3DNMA

Crystal structure hormone-sensitive lipase from a metagenome library
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
297
structure length
297
Chain Sequence
DTKMDPRDFLQLLKINAEKAEKNLPLDQKRAGMEALCERFPRAEGVELTLTDLGGVPCIRQATDGAGAAHILYFHGGGYISGSPSTHLVLTTQLAKQSSATLWSLDYRLAPENPFPAAVDDCVAAYRALLKTAGSADRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLSPFVDLTLSRWSNSNLADRDFLAEPDTLGEMSELYVGGEDRKNPLISPVYADLSGLPEMLIHVGSEEALLSDSTTLAERAGAAGVSVELKIWPDMPHVFQMYGKFVNAADISIKEICHWISARIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of a novel hormone-sensitive lipase from a metagenome library
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 99
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.-:
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dnmA00
1ZI8A 3WYNA 1TCCA 4DMFA 3IUMA 2AXEA 2FUKA 3BDIA 2BCEA 1XZMA 5I9IA 5LZ7A 1DQYA 1AZWA 5E2IA 3DYIA 4DMCA 5DTIA 5CT9A 5K3FA 2OGZA 1YS1X 4I4CA 1N5MA 4J0CA 3BWXA 3WYDA 5AM1A 2XUHA 1LZKA 1P0QA 5FUMA 3D5EA 2WIJA 1FFDA 3QITA 3V48A 4DIUA 2IX9A 4M0FA 3BF7A 3U1TA 1ACLA 1CUJA 3WWPA 5AP9A 3FBWA 1BROA 4OYYA 3GELA 4UHHA 5CH3A 4ZI5A 2JBWA 4C87A 2VAVA 4TVKA 2VJBA 1N1MA 4Y2UA 2HL6A 2ZVDA 3CCBA 5ALQA 1G66A 2WJ3A 4WJLA 4KRYA 2WHQA 4Q3KA 3RK4A 1ETHA 3STVA 2JGMA 4BRZA 1XZAA 1XLWA 4GI1A 5CT5A 2IITA 1ZI6A 2VTVA 1XFDA 1X2BA 2XMSA 2I78A 4BBZA 1N8SA 3HABA 1R4ZA 3WZLA 4AXBA 1GQSA 4BYMA 1SC9A 3R40A 3MUOA 1GQRA 1ZD5A 2VATA 4ROTA 4U2DA 1LPAB 4CIAA 4J3JA 1ZI9A 2HU8A 1FFAA 4OPMA 3BJRA 3DKRA 1UOOA 4QLOA 1H22A 5D3ZA 1HDEA 3UUEA 4E15A 4B9EA 1FFBA 1LLFA 4GEGA 1SOMA 4EB0A 2ZYSA 1QIMA 3IULA 5T4EA 1EB8A 2XUQA 1MTZA 4ARAA 5ALUA 1XROA 4X71A 1J2EA 4OB6A 3S8YA 2WG1A 5JAUA 2DCMA 4H18A 5SYNA 3F8SA 1XZCA 2WU4A 1CUEA 1Y37A 3G9TA 5AJHA 1BEEA 1S8OA 2DSNA 3EQ8A 2HIHA 5CW2A 5EI5A 1L7AA 1T4MA 4G9EA 4BVLA 4YK7A 4IH4A 4H35A 1THGA 4WY5A 5LKAA 1QOZA 3OURA 3D4LA 5AO9A 4LKOA 2AJCA 4BVKA 3BF8A 4H7FA 1XRRA 3PF8A 2HA4A 3FLEA 4UBNA 1CFJA 4IO0A 4WCVA 5CTAA 3WK5A 1JFRA 1E66A 4X91A 4QA9A 3HLKA 1Y7HA 3YASA 4H7IA 5AKEA 3NOXA 4KE7A 2PU5A 1ODSA 3C70A 1YCDA 2DHDA 3LIIA 3I6ZA 3ZLUA 4C6HA 4HAIA 5DWDA 2VA9A 1UK6A 1XZEA 1CUDA 3VISA 3E0XA 5FLKA 5AI4A 5E4JA 3L1HA 4FNGA 4X7BA 1MPXA 3D2AA 4I19A 4GECA 4UBOA 4MEAA 3GBSA 5LIPA 1BU8A 5AM2A 3WLAA 3WWOA 3R3YA 5E4TA 3ESDA 3WL6A 1DX6A 1Y7IA 1P0MA 4CIBA 3V9AA 2XDWA 1W52X 5HK9A 1WHSA 5K3AA 2OAGA 1CRLA 3FLBA 3I1YA 4B0PA 1XQYA 2QJRA 4BCBA 2WG0A 3ICWA 3D3NA 3WK9A 1A88A 1FSSA 4H7EA 1W4LA 4GW3A 2WUEA 3H17A 2J3DA 4H7HA 3QMMA 3WL5A 3BJMA 5IVDA 3R3VA 1XZKA 3K2IA 4MYSA 1EK1A 2H7CA 1E5TA 5LLSA 1JU3A 4BRSA 3C6XA 5ESRA 5K3CA 4WFJA 3AILA 4TGLA 4CCWA 2WKWA 5A7FA 2WHPB 3KD2A 5D7BA 3HJUA 1YAHA 1AX9A 1IZ8A 1H2ZA 5A2GA 4X6YA 1XZGA 1YA4A 4WDQA 5DYWA 5AI6A 2HU7A 4KAJA 3QVMA 4AN1A 2WQZA 1DTEA 1LPSA 4QDXA 5K3FB 2VSQA 1GPKA 2E3JA 1EA5A 4AO7A 4GBGA 4S0XA 1XRNA 3WJ2A 4BZZA 4OB7A 5CH5A 4EUSA 1CUXA 4EZIA 2EDCA 5CURA 5FPPA 3VXKA 3H1BA 4J0GA 1E8MA 1QZ3A 3F97A 3WA7A 3G9UA 4MYDA 4K6GA 1XZFA 3ZWQA 1U8EA 2O2HA 1EVEA 2XQJA 1LPMA 1BCRA 4AMYA 2CB9A 1XKTA 2CKMA 2O7VA 4ZREA 1X70A 4GLBA 2PBLA 3W9UA 4ZGBA 3HI4A 4UHFA 2JGKA 3UUFA 4C89A 1H23A 3DCNA 5C8ZA 1IVYA 4M0MA 4X3CA 3G8YA 3VKFA 4H7KA 2QOEA 3F67A 4F60A 4Y9SA 2G63A 4Y2VA 4G1FA 3D59A 3I2IA 4FBLA 1B41A 5HQ3B 4MQMA 1UKCA 4LIPD 1MX9A 1VA4A 3AJAA 4Y2YA 3PICA 3WIOA 3DLTA 5DNVA 5T4BA 3C8HA 1ZIYA 4E14A 2WTMA 2JGLA 3BXPA 4KE6A 4FDMA 1AURA 2BKLA 2HU5A 3TJMA 3IIIA 1TRHA 2ZJ6A 1IMJA 1YASA 3I6MA 1LNSA 1LPOA 1CUWA 2GZSA 2Z5GA 4EY4A 3BIXA 2PSHA 2CZQA 4Q3LA 5IVKA 4JYMA 1CEXA 1BN7A 2X5XA 3EQ7A 3MUNA 4TPKA 1OILA 3ESBA 1TCAA 3G9XA 1Z68A 3FSGD 1SCKA 5AICA 5IVIA 2WG2A 3KWFA 5AM3A 5FRDA 5HF5A 2C5FA 3AZPA 5BWCA 2WIDA 3I1IA 1QIKA 4EY8A 4L3WA 1WB6A 4BB0A 4B7ZA 1QTIA 3O4IA 2X76A 4BZWA 2PUHA 1ZJ5A 3FAKA 2HFJA 2QR5A 4C88A 2HA7A 1ORVA 2BUBA 5T4FA 4Q34A 1DINA 3R3XA 2OPHA 3RLIA 1Q0RA 5JATA 3OM8A 3H1AA 1W1IA 1NX9A 3FVRA 1FFCA 3O4HA 5EHNA 2V96A 4WFKA 2H9YA 1DWQA 2QMQA 1WM1A 4LYDA 4FOLA 3FVTA 2WTNA 2RAUA 3I28A 3NUZA 1QO9A 1VA5A 4QLAA 3M83A 5A7HA 3W06A 2CUTA 3FYUB 3W05A 3HXKA 4XX1A 4HZGA 4B0OA 1TCBA 4CFSA 4LYEA 5A6VA 1AQLA 4BDSA 4KEAA 2K2QB 2ACKA 2OCIA 4UBKA 3ZV7A 1USWA 4J0HA 5E4YA 3EIOA 3STTA 4Y2QA 2HM7A 4HTAA 3Q0TA 4UUQA 3JW8A 4J7AA 5AIBA 2XT0A 5IVHA 2JGEA 1QFSA 1CIJA 1EI9A 4Q05A 3WQHA 4DMKA 3W9BA 4EHBA 1LBTA 1VKHA 2JEYA 1YR2A 3WWEA 2GYVA 1UK9A 3GZJA 