5KSAC 2DLHA 2P5EA 1YQ2A 2ZCKH 2NY7L 3HZKB 4MZ3A 1BBDH 2DWEB 2BNUA 2KZ1B 4NUJA 1K2DB 4LCYA 4DW2L 3DYOA 5C0ND 1RMFL 2HT3D 4YLQT 4G6AD 4PJ8B 3RWIA 3OAZK 3MGAA 4JKPL 5L0QC 2YD1A 3TT1L 4PG9B 3VXUA 3CU7A 1IAII 2C9AA 4ETQB 1PX3A 5DJ8A 1UJ3C 2NY5L 4DGYH 5LXGL 2BVQB 4DUWA 3MX0A 1TPXC 1RFDL 1ZS8A 1MFBH 2DB8A 1OP5H 2IH3A 1INQA 5MHSE 1EFXD 3SDCD 1HE7A 4ETYA 4RWYL 5ACMA 3BEVB 5F1SA 3RWJA 1RURL 2IPTH 1CFBA 1BM3L 5IHZB 2GKIA 3WL9A 5GGSY 3F7VA 1QSEA 1XIWB 3UJJH 5HI4D 4M3KB 1L0XA 4ZS7L 1EJ6A 4Q6IC 1NBYA 3ARUA 1LEKB 3ARGC 5T1LB 3VFUB 1NLBL 4XXCA 2V17H 3KJ6H 3V8CA 4G7VL 5L2JA 4Z7VA 3PGFL 3TEUA 4DKDC 1G9MH 4K8RD 5D7JD 4FQPA 1EGJL 4KY1H 1IGTB 4ZFOL 3KXFE 2GUOA 2VUOA 2P8LA 5J89A 4S2SB 3QQ3A 1MCWW 1X6NA 4F33B 1R3KB 1S7UB 2PTTB 2X1QA 4HUNB 4UIKH 32C2B 1QSFB 2DQHL 4ZOCA 3VWJC 4G8FB 5C0AE 2XWJB 3O6LL 4DGIH 1FFPA 1AO7D 2BVOB 1KLGB 2A9NH 4S1SL 2QTEA 4PP1D 2ICWI 2DD8L 5D4QA 1GJIA 3H42L 3PP3H 4PYHA 2C3VA 2NY0B 1CDGA 4H1LA 4NRZA 4PJ7E 2W0LA 4NO5B 5F1IB 5GSVB 1ZT7B 2NX5D 3HMXH 2P24B 3PHQB 1RZFL 2HLAA 3FL7A 1TETH 4Q2ZA 4U6YA 3DJ9A 3LN9A 3V6OA 3OR7A 1T5XA 3HS0A 4MNQE 2FL5B 1CLZH 4J3WA 1UCBH 1A4JA 3G08A 5BV7H 4Y5XA 3MLYL 1T7YA 4HS3B 4ZOEA 1O7SA 4JLRB 3OXRB 2CLZB 5E08H 3SDXE 3SJVB 1BBJB 3ARVA 2EC8A 3BUYB 2O61A 1UA6L 4R8WL 2AKRB 2NLJA 3PHOB 3HI1B 4NJ9L 5D2NB 3EOTH 1QFUL 3TA3C 2OMBA 2VDOH 2FX9H 5I2IA 2EYRB 4NCC2 3NIDF 5EU6B 3ULUE 1EUUA 1CL7I 5KW9L 3OSKA 3OKEA 5MI0C 4V1DE 1NCDH 4FQLH 2H9GA 5CD3A 4WO4B 5JW4R 5EIQA 5ESQA 2Z8VC 8FABB 5DK3A 1WFTA 2ICES 3BHBB 1GGIL 3RRQA 2AJZB 3KHQA 4HS6B 4ZMAT 1U8HB 1YMMB 5IFAH 4MA3A 2FATH 5B38A 1MUJA 3W82A 4N9GA 4GKZB 2FBOJ 3B8YA 3V6FB 5CBEA 4UUJB 5GS2H 3QCUH 3PWUB 5IMLA 5DJAB 4NNYB 4ZAKC 2JJUA 5ACZA 1XH3A 3KAAA 2AEPL 1FC1A 3KPMA 5IEKB 3C5ZA 5E2WL 1VSCA 4G9FB 4AENA 2ITDB 3MOAH 4YHZL 2IAMC 5EFIA 3G6AB 4D9RE 5F7HA 3RWFB 1IKNC 3NA9L 2IFFH 4EQ2A 4QYOA 5ANMA 1PZ5B 1S3KH 1OD7A 2WUBH 1I8MA 3KPQB 4AEIH 3BZEB 3B9VA 5D6DA 4BSWB 4YHIA 1YY8B 5EO1A 4CADB 4LL9A 1NFDA 2DMKA 2PXYC 3TBVB 3MLRH 3O9WA 2AAVA 4M7ZB 4QRTB 1J1PH 4OLYL 2X4RB 3ARED 3T4AB 3UZQA 5F7DA 1R6VA 2ADJB 1ZAGA 4F7EB 3JWDH 3QHTC 4OLUH 4QWWD 4DZ8B 5E7FA 3BXNA 1BX2A 4O2EB 1LWRA 2GW5A 2RJMA 2GY7B 4NJAL 1Q9LB 4P2OC 3U7YH 2IPUK 5L9DL 4PP2B 1CF8H 5JPMA 2DIJA 3HG1E 4Z7QF 1FNFA 4R4BA 2J6EA 1OB1B 3MGOB 4UTBH 1D6VL 1H15B 2EE2A 4L4TA 1P7QD 5D1XB 5CCKL 1GCFA 2A6KB 3HE7A 5E4EB 1TZIA 3IF1B 1M6OA 1H3UA 4YE4H 1BOGA 2GYSA 3RP1A 1T7XA 3H9SA 3NZHL 5GRJL 5KS9F 3NA4A 2ZP0T 2Z35B 5IB5B 3DETC 2DKSA 4BFGA 4Z77A 4YHNA 2BMKA 4WGWB 3CMOL 2BNQB 2NMSA 4FG6C 3CJJA 4H26A 4OQ1A 4KZEL 5C07D 1NUNB 4WFHD 4N0YH 5GS0C 4HJJH 2HJKB 1Z9MA 4FQ1L 5IV2B 3QDGA 3DMMD 5HYSA 3D2UD 3VU2A 3IXAB 4JDZA 4H25B 