3DNKA

Enzyme deglycosylated human igg1 fc fragment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
209
structure length
209
Chain Sequence
b'GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYDSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IGHM protein
molecule tags Immune system
source organism Homo sapiens
publication title 2.8 Angstrom structure of a enzyme deglycosylated human IgG1 Fc fragment
rcsb
total genus 34
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dnkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dnkA01
1SJHB 3QNYA 3ARBA 4K3GA 2IPUG 3OAYK 4JDTL 5D7IF 3NAAL 5KSAD 3OKOB 5I1CH 2VLRB 1JF1A 4YGVB 4E41D 1LK2A 3TCLB 1NDMB 2CJUL 2BC4B 1M7DB 1EHLL 3B43A 4YEEA 3HNSL 2GT9B 1H3TA 3ZT6A 4KQ3L 4H5SA 3ZT7A 2BMKB 2X89D 4PRIA 1HK6A 3BW9B 3BDYH 3N85L 1A3LH 5HSFA 4QRSB 3UYPA 4ZG1A 2GJ6A 2H9GA 3D39A 2AABH 2R2HB 4HJJL 5C0FA 5IHBA 2YWYA 1HHGA 1CD9B 3KYNA 5D72H 1NC4A 3T1FB 3FB6A 3ULUL 4JRXD 2XTJE 3SDDB 3DUHA 4G8EA 1ZMYA 3L5IA 3MZGB 5JW4N 3VG9C 2EDXA 3V4PH 1I7ZB 1MRDH 3D2UB 1YEIL 4NJ9L 3ULVC 2P24A 2HKFH 1UQSA 3I50L 5DJ6A 5DMKA 5KVGL 2ZOLA 2E8YA 4PJXB 2FX7L 1IARB 3CX5K 5IB5B 1T2QL 2MPAL 4I18C 3QIUA 3CFKB 4PYHA 1HDMA 3MLTA 4KUCD 3PXHA 4RX4A 3VRLE 3UDWA 3MLZH 2Q86A 3VGGA 5L6YH 1AP2B 4GO6B 3FQNB 4NP4L 5FCSH 1QFWL 2OJZH 1TNNA 2FJHA 3IDYC 4WU7A 5EFIA 2Z0BA 4NZRH 3GJEB 1QA9B 1KT2A 3V7AE 3LSOA 2K1MA 4OZHB 3QEUB 1KOAA 5C09A 3I6LD 4G6JH 4FOMA 1BJ8A 2FLBT 1CGSH 4CN1A 3KLHD 4ONFH 3L95A 3T09A 4NHCH 4Z8FH 3MJ8B 1AH1A 3ZL4L 3PABA 3FRPG 3WLBA 2G60H 2JK5A 4BFIB 5I1CL 1QKZH 1D5MB 2CIIB 2DM7A 5DRNA 4PRHD 3G6JE 5ID1A 3GFUA 5FO8A 5EU6A 1KEMH 3MV11 4PJEA 4LFHG 2R9HC 1DQDL 2FSEA 5CZVH 1AO7E 2YK1L 3QIBC 15C8L 2ATPB 1W72L 4KMTL 1IZJA 3GSOA 1D7FA 3TZVB 4MJIE 2EE9A 4U6VL 2I9LA 4ETQA 3IKKA 3SGDH 3ZDZF 1CDBA 1BOGB 1JGEB 2KKQA 1I9RH 1NBZB 4WVRA 3TNNA 4CADA 5ACZB 4XHJC 4CVZB 3IAPA 2V2XA 5D7LE 4BH8A 3CDCA 1D5XB 1HHJB 2K9UA 4KTDH 4L8CB 1KN4L 2GITB 4ZOAA 5INDA 1MVFA 4QCIA 2XWJA 1OGAD 4S1DC 4X6BA 3MV01 4AH2B 1W72B 4HIHB 3VXOA 1CFQB 3VXSD 2XA8L 4HKXB 1GOFA 4YBLB 3MOAH 4N90E 4HKBB 2R1YB 4HUUA 4M7ZC 1R3HB 3MUGA 5KS9F 1PW3A 1IGML 4U7KA 1I1FB 3IU4L 1I1CA 5MENE 4QYOA 1C5BL 4H26B 4FQXD 3MNWA 5E2TH 3CVHL 4U3CA 3OJ2C 3PDDA 3C8KB 3RGVC 4G9FD 1TQBB 5E1AB 3HG1A 4PRPA 4B5EA 5KSAA 1NMAL 3BIKA 1U9KA 2I07A 1A6AB 1VADB 3KPSB 4LRNL 4ZD3L 5E00B 4D0DA 3G6DL 2UYLB 3T65A 4GUPA 2MQ3A 3WIIL 1XR9A 3AFLA 5EUOA 4P3DA 2GEEA 2H6PA 4JN1L 1B90A 5KOVC 1OB1A 4LLMB 5IESH 1AKJB 1TCMA 2KQNA 1S9WA 1CGUA 4JY6B 4KJPD 4OCRH 3U0PB 5F9WB 5CJXA 5ANMB 3CH8A 32C2B 4MJ5B 4ZUWA 2UVEA 4G8GB 3V6FB 3DXAA 5I76B 3TV3L 3DO3A 5CJ5A 4I18A 4OZGF 2BHUA 1CLYH 1AFVL 3GIVB 3NZ8B 5E9DA 3V7AG 4FFYH 4G8GD 2OSLA 3STZA 3QQNA 2CK2A 4NQEB 3UTSD 4XPBH 5IVNA 3QG6A 4RCAA 3QEQA 1WCQA 3PWNB 15C8H 5FA3A 1TENA 4YC2B 5MEPA 4JB9L 4DTGL 1RD6A 1FV1A 1F4YH 1KG0A 3ZDYF 5T1LA 5GRUH 1JWUB 4HCRA 4YBQD 5DMJB 3KWWA 4XNYL 2H32H 1XMWA 3MRKA 4XHQA 3O6KL 4LBEB 1XGYL 4KK9D 3BP5B 2YUZA 5TE7H 4MWFA 4K7PH 4ZXBB 1IBGH 1U8MA 2AEQL 3DRTA 4DKFL 5BMFL 3ARUA 3FT3A 3X3FL 2JJTC 4FNLH 2H8PA 4ZUSB 3S98A 5LVEA 1G7HA 2V7HA 5ENWA 2LAAA 1PX3A 4JFOA 1QVOB 4PJCF 5IMOB 1EV2E 1SY6H 3OV6A 1A4KB 4LCWA 5C0AB 4Z9KB 4P2QB 1YN6B 4IIQC 3V9FA 2W65A 2E7HA 3VGDA 4ELMB 3VXNB 3L3JA 3C6LC 2O5ZH 4WI9A 1N0XL 1ADQA 1INEH 2AK1H 4FFVC 1D5IL 3PL6A 1N7MH 4C56E 3TYFA 2HJKA 4X6DA 4XC1H 3RWGB 1NANH 2EXYD 35C8H 1KIRB 4PGDB 1QRNA 3PQYD 5E2JA 3L3OA 2AXGB 2BDNH 1ZHLB 5BCAA 3T2OA 3MR9B 4XPTH 4FZ8H 5HI4D 4DGYH 2VLKA 3V2AR 3ZHLA 5EOQL 4GBXD 4HFWA 1KACB 2ZCHH 4MQTB 1FGVL 5KW9L 1QSFD 5HJ3A 1PQZA 2PW2A 2XN9B 4QTIH 5ISZE 3KHQA 4OI9A 1NDGA 4M3JA 2X4PB 4XNQA 1J1OL 1W0WA 4GBXB 5E8OA 5JDSB 1CGXA 1G7LA 2VL5B 5HYSB 3VXMD 5B3JF 1NCTA 1ITCA 3MLVH 1A6UH 4NKIL 4D9RE 3PDOA 2BSSB 5LAXA 4B7IA 1KB5L 4P4KB 3WHXA 3O3AA 2OI9C 4R4ND 4OBRA 3O9WC 3OGOE 4G6JL 3C5JB 4XNMB 2MNUA 1TQCC 1HIMH 1Y0LA 4JDZA 3QXAB 2XWTB 3CJJA 4PTUB 1T7WA 1DVFC 4V2CB 5DJ2A 1OW0A 4YO0B 5C86A 5IBLD 7FABH 4J4PA 2IG2L 2DIJA 1F90H 3BOVA 1IM9D 2CLRA 1N8ZB 3C8DA 5C08E 5FGCE 4XGZB 4JPVH 3W9DB 5CAYB 5JOEA 1MCPH 2HKHL 4MQ7A 3SGDI 5C0DA 4HF5L 1MRCL 3NMEA 2VL4A 5BVPH 3P9MA 3CPLA 3BPOC 1NAKH 3VI3E 9CGTA 3RWFA 4HS6B 1LO4L 5B39A 5HHXL 5HDLA 4NBZB 1M4KA 1OPGL 4YHOH 5HYJE 2G2RB 3BKMH 1SBBA 4KDTC 4NZDA 3GMPA 3V4PL 4NUGH 5D7LD 1QSEA 4LSRL 1XCTB 1IJ9A 3MMEA 4LSUH 2VLMD 3UTZA 5MENA 2PNDA 3DVNB 2CKBL 5FA4A 2EC9U 3PP4H 5DS8A 1W0VA 4CVXB 3O8XB 3QIWB 3RVUD 3VXMA 1MNUH 1UWEH 1JGUL 1VESA 3BKCL 1GH7A 2D9QB 2X5PA 1HKLL 1J1PH 2P7TB 2R23B 5IHLB 3UTSA 1HQ4A 3LV3A 5ICZB 3I75B 3U0WH 5IBTH 2FX7H 1CDCA 4HGWB 2OR8A 4AIZA 4HFUH 2H41A 4WFHE 5ADOL 1VFBA 1YEHL 3F7QA 3LKNA 2A0LC 3KJ4C 1G7JA 4NRYA 3RZCC 1R3LA 5BRZD 1MHEB 1H3PH 1I8LC 4I3SH 3UJJL 3QCUL 1I7TB 4B41A 1FIGH 2QQLL 3BUYB 3NABL 5IHZB 5F9DC 1FNLA 1U8NB 5FYKD 1RIHL 4Z7WB 1VKXB 5EU6E 1XIWA 4YXKH 1A2YA 2BXZA 2AJUL 2J6EH 2VDMH 3PWPE 4FS0A 5TDOB 2Q8BH 3OXRA 1G9NL 3FFCB 5ICYA 2Y5TA 5FHBL 2A6IB 5D9SB 1FO0H 5EUKA 3GMOB 3Q5TA 2GHWB 1CGSL 2VLRD 1KB5B 2HFGH 5DC4B 4NHCL 5EOTB 2C1OA 4Z8FL 3P77B 4TRPH 3AXLA 4YXLH 4XWGL 3MXVL 4OZIE 3TFKD 