4B81A 4BAUA 2HA3A 4RNCA 4HRXA 1WCYA 2B4KA 3HZOA 4C01A 2FJ0A 4UBIA 4PSCA 4Y2RA 2VJCA 5C7YA 2CBGA 4DNOA 3A70A 2VF2A 1ZD4A 2HA2A 5JZ9A 4BVJA 4X00A 1NU8A 2BUAA 2XUKA 3WK7A 3EF3A 4CG2A 3HACA 2XMQA 4P92A 2D5LA 3FWHA 1XQVA 1EB9A 1QIGA 2DR0A 5JARA 4RPCA 4H7JA 4EBBA 2WFZA 3QZUA 1K8QA 3I6YA 3C6ZA 2R11A 3G0IA 3QH4A 1WOMA 1VJ5A 5HFAA 4FFWA 3R3ZA 3W2TA 1WPRA 3WKCA 1I6WA 3DQZA 2QUBA 1LPBB 2HDWA 2J3QA 1EVQA 3N0TA 3ED1A 2O2IA 2HA5A 5KREA 2RIPA 4AZ0A 3O9VA 1VLQA 2XUGA 2WUDA 4XJVA 5AIAA 3LP5A 4GHWA 4M0EA 4BTLA 5JALA 2J4CA 3H2IA 2XLBA 3DOHA 1R50A 2PX6A 2WFLB 2JGIA 1UOPA 1ZOIA 1JJIA 2QZPA 1OCEA 4K5QA 3D7RA 4L9AA 1D07A 1MAAA 5K5EA 2QXTA 2OG1A 1QIJA 4MJ3A 4QDOA 3G02A 1BRTA 1CLEA 4KACA 1XKLA 1BEZA 3E3AA 1EDDA 4MWTA 4DTCA 5ISMA 3IB3A 3PFCA 4WFIA 3ZLVA 1LPPA 3R0VA 1XRQA 5KWIA 3DL7A 3N2ZB 3GUUA 2XMZA 3I2JA 3BL8A 4X6UA 3VJLA 4X85A 4FLMA 4FWBA 2WIFA 2ZSIA 4U2EA 3TRDA 1UZAA 3M81A 5KWJA 1VXRA 3HYSA 1DU4A 4G8BA 4ZRDA 1U2EA 1GPNA 5ALOA 1M33A 1XRMA 3W04A 1LBSA 3VJKA 4CG1A 3X3HA 1BE0A 1QIDA 1R9MA 2XUIA 4Z49A 3PI6A 2CMFA 2DHCA 3K6KA 1CUBA 4B82A 2PKYX 1JJBA 5HKAA 1Q84A 2D0DA 3DKKA 4BAZA 4H7DA 3T4UA 1XQWA 2CEKA 3DNMA 5EGNA 4E11A 2DHEA 1J1IA 4HXGA 1PJAA 2WU3A 1CUZA 4QWWA 1KEZA 1U4NA 4OU4A 4U2BA 3R3WA 4UBJA 4INZA 5AKYA 1G5FA 1L7RA 4W1RA 3BDVA 1EHYA 2OQVA 3V1LA 1E3QA 3QMWA 3GROA 5K3DA 4UPDA 1ODTC 5AK6A 1AUOA 1O6GA 4JYPA 4W63A 4Y2XA 2C0PA 2P8SA 4HRYA 2C7BA 1FJ2A 4PF1A 7YASA 1UWCA 3L1IA 3FOBA 2JGJA 2GBIA 3OG9A 3L1JA 2UZ0A 1DT5A 1UKAA 2RHWA 4WDRA 4EY6A 1PFQA 2V98A 1ISPA 2BGRA 2G5PA 5ALJA 2CJPA 3HEAA 3WL8A 1W75A 5HQ3A 1ZGCA 4X95A 3LLCA 5C81A 4HS9A 2XUOA 1EINA 4HVTA 3U0VA 1O6FA 1YAJA 2C58A 3FNBA 4GXNA 1XRLA 2H7YA 2QJWA 4AO6A 4E46A 1QGED 1MNAA 3CN9A 3DEAA 1CUSA 4LHEA 3DJYA 1AKNA 3WKBA 5LYYA 4NS4A 5C8VA 4BP8A 1K6EA 3AIMA 1ZICA 3KXPA 3QYJA 3RKSA 5ALGA 4EA6A 4G9GA 5AM4A 1LPNA 3FYUA 3D0KA 4P93A 1H2XA 3UMJA 5YASA 1CUYA 3MGAA 2H7XA 5T4HA 2PVSA 4IH1A 3FSGA 5ALYA 1IUNA 3STYA 4Y2SA 1GKLA 3GFFA 4UBLA 5FOQA 3H18A 4O08A 1T2NA 3RM3A 4K6KA 3A6ZA 2BFNA 5AK4A 1GT6A 2FX5A 1HLGA 2H1IA 1YS2X 4KAAA 4MQLA 2OAEA 5LZ5A 4OSEA 1RYYA 2X8BA 5FPQA 4AB1A 1Q83A 4FLFA 4OCZA 4OUKX 5ALRA 4NZZA 3PUHA 4MXDA 3V1NA 3PUIA 1A8QA 2I03A 1CQWA 3TGLA 1R1DA 4Q1VA 3WKAA 5EHQA 1JI3A 3WA6A 1E8NA 4KJXA 2B9VA 1JT2A 3PF9A 1WB5A 4W1SA 4DMHA 1N5RA 3JWEA 5AI0A 5DJ5A 1XRPA 3Q8WA 1R88A 4QE3A 2ZYIA 1G4HA 5AI8A 4B6GA 1B6GA 4LXIA 2RGUA 4X94A 5FXMA 2BGNA 5BV7A 1AMNA 1W76A 3H2KA 4QZVA 5SYMA 1HPLA 3WWDA 5JAOA 1W6RA 1VZ3A 4B9AA 2PSFA 5ALNA 1IUPA 1EX9A 4K6HA 2WILA 3T52A 2XQGA 4G5XA 3DOIA 2XUDA 3IUNA 3JYHA 2O2GA 3LIPA 4F21A 2PU7A 5ALWA 4G4IA 3DDUA 4Y7DA 2PM8A 4N8DA 5HKBA 2ES4A 4LXHA 1GKKA 5EHZA 4ETWA 1CUHA 1DT3A 3QM1A 1EDBA 2Y6VA 3CXUA 3I2HA 1A8SA 2OGTA 5DNUA 4ZWNA 2XB6A 3PFBA 4BCDA 2AJDA 2XI4A 4YX9A 2GBFA 6YASA 5JZSA 1GXSA 2EDAA 2BJHA 2ZSHA 5ALPA 2JEZA 2XUAA 4F0JA 3O4JA 4YASA 3V1MA 3I2FA 5EHXA 4Y2TA 1PV1A 2OCGA 1SCIA 2QM0A 2QRUA 1MO2A 3HC7A 1TKRA 5HFNA 3WK8A 4XIIA 2WIKA 1CR6A 1ACJA 1QIIA 4WY8A 4JH0A 5AKKA 1EDEA 2IIVA 4W9RA 4G4JA 4MEBA 3QPAA 2XQFA 3C5WP 3WWCA 3EQ9A 1CUFA 1F8UA 4PQEA 3SK0A 4QEKA 1LGYA 2WUFA 1YB7A 5AKJA 3E4DA 3BIWA 3ILSA 3PDCA 3A2LA 1ZD2P 4BDTA 4ZV7A 2VJDA 4BP9A 2ZJFA 4FHZA 2QT9A 4U2GA 2ROQA 5AKLA 1K63A 3KSRA 3WKDA 2AJBA 3M82A 2QVBA 3NGMA 1QIEA 2PPLA 1HKHA 2QTBA 2Z8ZA 2VQ6A 2AJ8A 1R3DA 2WHPA 3FCXA 3DL4A 3LS2A 3G0BA 2QS9A 5I7UA 5ALZA 3PE6A 1JMYA 2C5GA 5H3HA 2PUJA 3IUJA 5LZ2A 4UFNA 1H2YA 1IZ7A 3H2JA 4KR0A 1QE3A 1CV2A 1E8DA 1XZHA 3ESAA 5AOAA 3H04A 1MAHA 4J0IA 5A62A 5HZGA 4DNFA 3HRHA 1VOTA 4DM7A 4J0DA 2WJ4A 4AZ3A 2GBGA 5FP0A 4BC0A 4GDMA 4UHCA 3WL7A 2HA6A 3FYUC 2HHAA 2V97A 2Z3ZA 3H0CA 5DYYA 2C0QA 1VE7A 5JANA 5ALKA 1X2EA 5J3JA 4HXFB 3FLAA 5HF6A 2Z3WA 3NWOA 3ANSA 5ALEA 5LZ9A 2ECFA 1DWOA 5JIBA 4W1QA 2WJ6A 1TQHA 5CXXA 2XMDA 2ACEA 1C4XA 1QFMA 4BE4A 1BCSA 5EFZA 1SFRA 5D3KA 5AOCA 4BCCA 1Q0ZA 2W22A 5EIAA 3AINA 5AOBA 4B85A 3OTQA 4OD0A 5AK5A 5F4ZA 3B5EA 2HFKA 4QDZA 2ORYA 4L0CA 2J4FA 2YASA 4BE9A 3G7NA 4Q3OA 3AIKA 5JAPA 4FMPA 1R9NA 1XZLA 2VEOA 2BAGA 1QONA 3QBJA 3WIBA 4RE6A 3C5VA 1IUOA 3STXA 5ALVA 1GPLA 3D2CA 1TAHA 3I2GA 3OOSA 1UK8A 4KAFA 2PSDA 1A7UA 2WHRA 5A7GA 4C4XA 2OXEA 4L72A 1XZBA 5ALDA 3G0CA 5LP1A 2XQIA 5EIHA 1QTRA 3SC2A 3P2MA 3IBTA 4PW0A 5AK3A 5AKGA 1U65A 2I3ZA 2HRQA 3H19A 4H0CA 4DNQA 4QNNA 3AZQA 4DLNA 4PSDA 4J03A 2W6CX 3IA2A 3WK6A 3IDAA 2VT7A 3ZPXA 3C87A 3ICVA 