2IQ9L 4KRNA 1JRHH 4WFGD 5EU5B 1DBJL 3TNNB 1HYSD 5SX5H 2W9DL 2EEBA 3F58L 1FLRL 3CVHB 1VKXB 4BH7B 1NFDF 2P42B 1HXMA 1VPOH 2ZNWA 3G6JB 2G2RA 2UY7A 1U8MB 3MBEA 1YC7A 2DTML 4LASH 4JPWH 4LSSL 4Y5YB 1NEZB 2K7QA 4BQBA 1L0YA 3QG6B 4M43H 1KN4L 5MERA 4FQ2L 1VENA 4HFWB 1N3NA 5SV3A 1PQZB 5JHLH 4NNXA 2N7BA 2XWBA 2BDNH 3VGHA 3HB3D 4XVUC 4GH7B 3OXSB 1UXWB 1N6QH 2ADIB 5KSAA 3FO0H 4PJXB 1TQBB 1HH6B 4J6RH 2OBGA 5I8CA 5GZOC 5L2KE 1TXKA 3QJHB 3VFSA 3FAWA 4M7LH 3RJQB 3QFJD 1YEEH 2CK0H 4GRWE 4Z0XB 3EO9H 1OPGL 1AXSB 4XB7A 2OTWB 3PL6A 5DO2D 4HUKB 4CVZA 5H35B 4NN5C 25C8L 4TPRL 3V4PH 1Z3GL 3IXTA 3OKOA 1CXIA 1DQQB 1UJ3A 2QR0A 4GT7A 4HGWA 4RISH 5DD0H 4BZ1H 4DN4L 3UPCA 1J1OH 3RUGA 3MLXL 1IEAB 1EAPB 4R7DB 3UXFA 3FN9A 4OCYL 1UM4L 3GSNH 1JGVH 4DAGL 4KV5F 3DX8B 1HILB 4DKFL 4XCFL 2H2SC 4KROD 5HYJA 2F8VA 2Y6SD 3SDDD 1C08B 1OAKL 3TIDB 2WINA 2H8PB 3V0VB 5T3ZL 1I9JH 5IVXF 1NDGB 2XQBL 3L5WB 2F74A 3EHBD 5C0FA 4U6HB 1BQHA 4PRIB 5MENB 3GB7B 1JYNA 1RI8A 2WQ8A 3TIEB 3PWJB 4MMZC 3V4VH 2BVPA 3HZKA 2FO4B 1RVFH 2DWEA 2PNDA 5KSBB 3BPNC 4Y5VB 4Y88A 2DQDL 1VADA 4DVRH 1MCBA 2PYFB 3QXVA 4AG4H 1EEYB 1QR4A 4LCIH 3SO3C 4LBEA 5T1KB 4PJ8A 1A6UH 3WUWB 4ZDHA 1CD9B 2CK2A 4D2NA 4ETQA 1J0KA 1I85A 1GZPB 3K2UH 2P44B 3U7WH 2BVQA 4GG8B 4L3ED 3BPLB 4Q6YA 5IWLA 2J6EL 1GXEA 1G6VK 5FOBB 4TNVK 5EU7C 4C58B 3W9EA 3MLPA 2B5IB 1U3YA 4HX1B 1FAIL 1MHCB 4GXUN 3H9HB 1XIWA 4YHKH 1O5DT 2QSCH 3AGVA 2NXZD 5CEZD 1LEKA 4F37K 3ZYZA 4LPWA 3VFUA 1LVEA 1CQYA 4MVBC 4NPYA 2PTVA 4YHPB 1L7IH 1DVFC 1FNSL 2GITB 1FVEB 4NC1C 1IGTA 2HTLD 4S2SA 5DRNB 2CLRB 4LHUG 1DP0A 4F33A 1R3KA 4GXUM 4CMHB 1BD2E 1S7UA 1OCWH 2PTTA 3IFLH 4WFED 1T2JA 1QSFA 32C2A 3NIFF 5DJZB 4G8FA 4J4PD 2XWJA 5I71B 4LVOC 3PQYD 3T09A 2BVOA 1W72H 3TA3A 1KLGA 1NKRA 3OB0H 2MHAB 4EDWL 2X4PB 4ZQKB 3C8DA 1WT5C 4R96B 2YS4A 3BYTA 2CDFB 2WP3T 3WS6A 5F1IA 4M6NL 1G9NH 5GSVA 1ZT7A 1MWAB 4HAGA 4WHYH 1KJ3H 2P24A 1A2YB 2YOCA 3PHQA 5KTEH 2RB8A 4RA0C 1CLOH 4RGOH 4HT1L 5E8NA 1OAXL 5C08D 2Y7QB 2FL5A 3ZKMC 4RGNC 1MI5E 2FGWL 3RVXD 5LBSH 1GHFH 1OWWA 3QRGH 1Z6JT 1X5FA 1AC0A 4K8RH 4R6UA 4MZ2A 4R7NB 5INDB 5I30H 4TSBL 3WSQL 4HS3A 4PV9B 2NTSP 2ICCA 4JLRA 1MFEH 4JQIH 4JFEB 3OXRA 2WSKA 4K2UH 3S6CA 2CLZA 5F7EL 5FYKL 5CAYB 5D96B 2A9MH 3SJVA 1BBJA 2GHWB 1CXFA 3BUYA 4XWGL 1CD0A 2AKRA 4L4VD 3I3DA 3KPTA 3PHOA 3HI1A 4DN3L 5LVEA 5D2NA 4XWOC 3QEQB 1MCSA 4OFIA 3EOBB 5IROC 4M61B 2EYRA 5D5ME 5FYJL 5I18H 5EU6A 4FQXB 1WF5A 3WXVL 2ARJB 3RU8L 1OARL 3KDMB 1N0XH 1V3KA 2BNRD 4UT9H 2JJSC 4RAUB 2DQIL 2OL3H 4MB5A 3IDXH 3IB4A 4PB0L 2XYCA 4KJWC 4WO4A 1Q94B 3IRPX 5C1MB 4XAKD 3L95B 3TZVC 1JHLL 5DDHB 4OTXL 3BHBA 4KMTL 5DHXB 4HS6A 2WIIB 3PABB 2O5ZH 1U8HA 5E8DH 1YMMA 4MD4B 2A38A 2XTJD 4LSRL 