2WLZA 1TJHH 2NX5B 2V5YA 5I1DA 1FBIH 4RFEB 5JXAL 4KRLB 5IWLA 5D1QB 5DC0A 2L7JA 1H3PL 4WV1B 1F6FB 4QT5A 1JFQH 1IKNA 5FO9A 4ORZC 3MRJB 4XCFL 1OTTD 3MRGB 3ARFC 3W39B 1F8TL 4IOIA 3RZCD 3T0EE 5HPMB 4DGYL 4L5FL 3N1PC 3M1BB 1JNHB 1M05A 4ETYA 1G7PB 1H8OA 1KB9J 4NQSB 4QRTB 2MFNA 4KPHL 3MACH 5HHQB 4JG0H 3A6CH 3F7YA 3I6LE 3IDMB 2VTFA 5GSRA 1YEKL 1ODAA 2A6JA 1QYGH 1WJ3A 2IQAB 3MCKA 2CD0A 5CIPB 5C0CA 1KV3A 3QXTA 4C57C 2O5XH 5KG9A 4QRPD 1QBMH 1WEJH 4RWHA 5B22A 2GKIA 5F44A 5FDWA 3QNZA 1ORSB 2DLGA 3HE7A 1N2RA 3L5XH 2M26A 3DVIA 1AO7D 4RMSA 2AEPL 1S7XB 2EDLA 4P9HH 2NXZC 4HLZH 4UU9A 2EDKA 5HYEA 2QHLA 3ZE2F 2L0DA 2IWGA 5D2LB 2ZG2A 4F3FB 1FGNH 4LLUA 1U8OB 3G6AB 4PLOB 2VABB 3NIDF 5D1ZD 4OGXL 1KCRL 2C4XA 4Z7QE 2FATH 3DJ9A 4K8RC 1YEJL 4F33A 4LPUA 2YEZB 2BOBA 4WWKA 3RWHB 4LPYA 4S1DD 4L4VB 3MA9H 3VG9B 3I3BA 5IEKA 3MV7A 3PP3H 3VXSA 4PJBB 4XH2A 5B8CC 4LEXH 1QFWM 2GCYB 4P2OA 2GJZA 2OTWA 3VWJC 2NZIA 2Z4QA 3EYOB 1RJZA 2GIYA 4FQLL 2EYTA 2VQ1B 4ZAKD 1A7BA 5FKAA 1BZ7B 3PWLA 3QFJE 3C60B 3BKYH 4N8VA 3KLDA 1JHTB 4ELKA 4LSVL 3QAZB 1E4XL 2XPGB 5BZDB 1XGRA 4UAOB 2J6EA 4WJ5A 5C0IB 3SDCD 3OWEA 3THMH 4URTB 1CDHA 1N64H 3DIFA 2CQVA 4XNZB 4BUHA 3CUPA 4AQOA 1KCKA 1FVEA 4OUUA 3PP4L 4K7FB 2IFFL 2XYCA 4GXVH 3SN6N 3IXTA 3MUZ1 2AV1B 1IAIM 2B5IC 5JHLL 1CXFA 4XH2B 4QGTA 3VXSB 5D6DA 5GRYA 2KUTA 1MY7A 1Y6MR 43C9B 5JUEH 4ZUVA 3VFPB 3VU2A 4GLRH 5HHOB 2GTZA 2OTUB 4RDQF 1ZANH 5ETUA 5J9PB 4LDLB 4EDWH 1LK3H 2VABA 4RMWA 4H0IA 1QBAA 5KSBB 2OXHA 3LKOA 1MCPL 2HKHH 4G9FE 3RHWF 2ZSWB 5GRJH 5D70L 3D85D 2ADGB 5CILH 2CRZA 3MFGB 2UWEB 5I1AB 2R0LH 3RY6C 4PRHA 3TP4A 1GVIA 1UB5B 4X9FA 2Q6WA 2WANA 1Q0XH 3KPSD 4M7KH 3FQXA 3B6SA 3G04A 2YA2A 3WE6A 3GRWL 4FQXB 1HEZB 1F4AA 4ZAKA 3WL9B 1D6EB 2RQ8A 1G7IB 4OZ4A 2QSCL 2DQEL 1KULA 3BKML 2XG4A 4X5WB 4U3HA 5C2BL 3QDJB 4LLVA 4LSSH 1S7SA 3LN4A 4KZDL 4LLVB 4Z77B 5FYLE 2AEWA 5BQ7B 1JNHA 2Q8BL 2AQ2A 4RIRA 3CDGA 1T6VN 1MCIA 4NQCA 3QEHB 3QUZC 5C8JA 1TZHA 3O6FC 3VI4E 4AIOA 1UWXH 3BJLA 5DUML 2BHZA 1AY1H 2I27N 3TH2T 4HUNB 4CNIB 3R06B 4Z0XA 2UWEA 4Q58C 4FZ8L 1T21A 4OLEA 2QV2A 1HH6B 1I8MB 1TQBC 3BH9A 4G6KL 5C0JB 5IW6A 3AXLB 2CR6A 3MOBL 2C1OB 2LVEA 4RWYL 4AEIH 2JCCA 3GSXB 1EO7A 3GMRA 4KI5D 4TQEH 5CEZD 3KHOA 3P4NA 3RKDD 1EAJA 1B88A 1NAML 5MI0C 3GJFH 4QRPA 1CGYA 4PJBF 4K71C 4NJ9H 1H9VA 2WSKA 3I85A 4C56D 3VFMB 3VFPA 43C9A 5I75B 1ZA6B 3FFCA 3OXRB 5ALBL 2YD9A 4KRNA 1FFNA 5E4IA 1V8HA 4LCCA 2HT2C 1IEBB 1JYNA 1TZIB 5AUMB 3NOIA 4L3ED 2B2XL 4YHYC 1FFPB 5E6ID 5LGKA 1HNFA 3V0AC 1WGOA 3TT1H 4TVSa 3F5WA 3FHAA 2XY2A 1VFBB 2DQJH 5CJQL 5F7DA 3RWDB 1NGWB 5D93C 3GSQB 1D9KB 5CHNB 5GSVA 1KJ2H 1MRFL 3BH8B 4PRDA 4R26L 5J7CC 4AEIL 5ISZD 3GSNB 3D9AL 1Q1JL 4IJ3B 4ZXBD 3GSRA 3MV7D 5DO2D 2MCG1 3OKDB 1BZ7A 3PWLB 5D1XC 4HS3A 4U1JA 1NGPH 3VRJB 2Z4QB 1Z9SA 4ZO6A 4ONHB 5D7JA 3BRDA 3MV7B 5GS0D 3DNKA 5IEKB 1A22B 3HS0B 1E0OB 1I7RB 1ZGLM 4OTXH 1NCCL 4NT6B 1JGLL 4RGNB 3MMEB 2BOBB 4WWKB 4LSPH 3ZKSD 4C55A 1RJYA 3BP6A 4OD3L 2Y6SC 1IZKA 4MVBD 5DGQA 1UWXK 3N85H 5KSBF 4X8JB 2G2RA 1C5DA 5FGCB 1VDGA 1B3JA 3P30L 3L3DA 3K74B 4ACPA 3L7EA 2E5EA 2F15A 4RGND 4Y4HD 4KZDH 4DGIH 3BGMB 3MLRH 3ZE1F 2H2SC 2RCSL 1BD2A 5DR5L 4IRZL 3H2WA 4LFHD 4QWWC 3FONA 2QKIA 4ZOCA 2IGFL 4NHUB 2NW3B 1GSMA 4X7FC 5C0CD 1YDPB 4NZUH 3S5LG 3FB7A 4M7JH 1SVZA 3OHXB 3QDGE 1F58H 3N50A 3V6BR 3SO3C 2LABA 4YXHL 5LXGH 5KG9B 4KQ4H 2IBBA 3L9RB 5ESQA 3EDFA 1YEHH 3SJVE 5IMMB 1NCWL 3AS0A 2PYEE 3VD3A 4XBPB 4PTUA 4OKVB 1JK8B 1KC5H 1XGTA 1D5IH 1FC1A 1JMZA 1KCUL 4NUJB 3V6OC 3DXAE 35C8L 3GKWH 2AJVH 3M1BA 5E99H 3V5HA 4HUWA 1ND0A 1X5YA 3QULA 1OQXA 4DN3L 5DSCA 3SCMB 2EXWC 1J18A 3CC5A 4PJXF 3MRJA 3U82B 3H0TA 1RU9H 4PJDA 4Q9BA 4J2XA 1DVFD 2DI9A 1F97A 1PSKH 2X4PA 4XNQB 3VXME 3LQMA 3R1GL 5L8JB 2HT4C 3B9EA 1KJ2A 3HKFA 3GM0A 2A0LD 3RGHA 5SWZA 2E8ZA 1T4KB 3HA0A 2PO6D 3VFWA 4NKDA 2F54D 5D2NE 5DJYB 3VG0L 2YUWA 3PIQA 2VLJB 4ZTPH 5D9SA 2ESVB 3HG1E 4PGDA 4NN7B 2OS7A 1WT5A 1HXMB 4CMHB 3N1GC 4OD3H 5SV4A 3HAEB 1IILE 3DYPA 5CEXA 4EI5B 4POZD 1W72H 3HZMB 5J0BA 3G08A 2VLJD 5IHZA 4U1LB 4R7DA 2AAVA 1MIEH 2NR6C 4WFGE 2I60L 3BPNC 3FO0H 1UWGL 1FVDB 4UIMB 4P2QA 3LKNB 5A2JH 3G5YB 2IGFH 1R5WA 5IBLC 4DN4H 1JZ8A 1AY1L 2HTKC 4X4XA 4NZUL 4HHAA 1JWSA 3BPOB 3MYJB 1UJTA 1UA6H 1I7UA 1NCAH 3KYAA 5HYQB 1ACYL 2DAVA 2DKSA 4K55A 3QHZL 2HT4D 5T3ZE 1JP5A 3R4DA 2AQ1A 4LVHC 4G9DA 1QUNA 5AZEL 3JUYA 4NO5A 1NLDL 5DVNA 2VR9A 5C71A 5BVJB 5DGRA 1LO0H 5GGTH 2AV7A 4Q6YA 2VDOL 5DJ0B 2OCFD 5I1KL 3FN3A 1P6FA 2Z31D 4Y4KD 1OGAE 1XCTA 1KLGA 2BCKB 3G6DH 3VJ6B 4P23C 1GJIA 2D7TL 3WDJA 3TCXA 1R3KB 2HMID 4L3EA 3VXRA 3QG6B 5KBNC 4NRZB 1I1YA 3A6CL 5DUPH 3DETC 3I6KA 2AJSL 3HFMH 1AXSA 4K23H 3CK0H 1J0KA 5L0QC 3V5KB 1BEYH 2X4NA 3GSVA 3WFEL 4F9PA 5C0DB 1Z0NA 1MRFH 4G8GA 3V6FA 5TDPB 4WI4A 4WI6A 2JJSC 4E0RA 4EVNB 4QRRE 4MZ3A 3U0PA 3TFKC 1CBVH 4JY6A 1S9WB 4NRXB 5I16B 1QFUH 3LPFA 4AQ1B 2H6PB 4JO2L 2DYPD 4GKOA 4L8SA 1Z5LA 3TBYA 3FB8B 4XPHL 3FRPA 4OGYH 1X5ZA 2K7PA 3C5JA 4PJ9C 1P53A 3CSPA 4XNMA 3DVGB 3HI6H 2EIZB 4L9DA 3EAKA 5F96L 3O3AB 4PG2A 2NQCA 3RVVC 2H26B 5LAXB 4Y4KC 3S3SA 2XKNA 2W9DH 2ZOKA 3HCVA 2YUVA 5D5MF 4KQ3H 2VXSL 4JFDD 4DN4L 5GHWL 3SDAA 3CK0L 