4XWGA 4CG3A 2G5TA 1K5PA 2XMRA 4C4YA 1DWPA 2ZJ7A 2I3DA 1AGYA 4DNPA 5IH7A 5JYCA 1P0IA 4KYVA 3R41A 2XMBA 4UHDA 1RP1A 5CRIA 2OGSA 5JAHA 5KBYA 3A2NA 1YA8A 5CMLA 4N8EA 5ALSA 1VE6A 2GYWA 3KDAA 3F9CA 2FJPA 1XLUA 5ALHA 2O7RA 2XMGA 5IKXA 3QPDA 1CUIA 1XZIA 5ALFA 4PV7A 3I2KA 3AIOA 4AQDA 3VJMA 2XQKA 1ODCA 3ZLTA 5ALMA 2RHTA 1CUGA 1UOQA 3F96A 1MX5A 1CPYA 2XMCA 4X92A 1P0PA 1XZJA 1EK2A 4DSAA 4OU5A 1XZDA 1SCQA 1AC5A 4X97A 1JMKC 3ANTA 5AKXA 3O4GA 5AKHA 4C4ZA 2XUJA 3DYVA 4RGYA 5DYTA 3STUA 3KOOA 2B20A 3H2HA 3TEJA 3B12A 2YXPX 3CCCA 1MNQA 4Y2PA 4PSUA 2ZYRA 4OB8A 2PL5A 3IVMA 5JASA 2GZRA 2QXUA 4EY5A 3WI7A 1THTA 3G9ZA 5HF9A 4IH9A 5DTJA 3C6BA 4HXEB 5D6OA 4AO8A 4B80A 3WK4A 1DX4A 2XLCA 2HRRA 5CT4A 2DQYA 3G0DA 3MVEA 2Y2UA 1UFOA 2EEPA 3OPMA 1BN6A 5ALTA 3C8DA 3CN7A 3STWA 2WLSA 1VZ2A 1QIFA 1UXOA 3AFIA 1TK3A 2ONCA 1MU0A 1CUUA 1DQZA 2Q0XA 1ZJ4A 1JJFA 4IHAA 4G4GA 3F98A 1A8UA 2Z8XA 3D2BA 4I3FA 4G8DA 3B3QA 4P08A 3V1KA 1EXWA 3AUKA 1MN6A 2WM2A 3R3UA 1CQZA 5AKZA 3C6YA 3O9MA 5LZ8A 1G42A 1BS9A 3QPCA 4DYHA 4UFPA 4BATA 5C8XA 3FCYA 1CUAA 1FFEA 5ALLA 1YB6A 4Q82A 5DNWA 3QMVA 1WHTA 4AN0A 1QLWA 5HF8A 1H2WA 5ALXA 1EH5A 4FTWA 4A23A 4Y2JA 5FDFA 2Y1KA 1CUCA 1F0NA 4G8CA 2C4HA 1HL7A 1TIBA 3WZMA 3SWWA 2JF0A 2G4LA 4B83A 4U2FA 4IQ4A 5CH8A 2PSEA 1WB4A 4MWSA 2HA0A 1VXOA 1UT6A 4RE5A 3SX4A 4ZV9A 5K3BA 1MJ5A 1ZD3A 2GYUA 2AJLI 3C43A 2QKYA 3FYTA 2YYSA 1L7QA 1OXMA 2OQIA 1CVLA 4LXGA 5JZBA 1K4YA 3C45A 1QO7A 1RWQA 4BTVA 4F5ZA 4P9NA 5JD4A 4JUIA 2JGFA 4B84A 3RARA 3IURA 2XUPA 4JNCA 4AX4A 3IUQA 1XLVA 5BOVA 2RONA 3BE8A 2JIDA 1MX1A 4FLEA 5FKJA 4N5IX 5AM5A 4KE8A 4NMWA 3E1GA 4PNZA 1HBJA 2WIGA 2NW6A 4KE9A 5AI5A 3EBLA 5AI9A 3VVLA 1WPXA 4DGQA 2BUCA 3A2MA 4J0JA 2WFMA 1GGVA 1NU6A 3M3DA 5EIEA 2PSJA 4UHEA 5JD6A 4X93A 3DS8A 1F6WA 2GBCA 1JU4A 4V2IA 4JEIA 1MT3A 1JKMA 1KU6A 1ZIXA 2OLEA 3HSSA 4K2AA 1LZLA 4CI9A 3GA7A 4U2CA 5ALIA 4UFOA 4QDTA 5A71A 1J07A 1HQDA 5CXUA 4UBMA 4CCYA 4DSZA 3OC0A 4QDUA 5FV4A 3G0GA 4A5SA 3K9BA 4D9JA 5LZ4A 1C7JA 2Y6UA 5CBKA 2B61A 4A16A 4ARBA 2OCKA 4FBMA 2ZYHA 4QWMA 2DFPA 4N5HX 4ZXFA 5CT6A 1E89A 2Y2VA 4BAGA 4BC1A 4N8SA 3H2GA 1UKBA 3VVMA 5AH0A 4UHBA 5AM0A 2XUFA 1UK7A 1ZGBA 5I8PA 4H77A 4AMZA 2VJAA 4FKBA 1C7IA 5DLPA 4FNMA 5CT8A 4X6XA 3KWJA 2WFLA 3WMRA 2YH2A 5HK8A 1J06A 4XVCA 5AKIA 4OYLA 2DQZA 4W1PA 5K3EA 3AZOA 5LKRA 5AHXA 3O95A 5BWBA 3WKEA 2HADA 2XE4A 5JD5A 2V9ZA 2VAXA 4YPVA 4X90A 2WSLA 3LCRA 3O0DA 2QUAA 2WUGA 2LIPA 3ESCA 3VDXA 1XQXA 1YSCA 2R8BA 1ORWA 1CUVA 4CCYB 1F0PA 4FFVA 2VT6A 4J0KA 5JADA 4NVRA 3ZI7A 2RI6A 4ITVA 2OCLA 3DD5A 1QIHA 4EY7A 3WJ1A 5HCUA 1GZ7A 3S2ZA 1KU0A 4GWLA 1QJ4A 4KRXA 4PO3X
chains in the Genus database with same CATH superfamily
2GUGA 5EMLA 4KQKA 1ZI8A 4PM4A 5KTNA 3WYNA 4F97A 1TCCA 3I01A 5FI1B 3RO7A 2B4RO 5ERYA 1L5QA 3JYNA 2O57A 3NVAA 4WASA 3DE4X 4ZVUA 3EEOA 2IS2A 1SM4A 2Z9DA 1NRWA 4KGVA 3KVRA 1BD4A 4Q9KA 2FUKA 5FA8A 1X92A 5I5EA 3KTAB 3GEIA 3BAZA 4C0AC 2PD6A 1FS5A 3URMA 1UM8A 1FXWA 1GVNB 3DBRB 1YK0A 1KMCA 1T8SA 1CETA 3LVQE 4OJYA 4QJ3A 1RKXA 2F8TA 1DQYA 3MTJA 2QQGA 3W5AA 2WINI 4UNIA 2IPNA 1H2AS 3UKOA 3C1UA 4GI3A 4R98A 3OQIA 2CF5A 4BVAA 4OXRA 4BWYA 4HDAA 5CT9A 4YR9A 5LLDA 4G4SP 1YS1X 3DWGA 4I4CA 1MRZA 4MVJA 4MIEA 3UK7A 3NETA 4J0CA 1BW9B 4R1SA 4JZKA 4QO8A 2C03A 2MWMA 3QLJA 4FFSA 4W8OA 3DZDA 1IY1A 4QU9A 1VJRA 3AFHA 4QQNA 1K89A 1P6UA 5IDYA 4OHFA 3RK1A 3FCOA 1RKVA 3BWXA 2JIQA 2FPIB 1NY6A 3TQHA 4AP5A 4JT9A 2XUZA 3IS3A 3Q1LA 5AJZA 4N3NA 5H70A 1ZNXA 3SLRA 3G2OA 4ZI7F 4X1KB 2J5QA 4QRIA 1MOPA 1Y81A 1T5OA 3PR3A 4RQBA 2JANA 1X9GA 2IOYA 4LDJA 4ENTA 2ZPUA 1FFDA 1NUAA 1I10A 1TJ3A 3D5TA 4DZRA 1NJSA 4DIUA 1UBFA 3FKQA 3PC2A 2VHTA 3BF7A 4HDMA 1ACLA 4EPRA 3WWPA 4ALIA 4N47A 1CF4A 5BQFA 5AP9A 3ZU4A 1BROA 3GELA 4BASA 4DC9A 5IZCA 1G17A 3CVOA 1T3LA 3TLMA 1APBA 2IA5A 1Z4JA 2JBWA 3JPYA 4KXQA 4V38A 1CC1S 1OROA 1I51A 3FY4A 3D43A 2VJKA 3ERCA 4JI6B 2QZSA 4PZYA 1D8AA 2QTMA 4TVKA 2JFZA 1CDEA 2PS3A 4JJAA 2WJHA 2EWWA 1TB4A 5JPCA 1ORRA 2H4YA 3N39C 4TVSA 3OKCA 3NNNA 1W88A 2ZVDA 1OXXK 1A9SA 5A4IS 2YIVX 1S4QA 3GAMA 4FB5A 1EFTA 4CM9A 3BQMB 2WJ3A 3ZHYA 3KZVA 4F71A 4H1TA 5FLXA 2VDLB 4AS1A 2M2IA 3BC1A 4HB3A 4MI6A 5E1DA 3RVRA 3BH0A 3I0NA 4HQOA 5FL3A 4CM8A 4GI1A 2HMAA 1M76A 2RBEA 4FNAA 4XWTA 2V4UA 3CX4A 1X7ZB 1NXPA 1ECGA 3K3PA 3O83A 4OLBA 2HHLA 2GSWA 3BN3A 1TA9A 2JH9A 3B7GA 1C30B 4Y18A 4E5NA 4EHLA 1AUPA 2YOFA 1I9CA 2YXEA 1QHHA 4L5CA 1DL5A 4W8GA 4HTFA 