3QPXH 3OF6A 4J8RB 2AEIT 1ZHKB 3RVUD 1HKLL 1I9EA 2E27H 4UUJA 3PWUA 3QUZD 2WANA 1F58L 4JFPB 5SX4H 5DJAA 3SDAB 4NNYA 2RFXB 3MACL 2VDMH 4TVPL 3EO1B 2VDRL 4KK6C 4KDTC 4MQXC 1QD0A 4Y4HC 5IEKA 3Q5TA 4EI5B 4JPKH 4HH8A 1MCKA 2MWCA 1A14L 4A2MA 1EUTA 1XGQB 2ITDA 4HCRA 3VRLF 5EN2A 4I3RH 5HHMB 3ZDZE 2M1KA 3PXJA 3BWUC 4NZUH 5J3HD 4KK9C 4YBLC 1P2CB 4TYUA 1PZ5A 5MEOB 2VLJB 2E7CA 5JMOC 3WFCL 3NAAL 1EO8L 3WV0A 2F53D 3O2WL 5FHAH 3KPQA 3BZEA 4XXDB 3I50H 4QRRD 4BSWA 4PJEB 1YY8A 4CADA 1U8LB 1VGKB 3TBVA 2R0LH 1X9QA 2J8UF 1JZ5A 1I3RB 1KLFA 4QRTA 2ARWA 2X4RA 3SGEI 3T4AA 2YRZA 3FCTB 4QGYA 2EH7L 2J5LC 4FXGB 3QEUB 2MKWA 4U1LB 5C0EB 2ADJA 1K8IB 4CMMB 2MPAH 4M93B 2GSIB 4F7EA 1AQKH 4DZ8A 5HGBA 1J1XH 1P7KB 1QRNB 3QXTA 1DDHB 4O2EA 1VDGA 4I48B 3QUMH 1JTOA 1Q9LA 4G8IB 1VEMA 2XN9B 5EU7E 1N7MH 2GT9B 3LEVH 4PP2A 3TJEH 1OB1A 3MGOA 4PYGA 1H15A 4PJ5D 2N4IA 4K3EH 1AD9B 5D1XA 5GGRY 2A6KA 3GJFK 1RK1B 5H94B 1X5KA 3IF1A 5EZJB 3LD8C 5JOEA 4C55A 2NY4C 3L5HA 1MFAH 3FONB 3O2VL 1KFAL 4U0QB 4QOKB 2Z35A 1RK0B 3VFPB 2BNQA 1GC1L 5I1GH 4ODWB 3T4YB 1K5NB 1KACB 3TC9A 2HJKA 5IV2A 3C9NB 3CVIL 4CN4A 4X6DB 4OIIH 1OGAB 1CXEA 3DUSB 1M05B 4Y7MA 3IXAA 4H25A 1JPTH 1WFNA 2VXVH 2A83B 1UB5B 2BC4B 3GK8L 4QEGA 4XP1L 5EU5A 3TNNA 4PJCF 1FNEB 4K3JL 4LSUH 4IDJL 5GRYA 2FSEB 4PG2A 1KT2B 5IW1B 1HIMH 4W6XB 3CVHA 1U8KB 1VKXA 1WSST 1DQLL 4BH7A 3O81A 3G6JA 1U8MA 1FIGL 3ZKND 3MNVB 4EN3C 4FMFA 5CINL 4Y5YA 1NEZA 5E2VL 3QG6A 2BY0A 4FQJH 3V0WH 4HFWA 4OD1L 1MLBA 4J3SA 3D87B 5IB1B 1PQZA 5F21B 2F58L 4HJGB 3QBTB 3MO1A 4QRPE 5ITFB 3OXSA 1NBQA 1UXWA 2ADIA 5SWSE 3SGDI 5D9SB 5EBLB 4PJXA 4R9HA 1HH6A 2EO9A 1NUGA 4M7KL 2VQTA 1FJ1B 3QJHA 5EU3B 4JHAL 4LCUB 4LCWB 5C2BL 1CE6A 4Q9BA 4JQXA 3P40A 1AXSA 4RGNE 2OTWA 4ODVH 4PJFB 4X9GA 5H35A 3WXWL 4IOFD 1DQQA 3VG9B 4OCLC 2JJTA 5CUSL 2WAHA 3C5JB 5I0DA 4L1HA 4IMLB 1HZHH 4R7DA 1IEAA 1EAPA 4Z0BH 4KKLD 2MJWA 4XI5D 5CD5D 3GSQB 1EA9C 1NGQL 2H1PH 4BK4A 2HA1A 2C4FU 1F3RB 4HCRL 1N2RB 3DX8A 1HILA 1QG3A 3G5VB 5IBLD 5IHLB 3B9KB 4EBQL 2D0HA 1T03H 3B2VL 1E6JL 1CDHA 5FUZL 3Q2CA 4HH9B 4YDVB 3T0AA 4OAWB 3V0VA 4Y8AA 4PLNC 12E8H 3L5WA 5IBTH 4U6HA 3S37H 1MRDL 3GB7A 4B41A 4M1GL 5MENA 4ONGL 5F9OH 3TIEA 3PWJA 2XZQH 4NO3B 1CGSH 2FO4A 1KJMB 5GGQL 1NKOA 5KSBA 4WDIB 4I2XB 4Y5VA 3ULUD 2PYFA 5I1CL 1EEYA 1ZOXA 2ZWLT 4L9LB 4V1DD 1XGTB 5T1KA 3LY6A 4UT6L 3WUWA 3QIBD 5J57B 1BMGA 3BP5B 5E6ID 4ORZC 4E41B 4B7LA 2GTZB 5D1ZB 4D0CB 1GZPA 1JGLH 3BKYL 4GG8A 2BVUA 5TPWL 5KZCB 3S3PA 1BF2A 4WY7H 5T33L 5FOBA 2Y06H 4BUHA 4DTGL 3I75B 2NY7H 4PS4H 4MCZA 4QHMB 3VXRD 4HX1A 1RZJC 1WT5A 5M94B 3S5LB 1G0DA 5CBAB 1MHCA 3BUTA 3H9HA 1SJEB 4HIXL 4ZYKB 5JQHC 3EJYD 5J06A 2DLTA 4HUMB 1U58B 4OZGE 1A7PL 4OCXL 1DCLA 4D9RD 