3UJTH 1G7LB 4LKXB 4EBQL 4KV5E 1OQOA 3DPBA 1ZLVH 2ESVE 1JN6B 2VOTA 3OR6A 5E1AA 4XX1G 1NDGB 1KTKE 2NTSP 1H5BB 1RVFL 1Q72L 3C5ZB 4RRPG 2MTPA 2J5LC 5IQ9A 5C6TH 3C08H 4U1MA 2FX9L 4IRJC 5FK9B 4O51A 1L0YA 1YQVH 1C5CL 1OD7A 4CRPA 1NKOA 1JHKH 2NY0C 5IR1B 2YD3A 3UPRB 4OSUL 4UUJA 4GAYA 3PL6B 4JO3H 4PP2B 1RQ5A 5DDHB 3UEZA 4M1DL 3EOBA 3ESUF 3O2VH 1HHHA 4JZJC 3ETBF 1DQJB 2KBGA 3I9GH 5JQHC 3MGOA 3VXNA 4ELMA 4LSSL 3B2VL 1YN6A 5HXMA 1U3HB 1FORH 2ADFH 1U8QA 3HNVL 1F00I 4LSQL 1VEPA 1VB9A 2H32B 4LCWB 4KTEH 3OKMB 2YPLA 4POYA 4ETQB 5BW7C 4RAUA 5EOCJ 3GNML 1TPXB 5CGYC 3MNZA 1TVDA 3IDUA 4Z7VE 1RIVH 1ZK9A 4G8IA 4HV8B 4DKAA 2BHYA 2V7HB 5ENWB 4U6HA 3QR2A 2H8PB 4MMZC 3CFEB 1U3ZA 1DN2A 3GZKA 3SPVB 1OSPL 2K7QA 3Q5OA 1DBJL 5JMOC 4X4YB 2APFA 3QZWB 1I8IB 3FB5B 3MJ8A 4YHLH 2XZAH 4XWOD 2AGJL 2QL1A 4ODUB 5EU7C 1FV1B 1F4HA 1MCOL 2CUIA 3E1F1 1MI5B 3B2VH 4P46B 5C09B 1SM3H 4PB9L 3PWNA 4Q7DA 3QEQB 3DI3B 1A6WH 3RIFK 1YC8A 2VO5A 4QRRB 4KTYA 1OWRM 4GG6F 1KSRA 5L88H 5LBSL 3VFUB 4OFYA 1FE8L 2VDNH 3BSZL 4P57A 2I24N 5FXCH 4EN3B 1CVRA 1EVTC 4I18B 4XZUA 1U3YA 5I9QB 2BXYA 3S34L 1RHFA 1KBGL 5ANMA 4G6FD 4KI5E 5CEZE 1UA6L 3QIUB 1KTLA 4JDTH 5AZ2H 1J87A 2Z8WC 1DQMH 4U49A 4TOYH 1T0NB 3IDYB 1JTPA 1UQSB 2VB5A 3IDNB 5IK3B 5IMLA 4M93B 1MCOH 3DGGB 1O7VA 1J05B 3T65B 4L3EE 4QHKJ 4F7EA 4PLKD 1IT9H 3G9AB 5DJDA 4D0DB 4FABL 4Z7NF 5GS0L 2OZ4A 1T1ZA 2APBA 3IFLL 4JY5L 3S36L 3HPJA 4EQ3A 3L5JA 3LQAH 3QWOB 4G6ML 2D7NA 2GJ6B 3VMPA 1NGXA 3Q5YA 3BEWA 4H25A 2GT9A 4ONFL 4YZFE 2IBZX 5CSGA 3GMQB 1G9NC 1M7DA 3QJFB 1NC2A 2N7AA 2ZUVA 4CW1B 3RTQA 2WK2A 2VDPH 3TT1L 1KIPA 1MJJB 1DFBH 4JFQB 3K80A 3CFCL 4MNGB 1GZPA 1JVKA 1CBVL 4LVEA 4QOKB 4YDVB 3RZCA 5MHSD 1QQDA 4X4ZA 1SY6A 1Z6JT 2A73B 1WEJL 5CGTA 4YFEA 5F6HJ 1VACB 1VFMA 5KANI 1BF8A 1A1NA 2GSGB 3F65A 1D5XA 3O3EB 4PJAA 3MFFB 4Z6AT 3GSUB 5B21A 2PXYA 5IJKA 2CKBB 3AUVA 4FMKA 3MACL 2XXCB 1RMFH 3TNNB 4CADB 1KENH 3ZSTA 3L3HB 5EZLB 1ZGLA 1LO5A 4Y4HC 3ELAT 5HYJA 3CSBA 3KXFE 4HF5H 1BAFH 2NXYC 5TPWL 1U8IB 4K3JL 5ISZB 2VN4A 3OL2A 1U8KB 5LG1A 2W92A 3EYVB 4N0UE 3MOQA 2EEDA 3EBAA 2HFFA 1OGTA 1T89A 3BQUA 3CLEL 1QEWB 3D0VB 3IXAB 5EC2A 2RCSH 5FDYA 3WFBL 3O2WH 4YHNA 1G6RA 4WHTA 5HGAB 1D5BB 2FHBA 1PKQA 4UILH 1S8DA 3VFOB 5EO1B 4IEFB 2FR4A 2H3NA 1A3RL 1UM4H 5F21B 1EA9C 4ZXBC 4WWKD 3SE4A 3SO5A 4KZEH 4JO1L 3QT2A 2GTWA 3U9PH 4M48L 5BS0E 3QDMB 4RFNC 2GQHA 3K4ZA 2VDQL 3RWIA 1GGYA 3T0EB 3GJEA 4L8SC 5TPWH 1QYGL 1ADQL 3FL7A 5L8LB 1RULH 1KIUA 1FO0A 1ZHNB 3DX9B 3MJ7A 4GQPH 4OLXH 5DRXB 1T1YB 6FABL 2J8UB 1M6OB 5CINL 1QR1B 3VXRD 5IV2A 1ZS8A 4PJ5E 1T7YA 5I1GL 2O26U 4QHNA 5F1KC 5FUCE 1KN2L 1JNJA 5IB5A 3UTQB 1ZAGA 3R1GH 3EFFA 4M6OL 1PG7X 3CVHH 3D2UA 4LSTL 4P2OC 1HWHB 1UB6B 4TUJA 1PY4A 4C54A 4G8EB 4K8RL 5B4MD 5JW3H 2FD6H 2R2CA 1R3JB 3UROR 4WWKC 3T1FA 1AI1L 3KJ6H 2F53B 3MV8B 3TM6A 1N5YL 2DLTA 1AXIB 5L6YL 3MRDB 3K2MC 5CILL 4K7PX 4PGCB 1A3LL 5EBLA 3ARVA 1K3IA 4RA3A 3TBVA 4P5TC 4ZDHA 5MEOA 2BMKA 4PRIB 1RSFA 3TH3T 4JGJA 4JR9L 1T5WA 1UXSA 4BK4A 4DZBA 3IDJB 4WW1B 4DVRL 3ARBD 5IQ7L 3JV4B 2QADB 4MD0A 3EFDL 3G9VA 4WDIA 1E28A 2FL5A 3F58L 3OKOA 1U2HA 2R0WH 3X11A 4J3TA 3ARBB 3QNYB 4JFYA 1CXHA 4H1LA 1IQWL 4HJ0C 1QSED 1JBJA 4XRCB 4U1NA 3OF6D 1DQML 3BZ4B 1ZLWH 4UQ2B 3ULVH 5DJXB 4GRMB 1BFVL 4PGZA 4XNXL 2Y4SA 4GW5B 3X11B 3VFNB 2LVCA 2Z31C 4F37K 3E6FB 2VXTH 1C12A 1NLDH 1MCSA 5K59F 4F9PC 1N7ML 2IPUK 4OBSA 1OY3B 2PYFA 4WFGD 2C4FT 3KPRD 1DN0A 1U8PA 2IAND 3HZYA 3CSYB 1IM3A 1WIPA 1BZQK 3S97C 2DMKA 3QCTL 1EBAA 5FYKH 1NEZG 4M1CD 5MEOB 4MJID 2ZUTA 5EBWB 4M6NL 4IS6A 2O93L 3IAGC 2AKRB 5ESAA 2A6KA 3WS6A 4A6YA 1CR9L 4KMLB 4Z7UA 2EC8A 2QQKH 3UAJD 4KKAD 2BNRD 5E5RB 1A64A 1R3JA 4M6OH 1H0DA 1OP5K 1SHMA 5KAQF 4ZSOA 1DR9A 1LK3L 2J4WL 5MEND 1OOAA 4WHYH 3QRGL 4CL7A 2R0ZH 3RP1A 4X5XA 1BVZA 5JLZB 3HNTH 3K8KA 1OM3H 4O4YL 3IF1B 3OX8B 1ZS8B 3HN3A 2WIIA 4Y1AB 5JHDE 3SJVA 4CN6A 1MCNA 5CJQH 4Z95L 1FL5B 3SE8L 3LS4H 4H0HB 2IFFH 2X1PA 3U83A 4CVUA 1FO0B 1ZHNA 4JREC 4OV6F 5H37H 1N5AA 1G0DA 2ZCLH 5JPNB 5FYJL 3K4AA 4DOHE 3KJ6L 2EDYA 2JB5H 5JNYA 4R0LB 2PCPB 5LWYL 5I6XC 4ORGA 4KTEL 1TETH 3BIBX 2VLKE 3CFJB 4KJYB 1I1RA 1PLGL 3KNBA 1BQLH 4XXDB 3UAJC 1FQ9C 3PUCA 5F1IA 4M61B 2C3XA 3PP3K 3GUTB 2N1KA 2ZUQB 4D9LH 3SE4C 5KSAC 4RWYH 2IMMA 3JUZA 5A1AA 5KAQG 1MFBH 3PE9A 4MB3A 2ZSVA 1MUJB 2HFEA 3HI5H 3P9WB 3RWJA 5BS0B 4LVNC 5IM7A 4PRBB 2N7BA 2D4DA 4JGUA 3VA2C 3EHBD 1KGCD 3FT2A 4OF0A 1SEQL 4AJ0A 2NY1B 4FQ1H 2EYRB 4WUUE 2ICWI 2E3VA 1RK1A 1X7QA 2H2PC 4X9IA 5DI8B 1MCWW 5F1NA 5HI3D 5DQJB 3FMGH 4HUVA 1DN0B 4J1UA 4CBPA 5AZ2L 3ARDD 3LHPH 3HR5B 1OP3K 4X6CF 2AVGA 1BGXH 1FZJA 5HI5C 4ZFOB 2EKSB 4GXUM 3SGEI 2XOTA 4ODVH 3IS0X 3QXDA 1FFOB 3C09B 3EOTH 3E6HB 3G6JA 4I4WB 4MXQD 5GGSB 3NFNA 4XRCA 4JM2D 4XPGL 4YFDB 3F12A 4MNGA 2MJWA 3UYRL 5C0BB 1RUPH 2DI8A 4NQDE 5GXBB 2HH0L 1TZGL 2NXZB 5D4QA 3WIIH 3ZLQC 2CXGA 1NC2B 2RHEA 4ZFFA 1ZGLP 1KYOK 5LQBH 4OZFH 3JTSB 1UXSB 4QKXB 4OB5L 3H9ZA 2XQBL 2FNBA 3BEWB 1OM3L 4YPGB 3EJYC 5TF1H 1AQKL 3VH8A 5EBLB 1NAKL 2X9YA 3MRDA 5F6IB 4U1GC 3HPJB 5FFLA 1YNTA 4Y16B 3BAEH 3AS3A 4NQVA 5HI3C 1JPFB 2WQRA 4Y0GA 5DD5L 3KLAA 1LVEA 4MD4B 3PGFH 2B2XH 4I48A 5C92A 5EU3A 4B0MM 5IMLB 