1BX3A 2ZKLA 5IJ9B 3BIJA 4RD1A 3QLVA 2QTVA 4BYMA 1YHZA 3KHKA 3R40A 4Z8YA 3U44B 3UXEA 1WCXA 5JS1A 1GQRA 1C4OA 1UJMA 5EE1A 3C5HA 1YF3A 1ZW6A 4EJ0A 3MCUA 3HL0A 4ESEA 1YGYA 3WGUA 4CIAA 4I1PA 1PT9A 4EYQA 1YQGA 1DBQA 4JD5A 5EMNA 1S4MA 2VP5A 2W2TA 2WM9B 2CSXA 1VDMA 5IBPA 2HRDA 4C30A 3VSAA 4ZAXA 2CXNA 3H5RA 3MS2A 4OPMA 4TLLB 3MUFA 2VKQA 2QUIA 1Z6PA 1OLSB 2VJYA 4NEHB 4BQIA 1DXQA 3N3AC 1Z9BA 4H6VA 5FPSA 1UOOA 4QLOA 3Q6IA 1H22A 2C1EA 1VKZA 4JLNA 4N0DA 3TO5A 3X2SA 4WOPA 1LLFA 3ZZ1A 4YJGA 5CG2A 4BLTA 5LCXA 3M6UA 3U4IA 4M9CA 5LQJA 2ZYSA 1X39A 2AXPA 1KRHA 3ZW8A 4C07A 2VWGA 2DJIA 5JHGB 5ICGA 4A1FA 2VC2B 3IP7A 4KFTA 2I7XA 4UAJA 2PD3A 3WSTA 2M32A 5BT8A 4JHXA 1DKPA 3JAWB 1SIOA 2JS7A 2C31A 3Q9LA 1I5RA 4A0QA 2AOWA 1RRVA 4XM0A 4DA0A 2H9AA 1J2EA 2AOTB 3WP1B 2WG1A 4OI0A 4TKVA 3C15C 2AK2A 3RT7A 3WSWA 1E4OA 2JATA 1XI2A 2XY4A 3FPCA 2G9ZA 2GPBA 2WU4A 3N2NA 4Y98A 3VHLB 4B35A 4LJ4A 3HJHA 2P2NA 5I7SA 4NBNA 1G2IA 3A7EA 3ESYA 1ULSA 3ZWNA 5CLFA 4OUDA 5I9TA 2DSNA 4C4RA 2YRWA 1QBKC 3ETNA 2HIHA 2F1JA 3UWKA 1L7AA 3KTDA 3RLFA 1GQYA 2GK3A 2OFOA 3I05A 3OU6A 2WBLC 4G9EA 4P58A 1ISHA 4XVQA 5AVOA 3HVJA 4YK7A 4IH4A 3PX3A 3TR5A 3UW1A 5KAMA 2YRFA 3DV0B 5D5HA 3SEAA 5KOYA 3DPIA 4BO2A 2A5LA 1XMOB 1ZGJA 2D5CA 3MZ0A 2IOHA 4H35A 1L9XA 4R84A 4HNSA 4Q93A 1Z33A 4HWTA 4DVGA 3DZHA 5IAEA 5AO9A 4YONB 2EJUA 4JBYA 1J8FA 2IYPA 1ML3A 5BSRA 4BGEA 2ATEA 2XPCA 1BJKA 3L77A 3SIWA 5AHWA 3MBOA 3PNPA 1DBSA 4CEIB 4H7FA 2YXBA 3G82C 5KJEA 4B4OA 4ARBA 2Q4EA 1AD2A 3LXUX 4L02A 4YWHA 4U7FA 1DAHA 4F92B 4UBNA 5G0SA 5TMPA 1N8TA 3CVJA 1ZM2A 4WCVA 2P5TB 3D4IA 3IMEA 3EA4A 2J9XB 3F7OA 3N6VA 5CP8A 1Y3HA 1U8UA 2AVNA 5CFRA 3KVOA 4DV4B 2ZJ1A 1DUIA 5AKEA 5B64A 3NOXA 4KE7A 3MGKA 2BEWB 5GWXA 1NGSA 1XU9A 1ODSA 3OE7D 1YCDA 3QFTA 5DGIA 1HMPA 2I0FA 1G7SA 3CO5A 3LIIA 4QVKA 5D2CA 3P0JA 3FPAA 5BSFA 4XR4A 3VR6D 4JYBA 3NRJA 4C6HA 2PUBA 3IEVA 3ZCQA 2NZWA 4MYRA 1ZXXA 4J1TA 2VA9A 3TB4A 5L40A 5K51A 1RKUA 1CUDA 2J7PA 5AI4A 5E4JA 4IICA 3RRJA 2IC5A 2F3QA 1IEVA 2JZNA 4JYCA 2ATVA 4Q6BA 5DSZA 1KDVA 3FIJA 1Z7WA 2FZKA 4CLEA 5I8WA 3IE1A 2XD9A 2XCOA 2L0XA 5A0VA 2V65A 2YWXA 4X7BA 4EZBA 2W93A 1A82A 1UODA 3P9ZA 2H0RA 3ZS8A 1W0KD 1NKSA 3SYMA 3GBSA 4DSUA 4RIGA 3Q72A 2IUYA 2GPNA 3GQVA 4J7CA 1T6ZA 4UZEA 1M1YA 3R7WB 1BU8A 1NURA 2E82A 4TYWA 2G80A 4I9GA 1OXVA 4ENQA 4HBZA 1ESEA 4K8RB 4LHVA 1P81A 2RJ3A 4JJZA 1U5BB 2YRXA 4X8LA 3BXZA 1NPDA 2CNKA 4E0BA 2E4AA 4LF7B 1J8YF 3EVBA 4LMAA 3NBMA 1DX6A 4FFPA 2JGDB 4L1KA 1P0MA 4CIBA 1VI6A 1Z34A 3V4ZA 4QXOA 5JNRA 3JASB 1CWUA 1JQKA 5C5CA 3ISVA 4RK4A 3SOZA 3V9AA 3ZIDA 4HAWA 3F6CA 2FPPB 2F1OA 2C7RA 3DTVD 1JYSA 4AJLA 4C4AA 2Q3FA 3OY2A 4H9GA 3DL0A 4XDGA 3U3DA 1HY3A 3OVMA 3GLUA 4EYEA 3TRFA 2IXDA 1OX4B 1E3TA 1VG8A 5DIFA 4HWRA 2QJRA 4ODIA 4B0PA 5TIIA 1CJVC 3D3NA 3WK9A 3V8NA 1GGEA 3GZNA 4QPPA 3LY9A 1AS2A 5H3CA 3SSMA 2J08A 1EBUA 1U7TA 1W4LA 4L50A 2RGRA 2OORC 4KR7A 1IXKA 4GW3A 1PZMA 2DKOA 1BO6A 2WUEA 3VZBA 1K8ZB 4OHBA 4UTVA 1C9JA 1T2FA 1TK2A 4GRIA 4Y6QA 1T8TA 3QJGA 3FZYA 3NTQA 4H7HA 4YWJA 2ZSDA 5IC6A 3V46A 1UIMA 2YVQA 1EK5A 1JHPA 2FUEA 5IVDA 1T9AA 1W8IA 2Q5JA 3GJXC 4Q03A 3NNDA 4YMSA 3S68A 3ID6C 3TNLA 4MYSA 2IHVA 3DQPA 2H7CA 2ZUEA 3GUVA 1E5TA 2FDXA 2O2YA 1JU3A 4AXXA 5IK2A 1NDHA 4L78A 1DIAA 4L9WA 5HUHA 2YY7A 1LSUA 3C6XA 3U3XA 2IYQA 4JP1A 3DKIA 5K3CA 5AVTA 4WFJA 1RAHA 2QLMA 1YMQA 4JBGA 4TGLA 1M3SA 2X0EA 2WKWA 4CCWA 1NNSA 3OJCA 3QVTA 1YZHA 8OHMA 2GXAA 2XNSA 2BHRA 3A9WA 2HZ7A 1CB0A 4TMKA 3UOAB 3A05A 3PQDA 4R0VA 2KWIA 3W5JA 3THXB 4D41A 2NUPA 2XSZD 1VLVA 1H2ZA 3M9WA 2O3UA 4KH0A 2VDKB 5IF3A 4LF4B 4OL0A 4G0WA 1VIDA 4QGAA 1DTSA 5BVGA 1ZYUA 5A1TA 3CW2A 2YW2A 4YFVA 1Z2DA 3OFND 1KMQA 2XB4A 2X2EA 2CNOA 2ZYDA 3FUTA 3T34A 3W90A 2P3SA 3T7DA 4Y8VA 1U2RA 1GUBA 3C3XA 3QE9Y 5G40A 1PBTA 3TQIA 3TWOA 4MHTA 3F90A 3ZWOA 4GR9A 1T4CB 1H3NA 2H3EA 5KJ6A 1CX9B 2PPVA 3KSMA 5H02A 5CCEA 2NYRA 2Q99A 3JQAB 3THWA 1H9AA 1IJEA 1V5EA 1FZQA 2BDEA 1HLDA 3WIEA 3GHYA 2HCBA 1CE8B 3EGXB 4LRSB 3W9YA 4ZJUA 3JASA 4CKZA 2E3JA 1D1TA 2AL7A 3PHGA 2YDXA 5IBRA 3RFTA 1HORA 3COJA 4N0EA 1YBMA 3QKIA 1C1YA 4XDZA 5TNXA 3IDSA 1VSVA 3DBHA 4OB7A 5HOQA 3MLAA 1MQ9A 2VI5A 2PAAA 5A9TA 5JBNA 2BELA 2EDCA 1MC4A 5A4FS 3FWZA 2BEWA 3HGQA 4R05A 2QZ9A 4NR0A 3A6GA 4GMFA 5CURA 5E1BA 5FPPA 4ARZA 4ARUA 1Q5PA 4TRRA 4XJTA 3OCZA 5F7ZA 2D6FA 5DYNA 5HUQA 5L3QA 3F97A 3WA7A 3G9UA 4MYDA 4OQNA 4DVJA 8LDHA 1INLA 1RHJA 2Z57A 2QORA 1S7GA 1K9SA 