4HXBH 2SEBB 5DQDH 5EOCH 1EBPA 4Y4FC 4B5EA 2HTKD 1Q0YL 4K07A 4YHPA 1D9KD 3T65B 5C0CB 3ARRA 4F7MB 1J0JA 1NSNH 2B1HH 1FVEA 5BO1H 1N5YL 2UUDK 2QV2A 2M2DA 5DRNA 8CGTA 2Y07H 3CVHL 4LLUB 4KC3B 2HRLA 3LQAH 4P2QB 1SY6L 4C59B 1OAQH 3KLAB 4KQ3L 1P7HL 5J8OA 4P59L 5DJZA 5INCB 2VDKH 4PY8J 1JGUH 5GGVL 2NZ9C 4DQOH 1ZGLB 5IKCB 1IL1B 4I5BA 4KI5F 5HDBF 4UQ3B 4U31A 3PGFH 1NCAL 2X4PA 4ZQKA 3MUY1 4R96A 4DKEL 4QF1B 4C4KO 4KTYA 2CDFA 3U4EB 5L7XH 5DWUH 5DD3L 5JW3H 1MWAA 4LVHB 3RI5F 2FX7L 1A2YA 5I8KL 4PBVC 5T5FL 2DDQL 3N85H 2J88H 5GJTH 3ARGD 1J86A 3KYOB 1XCQB 5H2BB 3Q6GH 2P46B 4H1LG 3INUL 1IQDB 3SE9L 3WCYA 2WUCL 1JUFB 2ZUYA 4R7NA 4NZTL 5INDA 3QJFB 2GI7A 1NGZB 2R0ZL 3CK0L 4TUJB 1LP9F 4CDGC 2KKQA 4PV9A 2YD9A 3VXQB 2YA0A 4JFEA 4Y4HA 3ULVF 4ZFZA 1W0WB 1NMCC 3KGRA 1MJ7L 1X5XA 3UJIL 4Y8DC 4LHQB 4I3SL 4QRSB 3JWOH 2AJUL 3VWJD 2J12B 4AL8L 3QEQA 3GI8H 2BX5A 4TSCL 2RGSA 1FGNH 3EOBA 4M61A 3UTTB 4FQXA 2ARJA 4OZIB 2IAND 3KDMA 2ESVE 5DGRA 4RAUA 5F70A 3ZHDA 1UM5H 2QHRL 5HI3C 3VG0H 2W65B 1Q94A 3GO1L 3L95A 2P5EE 2VDLL 5DDHA 2VLKA 4KUZH 3JVGA 3GKZA 2H2PC 4IIQB 2WIIA 5DS8A 3PABA 3RX5A 1ONQB 2DQUH 4M6OL 3S97C 3SGJC 4QHNB 5L2KD 3P9LB 1QNZH 4J8RA 2FIKB 1ZHKA 1UXSB 4OGYL 5ENWB 3VXUE 1IEHA 4JFPA 5EZLB 3SDAA 1D6EB 4F80A 2RFXA 3H7BB 5AYUL 4K7PY 3MV9B 5KW9H 1NAMB 1BWMA 3AS2A 1INDH 4EI5A 5B38G 3S35L 3KPNB 4XPTL 1XGQA 4NQEB 3MXWL 5D8JH 1HWGB 3FT4B 1LO2L 3S36L 5DUML 5E9DB 1FAKT 5HVGB 4KZDL 1DLFL 3DBXB 2HKFH 3ULVL 3B9AA 1M7XA 1P2CA 5MEOA 2VDNL 2VLJA 3TA3D 2OK0H 4GO6B 3MJ6A 3HZMB 5AZ2H 4OLZH 4H20H 5JQ6L 1KCRL 4XXDA 3V7AE 4W6WB 3L3DB 1SM3H 2R0KL 4PJEA 3MODL 1U8LA 1VGKA 1F02I 4IRSB 1IC5H 4XMKL 1I3RA 4JM2F 4K3DL 1LK2B 4UV7H 1ZEAH 3FCTA 3N1FC 5I0ZA 5IB2A 4FXGA 3T08A 3QEUA 1BECA 1ZVSB 3CSBA 3Q5YA 4U1LA 1K8IA 4XVSL 5C0EA 5I17B 4DFIA 5L8LB 4I8DA 1LNUB 4X4YB 2GSIA 4P23C 4P2CG 5CZVL 4LGSB 3IU4H 4X8XA 2XRAH 1ITCA 1FZJA 1P7KA 1QRNA 1MCJA 4PJHB 1F3JB 2B8OT 3SQOL 4I48A 3NIDE 3HC3L 1QHOA 4I4WB 5B3JF 3MLSH 4G8IA 4AIOA 2GT9A 7FABL 4ZAKD 9CGTA 3VH8A 2CGRL 2FDBP 5D1QD 1AD9A 1IC1A 1RK1A 1TJIL 5H94A 4C56E 1MWAL 5EZJA 2WBWB 4ZTPL 1TVBB 2EYSB 3FONA 1QRKA 4CJ1A 1ACZA 2IAMD 4XMLH 4QOKA 3EZJB 4HWNA 4MCYB 3C08H 3MBXH 2L0DA 5SWZB 1JTPA 2NY2C 3VFPA 3EOAB 4ODWA 3T4YA 1OL0A 5I74C 1K5NA 3D6GA 3LQZB 2DWDB 4NN6B 3C9NA 1YEFL 2FYYB 4X6DA 4BA8A 1OGAA 3BRGC 2OR9H 3DUSA 2PXYD 1D7FA 1M05A 2DM7A 2CLVB 4JY4B 3P4LA 2A83A 1UB5A 2BC4A 4XPHL 5J1AB 3BKJH 5J11B 3UROR 1FNEA 2HJFB 5KOVC 1GZQB 3L1OH 4MHHG 4PLKC 3KPSD 5D71L 5I6XC 2FSEA 3NIGF 1KT2A 3F65A 4HD9A 4KMQA 5IW1A 1U8KA 4KKCC 5HYSG 1KG0B 5SV4A 3NTCL 1CFTB 2A1WH 4O9HL 3MNVA 3BH9B 4F9LA 4P2OD 1YJDH 3BZ4B 5E95B 3K81A 4X9FA 2XNAB 3TN0C 5IB1A 3H3PL 4HFUH 