5E6IA 4DKEL 3IDNA 4WV1C 3F6LA 1F2QA 1UEYA 2F5BH 5CP7A 3TN0B 2J7LA 3O6FA 1S9VA 2X09A 3U4BL 2JIXB 4XCCH 4M4PA 2PXYC 5DR5H 4NOFA 1CXKA 4APQA 1PVHA 3QI9B 5DHXB 4EUPH 3SKNB 1QR1A 4FFZH 4UAOC 2Z91B 2VN7A 4HWZB 1U6AH 4PLJD 3MJ7B 4YDLB 4NGHH 4XWOC 5JO5B 2XI9A 4BQ9A 1SJXA 3U9UB 4U1HA 1BQSA 1EJOL 2CRMA 3T0EA 3BWUC 3SE9H 4J6RH 2VMFA 3MRLB 3VWJD 4P46A 2G5BB 3NTCL 4NPYA 1K4DA 4NO0D 4P9HC 1I3UA 1K9TA 5F3HA 2D31B 3ZSSA 3NZHH 4NKMA 5F9JB 2BK8A 4H0GA 4WHTB 1OAQL 5D6CB 5HGAA 1FL6A 2ED8A 4YHNB 1UH4A 1ZVSB 4Y7MA 5H2BA 1INEL 3PJSB 5I1EL 5EC2B 3CFEA 4WCYL 3O11A 5T33L 3G5VB 1Y6KR 4IM8A 5L2KD 3QWQB 4OFVA 4HV8A 4F7CA 4G8IB 1SEBA 1U8KA 4UTAH 4WI2A 1U8IA 5F1SA 5I8CA 4D9QE 5HYJB 3HMXA 2X44D 1L0XA 1QFPA 3EJZC 4JZOA 2YPLB 5CP3H 3QUZA 1S9XA 5CKAA 4KPHH 5EZLA 1ZLUK 4N0UB 1FGVH 2VR4A 4ZPTA 4RMTA 1F2XK 1OHQA 4X7CC 5HY9B 2CKBA 4Z78B 3GSUA 1DBKL 1E4XI 3GSWB 3AM8C 2YPLD 3O3EA 4K23L 5FGBA 4XAWH 1EUUA 5I73C 3EOBB 2DBLH 3LRSA 4GAYB 1BEYL 1MAML 2M2DA 4HWNA 4HGMA 4UUJB 3ORJA 4HX1B 4NWTH 3BWAA 1LWRA 3DX8A 1F3DH 3U46B 1FP5A 2J4WH 3IDGB 1CGTA 3BMVA 3BFOA 3X13A 4CAGA 4Y2OA 1NL0L 3I02A 1FZKB 4U1MB 5JA8B 5KVFH 1MJJA 1K6QH 1ZHBA 3P0GB 1GOHA 1YNLL 2AJ3B 4LLYA 1KIPB 4ERSL 1MRDL 4CW1A 2DQCH 5D1ZC 4NNYA 3RKDC 3OR6B 1SYSB 2FATL 4L4TB 4K8RD 2D0GA 4FXKA 1WBZB 3FKUS 5A2LH 3QRFM 5EU6D 2COQA 1WCBB 2ZOKB 4QHUB 5J6GB 4UV7H 5DJDB 2HT2D 3ARZA 3PWJB 1TCRB 1GL4B 3CFDB 1Z3GH 1J05A 1V3LA 3DVGA 3LN5A 3C2AL 4H1LG 1DBBH 1CDGA 3DGGA 5DWUH 3MBEC 5TJWK 2EYSB 3FB8A 1H3GA 4N8VG 3FO0L 3ILPA 4EI6A 3ULUD 2FIRT 5I71B 1CFVL 3H3PH 2YD6A 1OVZA 1EH9A 3FQRB 4ERSH 3OG6B 3RNQA 2I9TA 1OT1A 3CGTA 1IGFL 2X4SB 3QDMD 1R0AL 3WUWA 3QIBD 1GC1H 5C0EB 2OP4H 5D93B 5KSBE 1LDSA 4HC1A 2XFXA 5I30H 3GI9H 4ODTH 1JZ5A 1ED3B 1HKFA 4WUUD 3MODH 3NBNA 1QSFE 4Y4HB 4AIXA 4GFTB 1MCQA 4QRRA 1DBKH 3C6LD 1I1YB 3VXRB 2BSRB 1Y6NR 5GGVL 4JANB 4A2MA 2NLJA 3EYQC 4LRIA 5DLML 1AJ7H 3WUZA 4RGNC 4M9PA 3O6ML 4Y8AA 4YDIH 3JXAA 2FYYA 3ZTNH 3DRQA 5KS9E 3O0RL 2RJMA 4NO5B 2BFVH 4Y4KA 1E4WH 1I8KA 2VXUL 2WUCH 2X10A 1ZKAA 2IF7A 3HI1A 5E7FA 2V17H 5CEYB 4N8CH 4ISVB 3MRHB 5BO1L 4CJ1A 5CINH 3ALWA 5F7UA 4RFNB 4OFPA 4OLWL 1YNKH 3GMMA 1XAUA 1N6QL 3QG7L 2H32A 1U8QB 2D3VA 4KAQL 3L6FA 4XVUC 4PB0L 4MNGE 5SWSB 3P11L 4YXLL 1YEJH 5GGVY 2BY2A 1A02N 4L4VE 2BVPB 1PAMA 3S3JA 2ERJC 3VDAA 1KJ2L 4HUXB 5FECA 1FCGA 3HAEA 1AD9A 4YHIA 8FABB 1HKLH 3SY0B 1MF2L 1Q0YH 5D7IB 5FUOH 1BJ1J 2I5YH 4XNUL 5E8PA 4U3XA 3LKPB 1KJMB 1PZUB 4G7VL 1WFOA 1TETL 3NCJL 1GGBH 2DM4A 3EOAA 2VRAA 5J06A 5IG7A 3L5XL 4P2RA 2P8PA 2A2QT 3QWRD 1MJ7L 1I9RL 3TIDB 5HPOA 4FQ1L 4D8PA 5HDBE 2OLDA 3SKJH 1KJ2B 4I3SL 3PDGA 1H5BA 2CH8A 2D2OA 4YC2C 3W9EB 1JN6A 3BGAA 1NGPL 4JM2A 1UACL 5EZJB 2FO4A 3HTLX 2R0WL 1T7ZA 5I2IB 2VIRA 4NNPL 3RNKB 3SDYH 4YHLL 4JQXC 3CC5B 1AGEB 4F2MA 3T8XB 3VG0H 4MCYA 1ZXQA 1HH9B 2H26A 2VH5L 1V7NL 3IAQA 3QNXB 4H20H 4OZIB 5FYKE 3IDIB 1WFUA 3AY4A 5TFSL 5A3ID 3FO9B 2NCMA 1Z5LB 5DD1L 5KSVB 4ONGH 4XBPA 1A6ZB 1TQCB 5IFAL 3BSZH 5I0ZA 1HYSD 1OSZA 1RZFL 4KRPD 2Q7NA 4WNQB 1DBAH 3CXDL 5JOFA 5C6PB 3OHXA 5TDPA 4JFFD 5DD3L 5CD3B 4W68A 1G6VK 3GSVB 2NW3A 1I9IL 3O6KH 3PWVA 1RJLA 4JPKH 4K7PL 1Q9OA 4GKZA 1AXSB 1T7XA 1NFKA 5KN5B 1S7WA 4X99A 4XCEA 3QRGH 1CFSB 3RVWD 1FYHB 4L3EB 2A77L 4OLYL 4X8JA 4MD5B 4D2NA 4KVNL 1PEWA 4OCWH 1YEGH 5DZLA 3LKSA 4JFFA 3NIDE 4JJ5B 1U93B 2BOCA 3ISWA 4P3CL 1AGDA 2DIBA 2WBJD 4TNVF 2ILLA 1WBXB 4GBXC 4KKAC 2IANE 4I0PC 4ONHA 3SBWA 2YPVH 4HPYH 3FQUB 3VXUA 4G9DB 5IMKB 2HN7A 5FV2A 5K9KA 1W8OA 3H9SE 2V9RA 1LP9F 3G5XA 1T5XA 1YN7B 5D1XA 4LKCA 1HINH 5ITFA 4LAQL 3MYJA 2VDLL 3BH8A 4X4XB 2R2EB 4Q9QH 2CDGA 5K93A 1R5WB 1RI8A 3ZDXF 1ONQA 4DEPB 3MLSL 4HWBH 4K07A 4UB0L 3UTTA 3ZYOA 2YZ1A 3ES6A 3WDHA 2P5ED 1YYLL 2X4RB 2MSPA 1L7IH 2P8MB 4LRNH 5FB8A 1RAMA 2NY1D 2IFGA 1RZJH 3TF7C 5IIEA 3VWKA 4NQUA 5HGDA 3QO0A 5JIKA 1QG3A 4KK8C 3S96B 1HXMA 3RUGB 1ZA6A 4NN6C 3U0TA 3GBNL 5C0BD 2ZUQC 5CWSB 4ZFZA 1J11A 5CS7A 3AVEA 3QDHA 4NKOB 4FZEL 1S7VB 4QNPF 5CBAB 3REWB 5L8KB 2NYYD 1M7XA 5SWZB 1AGCB 1EX0A 4RFOL 3LMJH 5IW6B 4LVNB 2QQNL 5J89A 2QSQA 4GG6A 1YEFH 1U8HA 7FABL 4GXVL 4D0CA 1KPRA 4PLJC 4PFEA 4PIRF 1UXWA 3BPLC 2NY7H 5CUSH 3W2DH 3O4LB 1TZHB 5C8JB 1F6AA 1FZMA 3RIAK 4UOW0 3RQ3A 4IRJB 3HR6A 1F45A 3ARPA 4KFZC 4I3RL 4RAVB 5HDQH 4E41B 3CDGB 4DWHA 3V5HB 3L3GB 1HE7A 3DMMA 3ESVF 3NCCB 4NN5B 5FHBH 3X14B 1EEZA 4NUJA 1XGTB 2JF1A 2AXFB 1EFQA 3U2SA 3QFJB 5IMMA 1DDHA 1NUNB 1BD2E 4TQEL 4BSWA 1BJMA 3QUXB 5FOBA 3MYZA 3WL9A 2CMRL 4PGBB 2R0LL 3B6SB 3G04B 1S7RA 2X4TB 2VR5A 2B4CC 4FQLH 4NYLB 3ULSB 3UPCA 2Q6WB 1A6TB 1OAKL 3BAEL 2W0FB 5HVGB 1B4RA 4LARH 1NEUA 2QKIB 2P5WD 2ADGA 1HZHH 2LQRA 2J2ZA 2PXYD 5HD8D 3LKOB 4QRRD 1BBJA 1J7VR 5LGHL 4XMKH 2J1KA 3NIGE 4NJAH 5KSBA 3MRCB 1J1PL 5GZNC 3O3DB 5T3XE 2VXSH 2AXHA 1P4IL 2F5AH 3U7YL 3IDXH 2F74B 1FH5L 1S5IL 2FEDC 1SYVA 2HTLD 4S10A 1VPOL 3MGAA 1DBAL 3O4LE 3O8XD 2GTZB 4JR9H 5J1SC 3LZFL 2CLVB 3V8OA 1IAIL 4NT6A 1NFDA 2DM2A 4LCIL 5D7JC 2ITCB 4HDIB 3HS0A 3DETD 4Z7VF 1ZLUH 3HE6A 1T80A 2F5BL 3HB3C 2B1AH 3E2HB 3MCLL 3OSKA 3OKDA 4ZO8A 1GPOH 1CLZH 4BZ2H 3GSNA 2WW8A 3WJLC 1WC7B 1J0YA 3BT2H 4IRSC 5CHNA 4Z7WE 2IALB 3R0NA 3RWCA 1A6PA 3RWCB 