2O2HA 4WCFB 1EVEA 1ZGZA 3FB4A 3WZ2A 4Z1OA 5ENVA 2C7QA 2OFWA 1BCRA 2W00A 3UXHA 4LDPA 3QLTA 4LOLA 5HCNA 3HO1A 5DE3A 1QP4A 2G88A 3EWAA 3T6KA 1VMKA 3F8WA 3NWBA 1L1EA 3HS3A 4MO9A 2XTMA 1A3CA 3PUWA 4GLBA 3DLIA 1Y6GA 3W9UA 4TKZA 3HEBA 4PU0A 4ZGBA 4ESVA 3HI4A 4KHZA 1UMBB 1YB5A 2EKLA 4FFMA 1D2RA 2QW8A 4UHFA 1NN0A 4YBRA 5F3WB 1Q7EA 2GPYA 3BFVA 3VBCA 2OV1A 5KHAA 2A30A 4Q39A 2XECA 4DV0B 3RRBA 1ETUA 1FP2A 2PR2A 2BN4A 3ED5A 1DKNA 1R6VA 2VVTA 3EIUA 1FCJA 2ZFUA 4UM8B 5TB5A 4L7VA 4D96A 1JFVA 1U2PA 1VMIA 3G8YA 3IL2A 5CITA 2PCJA 4H7KA 3WNDA 2E48A 2QL5A 4K46A 1XD2A 1HE5A 4FC7A 4KXLA 1ZCAA 4D3FA 3ZDBA 4RIFA 3H11A 3LZ6A 3PXDA 1XNQB 1B41A 1CY7A 3TR6A 3U4MA 3HYLA 1KOGA 3ZXYA 3GRCA 1MX9A 2GJ9A 3ZHQA 3HSYA 3MWEA 4Y2YA 4D4IA 2JCSA 3ZDXB 2D4AA 1NXTA 1UP7A 3PICA 5ITWA 4EUNA 3NC1C 1XJCA 3BSFA 1UFQA 5T4BA 3QEAZ 1ZG3A 3RIYA 2Q07A 3SKYA 3ZI4A 1NI4A 3JQPA 4NCAA 3ETGA 4AKSA 3GK3A 3FSJX 4P2GA 1AURA 2IXGA 3PHLA 1RI5A 3ELDA 1DJOA 5BW4A 1B00A 2MU1A 3GLHB 4NJMB 2B8TA 2HU5A 2JKVA 2NU9A 2Q6LA 3B70A 3HU5A 3IBCA 4D3YA 5IN4A 4Q3NA 1AV7A 5ECYA 3U1BA 3ZCRA 1LNSA 3MWEB 4AX8A 2LW7A 2Q9UA 2X8AA 1L7OA 5AXCA 2XOKD 1I8TA 2HBYA 1IWPB 2PSHA 2ZWAA 1TJPB 4Q3LA 3T1QA 4G5HA 1KH3A 5CJPA 3F3SA 2H8GA 4ENRA 3E9EA 1WF3A 2NP6A 3UK6A 1FZTA 1OILA 4D4GA 4BNVA 5BYAA 1OZFA 2IVZA 4MA4A 5JSFA 1HFEL 3A9RA 2KJQA 2QTCA 3G8BA 2HGSA 4GVLA 4MEJA 4OBEA 3HLYA 4FQ5A 5H7XA 2QG4A 5DI9A 1S1MA 5D00A 1GT91 2IXBA 1KAOA 2PGOA 4PINA 5AICA 5ES3A 2FPGB 4ZT7A 2R00C 1EGAA 3SBEA 1QORA 5E9WA 3ULKA 3QOXA 1GTMA 2P2LA 4DARA 2VRCD 4F11A 5KHLB 4RTMA 4Y67A 3EXG2 4X44A 221PA 1GRQA 2BEVA 2ZVQX 1JBEA 2FETA 4PRZA 5CPBA 2N9UA 2WIDA 4WGGA 1K4MA 3I1IA 4WZAB 4PVDA 4EY8A 5KYTA 4L3WA 2GRJA 4MQ6A 4TM8A 1YDWA 2G07A 3QXXA 4M7WA 5CX1B 2WKPA 5BQXA 5LOVA 5JJIA 3GF4A 4HOYA 2XGJA 1RRFA 1M2OA 1BFKA 4JL6A 3I6QA 1U2ZA 4TYQA 4BJ1A 3C3WA 3JWIA 3I5MA 3KKMA 4NARA 4TSFA 5TLSA 1T1IA 4C88A 2WM3A 1W4RA 1T3GA 4HATA 4ONEA 1ORVA 1IAVA 1NRXA 3H8SA 4XCXA 5F1PA 3VTZA 3CXRA 4XSHA 5JATA 2C2YA 2VAPA 3HPQA 4P84A 4KJZA 2C3UA 3KZXA 3LBHA 3OM8A 4Q1BA 4H1WA 5FTLA 5KVQA 2NVOA 1F2DA 2P9BA 4ZO4A 1O94C 1AKYA 2J7PD 3FVRA 3FX2A 3HKCA 4ZVRA 3CE6A 1EWTA 1OI2A 4YJFB 4F6RA 3SHQA 4D25A 5C4IA 3QIVA 5EXXA 1I3MA 3NCHA 2EHJA 4MVJE 2IH5A 4RSRA 1QP0A 3EMVA 4KQMA 3LUKA 3PVSA 4BFUA 2WJAA 2RG1A 3VU9A 1G3MA 2VHCA 1VPDA 3IT1A 2RGNC 4BO8A 1QCCA 2RAUA 1F6BA 3LT2A 4PIMA 2WTXA 3RUHA 2QAIA 3LWDA 4QOSA 2PH5A 2NMVA 4D9NA 2BM0A 1DSSG 5A7HA 4CV0A 1PG0A 3KPWA 2CUTA 3W06A 4KITB 3LFUA 2R5FA 4RIIA 2I6UA 3T4EA 3PHCA 3W05A 3FUCA 3RANA 1Y3FE 4B0OA 5LMUB 2FUG6 1J6UA 1RACA 2WWIA 3NHPA 4H27A 2XKBA 3FHOA 3H1PA 2ZB4A 4LYEA 5JY1A 1NXWA 2FEMA 3R5HA 4LK2A 5THXA 4FYKA 4BP1A 2GEKA 2VLIA 4CQMB 2PX5A 4Q3CA 3KYBA 4XW2A 3GFTA 4NU8X 4YRBA 1RLUA 4RWZA 4MGIR 1NZJA 2VT3A 1JLMA 3H2BA 4QATA 4RXUA 3WXMA 2PGNA 2XQVA 4PPFA 3FCAA 3LGSA 1L4YA 1NUQA 2FPRA 1KFCB 5FL7D 4C7XA 1KQPA 1USWA 5E4YA 5JSHA 5AJTA 3DDOA 2O1SA 3VZQA 3MM4A 3VA7A 1E96A 1KY4A 3IIJA 1F8YA 3EIOA 7ADHA 3P2OA 5HKLA 3KSBC 5DCUA 4XLLA 3E5HA 3W34A 1NHWA 1AF4A 3HH8A 1K0FA 4Z51A 1R4NB 2WV9A 5DLEA 2HUPA 1MCZA 4JL8A 3UGJA 2I34A 3UW3A 1VGQA 3I6IA 3RJZA 4HYYA 4I7EA 4MCHA 3PEWA 1MF7A 2XT0A 4NNPA 4R41A 1U0FA 3TW8A 2I6QA 5IVHA 3DGEC 3ZEIA 4ZI3A 1IHYA 3K9GA 3HJFA 3E3OA 3GP3A 4RV9A 1E77A 2ZS8A 3ZU3A 2DLNA 4NENA 1EI9A 1TUEA 2R6JA 3VAAA 3BGDA 3VPAA 3WYFA 4DMKA 4BQOA 4TV9B 2ZE5A 4AY6A 3UMGA 3JV7A 2Z09A 4EAQA 2NO7A 3N3BC 4EHBA 2C82A 2BLNA 2AQ8A 5KAPA 1ZQ1A 1NVXQ 4UCQA 1ZESA 3DW3X 2FF7A 3E7PA 4RFSA 2XB8A 3IAS1 3VYUB 1USIA 2FW9A 2V54A 4YB8A 1G38A 5IRCD 1NXXA 3SCZA 3MIZA 2HIMA 4OXNA 2Q5OA 2LPMA 2H5JA 2VZEA 4S24A 4DIKA 5FAKA 3PC8A 2NACA 3MILA 3BMNA 5HRCA 1XAHA 2W2XA 2YWHA 3PXGA 4NABA 1P62B 1YH3A 4HRXA 2B4KA 3HZOA 3OLQA 2NZYA 4IYJA 4RA9A 2PUTA 4C01A 4MJXA 4D5EA 1R4MA 1XA0A 3W2FA 2VO1A 4B4WA 1NA5A 3NHAA 4PG6A 3MBIA 1I7LA 5EWJB 1AUQA 2JK0A 1TEZA 1SWWA 4TV9F 2KE5A 3QVLA 3OLVA 1IM8A 4V0NA 1SZCA 1BKDR 4MDYA 4XDYA 1X7GA 2GF9A 1I24A 4QDKA 3A70A 4LSZA 1W36C 1Y0BA 1K68A 4KR6A 4C9BA 3MCVA 1J97A 4QBHA 1SK8A 2GTHA 2GNOA 3WX0A 3ROGA 1PEYA 1W35A 2BUAA 4TXHA 2RHLA 1JA9A 2DQ4A 4LYHA 2OXTA 3TPCA 2NSYA 3WK7A 2LKCA 3OKAA 4AK9A 2H1CA 2XMQA 4P92A 2VQ3A 2R4UA 4K0RA 5KIAA 2WJJA 4MITA 2E6UX 2QN3A 5DBEX 1M9NA 2DR0A 2A0KA 2QT0A 3IAXA 5LU8A 1NVGA 1N0WA 4H7JA 1AMOA 2MINA 3KSZO 5AW2A 3IKTA 2WFZA 4P0QB 3QZUA 1DELA 4JGBA 3TLXA 2EJBA 4YUVA 1ONOA 