5HGDB 5C70A 4HK0B 3GDBA 4HJGA 2WK2A 2NTFB 3OAZH 2IGFH 3BPCA 1N8ZB 1X5AA 3HNVH 4KHXL 3SGKC 4KPHL 5D9SA 5EBLA 3BGFB 1L0QA 4DJMA 1NAKL 3K4AA 1FJ1A 4GW1B 2AI0H 5EU3A 1CU4H 1MF2L 4LCUA 4LCWA 4MB4A 4QXUL 3Q48A 3DETD 5H37H 2VDQL 3QHFL 3FT3B 5D2LF 4GSDL 3GMOB 3GBLA 2ZSVB 4Z7QE 4FG6D 4PJFA 1MQKL 1OGTB 3AS3A 3VDCA 5K9QI 5GS0D 2C7UA 3DYMA 3C5JA 3AM8A 4IMLA 5CLWA 3GSQA 1QLEL 4JZJC 3HR6A 3O6KL 1N2RA 5ITBH 5ERWB 3OKYA 3G5VA 1OT2A 4WI5A 1WZ1H 3B9KA 5EA0H 4UOW1 1EXUB 4Y19B 5BZWB 3WHE1 4Y4KC 4HH9A 4YDVA 4OAWA 1JPFB 2DMCA 2YXFA 4H5SB 4P48A 1EO5A 3HE6C 3BESR 1S5IH 2MQCA 4GS7C 5FYLL 3W11C 3A67H 4NO3A 4OCYH 3JV6A 4XVUD 1KJMA 4WDIA 4I2XA 3MR9B 5HHOD 1NFDE 4PJIB 5BW7A 4WWKC 4B53A 4L9LA 1XGTA 3WFZA 1B2WH 2HH0H 3RKPA 5GZOD 1UFUA 1BQHG 3ARDB 3GJEB 3UBXB 3BP5A 4NDMB 1T80A 3UC0L 4E41A 1BF8A 2GTZA 1I1AC 5D1ZA 1FNAA 4D0CA 1CFVL 5IJKA 3O8XB 1R3IH 4ODSL 5CJQL 5FHBL 3MZTA 3B5GA 3I75A 4WFFD 1T04B 3MJ9H 4QHMA 2APBA 2XZCH 4XC1L 1XGRA 3R1GL 1FYTE 2ED9A 4OM0L 3S5LA 4TOYH 2VZ3A 5CBAA 2H2SD 4MX7B 4HSQA 2OQJB 1SJEA 4GMTL 4NQDB 1VESA 3A6CH 3N9GL 1U58A 2N7AA 3H9SE 2GJ6E 4HWBH 1KULA 2SEBA 4U6VL 1T4KB 3D39E 4XCCH 1EFQA 2DBLL 1JNJA 4LFHD 4NGHH 3T65A 1AHWC 5CGYC 4F7MA 4NZRL 1DFBH 1L9NA 5JW4M 1KYOJ 5DJ6B 3ULUH 5B8CB 2VN7A 4LIQH 4MNGB 4GKNB 5EULV 4LLUA 1H5BB 1V7NH 3CMGA 4MQ7B 2WBJC 4P2QA 1FDLH 2C1OB 4OD3H 3KLAA 4Q9RL 2LTQB 5INCA 1I3GH 1ZK9A 2AV7B 3NFSH 1WBXB 3D48R 2P45B 3FB7B 4XBPB 3IT8D 1ZGLA 5IKCA 4NUGL 1IL1A 1JHTB 3ALXA 5JIKA 1A7NH 4KJPC 5KVDH 4UQ3A 3S96B 5J13C 2E7LA 1N4XH 4YFEA 4QF1A 1B6DA 3V9FA 2HKHL 4JPIB 1F8TH 3U4EA 1AI1L 2BFVH 4LKCB 4KDWA 1D5ZB 5CKGA 1MPAL 4PRHB 4HUVB 4BQ6A 2MQ3A 3AMKA 3BO8B 1WGOA 1SEBB 4JKKA 2EEDA 2WZPD 4M1CC 3ZYJA 3KYOA 1XCQA 5H2BA 6FABH 1MIEL 3AAZB 4MVBD 3DXAD 1IQDA 1EO7A 1JUFA 1DVFD 1QOKA 3ABZA 4NO0D 4Z95L 5C0RL 4V2CB 1X4YA 2R2EB 4TNWF 5DJDB 2X9XA 3QJFA 5T3XD 4UI2A 1NGZA 4TUJA 1EVUA 5LWYL 4Z7NF 1KYOK 4X7DC 3U48A 3QP3A 3MCKB 3MRJB 2XG5A 3RTQC 3VXQA 5F9WB 4YXLH 4E0RB 1U6AH 1FZMB 4HDIB 4KUCF 1W0WA 1CIDA 5F7KC 4L8CB 3HC0B 4NQSA 4QRSA 5HYJE 1AP2B 3IFPB 3AUVA 2VDPL 4M4RA 5A16B 3BGAA 1J8HB 1DLHB 4MAYC 3F7PC 3F7YB 1CK0L 2R1WB 3UTTA 4XBEL 4WJ5B 1JZ8A 4IM8A 1AR2A 2DLEA 3QWRD 5CJOH 1CQKA 5CMAB 3Q1SH 3QUYC 4NKIL 4YC2B 1UEMA 3C5SB 1FRGH 4TTGA 2W65A 5LQBL 4QRPD 5FYJE 3JTTB 4XPFL 3LKQB 4IIQA 1ONQA 4JQVC 1KTKE 3TV3H 3BH8B 2BVTA 3C6LB 3DI3B 2FH8A 4QHNA 4XNUL 3P9LA 2VLRE 1FORL 4HPOH 2FIKA 1WVZA 1C5DB 4P4KB 1NGXB 1UXSA 3G5ZB 3MSPA 2CDEB 5ENWA 3V79C 3ZKMD 5EZLA 4RGND 3K4DA 1D6EA 4Y89A 4MA8L 1NJ9B 3MV9A 1NAMA 1FG9C 4UNUA 2EH8H 4X6CB 3FQWB 1TENA 1UWGH 3SBWA 5K59F 4D3CH 3KPNA 1CD1B 3STZB 3S7GA 4NQEA 2EDFA 1JCKA 3FT4A 4TVPE 2EIDA 3QQ4B 4ZNEA 