5C0IA 5GGRY 4Y2DA 1XGRB 1CDIA 4PBWD 2XTJB 1WC7A 3FFCE 5AG9A 2MQCA 1Q94A 3VD4A 3SGJC 2V5SA 2VLME 1FFPA 2X4OB 4IHOA 1WISA 5FKAB 1IGIL 2VZ3A 4PV9B 1HILB 4HK0A 4WWID 2V2TB 5GRVK 1FDLL 2X70B 1H3UA 4TULL 3P0VH 1YMMD 3MX0A 1FORL 4L4VA 4EOWL 1RUAH 1JGVH 1N0LA 4O9HH 1M71B 2NTFB 3P4NB 4EUPG 2F74A 4F9LC 4HKZA 3CFBB 1A8JH 3GEWB 2EE3A 5ADPL 3BH9B 1AHWB 4L4TD 1HH6A 1J86A 4UU9B 2HVJB 4Z0XB 4J8RB 1KTDB 1M7IB 4PJCA 4Y5XA 1C1EH 5HHNB 3HE7B 3KAAA 1NCCH 1ORSA 1PG7H 4Z95H 5B8CB 3QNZB 1D3CA 1ZSDA 3QUMB 3LKQA 5FOBB 4FQQA 1TVBB 3EFDH 4GW1A 4N5UA 5IEHB 4R97C 4BSWB 1CZ8H 3EJZD 2DWEA 4M03A 1ZLWK 3E3QC 3P40A 5I73B 3QUKA 3LN4B 1E6JH 5HHQA 4G7YL 1UJ3C 4ZAKC 3DMMB 1BBDL 3GO1L 4AMKH 5IEHA 1TVBA 4FQQB 2NXYD 4PR5A 1ZSDB 1HEZA 1YEEL 1HHIB 3W39A 2X1OA 4IRJA 1XF4B 4OCLC 5B8CA 4LGSB 1IAII 2IMNA 3P4LA 1FCCA 1C5BH 3PHQA 1XR8A 3AS2A 2R9HD 4J8RA 5I1AA 2HVJA 2F53E 4RFEA 3REVB 4J3XA 5F7KC 1R3IL 4S11A 5EIVA 2NX5A 5J56B 4YAQA 5J1AB 2ZP0T 3D39E 1AE6H 4XVSL 2R8SH 4KV5F 2GJJA 3H8NA 3MREA 4MXWH 1B4JL 1AGCA 5EOTA 1MQKL 2FJGA 3CFBA 4HKZB 4TSAH 2JB6B 5CBAA 2NTFA 5J9PA 2JCCF 1F8TH 1IGFH 2ED9A 4M6AA 5DVLA 5CWSA 1RIUH 2D0FA 4HC1L 3QO0B 3MBEB 1U8NA 4JCMA 4XTRC 3ZTJH 3QDJE 3N0PB 1BQHA 2NMSA 1EVUA 7CGTA 4XB8A 3B9KC 4BZ1L 4CU6A 2C7UA 4NRYB 4JFEE 2HFGL 3F8UB 4JZNA 4CN4A 1ONQB 2EDNA 4FQPA 4JO1H 4JZJA 2WWMC 2P5WA 1C08A 4F7PA 3EYUH 4HUMB 2XPGA 3KPTA 1FZOA 4LKCB 3UTSB 3HE6D 4P46D 5EORL 4MJ2A 2YD8A 1RJZB 1YEDA 3MRMA 4PLKC 5GRVL 4OLUH 4P2OB 5DRZA 1AGDB 3HE6B 5I1IH 1H3VA 3TNMB 2RGSA 3IU3B 3VGFA 1X5AA 4F33B 3V0VB 4BZ1H 1QSEB 5HHPA 1YEGL 1TJIH 2XZCH 3LS5H 4M8VA 2X4QA 4M8QB 2AI0H 3WO4B 2ZNWA 3OPZH 3HI5L 1MWAL 4JQVA 4JY4B 3D25A 4K3DL 3QXVA 4YHPA 5KN5A 5ITBH 4PJ7E 2FGZA 1AR2A 1RJLB 3GHBL 3S37H 3S6CA 3V52H 5IW1A 4J3VA 3B3IA 2LU7A 5DMIH 4B50A 4HK3J 4KI5C 1N2RB 2APTA 4MB5A 4HCRH 1WFNA 1L7IL 1S7UA 1S7RB 2X4TA 4FFWD 4XCCL 3FJTA 4PGBA 5EBGA 4UDTB 2EDJA 3MRIB 4PJFA 3U9PL 4YHYB 5DJ2B 1AGBB 1A6ZA 1CFNB 5KSVA 1VPOH 2EDRA 4GG8A 3ARDA 4ODVL 2WINB 1EEZB 3X14A 3MSPA 4QRTA 2R39A 4H8WL 1J8HB 3NVQA 3LPGA 3WHXB 4K3DH 4FA8A 2V2WA 3T8XA 4OGAC 4X9BA 1RZGA 1F6AB 5FO9B 2Q8AL 2EE2A 3BI9X 4QT5B 4RGOL 3RI5F 5DVKA 3T2PA 2VL5A 5HYSA 1ZE3C 2PKDA 2ICCA 2EDHA 3WN5A 2VQUA 4D0CB 2XKUA 1JFQL 1W0WB 3W9EA 2P1YA 3MRFB 4GRLD 1JMXA 5D1XD 5SX4I 5JW4Q 3FZUD 3UTTD 3C2AH 5IG7B 4FTVB 3EOAB 3K7UA 4BKLA 3TBWA 5ILTL 5JDJA 4RZCA 1JYWA 1F4WH 1KJMA 2CLZA 1QRNB 4S0SD 1ITBB 2HJKB 1KYOJ 4X6DB 4M1CC 4Z7WA 1P6AB 1VKXA 4UV4L 2XN9E 3I3DA 4ZSOE 2HMIC 3NCEB 5F7FA 4W70A 2F8VA 2BVPA 1FVCA 1I7TA 1A0QL 5DHVB 2DLFH 2W65B 3N06B 4P9HL 1MHEA 3HRZB 4P48A 4WEUD 5T1DH 3SQBA 1P7QD 3TYGH 4KRMB 3NPSC 1A4KA 4JN1H 2B8OT 5KJRL 1PG7W 5DMIL 2P43B 4QTIL 4L8DA 4FXGA 1LO3H 1DUYA 4KK9C 4HCRL 4JPWL 1QVOA 5DQDL 3X17A 3QQ9C 3IDXL 1I4FA 4OQTA 2AS5M 1A47A 1NANI 1QSEE 3FQWB 3O9WA 2D03H 4GRLC 3U7WL 3L5WB 4MWFB 2GUOB 3QZWG 4I2XA 5CMAA 4ZTPL 3VXUB 3AGVA 4QXGL 2VDRL 2YN5A 4LBEA 3NPZB 1JYXA 5AD0A 1EO8L 4Z7OE 5CCKH 2BOCB 3DVNA 1U93A 1CDJA 4JJ5A 2AP2A 3UTZB 1VSCA 2IPKB 1GGTA 3TJHC 1LEIA 4P5TD 1A0QH 4HIEA 2CKBH 4KY1L 4XB7A 3GMPB 3HMXL 5KTEH 2IQ9H 3LZFH 3KDMB 4FHBD 1EEQA 1RJCA 2GK2A 5CZXD 4WFEE 4UT6H 1B9ZA 1N64L 3M07A 4I0PD 3B5GA 4LIQL 5AYQA 4XP4H 5D2LE 3C6LA 3ZDXE 3ULVE 4OKDA 1G9NH 4XBEL 3EYUL 5I8EA 4DEPC 3QEQE 4YUEL 2FHCA 2CLRB 4OLVH 1HN1A 1S9YA 4WNQA 5FUCC 2FEEI 3FAWA 3FQRA 4PV8A 1VGEL 1OSZB 4I9WE 1OB1B 1UYWL 4Y16D 4LQ1A 4OD1L 4O58H 4XPBL 2XWTA 3LMJL 3QXAA 4EXKA 4R90H 2EYSA 1DEDA 5F71A 3B9KA 4S1SH 3IDIA 5DK0A 1NUGA 2AERT 3EJYD 4BSVB 3IB4A 1HH9A 2BSSA 1UM5L 3RVUC 3QQ4A 5E00A 4PG9A 5IKCA 1MNUL 1UWEL 5IVXF 3HC3H 1VADA 2I07B 3RAJH 3T3ME 5LWYH 4RGMC 5KSAB 5F6IC 1QRNE 2DD8H 3S35X 3MLUH 2ADIB 2R15A 3C8KA 4JM2C 3ULUH 5HJ3B 3DV4B 4UNUA 1WITA 3ABZA 4P2RB 3WJJC 2EEBA 4QYOB 4PRAB 1JNLL 1GC1C 1I9EA 4I0KA 4KHXH 1QLEL 3JWOC 4HLZG 2VE6B 5DQ9B 2UWEF 2CRYA 5IFAH 3KPOB 4HX1A 3MZTA 1GOGA 4NCC2 5I30L 4OFIA 5FECB 2PR4H 4X6BB 3D6GA 2IAMD 3CCHA 1KCUH 4OV5A 5FYLH 3QUXC 5T5FL 2VXQL 4RSVA 3MJGX 1ADQH 1U8JA 1X6NA 3KPNB 3L5HA 2AI0L 4N0UA 4YFLF 5IT2H 4A6YH 2I9LB 4MA3A 5HHMD 1SBSH 3GMMB 4TRPL 2EDFA 5TE6L 4DTGH 1KFAL 4TSBH 4UT9L 4M48H 3ZZ1A 4OD2A 4ZNEA 1IAIH 2CGRH 4JFOB 4B7LA 3MBXL 1WTGT 4L4TE 1G7HB 1P1ZA 3BESR 3UJIH 5C7XL 4Y4KB 2W07A 3BP5A 3K8LA 1D5MA 4PJEF 3CLFL 1ZTXH 2DQFA 4D94A 4NO3B 3X3FH 3GK8H 4DVBB 1BFVH 1NMBH 1T04A 1TLKA 2D31A 2XTJD 2CIKB 5F70A 2DQDH 3U4EA 1BFTA 5J57B 1KG0B 4ZNCD 5I1LB 2HRLA 1EEUA 2GW5A 2NLJB 3IFPB 5IB3B 3LD8B 1ZHKB 2R29L 2BSRA 4MAUH 4NZJA 3E2HC 4LASH 5JXEC 5DD1H 4JE4B 1XCQA 2W60A 2J5LB 3NN8A 1FAIL 4XCNB 3ULVF 5HI5D 3NZ8A 5E9DB 5L7XL 2Q86B 4Y5YB 2XFXB 5C1MB 2WWKT 3EO0B 4EN3C 32C2A 4MJ5A 4ZUWB 3SKNA 3CFKA 3CLFH 3QI9A 1I9IH 3WIHA 1Q9WB 2HLAA 1AKJA 1A14H 1T0PB 3QIUC 4ZYKB 1DFBL 1S9VB 5DJ6B 4N9OB 5DMKB 1MHHA 3TN0A 4P3DB 4JRYE 3P3YA 2WAHA 3ILPB 4YK4C 1R24A 1F6LL 4I48B 1B0RB 1OGAB 1TVHB 4NP4H 1KXQE 1MCLA 5B39G 4P2CG 5IT2L 3DO7A 4KKLC 1WCBA 4ZFGH 3QHFL 3T4YB 1YNTB 1HHGB 4G9FA 2ITDA 5EPMB 4PJGB 4PJHA 1LE9B 4PRPB 4XCYA 1KENL 4WI7A 1P4LA 3BW9A 3BD4A 3HFML 4NDMB 3CNKA 3KG5A 4OB5H 2BC4A 3D39D 4O2CB 1MWAH 3HUJE 3HC0B 