1N6NA 1X9IA 2WOJA 2C7VA 1UDAA 3EXHC 3INTA 4F3NA 1RJ9A 4FBGA 2P9ZA 3QH4A 4A0FA 2I2DA 2VXBA 3MIIA 4FFWA 2TMYA 1ZHHA 1U7UA 3OF5A 5C1BA 5CFZA 1F12A 3SX0A 3FHLA 1PS9A 2O07A 3JQAA 3ZNNA 4QBFA 2QUBA 1TM3E 3IR6A 2UUOA 1SVIA 3KPYA 5FI5A 1EQUA 1E4EB 4YJ2F 1SCNE 2HA5A 4WNCA 1Q1EA 1R0WA 3BCHA 1YQWA 2XVMA 1QQAA 1WR8A 4LHWA 1G63A 2B69A 1L5FA 4OEHA 1T91A 3D3EA 4TSKA 2HJRA 3O9VA 5K8TA 4IEFB 5DV9A 3R76A 1C1XB 1ECFA 2PKCA 5AIAA 3PLRA 2IPMA 1GNSA 2YMPA 4GHWA 2O1EA 4XQGA 5DSXA 4M0EA 2QUZA 5B1SA 1V11A 2V5UA 4BTLA 3I9OA 1D6JA 1E1RD 2Q3EA 3SFZA 2GYYA 5JALA 3FMPB 4US1R 2HPVA 2ZRKA 4WVFA 5GV8A 4XDHA 1E7SA 3ADDA 2FZWA 2JJ2D 1NUHA 5L3VA 1A9XA 5AVRA 3H2IA 5AW8A 1HFWA 3QBEA 3EB9A 2MOKA 5FUVA 4MR8B 2RBGA 3ZS9A 1QVRA 1M2FA 3WGKA 4OHMA 4ME6A 1J4AA 1BMDA 1UOPA 1ZK1A 2D3WA 3AEUA 3NBQA 3PITA 4I50B 4TMYA 2W2LA 3S2UA 3GEEA 1QPZA 3ZE9A 4KKXB 4EG4A 3LUFA 4E22A 3DVLA 4GPZA 2BKVA 4L9AA 4RBNA 1MAAA 4MR7A 5K5EA 1JG2A 1T1EA 2TECE 2EGHA 1QIJA 3HKDB 2IV7A 3D5QA 4JI0B 3UPUA 1KVTA 2ZJ5A 4OHRA 4QDOA 4PO9A 3JQ9C 3AHIA 3G02A 3T0IA 4HGQA 1T3TA 2EF1A 2X2OA 4MUGA 4KODA 1DXHA 1DRKA 3G1WA 3PQ5A 4NFLA 1XKLA 2G1JA 3IEUA 3WB2A 2FHSA 5BW6B 3VM6A 5LU9A 5EERA 3UQYS 4RKQA 1WMFA 3KBOA 2Q4BA 4R2JA 1I01A 1IBSA 1Z7YA 2HMVA 2Y1FA 4XI9A 5LWQA 3RU9A 5JWRA 4OI1A 1DNPA 4HMQA 1JHRA 4O0LA 3RSFA 1V8FA 3R0VA 2P6OA 4RY9A 2B2NA 2WSSA 3DL7A 4G84A 4O2LA 4K6CA 2XMZA 2YHIB 4FP9A 4LJAA 3OJWA 3U4QB 3BUSA 3BL8A 3FSEA 3WGQA 4QXRA 4QXAA 4FFBB 4WMLA 2GTPA 2P75A 2QVCA 2FFBA 4DV7B 5TVGA 4KSYA 4X6UA 4TXMA 2AFHA 3KC2A 4FWBA 4L8GA 3FI9A 1KJYA 4U2EA 3WGVA 4LSWA 2HLDD 4B45A 3CJQA 3Q40A 4NP6A 4I3GA 3RGWS 2B30A 3N6RA 5BRJA 4LPSA 1QH8B 5HRUA 4N3BA 1B4DA 4ZRDA 1U2EA 4JELA 1KBZA 3RODA 1Z0UA 1M33A 1XRMA 3W04A 3F6EX 1I4TD 3L8HA 2IYLD 3VJKA 2Z4SA 1OXBB 1OYWA 3VPDA 2ODEA 3X3HA 4RV5A 2XT9A 2F1RA 4HFJA 2WA1A 1QIDA 3ONEA 1DWUA 1T9GR 1SOWA 1NBMD 3F74A 1MQ8B 4MMXB 1TVKB 3O8DA 4Z49A 2CMFA 3K6KA 4WBXC 4R4JA 4NL4H 4DB2A 4WKPA 3OEED 2IQIA 2H54A 3DZ8A 3BSWA 3IP3A 3B1ZA 4I1OA 2D0DA 4K9RA 1P5JA 3DKKA 4GX0A 5FQOA 1N6RA 3L18A 4J16A 1M2WA 4B43A 4BAZA 4KPEC 1OYOA 3GLGE 1X0XA 2HT6A 2CEKA 1Z2EA 3WGLA 3ACDA 4B3MB 4GKVA 3N58A 2VR1A 3RU3A 4CL3A 4U00A 3UWOA 4E11A 5JCXA 1OXUA 2C3MA 2DHEA 3MWKA 1J1IA 1OTXA 3MTEA 4HN9A 4HXGA 4WCFC 4G0VA 1ZMBA 1R5NA 5F77A 4TLEA 1ODKA 2WU3A 1CUZA 5LA6F 2ERXA 5C32A 2I1LA 1PAUA 3X1YA 2A1UB 1NBMA 2HWYA 1XNRB 3AF3A 3TCKA 2P4UA 4TLDA 3DDWA 2FW0A 2HLHA 2IYTA 3MUEA 5BRAA 2FZLA 1OTYA 3G1TA 1M5RA 4IOKA 2H31A 4KUGA 3GRPA 1YZLA 3SYNA 4YCJA 4EJMA 1Z39A 2V59A 3OJXA 1FQOA 4TVOA 4V0LA 1A9YA 4OHUA 2Q3MA 1LBIA 2B4AA 3MHPA 3N86A 4BRWA 4UEJA 1EHYA 2D4HA 2W6IA 4PC1A 5KNBA 1XF1A 3DHYA 2IHBA 1YZGA 3T3PB 2QN8A 3KP1A 2VXOA 3SQXA 4UPDA 3WMWA 3GDOA 3GMIA 4BNYA 1A9OA 1O6GA 1U2DC 5FR2A 4KG7A 5JAIA 3KQVA 5K6AA 2FZCA 3I62A 2R5NA 1AZLA 1K08A 2WKSA 1W5AA 2KQUA 2Q3HA 2RJOA 4JBNA 1UPFA 1EX6A 3ZWWA 5AVVA 5HZKA 4X84A 1J70A 4G24A 5J4YA 2OQ2A 5EYPB 1I7DA 1JBQA 1M2NA 1WKBA 4ZQGA 4ZYTA 4M55A 3RT9A 2JAQA 3HUUA 3JARB 4MB2A 4GLLA 4EFKA 3HB0A 4B48A 3SJAA 2ZBUA 5AUPB 3OG9A 2MSWA 3SZOA 2ZP1A 1AOXA 1Y8CA 4HADA 5HG0A 2HGZA 5DWVA 4ZARA 1K27A 4TXNA 2PT9A 2FFAA 1RBMA 1U9ZA 3AY0A 4WDRA 4EY6A 2EYQA 4F93B 5A4DA 3BIOA 4RTSA 1UZMA 1AUXA 1ISPA 5JNVA 1Z74A 2IPLA 1ONPA 2PQ0A 3HEAA 2H5IA 2GASA 3AUSA 2GN1A 3EZXA 3WL8A 4IZOA 2C9BA 4F3CA 1U1IA 4B3JA 3M89A 1QLJA 3IVRA 4D97A 5EJEA 2WWYA 2YWBA 5J4HA 2XUOA 3M4ZA 1K3TA 4N12A 1EINA 1PSZA 3IALA 1FVXA 4HVTA 4K9MA 1NBIA 4TV8B 2GA9A 4ZIRA 2GD6A 2V0NA 3EF0A 1ZK2A 3F4BA 3O8RA 5JSKA 3WNBA 3OP1A 1XU7A 1JQLB 3PT5A 4TMTA 1ISFA 4FIZA 2ZR0A 2DQKA 1L5WA 3O93A 2I8LA 4RS3A 1GNLA 4CM4A 3RB8A 4TYPA 5BSGA 1MNAA 1AZTA 4NNJA 3TQTA 3AOEA 2PKWA 3I9MA 5FBRB 2J87A 3BD6A 3CN9A 3EN0A 5T7BA 3CUTA 1QHHB 1W2WB 4FMDB 3DEAA 4IUBS 3QBVA 1CUSA 3T1HB 1C30A 1R6BX 1Y4ZA 1XD8A 1KEEA 2A86A 1AKNA 4JLBA 1HURA 4AMVA 1ZSYA 3CEMA 2E18A 2D62A 4OTZA 2XEDA 3OKFA 4Q4HA 1JLRA 1Z13A 2EKPA 5F9MA 3CZ5A 1LWNA 2OGUA 3GFSA 4MV1A 3WWZA 4YXWD 4LCBA 2YL2A 2PIAA 2QQ5A 2V1XA 3PNOA 3WLEA 2IY8A 1RWMA 3TTWA 3WYGA 2E37A 3RQSA 4CLHA 1JEDA 1GILA 2ZR8A 5KJ1A 2W8ZA 3OCUA 1SUAA 4D8WA 3ENNA 1VPWA 3D3WA 2D00A 5KS2A 2PLNA 3TUJC 4P93A 3T7SA 2VF7A 3M5CA 1CZRA 4RVOA 4AW9A 1DE0A 4YJKA 2GS9A 3UMJA 3U3MA 2QY6A 1DJQA 3ZGYA 1A9PA 2WU0A 1XP5A 1CUYA 1V6CA 3EBPA 3WMFA 3PEFA 3FHCB 2XGGA 3HKCB 3BRSA 3IX7A 3UYKA 4LI0A 3U3ZA 4YJGB 1X7YA 5HUJA 2VNHA 1MFZA 