4I77L 5E9DA 3X3FL 3SKNB 3DBXA 4ZUTA 1RU9H 4XWOD 1DQDH 4OJFH 1X5GA 3L3DA 4X8JB 5ILTL 2Y36H 5IP4A 4IRSA 1QBAA 1BOYA 2BY2A 2OP4H 2XV6B 4NHUB 4OCRL 1LK2A 2H6PB 2BJMH 4KJWD 5IK3B 1VEOA 3BI9X 3QRFM 4HKXB 3TZVD 1GGBH 1ZVSA 3CAFA 3O4OC 5TQ2L 1GGCL 4LNRB 5EORL 1LNUA 4X4YA 4RMVA 4OZIF 1YEIH 2AJVH 4Y16C 4PJHA 5IQ7L 4FZ8H 5AD0B 3OAYK 4WCYH 5HD8C 4I4WA 4FHBD 4XX1E 1MCPH 4OIBA 4MJIB 4C54A 3F8UB 5GGUB 3TN0A 3LMJH 4KK6D 4RX4A 5IMMB 4KKBC 4MQXD 4Y4HD 1KPVB 1TVBA 2EYSA 3SGKA 1FZOB 3WFDH 4Z8FH 4MCYA 5CILH 2JTDA 5SWZA 4YBHA 5F6IB 3DSNA 2HFGL 4KK9D 3EOAA 4R90L 3LQZA 2DWDA 1XF1A 1E4XI 2FYYA 4M7LT 1VCAA 4K9EH 3OPZL 1EVTC 5BV7B 2BY1A 5TQ0H 1U93B 2CLVA 4JY4A 2LU3A 4RFEB 3VRLE 2AP2A 3EJZC 1KCKA 4YAQB 1UC6A 2HJFA 3N06B 4K71C 4XT1C 1HNGA 2GJZB 3P0YL 1YEKH 3HNSL 4WI9A 4YGAB 2ZUXA 4XP6L 4WI4A 2Q8AL 5ICXB 3FFCE 1X5YA 5DC0A 1KLUA 2QADB 2D7OA 1CFTA 4Y4KA 1MCQA 3BH9A 5FA3B 4NCDA 2YZ8A 3MFFA 3BZ4A 1YNLL 2J8UE 1A6AB 3ETBF 2XNAA 5CS7A 5HGDA 4HK0A 3O2DH 4KVNL 2D2OA 1YEGL 2NTFA 3BD5A 1DANT 1N8ZA 3P0VH 4HMCA 3BRDA 1ZLWK 3NZ8B 2LV4A 4YDLC 1YNKL 1NANI 3VFGL 1BIHA 4IHOB 1EEZB 4HUWB 2NY4D 1BFSA 1NEZG 2LU7A 1JPST 4GW1A 4FP8L 2ZCLL 5F96L 3FT3A 4OUOA 5CP3A 3GMOA 2ZSVA 1KENL 2Y4SA 1C1EH 1MAMH 1UB6B 3U0WH 3RQ3A 1OGTA 3CZJA 4YH6A 4KI5C 1S9VA 4AK1A 1BAFL 1MIML 1OF2B 1MY5A 1TDQA 3BFOA 3EYQC 4YK4C 4N1HB 1MRFH 4XP9H 4ZUSB 5ERWA 5JHDB 4CUCA 5I73C 5F93C 3RA7H 1M71B 4Y19A 5BZWA 5A43C 2CXKA 1LEGB 1ZV5A 2FNBA 5HDQH 1JPFA 4G9FE 5GGTH 2OTUB 4H5SA 3LKOB 2ZOLB 2AK1H 3TCXA 5BJTB 4EN3D 4LPCA 2CUMA 5KVFH 2HMIC 1JPGB 5BQ7A 3OJ2C 1RQ5A 4WNQB 2NY3B 4M03A 5C6TL 1A3RL 1PLGL 4LAJH 2AERT 4PJCE 2YZ1A 3H9YA 4R26L 1LMKA 3WJJC 5C9KA 1IQWH 4JRXE 1UYWL 2ESVD 4WW1B 4PJIA 3ULVC 1K3IA 2R69L 4NYLB 3CFJB 3OG6B 3ARDA 3BPOC 2VTFA 1JJUA 4I18B 2NZIA 3UBXA 3W0WB 4X80H 4RFNC 4HC1A 1IARB 3DV6A 1RUAH 4NKOB 1JGEB 3CFEA 3O8XA 2KL6A 5GS0H 2D7TL 1U8QB 2D9QB 3HR5B 4KFZC 3UX9B 3A6BL 5EUOB 3WUWG 1YPZB 3UPAA 1T04A 1A1OB 5AG9A 4R97B 5BVPH 4QRQB 4OLVH 5IT2H 4KKNA 3L3GB 1RUPL 4MX7A 5EC2B 2OQJA 3TWCH 1J9CT 4NQDA 4AM0A 4J3OC 3FQUB 2ZJSH 3NPSC 3GI9L 3MLTA 4LEOB 4X6FB 1WFOA 3EFDL 2DM3A 3S34H 4AEHH 1T4KA 4RNRA 1GOFA 2BNQE 2X89D 1K9TA 2A77H 3FJTA 2FR4B 5MP6H 1WZMA 3MREB 2F8XC 4OI9A 5DJ6A 3VD7A 5B8CA 4MNGA 4GKNA 4JFDB 3V0AC 1H5BA 4MQ7A 1YYMH 2C1OA 3NH7H 5ALCL 3SHSA 3MV11 2XXCB 4F7PB 3U79A 3JTSB 3OQ3B 1SBBA 1NPUA 3IETB 2AV7A 4OFVA 1WBXA 2ZSWB 2Q3ZA 3ISWA 3FB7A 4XBPA 1T7ZA 1NBVL 3MV8B 1JHTA 3B3IB 1UQSB 3S96A 1OTSD 3CU1A 3D1MC 4PJDB 1K4DB 1WISA 4JM2C 3ARBC 1MCOL 5I1EH 2FD6L 4ALAL 5DC9B 5TFSH 3WIFB 1WBYB 5KG9B 2VXQH 4LKCA 5E70A 4C56D 1QUNA 1K6QH 1D5ZA 3G5XA 4PRHA 3WO4C 5IVOA 3OAUL 3JUZA 4YHMH 4BZ2H 5HYFA 3BO8A 