3FOLB 4NM4L 5A16A 5EU4A 1LK2B 3MRQA 3OKYA 5LXGL 3ARXA 3SDYL 4X6FA 3HE7C 3O4OB 2X6MA 3K2UL 5C0AE 2NXZD 4TOYL 5DO2C 1ZEAH 1FFQA 5T1KD 3PNWA 5HGGS 1AXTL 2J12B 4HUUB 1VGEH 3VGBA 2XWJB 1FZJB 4U4BA 2DL9A 4ODWB 2C3GA 3HR5A 1ZT1B 2DJSA 1ZTXL 1LHZA 1QZ1A 2BJMH 3K1KC 4NM8H 4MS8D 3HPLA 2IC2A 4ZPTB 2VDNL 5DQJA 1AKJD 1U8LA 3VW3H 3X3GL 5DI8A 4ZTOL 5J11B 5T3XH 4V2BA 3GSOB 1OLLA 1PDKA 2E7MA 3MBED 5FKPA 4F15C 1SEBB 2JIXD 3DWTA 2OJZL 4W4OA 5KVDH 4RDQG 1A6WL 2GI7A 3JV0A 4PJEB 3NH7H 4LCUA 4P3CH 1I9JH 4P23A 4ZOBA 3LS4L 2NY4B 2ZUXA 1TDQA 3B9AA 5DD6B 4IRSD 2MHAB 4NQED 4OJFH 1JE6A 2WV3A 1O5DT 5F9JA 4BFIA 3QSKB 1F11B 1HI6A 2R1WA 1YECH 3GUTA 3VFGH 1BVKA 3SDXA 4LMQE 4GS7B 2V17L 1BM3H 2DS4A 2WBWB 4DK3A 4KQ4L 1T7VA 2YXFA 4UTBL 3L3IA 4R26H 1XF2A 4ORGB 4YNYA 2AK4B 5JNYB 1JPST 4XHJD 4XAKE 4N0FA 1N5YH 2F19L 5EDXA 4R7NA 1JV5A 3O6FD 4QRQA 3T0EC 2OTPA 1Z3GL 2AABL 4HJJH 1D9KD 2WP3O 3ARWA 4WO4C 2DJUA 3MLTB 1D6VH 1LDPH 3MOAL 5T3ZD 2ERJB 3CDYA 3OX8A 1J1XH 3EDJA 1FO0L 1A5FL 2BNQB 3VXPA 4JJHA 4PY7B 5C0AD 1ZT4B 3FAXA 1EJ6A 5C07D 4PRHE 2BNRE 4MX7A 4PY8I 4JRYA 1OAKH 4PGJA 3S4SG 4OM0H 3T04D 3CH1B 4K94H 2OR9L 4MJ6B 2DQGL 3WS3B 1DCLA 2OZ4H 3PQYB 3V0WL 2IH1B 4FN0A 2A6KB 2DDQL 4KDTA 5ESAB 1ES0B 1URLA 2YD1A 1MLCB 4LGPB 3VH8B 1AC6A 4CU8A 5EBWA 3S7GA 1EJOH 5IB1A 3WNNA 3V8CA 3BDBA 2VXUH 5BOZG 5B3JE 1QSFB 3NA9L 3JTSA 3H3BC 2DN7A 3WDIA 1WBYB 1XIWC 2BX5A 4HGKC 1MCKA 3V6OE 4FQ2H 5J6HB 2VLRA 4P0DA 3SCMD 5IVZA 4KRPC 1P84K 3C5SA 2CO7B 1KLFA 3MTRA 4OCRL 1SJHA 1G7MA 1KIQA 5INCB 4DAGL 4UQ2A 4ELMF 3KYOA 3NFNB 1FIEA 4Z76B 5JZ7D 3AREA 2ORBH 4HIIB 1FFOA 5GGSA 3P11H 4GSDL 2N56A 3AB0C 2EKSA 1YNKL 3QQ3B 4UTBH 3T77B 4HZLB 5D8JL 1N6QH 3RUGE 2HYMA 2A6DB 2Y6SD 4MVBC 5E99L 4QXTB 3UTPE 1PJ9A 3DURB 3JV4A 2QR0A 4QTHA 4HUVB 4BELD 2XTLA 2ATKA 3DUSA 2Z35B 1NGYA 4O00A 1BECA 1T5WB 4D0BB 1DQQA 2XZQH 5E6YA 1FC2D 3ROLA 3TIEB 3BRGC 4WEBH 3QDGB 4ZDHB 2Y9RT 2EYRA 1FAIH 2D7TH 5DT1L 5D7LB 4PREA 4M5ZL 1NH6A 4QWWD 3ZYJA 3HUJF 5GS1A 3FFDA 2OQJB 5IGXL 5HHVL 5DRWA 4MA8L 4XVJH 4KHXL 2F54E 1NFDE 1MUJA 4P2QD 1ZA3A 4AK1A 4R9HA 3MLUL 2EDBA 2P5EB 4JFXB 3RJQB 1FNHA 1OAQH 4LPWA 3HNSH 3ILQD 5J13B 4N68A 5E03A 1IAMA 3I9GL 4Y19E 4FQIH 5GISL 3U6RA 3SGEH 2Y06L 1IGYB 3LDBC 4L3CA 1ERNA 1HXYA 3VWKC 1KEGH 1XGYH 4R0LA 2SEBA 1M6OA 1SQ2N 2VSDA 5GGRB 4YX2H 2EXWD 5BRZA 4EXPX 3NZHL 1BQHG 1VFAA 2YPVL 1MCEA 4HPYL 2EEAA 1AR1C 1DE4A 4M02A 2BNRB 3MRPA 5F9AC 1A9EB 3ARDC 3NACL 2B1HL 2EZ0C 2JJSA 3JWDL 1CXIA 3SJVB 1U3JA 4X5XB 3GB7A 2M8XA 4K2UL 2ID5A 2WP3T 3CZJA 1NPUA 4Z18A 5IP4A 1Q0YL 2IANA 1H0DB 3HAEH 2NY2B 3F62A 5D7SL 1EAPB 3ILQC 5DRWB 2BSTB 4L8BA 3BQUB 3WCYA 5L88L 3CX5J 4JN2B 2NY6B 4JPIB 3QUXD 1SVCP 3WHE0 5TDNB 5ISZA 4BFBD 2PO6A 1SJVA 1OAUL 5DT1H 4O02H 4GT7A 2DYPB 4KDWA 5FF6A 1H8NA 2BNUB 4DCQB 1UCBL 1AQDA 3BJ91 1NGYB 3HLAB 3NFPB 2E9BA 5J3HD 1AQKH 3B8SA 3EO9L 4WI3A 4EDXB 5ECJE 4G7YH 4QXTA 2QEJA 1HYSC 2A6DA 2AEIT 4RQQB 4YHMH 1VFOA 1CL7I 4PJXE 1VFUA 5L7XH 1BX2B 4XMPL 4XMLH 1R6VA 4M7LT 4BM7A 5I66B 3H3PL 4HIIA 2R0ZL 3RZCB 4AEFA 1IAKB 2XNAA 4JFYB 2VDOH 1K4CA 1JPGB 2PYEB 4KU1A 3WEXB 1E28B 3RY6A 1GCFA 4TNWF 3E3QE 4WW2B 5GRXG 1MFNA 1WBYA 3QJFA 1AFVH 5GGQH 5BZWB 4A2LA 1PD6A 2BVYA 2Y1VA 1KXTB 1RZKH 3MUHL 3TBVB 2UY7A 3BRFA 3EDEA 3L7FA 4JHBA 4WY7L 1JZ4A 5DK2B 1HOCB 1RUMH 4QGYA 2KPNA 4D9QD 1F4WL 1P5UA 3IT8D 5CD5C 1QFOA 1DLHB 1V7MH 1YC7A 3BPLB 5IK3A 4G43A 4JRYB 3FO2A 2AXJA 1PYWB 5K9QG 1EDQA 4FTVE 1E4KC 4QEGA 3U7AA 3MRNB 3PV6A 3VRLF 2YRLA 4OM0L 5GGUB 1MCJA 1CTNA 3JWNC 4QHNB 4U6TA 5DURB 4N90D 4BFGA 5IV2B 3BP4B 5LQBL 1IC5H 2FX8H 4NBXB 3VW3L 3TT3H 3S3PA 1YYMH 1P4BL 4YDIL 1D5ZA 1PEZA 1BWWA 1MREH 2XTJC 1NEZA 4O5LL 4EN3A 1X5JA 3ZDZE 2D7MA 2HFTA 3NIFF 2DQJL 1EBPA 3QXUA 4QHLA 5E2WL 1G0YR 4N0FB 1JI1A 1WSST 1KELH 4N0YH 5F7HA 1RU9L 2AK4A 3WNLA 3QDMA 1JGLH 5D2LF 4R2GC 4EUPB 3T0BA 4Z7UE 1UGNA 2GTWB 4ONOA 3THML 4DN3H 1CFTA 5F89A 4QOKE 5ESVA 3TZVD 3WV0A 1CFBA 1E6OH 2NY0D 3U7YH 5ITBL 1S8DB 4AYFA 3OJMB 2ENYA 1H15B 3CZFA 5DD6A 3WNMA 1G6RB 1YQ2A 3SPVA 4JDVB 5TH2A 2X2YA 3BZFB 5EA0L 3MV9D 4XNXH 5IBUG 3QUMH 5LKNA 2DMBA 4GAGH 1OGTB 4TVPE 4JKMA 4Y16C 4PRNB 4HMDA 3LQAC 3JWDH 4M7JL 2JJWA 1XZ0A 5MEQB 3UYRH 1EEYB 5AAWA 3RWEA 5FO7A 4IMKC 4J6RL 3OKMA 1LO5B 1U8LB 3L3HA 1ZGLB 1G84A 3TN0C 2CSPA 2GK0B 5AAMA 4TSCL 3QAZC 3J7HA 4NSKB 1IC7H 1NBYB 1HHHB 2ZKHL 2Z9TA 2FGWH 4QRUB 5C07E 3RHWK 2ADJA 3SGJA 4IRSA 4I5BB 4OIIL 3U4BH 4NQCD 4M62L 4U2ZA 1I1AB 1NBVL 5IR1A 2AEPH 5FUZL 4I5BA 2ARWA 4ZOEA 5K9JH 2ADJB 1GRWA 3LH2L 43CAA 1PKQE 1FNAA 1NBYA 4JFQA 4OQ1A 1FDLH 4IRJD 5JIPA 1QFWI 4DKEH 5JORB 2VZSA 1WLHA 1MPAL 4ZFOL 3S5LB 4R4FH 3ECBA 1QFWH 2Z93B 4MQXC 1OTSC 5FO7B 1MH5B 2OM5A 2J8UF 3MJ6A 4HAFA 1NGXB 5IQ7H 3VGAB 4ZMAT 1LE9A 1BZ9B 3CDFA 4JQIH 4P99A 3QWOA 1P84J 1F4XL 1T1ZB 4Y8DC 5CZKA 3UBXI 4GKSB 3TN0D 4ZO9A 5EZIL 4XTRD 1L0QA 1MAKA 1RULL 4LIQH 4TPRH 3KPSE 2Q1EA 1PKOA 4KJWC 2WUBL 4QOKD 3CFCH 5T1DL 1CLZL 4NZTL 1B4JH 3H7LA 1T0NA 3EOTL 2YMXH 4P2OD 2IBGA 3SDCC 2VKWA 4Y5VA 3QA3B 1YMMA 1CK0L 4Z7UF 1JL8A 4E0RB 2VLRE 1ZT7B 1G9MH 1IGTA 2CK0L 4Q9QL 2BVTA 3EO0A 1NGZB 2R69L 4Y5YA 3O81A 4JQIL 1T2JA 1MEXH 5EU7E 1NEZB 1L6XA 2GAZA 2V9TA 3MROB 