1KZHA 5BVHB 4L95C 1VYVA 3JWHA 1UIRA 4ZVSA 3SQWA 1MMFB 1SU8A 3QF4A 5EJ7A 1C0LA 4A15A 2PV7A 1AA6A 3TTUA 1WG8A 3OLCX 4B3CA 1U8CB 3NT2A 3RW9A 3H3XA 2ASVA 5B7PA 3HNPA 4UBLA 5K0LA 3SLKA 1IY9A 3L49A 3N8GA 1MV5A 1XQ9A 1QRDA 4O08A 3IIMA 1EG7A 4MHSA 4V39A 3CUYA 1HTBA 3RM3A 1Z16A 4K6KA 2G70A 3ACCA 2BFNA 3LM8A 3SN6A 1EP9A 1FTSA 2AYYA 3OMWA 5AK4A 3K71B 2FX5A 1KORA 2IW3A 2H1IA 2I2FA 4FEAA 3TMAA 2VFAA 2P6PA 4BX3A 2C61A 3LLMA 4MQLA 5JXGA 5FB3A 4UZFA 4OSEA 3IEXA 1KETA 2CVOA 3D8HA 3L7NA 3NG1A 4HTFB 1PG2A 3GLIA 4G85A 3LTNC 1GG8A 1Z06A 1RPJA 5EKUA 4LX0A 2CLMB 1CJUC 1MVOA 1DFGA 3JXEA 1RZRD 4I1YA 3CMCO 3CZMA 4NZZA 4ZD6A 1O7JA 2G4VA 5L7YA 4RS4A 3UTCA 3CUUA 2QGNA 5ARDA 5IDQA 4TTTS 4V1CI 3CLHA 2G1UA 4DM3A 2PA0A 2QLBA 1SBCA 3PUIA 2BI7A 3V1NA 5EFOA 4XPIB 1YC2A 4XRGA 4JJFA 4GMDA 5L6LB 1CQWA 3TGLA 2YR0A 2P5YA 2P2GA 3OQMA 1R1DA 1TMGE 2O3TA 5EHQA 4BX8A 1JQJC 2IQ5A 3DDSA 2O1XA 1J8DA 1JI3A 3O74A 2GHIA 3WA6A 4RH3A 2QTGA 2DBRA 3AFGA 5CTJA 1T6YA 3DMDA 4JOQA 4KJXA 5E6UA 4JI7B 4ZZ3A 4FJ2A 4KXFB 3PF9A 3NTXA 2OCAA 1NRJB 2NSJA 3NJRA 3H1TA 2GEVA 4JUDX 4U5XA 4QSHA 4I9FA 3AY7A 3BCSA 4DMHA 3I5YA 3HCDA 3O3NB 4FDAA 4YRLA 1K06A 4HDNA 2FSVC 3R3HA 2GAFA 1WMDA 1X14A 1DIBA 5AJXA 1FYFA 3HDTA 3T3DA 1J5PA 3QUCA 3EA5A 4GSLA 3M4XA 4YI5A 2CUNA 1T9CA 4POOA 2YCBA 3F47A 2JFHA 3GEPA 1B8PA 4ZI2A 4B6GA 1KDTA 3CNHA 4JASB 3NUQA 2I6FA 5E6SA 3W6OA 3OT5A 2BGNA 1CJSA 3UHPA 2EKZA 3H1FA 4MQFA 5HIMA 1QJCA 2QP3A 3TZLA 5BV7A 1TUGA 5K0TA 3HJCA 2I1WA 1W76A 2IBTA 1NPTO 4LDZA 2RK4A 1BVYF 3JQ7B 4WK0B 1VGRA 1I36A 1YC5A 2F9FA 5JFTA 1ECPA 2XDYA 1G21A 2I76A 2IHYA 4JDUA 4Z9AA 1WUIS 1T2VA 4JQYA 3VKUA 3L6CA 2F55A 4GM0A 1E58A 5C8YA 2O2XA 1YDGA 2NU7A 4WTOA 5ALNA 4F85A 1X80A 3HO6A 2F3SA 5KOHA 2ZT6A 1NFRA 4IFEA 1J5XA 2QTNA 2PZKA 3DF9A 3R7WA 3OZRA 5T5QA 4NFSA 3RR2A 4E51A 1A0OA 1N34B 3E9NA 4G9BA 2A1IA 3JYHA 4AG3A 3LIPA 1YL5A 1JJVA 3G5LA 3SHVA 1IL0A 4GNRA 4DXDA 5MDHA 1WXWA 4MULA 2PU7A 5AVXA 5CGZA 3IAS6 1AHHA 4BFLA 1DAFA 1WMEA 2PM8A 4NECA 4N8DA 3W7VA 1H6BA 4WVLA 4PXSA 5HKBA 3DD1A 1SUEA 3ANXA 4QXPA 4LXHA 1GTZA 1Y1RA 2UVPB 3KNZA 3N0WA 4BMXA 5EHZA 4S12A 5C5DA 2Q1XA 1ZL2A 1QHIA 3DW1X 4I4LA 4YQYA 2CV2A 3IQWA 1EDBA 4Z7NB 4YPOA 4FW8A 2OFFA 2YYYA 4JVMA 3I2HA 3VPFA 1UBNA 3LOUA 2RAVA 1A8SA 4YHBA 3CX8A 3KXIA 5DNUA 6REQB 3NW9A 3RC2A 2XB6A 2BF7A 5KNDA 2JZOA 3UT6A 4BKRA 4J4BA 3AF2A 3MWGA 3HFGA 1T9DA 4JLWA 2XI4A 4MKZA 3WB9A 3ZBUA 2QGFA 4BNJA 1TW2A 2X58A 1CP2A 2FTKE 1QF9A 1U9YA 1W19A 2GCOB 1UWLA 5JZSA 1RLOA 1M6HA 2J5KA 1NQVA 4WLFA 5I7EA 3LWBA 3LHIA 1OAOA 5IP5A 2ZBRA 4P7GA 1G2QA 1G0NA 3FVQA 1YOVB 4EHIA 16PKA 1ZK0A 2G6BA 2XUAA 3HR8A 4RVFA 2AXQA 4DZZA 4EUFA 4U7DA 1PQWA 5HKKD 2XZDA 4NDNE 3O4JA 3VYWA 1V1MB 4YASA 4DCSA 3WISA 5GTDA 4C2BA 5ICSA 2VYNA 3INGA 2IUUA 1DC8A 4CU2A 4LOAA 5AVQA 2V7PA 1NXSA 4OREX 2J7KA 2DH6A 4UUMA 5EHXA 1PV1A 2JAOA 2IGTA 1SCIA 5JXIA 3K7EA 4WV3A 1NXOA 3RYCB 4RTQA 1E9EA 4IHJA 1FOEB 2EZ9A 4I1VA 4C0KA 2LCIA 1J2TA 3PZRA 3VRHA 4OJQA 5KSWB 4Y0NA 2PKXA 4NPHA 2AN1A 2WIKA 4NEGA 4XIIA 3ZY6A 3F6PA 3FFBA 1CR6A 1BIFA 1R0RE 5B55A 1DEKA 4YRGA 4YREA 4IMRA 1Q1AA 1Z17A 2PZJA 3TTTA 3TNDA 1R2QA 4FEEA 1R0KA 3R3JA 4IINA 1WPQA 5ANRB 4FZVA 2ODQA 3G5AA 4B82A 2NSLA 4LRXA 3UHFA 3H6GA 4LF5B 4JC8A 4P7KA 4R2HA 4BN0A 4MEBA 2OBFA 5G0WA 5IVPA 4CEHA 2GCOA 2V6IA 3GUZA 3EEFA 3OHMA 4PLZA 3TS1A 3ZHRA 3JQCA 3ZWKA 3C3CA 2NO5A 1FFXB 3IMCA 1WZ2A 3KOZA 1P2DA 1TAQA 4MGKR 4OQFA 4QASA 4C20A 3SK0A 2BHSA 2VYQA 3WS7A 4C05A 5AW1A 1CULC 2JD1A 3D81A 4BIMA 2Z2YA 3HV0A 4G4SO 1Z5PA 3CIFA 3HWSA 1FNNA 3EGIA 4DTIA 1G8KA 5AKJA 4EW2A 4JYAB 3LT0A 2I62A 1IY0A 2JLRA 2GJ4A 4I55B 5B1HA 3CA8A 3IVGA 4AYXA 1KTIA 5H59A 1ZZEA 1BDJA 2AN4A 4PQGA 2A9QA 4PGMA 3UH0A 2WZCA 3GLGB 4J1NA 1T0JB 4J9VA 1CEQA 3BWYA 4UD2A 1ZHOA 4C21A 3OETA 3L8FA 4DC1A 4YMVA 4QRHA 2X77A 2VJDA 3M7IA 1T1JA 1ZX1A 2FPUA 2Q5HA 3R6GA 3GJYA 5GV7A 2QE6A 3GARA 1JUDA 1X9HA 2OV6A 3RK0A 1NR5A 2FHPA 3P4YA 1JFFB 1XCMA 4HR7A 1USUA 4KO8A 4U2GA 2ROQA 4KUEA 4BNXA 2ZATA 2PBZA 5C7IO 4FR0A 1ITZA 2BEUB 5IYZF 3TUIC 5AKLA 4DLWA 2QL6A 3FNEA 2BFFA 1W8DA 1KEEB 5JS8A 3A9UA 1JG4A 2IH2A 1V8DA 2EIXA 5FTWA 3QVJA 3MN1A 1TK9A 2BKEA 5J4LA 4N3AA 4MVWA 4AY4A 5CD9A 5KQLA 3HJRA 1O8BA 1FRNA 4KIFA 1X1DA 3L7YA 1KH1A 4DDKA 4EPYA 1QIEA 3OZTA 2IPOA 2PPLA 3LXMA 1WVMA 1RYEA 1YRAA 1GFZA 4FN5A 4I8XA 4MZXA 5CVJA 5FNVA 2ZXUA 1HNZB 4ER0A 3FW1A 2VQ6A 2ZU0C 3L3BA 1I32A 1R3DA 1QYWA 2IS6A 1KZ6A 4Q7KA 