4U1GB 1U3HC 1SEBA 4RFOH 3U30C 4JQVA 4EIZC 4P0DA 1IILE 2ZUWA 1UACH 3KPPB 1HEZB 4X6EB 1ACYH 1KJ2A 5KAQF 3OGOE 3O4LD 3MUJA 4Y4FD 1ZT4A 4LQFH 3AAZA 1QFHA 2R2EA 2ZUUA 5DJDA 4DKEH 4M8QB 5KSUB 3VRIB 1A02N 3MCKA 3GSNB 3MRJA 3N0PB 1XR8B 4OZHB 2XZZA 3L3OA 4ZS6C 4E0RA 2OMNA 1FZMA 3VFWB 4HDIA 3QCTL 1WQVT 3BE1H 5HGAB 3PWPB 1JF1B 4TQEH 4G8GE 5FYJU 1AP2A 1I4FB 3IFPA 4BFIB 4YPJA 3DO7B 3VGAC 3VWKC 5A16A 2B7DT 1J8HA 1DLHA 1E6OH 3F7YA 2NZ9D 2R1WA 3BT2L 2QQKL 2GJJA 4WJ5A 1RUMH 4GBXC 1XGYL 3SCMB 5DUBB 5CMAA 1DN2A 1XF2B 4YHLH 2CD0A 3C5SA 5GS1B 1AKJB 4PRIE 1G7LB 2IWGA 3AY4C 3A6OA 3K1DA 1R5VB 4U1HA 1IGFL 2G5RA 4KAQL 3JTTA 3BDXA 1CLCA 3LKQA 2PW2A 1UZ6E 4HC1L 2AABL 4UMGA 3BH8A 4HG4J 3C6LA 5J7CC 1FFNB 4M48H 3WDJA 2Y9RT 4JRYE 3PIQB 4KI5E 5HDBE 1C5DA 4GUPA 1NGXA 4P4KA 3G5ZA 4GAYA 5GXBB 3ALPA 3DRQA 2CDEA 4PJGF 4FXLA 3RI5K 1JNNL 3O41B 1PW3A 3G9AB 3E8UL 5I1LB 2H45A 2R56H 2ZG1A 4LLWB 4FNLL 2IMMA 3CSPA 1QFOA 2Z31B 1NJ9A 1GPOH 2CMRH 3BKCH 2VC2L 3OHXB 4JJ5B 4M1DH 4X6CA 3FQWA 5AEAA 5T3XH 1FE8H 4V2BA 5DVMA 3STZA 1C5BL 3KYKH 2DF3A 1AXTL 3PE9A 1A0QL 1EMTH 3QQ4A 2QSTA 2Y23A 1BZQK 4W81A 4NNPL 3SKNA 3AXLB 4WWID 2HFFB 4ISVA 3RDTC 3REWB 1XT5A 4Y2DC 1LP9E 5D7IF 5C6PB 1GAFH 4DKAA 1RZGB 5SWQB 4Z7UF 3O3UN 1Q0XL 4JKWA 5C0BE 3ULVE 2H6PA 5HI3D 5K9JH 1G7IB 5IK3A 3NPZB 5TE7H 3BISA 4M5ZL 4LNRA 2H2PD 3VFNA 5F7FA 3S3SA 1R5WA 2XKNB 1HSAB 2R4SL 3OKKB 2VXSH 4KK5C 1EPFA 4EJ1C 4PJBF 5AD0A 4P9MH 2MKLC 4OM1L 3FOLB 4XCYB 1YECH 4X4MA 1CDYA 5HGHB 3P73A 3SPVB 4MJIA 4RWHA 4CKVX 5EZIH 1W72B 5GGUA 5I1DB 5IMMA 1N26A 4BUGA 1EFXB 4FFVC 4WU5B 3SDCB 1IC4L 2G75B 3L5XH 4J2XA 3MV7E 1KPVA 5HHPB 1ZGLM 2BHYA 1FZOA 3MRIB 4OLXH 1NMBL 3A0OA 1F90L 1FYTD 4JO2H 3T0WA 3HMXA 4Q9CA 2BRRH 2B2XL 1XZ0B 2NY1C 2GSGB 4YXKL 3LIZL 2RCSL 4RDQF 3NCFB 3RAJH 4X99B 1YQVL 1IKFL 2GJ6D 3NCMA 1ZHNB 3HPJB 2WMPA 2X05A 3UDWA 3D39D 3QEGL 1FV1B 4RFEA 3VA2C 4DUVA 1JV5A 5D7JB 1U42A 3T2PA 1P9MA 2PR4L 4YAQA 2JCCB 4KRPC 2GJZA 5FCUH 4ELMB 4N5EC 4P23D 4KK8C 1F00I 5ICXA 3UYRH 4JFEE 5ALBL 2HVKB 4OI7A 2Q8BH 3NCJL 1F4YH 5FA3A 2BSED 4Z9KB 4GG6B 4S1RL 1A6AA 1R3HB 1S7SB 7CGTA 3ZMRA 4XAWH 5F6HJ 5JOFB 3WIHA 1AO7B 2ZCKL 1BBDL 5DJXB 3SOBH 3VXSB 3NMEA 1CVSC 2YK1H 3S35X 3NZ8A 4X7FC 4W4NA 5KVMC 4IHOA 2OL3B 1EEZA 2EICA 4HUWA 4MD0B 1VHPA 4LNVA 1TTUA 4GLRI 1MY7A 3C2SA 5B3JE 1T2XA 3NGBB 3MRPB 3G6DH 2NX5B 2NY2D 1QSVA 2Q6WB 4DGYL 2V9TA 2BXYA 3UZEA 1UB6A 3DGGB 2E9IA 4ZO7A 4XTRC 4ZFFB 1HQRB 1JYXA 1MFBL 2W9EH 4JREC 5CGMA 4RIRB 5DJ0B 1OF2A 3PWVB 2HT4D 3VMPA 2IPTL 1WCQA 4QT5B 4ZUSA 3CXDH 3RWHB 1M71A 2YA2A 4PLKD 3UJJL 4RRPA 1LEGA 3JBG7 2V5RA 4N0UE 4KKCD 4RSVA 4YEFA 4OFYA 2OTUA 3LKOA 2ZOLA 5BJTA 1KEGH 4JCLA 5LGHH 1JPGA 3BDYH 2UUDH 3LHPL 4WNQA 