5HYFA 4OCXL 3IJHB 2ICEA 4MNQA 5I8OL 2M1KA 4XPAH 3SKMB 1LMKA 4NRZA 5A2KH 3I50H 5KVGH 1CT8A 3D3VA 4O2EB 4DUXA 1JTTA 3FTGA 3VA6A 2QSVA 1MFCL 5D5MA 4ODUA 2NY4C 3TO2B 2CIKA 2I25N 3UZVB 1I8IA 4MB4A 4I8DA 3X12B 2OL3A 5BVJA 5ADPH 4NO3A 2E27H 1DLHA 4U05A 5KZCB 5C7XH 4G7VH 2FGWL 3WFZA 5E8NB 3EZ8A 5FHAH 2QHRL 3TV3H 5A40E 5TF0A 1KLUB 3OGCB 1EHNA 1NBVH 1K8IA 2DIAA 2GJ6D 3JTTB 2EH7L 4NKIH 1JWSB 1IGCL 4HHAB 4R4BA 2QSCH 4RAUB 4X6EB 1K6QL 2ZG3A 3KPMA 1SM3L 1CE6B 1WK0A 4PB9H 5I18L 5I71C 4UIMA 4J12A 4WW2A 2X1QA 2QQNH 2BVOA 3WEXA 4L4JA 3GHBH 4HKJB 3G08B 4CJ0A 5EA0H 5DDHA 5CEXB 5T5FH 3INUH 1RZ7H 1SMOA 3ZHKA 3WFHB 5C08B 4D3CH 4XI5D 2AJVL 4UOJA 4IJ3C 2VE6A 4KJPC 3U0WL 5F6HI 3DGCR 4MA1C 1WAAF 1IMHC 1T4KA 1XGPB 4X8XA 3M8OL 4OM1L 1IEHA 2L7UA 1KCSL 3OKLA 2XG5A 1V3MA 5I1IL 5EWIL 3SDAD 5IFHH 3UC0H 1G0XA 5TGBA 5CEZL 4HG4K 5FF6B 2DQHH 1DLFL 2DYPA 1J5OH 5KVEH 2PO6B 3RVWC 1CQYA 1G6RL 3GBLA 2FDBP 3SDAB 4M62H 1X44A 3H0TB 2YSSA 4JN2A 5ALCL 3ARRA 5IKCB 3HCVB 4F8QA 4L8BB 2XKNB 5ILTH 1OPGH 4HUWB 4TSCH 5FYLD 2IANB 4EI5D 4P2QE 5HVHC 4BJLA 1BWMA 2IH3A 1MAJA 5IUSA 2VKXA 2YOCA 4PP1D 3DTXB 2OI9B 3QDGD 4GJTB 1IC4H 1L9MA 3Q0HA 5EO9B 2LTQB 5EC1A 1FRGL 2G75A 4UIKL 4B53A 3TH4T 3L9RA 5ESQB 3ULVL 4OFKA 3UBXA 1CD0A 1S9YB 3F7RA 3QQ9D 3S35H 2LU4A 2ZJSL 4OF6A 5I8EB 4MDIA 5DYOB 4JFEA 4BQCA 1MVUA 3WD5L 2W1NA 4NHUA 4P59H 3C6LB 1DQDH 3MRPB 3FONB 1DE4B 1JHLL 2B4CL 4V1DE 1VFAB 1BD2B 1LEGB 4WHYG 5JR1H 4OZGB 4ENEC 3GK8L 4OCSL 1WTLA 4M7LL 2CDFA 3KPQA 2XY1A 1XF5B 3SJVD 1R3KA 1C5DB 3BN3B 3RU8H 1CYGA 1IGYA 5F88B 4HIEB 2BCKA 3VJ6A 1BQUA 1LEIB 2ARJB 4C59B 5CZXC 5D7KE 4XPFH 2Z8SA 2P5EA 2YUXA 1YEEH 3DYMA 2NYYC 2W0PA 4Y4FC 3S37L 1OP3H 3QPXH 3MNVA 4HS3B 4XMLL 2F53D 1MCFA 1EO8H 4OGZA 5J8OA 1I7UB 3FFDB 2P46B 1TTUA 4G8FA 4XCFH 1WF5A 3T4AB 2BDNL 4S1QL 3C9NB 1DUYB 4P2YA 4OLXL 3QDGA 1ZANL 4IBLT 4NNPH 3E0GA 3VCLB 4YR6B 1NGQH 5AEAA 3RL2A 4XXCA 4P3WA 4M1GH 4R96B 2YPKB 3BQUD 5DHVA 1DTUA 1NLBH 4XXCC 4MAYB 3TO4C 2Y5EA 4MSWA 4E42B 4HH8A 5A3IC 1OCWL 4R7DB 4LCCB 2B1AL 1OAXH 1FFNB 1O7SA 3WO3B 2JLLA 2ZUYA 3ALPA 5L2JB 2E6QA 3AREB 5B38B 2ESVA 3QCVH 3OAUL 2YD2A 2E7LA 5INCA 4KC3B 2VNCA 1VEMA 3QHZH 3VFMA 3TBWB 5DJYA 1OAZL 4QRPB 5MP6H 3VFWB 4FQCL 4FG6D 4Y89A 4FTVA 5IVZB 2OR7A 3JV6A 4Z0BL 3GMRB 3S36X 2Y36L 4HUKB 3JWDC 1IM9A 1IT9L 4YWGL 4HJ0D 4MNQE 1JHLH 5C0JA 1R0AH 3O2DL 1MI5E 2DI7A 3IFLH 1Y18B 3QO1B 1WV7T 3CU7A 3VD7A 4U31A 2A9NH 3S35L 3IGAB 3QBTB 2DWDA 2A38A 3R8BB 1RZGB 4OCXH 3T08A 2IJ0C 2DL2A 2HAZA 3DV6A 5E2VL 3U30B 3SCMA 5DSCB 4EBQH 5C0NC 5GZOD 4RIRB 1PGRB 1J8HA 3CH1A 4JFHE 4N1CA 4X7TA 4EDWL 4OZFG 2XKSA 5F3BB 5K9JL 3GMLB 4DVRH 2ARJQ 1JK8A 1QKZL 1S7SB 4P4RB 2NZ9D 1U2CA 3HB3D 4NC0B 1AGBA 4F57L 1ZVHA 2VLLB 1ZT4A 4UT6L 4JHWL 1CLCA 2XN9D 5J12C 4OZGE 4PY7A 1IC7L 1G7IA 2ZKHH 3OBAA 4UDTA 1X4XA 1A21A 3PWPB 1G6RH 3HHRB 3BKJL 3FB7B 5FV1L 3TVMA 2VC2L 3PL6D 3DHMA 1DSFH 2F58H 5HDBF 4LSTH 5D72L 4BQ8A 4XPHH 4PRHB 5CGMA 3B8YA 1MOEA 5ERWA 3W2DL 3OJVC 1LNUB 1QRND 5E56A 4ZS7H 4L1HA 2VXQH 3EYSH 4YHPB 2VZVA 3D25B 2YA1A 3L7EB 4NN6B 4ONGL 1KUMA 3OB0K 3VFGL 2C9AA 3L3DB 4MHHI 2AJXH 4XP1L 4LQFL 1TJGH 3O6LL 3C60D 1BBDH 1LD9B 3I84A 3EZJB 2X4QB 4RGMB 1BM3L 5ETUB 3S9DB 2OTUA 4YDKL 1QHPA 1RFDH 5HHOA 4LVOB 4Q97A 4X98A 5F7MC 4PLNC 5JXED 1IAOA 1Q72H 4N0RA 3GBML 5D7JB 2CMRH 2HKFL 3C87A 3LD8C 5T1MB 4HAGA 3FT4B 4HMCA 3VRJA 1I3RA 3ZDYE 4JGMA 5I8KH 2UVFA 4FQJL 5DTFB 3VWJB 4K7FA 4OUUB 4XWGH 5H94B 4LCUB 3O2DH 3U1SL 3RDTB 1X3DA 3CUPB 4IRZH 2FBJL 3FOMB 2IPTH 1A5FH 1C08B 1D9KA 5GSVB 2P44B 4G6FB 5IB2A 1GZQA 5GGQL 4JZJB 4NN5C 5FM8A 1Q8MA 5EOCH 1KBGH 5C2BH 1OTTC 4JZNB 1C5CH 1KB9K 3NCYS 4N8VB 1XF1A 2EDDA 4S1SL 5C0RL 2W91A 4M7KL 4DOHB 3QUYA 1IEBA 4MQSB 3W11C 1KFAH 3MLYL 4Y19D 5FYJH 2A1WH 1IFHH 1RK0A 3ARGB 3GBMH 2UUDK 1INDL 3KLHC 3MLWH 2YK1H 4KH2A 5E0QA 2ED7A 1T1XA 4LF3A 4DK6A 2ENSA 4JEGB 1VHPA 4K3EH 4ZUTA 5DZNA 4N8CL 4X9HA 5GRWA 4I2XE 4X6FB 4MHHG 1JPSL 1T2QH 3GSXA 1E4JA 1GXEA 5EU4B 3HZKB 2Q7YB 4LU5L 3MREB 5IJVA 1NC2D 4O2CA 4LLUB 2HVKA 1GGCL 4X7DC 1MFDH 4H8WH 4QF1B 2R0KH 5DEFB 2ZUWA 5T5NF 1P4LB 2EDEA 1BLNA 3DROB 5K9QI 1VENA 1CICD 5EPMA 1S7XA 4EIZC 3PHOA 1CG9A 1XR8B 3PHQB 5T1KA 5HGBA 3T4YA 2GSIA 3QEHA 3DO7B 3O41B 4YDJB 1KELL 12E8L 5ACLA 3BXNA 4JKLA 1TVHA 4OQTL 3KS0J 3LKRB 4Y5YC 4OLZL 4GMSH 3IDMA 4MA7L 3TWCL 1RPQA 3BPCA 1MHHB 5HGHB 3QDJA 1T83A 4Y19A 4ZYKA 1A6VL 4GW1B 4WEBL 4G6AC 2HLAB 3BKYL 1HYRC 4HZAA 4U1IB 1IE5A 4FQXA 1NMAH 3K8MA 3T0AA 5JHDA 4WO4A 3OAZH 3WXWL 4G3YH 4WV1A 4LEXL 3RTQC 4TTGA 3B4NA 4DW2L 5DEGB 1QBLL 3WSQH 3BEVA 4XCNA 1DBBL 5DWUL 2E9IA 1I9JL 3GNMH 3NN8B 4DQOH 5DJAB 4OLVL 2IAMB 5CJOL 3UTOA 3L1OH 4NQCE 5IB3A 2H1PL 5DD0H 2F8OA 2Y06H 3GMOA 2EDOA 1MIML 3VFTB 5E95B 4MNHB 5BV7C 2B7DT 4ZUVB 1U95A 5E5MA 1T04B 4K71B 1A7RL 5GRZA 4DVBA 1AHWC 3BIAX 2AV1A 1B6DA 1DEEA 2IQ9L 3IXTB 1HILA 2HJFB 3QUZD 4PS4L 4IHOB 3C2SA 3LRHA 1A9BB 2KZ1B 4YBHA 3QIBB 3ZE0E 4G6AD 1G7JB 4BK5A 4FQXC 3TZVC 1PZ5B 3MRBA 4X0KB 4WJ5B 2HT3C 5FGSA 3LQZA 1P7KA 4ODSL 3S4SA 5ICZA 3H6JA 1RMFL 3KPNA 3C60A 1BVLB 3AMLA 4ZODA 2KZWA 5KSUA 5IVXB 2WLYA 2E9JA 1CLOH 3CMOL 1LP9E 3QIWA 1SMAA 3O8XA 3KPPA 2GCYA 3RX8A 5HDQL 5FA4B 