1Q9OA 2V17L 3JXAA 3KJ6L 3TN0D 4M8VA 2VLJE 4NSKB 4C4KT 5JORB 2WQRA 4KY1L 5DYOB 4IRZH 4W6YB 5KVGH 3NIGE 1QVOA 2AK4E 4PJEE 4WW1A 1RJCA 1OAZH 1I3VA 2R8SH 5FYLE 3DV4B 4Q58C 1KXQE 1MCEA 4NYLA 3CFJA 3O11B 3MLZH 4I18A 3W0WA 3DHJA 4UIKL 5FYJD 3ZTNH 3SDXF 4NKOA 2VAJA 3U1SH 4DGIL 2VLRD 1UENA 3QUMB 5EZOH 1U8QA 2A9NL 3HR5A 2A6IB 1NDMB 5EUOA 1YPZA 1A1OA 1UVQB 2XN9E 4GRMB 5LGKA 1QPXA 3EO0B 3VD4A 4CW1B 4QRQA 1QFWM 4LMQE 4LK4A 5J12C 5K93A 3X17A 5D2LE 3L3GA 2BCKB 3AFLA 4IEFB 3RL2B 1I8KB 5JOPE 5EC2A 5ADOH 3HMXL 2FHFA 3MNWB 2OTPA 3FQUA 3L7FB 4Y4KD 4AH2B 1TETL 1DQMH 1KCUH 4WI2A 3WUZA 3CIQA 4TVPD 4BKLB 4P5TC 1EEUA 4MMXC 2UY6A 4LEOA 4X6FA 3HE6D 1DZBA 1CLZL 2D7QA 3S5LG 1UCBL 5BV7L 2VH5H 3W11D 1BFVH 3MREA 2R23B 1NLDH 5IR1B 4JFDA 4MA7H 1OGAE 5BOZG 4WWKD 5B3NA 3UPRB 2VR4A 4JN1H 5E08L 3AREB 2EDTA 4FQQB 4F7PA 4K7FB 3JTSA 3IETA 3EOTL 3TF7C 1I1AD 4XPGH 1URLA 4UTAH 1EX0A 1HKFA 2ZSWA 2LFGA 2EDRA 2VDOL 4GRLC 1NGPH 2FX9L 3MV8A 2OI9B 3RBSA 3B3IA 2FZ3B 1CS6A 1BHGA 1NH6A 4PJDA 1K4DA 1NCDL 5J6HB 4FQLL 2ORBH 2VO5A 4ELKB 1P7QB 4I0KA 3KVQA 4YDJB 3IGAB 1BWWA 1WBYA 3WIFA 5KG9A 1KB5B 3P9MB 2QEJA 2F54D 5IFAL 4H88H 1YPZF 2FATL 2W60B 3VFRB 2XXMB 4G43B 3KPPA 2DI7A 1HEZA 3QDJA 3QCUL 1I7TB 4X6EA 5HPMB 3O3BB 1A6ZB 1DBBH 5C07B 1KCVH 1CICC 3VMOA 1DJSA 5CGYD 2DLFH 3DMMB 5FM5O 3D2UB 4M8QA 5KSUA 3VRIA 4JO1H 3GSNA 1U8PB 4P46C 3L5IA 3MOAL 5FGBC 1EAJA 3WIIH 4M9OA 1E4XH 3VFWA 2WBJD 4LRIA 2J2ZA 5HGAA 3PWPA 1LO3H 3QWOB 3U82B 2AJ3B 2IFFL 1JF1A 3VFOB 1A1MA 4BFIA 2E3VA 4RBPH 3DO7A 2B20A 2FLBT 2WUBL 3FFCD 4AEIL 5C09B 3OB8A 2D7PA 1I1YB 2EDDA 2XY2A 4KJPD 3K80A 1NGYA 3SCMA 5DUBA 3MLRL 1XF2A 4F3FB 3CNKA 5GS1A 3N1MC 1AKJA 2C5DC 1J1PL 2KQMA 1C12B 1R5VA 1RZJH 1MEXH 4IRJC 1JF6A 2X4OB 4I2XE 3JWDL 4OLUL 4RGMB 1FFNA 4MLSA 1NC4D 5BXFB 3LPWA 1TJHH 3PIQA 3QFJB 3KJ4B 4M1CD 3ZE1E 3IS1X 3U7YL 4XRCB 2DOCA 1F2XK 3O41A 4F15B 1CF8L 5I1LA 4LLWA 4UU9B 4E41E 4HS8H 4UTBL 1A7BA 4PRPD 4JFXB 3OHXA 4JJ5A 1BLNB 3R8BB 1S9XB 4WUUD 4YE4L 1T6VN 3RTQD 1OQXA 4NM8H 2ADFH 1ZMYA 2E7HA 1PGRB 1WLHA 2IBZX 4KROB 1F4WH 1YDPB 1MJUH 3SDDB 4D9LH 3QDAA 3AXLA 4IMKC 2HFFA 2XTLA 4HUXB 1TFHA 4MAYD 4N0YL 3REWA 4GRWF 4HJJL 4ZTOH 4OI8A 4OZHF 2AXHA 5HPOA 3P11H 1NCWH 1RZGA 5SWQA 4G6FD 1CXKA 4JG0H 3QUYD 1JRHL 4EVNB 1QBBA 3G5YB 1G7IA 3LB6C 5F89B 5C0CE 3LRSB 2JELH 3U0TB 4JRXD 5TF1H 2WV3A 2XKNA 3ELAT 1HSAA 1VPOL 3OKKA 4UDTB 2ZOKB 5GGRB 4U6XB 3QIUC 4PGDB 4LASL 4JPWL 4IBLT 4P2QE 1A64A 1W0VB 2DS4A 4OB5H 4M43L 3FOLA 4XCYA 4GKSB 5DD5H 5HGHA 3SPVA 5JLZB 5JHLL 4L3EB 3M8OH 2NY6C 2BDNL 4WW2B 2HG5B 1BJ8A 1W72A 2PYED 3MXVH 4GAJH 5KANG 5GRZA 1EFXA 1N6QL 2D4FA 4WU5A 1BVLB 4M02A 3SDCA 1W8OA 3FO0L 1PYWB 2G75A 1DE4B 2PUQT 4J6RL 5ABDE 3BQUC