1E4KA 4S0TD 1NFDB 1J0ZA 2Q76B 3BO8B 3CU1A 2PETA 5T3XL 2DF3A 4EQ2A 1SY6L 3QH3A 1SYVB 3F6IA 3RY5A 4AY0A 1UZ6E 4JHWH 2R1XA 3RGVB 3RIFF 3DV4A 5LJYH 3CAFA 1B0WA 3VD9A 1AO7A 4C83A 1A3RH 1WICA 1FNFA 4JRXA 3KGRA 4LDOB 1Q9KB 3GO1H 4HS6A 3RWFB 2V7NB 3DX7A 5C08D 5JQ6L 5CJOH 4APQD 3V0WH 5F7WC 3H9YA 1RUKH 4XGZA 3LPWA 1FNSH 2FX9H 3BUTA 3O3UN 1T3FA 1BOYA 2HWZL 2D7QA 5F9OH 1ETZB 4YO0A 4TN9A 3TESA 1A1OB 4MYWB 5GJTL 2LV4A 3FRUA 1Y0LB 5C09E 2A83B 1LP9B 3IFNL 2R56H 3Q1SL 2DQUH 3LN9A 4JFDA 4PV8B 4P4KA 4XP4L 3O0RH 1YPZA 5DHYB 4Y4FD 5HI4C 4LNRA 4KHTL 3WBDA 1FZMB 3BP7B 1D6VL 1FE8H 3O4LA 3SCMC 4QXUH 5T3ZH 3RA7L 5D1QA 3GRWH 1OAZH 5GJSL 3QPQD 3BZEA 1KPRB 5I1DB 3DHJA 4Z5RA 1J1OH 1DQTA 3TJEH 3WNOA 4PJIE 2XN9A 4QO1A 3P77A 2DDQH 1IEAB 3KDMA 3FO1B 1KB5A 1AD0B 4HFWB 2APWA 4Q6IC 4NKOA 4PJHE 2BNQE 5TE6H 5EUKB 5C70A 5AG8A 5DD5H 1ZHLA 4JFZH 3U0TB 2A6IA 2ZUSA 4IDLA 3ZKNC 1KIRA 4PJHF 4R4NC 5HVHB 1P4BH 1F4XH 3S96A 1XIWB 2Y07H 4ZPVB 5DUBA 5AD0B 3TYFB 3WUWG 1JGDA 3EOYG 3VWKB 5DFTA 1YEIH 1RUQH 1ULVA 3T2QA 3OPZL 5JUEL 2P8MA 2GUOA 3L3JB 4JPKL 1CWVA 1REIA 1T1WA 2CK0H 2X4RA 4IOSD 4V1DA 3O9WB 3FQWA 2FH6A 3DX6B 4N9GB 4ALAL 2NY4D 4ODXA 1I4FB 3QEGL 2D7OA 3GHEH 5ELIA 2FIKA 4PYGA 4AEEA 2E7BA 5EU5A 1MHCB 1JNLH 2J8HA 4FXGB 4L8DB 4AIZB 2CDGB 3ZE2E 1KGCE 4HGWA 5IHUL 4LPXA 4NC1C 4GMTL 4HIJB 5GGVH 2HP4A 4ODXB 2R23A 3G5XB 4L9LB 4N9GA 1RY7B 3AY4C 3FT3B 1XF3B 3G5ZB 1K85A 1KF9B 3U48A 1FVCB 4OZIF 5D71H 1T1WB 2X7LA 3W0WB 3L1OL 3MODL 3U79A 3WXVL 4XP5L 5DS8B 4U6XB 1WBXA 5A43C 1JGDB 1EERB 1NAMH 5DUBB 4ZPVA 5D7KD 1VA9A 3Q1SH 4POZC 4RAHA 1P69B 1C7TA 3TLRA 5HBBA 1JZ3A 3NCMA 1X4YA 2EE6A 2VWEE 1MFCH 1E27B 1QFHA 1AD0A 3SKOA 4XX1E 4MLIA 1CFSA 3LIZH 1IEAA 4JVUA 1RVFH 4X6DE 4F8TA 3MA7A 5E8EA 5DEZA 4XAWL 3P4OB 3PWVB 1NUFA 3CPLB 3UTTE 3QJHA 4OIIH 2ZPKL 3FZUC 3QHFH 4OGXH 2Q8AH 1NMBL 4LNRB 5GZND 3PGDB 2V2WB 5JOFB 5JHLH 2DB8A 5SWZD 2MCPH 3T0DA 4JFDB 4XVTH 4EOWH 1WIUA 2WINA 2A83A 3ARDB 3FO9A 2DQCL 1CFNA 4PB0H 3TPUB 4CMMA 4F7TA 2EIDA 1DVFA 5CLTA 2VUYA 3B9DA 1MELA 1BGXL 3QNXA 4OZIA 1ZEAL 4WW2C 5C0ND 4HXBH 4PJ9B 3PDOB 1NL0H 4M5ZH 3I3EA 1FL3B 1NMCB 3ARSA 2YN3A 5FM4A 2RAMA 3QJHB 4FP8H 4ZQKA 2JELL 3I6GB 1JF5A 2OL3H 5JDSA 4S1QH 3HG1B 1Q9KA 2XT1B 3NH7L 4ZNEE 5EO0B 3MJ9A 4AM0A 2A9NL 1S3KL 4H26A 4GXUN 1KJ3L 4TUOB 2FB4H 4OQTH 1OAUH 4OF7A 1T2XA 2UZIH 4JG1L 5DMYA 1E27A 2VLKB 1I1FA 1KCLA 1G9MC 3GI8H 1IC4L 1R3HA 3MUGB 4JFPB 5I1KH 4C4KO 4Z7OF 5I18H 3RPKA 3TNMA 1BMGA 1NBQA 1RUML 3SQOL 1U58A 3M45A 1CS6A 5DRZB 3RA7H 1W72A 4U6XA 1A3QA 5E2UH 3ZE0F 3ARFB 4L8CA 3PG2A 2X7LB 3W0WA 1MI5D 3UX9B 4BH8B 4F57H 2B0SL 4FQIL 5FYJD 5GISH 1T22A 5IVXA 3L6FB 3C09C 4P5MB 1FZOB 1NBZA 4HIJA 4PJDF 5F7EH 3LQZB 4IIQA 3V95A 5KVMC 3MRBB 4DQOL 2W38A 5EU5B 1PZ5A 2ZCHL 4NO0B 1N3NB 2C7UB 3MRHA 4ISVA 5FO8B 3DRTB 3HI1B 3KYMB 1I8KB 3K1DA 2XQBH 4XP1H 2HLFC 3VFSB 1DEEB 5JW4R 1NSNH 3LEXA 5GGTA 2G60L 5B38G 3KWWB 1UG9A 4LVOC 3IYLW 4JQVC 1A7NH 5T1LB 5I1JL 3FHQA 3L95B 3MO1A 1J1XL 4KUZL 3DXAD 1RZIA 3O2DA 3QDJD 5F7YC 3B83A 4I0CC 1EZVX 4KI5F 1UCBH 3SGKA 2YKLH 5HHMB 3FO1A 1UKSA 4NOBA 2PTUA 3LSOB 4KVCL 4NQEA 4I13B 2OSLB 3BEVB 1DSFL 2F58L 4YAQB 5J1AA 1F3RB 5DEGA 3GIVA 3BZEB 3REVA 3FQNA 3OJDA 4GG6E 3FFCD 4WCYH 5C0EA 1QOKA 4LAQH 2NY2D 3MLPA 4LHJB 5DHYA 1YPZB 1RIHH 2MPAH 1R5IB 4NQEE 5CJXC 4R8WL 2XIDA 4OIBA 4JFHD 1LP9A 3O3BB 3BPCB 1F4YL 3SE9L 2A1WL 1G1YA 2OBGA 5DF0A 3WD5H 3CX2A 3DYOA 4GUPB 4RNRB 4YK4B 1CF8L 2CR3A 4R2GB 3TGXA 5K59E 3SDDA 3FCTA 3QUMA 3T3MF 3T1WA 4YWGH 4R4FL 2X1WL 2ADFL 4LSQH 5F8RC 2P4AB 2BJML 4NM8L 1M7IA 2DLFL 2H9GB 4YUEH 3OKEA 4M4RA 4PJ7F 1BLNB 2DQEH 5FIEA 4KI1A 4OCNC 4C4KT 4JRXB 1MJUH 1FAKT 1NDMA 3H9HB 5KVEL 4GAJH 4GMTH 4LMQI 3RGVA 2R1XB 3VDBA 3QH3B 4K8RH 1L7TL 4ZUTB 4P46C 1T1XB 4LF3B 4MDJA 3WFBH 4XP9H 5DA0B 3U46A 2R1YA 4HKBA 2Z92A 5E8DL 1MFEH 4NFBA 1CFQA 1BIIB 3MLXH 3S88L 4M43H 2XWBA 4O58L 2X70A 1FNSL 3KPPB 4QCIB 4AH2A 4OZFA 2BRRL 2OL3L 3UCRA 1AGFB 1NGQL 2V2XB 4WUUB 3MC0A 1CXLA 6FABH 1Q94B 5KZCD 1BOGA 1JGEA 4JPVL 4FFZL 5DUPL 4X0KA 5MP6L 1GZQB 4RISL 4HBCL 1U91B 5M95B 2XQYK 2ATPA 1FN4A 1QO3B 1V3JA 2YXMA 3DOSA 4LSUL 1EIBA 3KPLB 2VERN 2DJ4A 4M7ZB 5H94A 4Y2DD 2HJLB 5DTFA 3VWJA 5ID1B 1A14L 5D1ZB 1YY8B 3N1FC 1TJHL 4PGEB 1GAFL 1FL6B 2CIIA 5SWZE 5I0DA 1QLFA 4PJAF 2DKUA 5T1MA 4J3SA 5J4MA 2JK5B 2LFGA 2D7PA 5T33H 1KN2H 3PABB 3WLBB 4L4VD 4HDIA 5CBEB 1IQDA 1U95B 5F3HB 1YZZA 5D7SH 4X98B 1J8HE 1F13A 2BY0A 3SQOH 5BMFH 3Q3GA 2G5BA 5E08H 4JKPH 5DXWA 4RMRA 4ODSH 3F7PC 2E7LC 2IAMA 1KT2B 4WW2F 5DJAA 1JPTH 3UBXG 4XNYH 1EGJH 1C7SA 4WU7B 5EFIB 5IFJB 1FIGL 2QQLH 4GQ9L 1II4E 4MMXC 4L3AA 5ERWB 3H7BB 3TO4A 4PJIB 3HE7D 4R3SB 3ULSA 2FWOA 2F9BT 4WO4B 4Y1AE 5JHDB 1HDMB 3T2NL 1T03H 2NY5H 1Q1JH 1LE5B 4Y2DC 4TSAL 5D2NB 4FFYL 2VLLA 4JAMA 2LU3A 5EOCL 4OZHF 3VFVB 2ZOLB 4PJXA 2DTML 1G9ML 2X89A 4KDVA 4PRID 4O9HL 2X9WA 1OAXL 1P2CB 2H45A 3LKRA 5J11C 4AEHH 2EH8L 5HYIA 3T0XA 3FB6B 5EWIH 3BX7C 3OAYH 3DV6B 1PY9A 3SHSA 2GSIB 4Y16A 3KYNB 3SDXE 1YNLH 3QFDA 1CG9B 4X80L 2CO6B 3D39B 3IGAA 3M17A 5IF0B 1I85C 4WI8A 5EZIH 3DROA 4K3JH 1A7QL 1FNGB 3WKMH 3GJFB 5DEFA 4H5SB 5TE7L 1I1AD 4QF1A 1Y18A 1RZKC 3LB6C 3M8OH 4CGTA 4KJW