1Z7BA 2YNMA 3FCXA 3LS2A 5EIBC 4XYGA 1WU7A 1YU9A 2ZYUX 4HFRA 4K28A 5G4KB 3VDNB 4QLBA 3B9PA 4OM7A 3V5NA 2FWNA 1EA7A 1A7AA 3DZIA 3KWLA 3MJTA 4M60A 3P2IA 1YXMA 4HZIA 4LBVA 1XDDA 1Z37A 2Y67A 4RVHA 1C14A 5FBQB 2C57A 2H52A 4L4ZA 2PXXA 5IYZB 3ASYA 1H94A 5SY4A 3QKSB 3GJ6A 5JVDA 2V7QA 4OQMA 3I8SA 3X44A 4UDYX 1A2OA 2V6FA 4GE0A 2J9GA 3GT0A 4OX9B 4UFNA 4UM7A 3LRTA 4YJ3F 4Z9XA 1AGXA 4P4SA 1A5AB 3UICA 4DLBA 4IJVA 3T5BA 4EW1A 3DZGA 3AGPA 2DERA 3ESAA 2V4MA 2ID7A 1HNXB 2YVUA 5AOAA 2ZQYA 1P80A 5GONB 1JSXA 1V16B 4GO1A 4TS3A 3REOA 1SQGA 2R66A 3OZWA 4JP5A 2C9MA 2J6CA 4XWYA 1DGQA 1OGJA 2G36A 2CD7A 2QLLA 1H93A 1T24A 1VOTA 1PW5A 1QR6A 1L8LA 1RAFA 3MCTA 4MCAA 4WK4B 1C7RA 4ZPXA 3UFBA 5HXAA 1ZBQA 3ZWCA 4QTZA 4J0DA 3JAWA 4GLJA 1M34E 2ZYAA 1QYCA 1KO1A 3QQPA 2HSZA 5INTA 2BSAA 1CQIB 3HDYA 4BFYA 3ECCA 4P3XA 2RHRA 5JQGB 5DHTA 1RC8A 1KVRA 4TTSA 1PG5A 3GT4A 3RF6A 4BC0A 4JI3B 1GR0A 1P5HA 3BWMA 3IAM1 3LH5A 3L8EA 1RXCA 2RB4A 3SF0A 3DG9A 2XE7A 1Z4KA 4E5VA 1QC5A 5BN5A 2ENUA 4UXHA 5EMKA 4WJKB 4WN3A 2GBLC 1N0IA 2VT2A 5HILA 3OFNA 3OA2A 1SVWA 4F2WA 3DTYA 1UBLS 3QHQA 2W70A 1GQFA 3P1JA 1DX9A 3ZH2A 5LQCA 1ZBDA 1P2VA 3AVQA 3X1WA 3FLAA 2TMDA 1MB4A 5HF6A 4F9EA 2XSZA 3AWIA 4ZOBA 4YC7A 3DH0A 3OQHA 5FWDA 4DCGA 1DKMA 5C7OO 4G0MA 4QOIA 5LBTA 3AI1A 4L5BA 1JAYA 4PTLA 2DPXA 3ETDA 2YVLA 3N28A 5JIBA 5BUZA 4LMRA 2RH4A 4V02A 1TQHA 4HHEA 1HDIA 2VUIB 1M67A 1PR9A 2ACEA 1NVUQ 2HUNA 3HJNA 1Q74A 2BKAA 3VO9A 4HH4A 1FTGA 2XYGA 1JDNA 1QFMA 1V7CA 4YRDA 2IW1A 4BE4A 1NPYA 2JRCA 3EE6A 1KJWA 2QN1A 1QQTA 1SFRA 3IPRA 1LWOA 1M8JA 2PYIA 4TLBA 5E7IA 4BMOB 3K5PA 1NY5A 3VYVA 2W22A 3B6IA 2G9NA 3RIHA 1GYPA 2C07A 4AUNA 1IBRA 4W5HA 4LMPA 5AOBA 2DETA 1Y4UA 4WXRA 4F12A 2MTBA 4ZZ2A 6AT1A 3EXG1 5A5GA 3LC2O 5HS6A 4F7WA 1CIVA 1JXQA 2Y4NA 4QDZA 1WSDA 4R51A 2ET6A 2V0GA 1TQ4A 3FPHA 5K0NA 2X4LA 1SIWA 3UMYA 2ZSUA 4HVAA 1STOA 5E0OA 3M5PA 4D4LA 4P7BA 4CTJA 4JB8A 3AIKA 2AN9A 3DAYA 4OI4A 1FSPA 1B0UA 1JSLA 3K73O 5DULA 4CQNA 1LTHR 1TYBE 5KYVA 2LNDA 3WP0A 1QONA 4B46A 1M6VB 3C7DB 3TK1A 1SHKA 4BV2A 2JNWA 4S3MA 4DLVA 2MT9A 2P4EA 2YIDA 1GUDA 5FPTA 4RE6A 2RGWA 1MVLA 4TL6A 4IILA 4C06A 2W98A 4URFA 5KC9A 4M0KA 2ZXEA 2D0OB 1R16A 3AR8A 3OJLA 1AG9A 4LXYA 1KA9H 4G23A 4NNOA 1BGXT 2Q41A 4O4LF 4CIXA 5ALVA 5BYKA 1Q17A 1GPLA 2JRLA 1H0KA 1JS1X 4HDKB 3OOSA 1Y98A 1UK8A 4YP7A 3TLAA 4FN4A 3HMKA 2FG5A 2PSDA 2ZRNA 5C80A 1A7UA 2FPKA 2AG1A 4CI0B 3DNPA 4DR5B 4H7PA 3ZU5A 1MKYA 3EWSA 1GY8A 3OPYI 1TCVA 2AJTA 3N7TA 3PP8A 3DOEA 5ALDA 3NM4A 3SSOA 4JVNA 4ALKA 5K6AC 5LP1A 2NIPA 4FYPA 1MX3A 4RTJA 2HPHA 3ZV5A 2G0TA 3TRHA 4ZYUA 1PSWA 4C0SA 4RGBA 3IBTA 1SBZA 4CLOA 2O8NA 1NVEA 4DCVA 4ZAZA 1EFKA 1KSJA 4GBMA 1BDBA 1GNVA 2FPSA 2RBKA 2YZKA 2NU8A 1MOZA 3IV7A 5AK3A 4H17A 2C94A 3QWBA 1U65A 4MUIA 5E1OA 2I3ZA 4DMLA 5LLTA 1E2BA 3ECSA 2J30A 5G0TA 3H19A 3QELB 2JLQA 4H0CA 4U7PB 1YGPA 3V55A 4MPPA 3OAAA 1DDGA 2X8LA 3PIDA 5DHAA 3OZEA 4MOWA 4A8HA 3JQ7A 4DLNA 4HV4A 2QD2A 3ZWAA 3HHPA 4J03A 1W4CA 1IN7A 2Q6KA 1P29A 3WK6A 2VT7A 1O94D 2I6TA 4C08A 3BTOA 1V4BA 1XWWA 2LXNA 2G5TA 2XE8A 3FDZB 1TEVA 3K0FA 1IN5A 2FRDA 2YYZA 3O1JC 1DWPA 1H0HA 3PWTA 4JT2A 4QAQA 4WOBA 3VGPA 3I04M 5LQMA 4G1UC 3H7IA 5F5NA 4EF6A 1S2DA 1QUFA 5BV2P 4NONA 1DTWA 3QBTA 2GJAA 4JLMA 1KDZA 3W2GA 1JTVA 3EWIA 1AGYA 2BSQA 4PBSA 4BN5A 4AF7A 4J3NA 5CAEB 2TSYB 1G3IA 4QPDA 2V7VA 3OIUA 4KR3A 1TKAA 2AD5A 5LD2C 1Q7TA 4UHDA 4NCNA 1RP1A 5CYOA 1TTTA 4OSPA 3UAXA 2OGSA 4ENSA 2AKAB 2WD8A 3FNFA 3KM0A 4JB2A 5KBYA 4PHTA 4CEHB 4B3RB 3KUXA 4N7BA 3UGKA 4U0KA 4QAJA 5FJIA 4DYDA 1UH5A 2LKDA 5L4NA 2GYWA 1OJLA 3PPWA 1JBKA 1P44A 4QM7A 1I7NA 3RS8A 5FO1A 4B47A 2FZ5A 1GZ6A 2Z6AA 4R9NA 3UMMA 4FILA 2X40A 1ZQ9A 3J7TA 1N4DA 2J3EA 2XB2A 1ID8A 2XADA 2OBMA 1CSEE 1YI8A 3DZCA 3V4RA 1BX0A 3S0JA 3PLNA 4IPTA 2EKQA 4NMLA 4Y1FA 1YZ3A 2VPTA 2A3RA 1GAXA 3QPDA 4HDRB 4W5WA 1II8A 2GCIA 4MQEB 3RROA 4RAOA 4FIDA 3RYHA 1WWKA 2XVAA 3ICCA 1G8JA 2PL9A 2QLNA 1ZWLA 2QRZA 1ILEA 4FX2A 1Z4NA 2PX4A 4RJLA 3KT8A 2WYOA 3TJZA 5I4IA 3NBXX 2ACVA 4LZPA 4NMMA 1T8RA 4V0QA 5DLYA 2EG5A 3PC3A 1H66A 2Z83A 5E9QA 1NVDA 2Y27A 3DMFA 1KJZA 2KM1A 1CVRA 1UOQA 3MSXA 3U48A 1WZNA 1L7PA 5TQ2B 4IAOA 3FUXA 1L3IA 3ORRA 3F6YA 2C92A 1KOLA 3V7FA 1V3VA 1W2GA 1KKLA 3MTIA 3PCRB 1TW3A 2XYHA 1P9NA 2GO1A 1N2CE 3G2IA 3K72B 3Q1KA 3EAFA 5F52A 2MYNA 5IWCA 1A95A 1E1CA 3D8BA 1EFPA 2YN0A 4G0OA 2IZ1A 2NV2B 3GJ4A 1SCQA 4P4TA 5BNTA 1BTOA 1P31A 4N01A 2C9DA 4O2BB 5HFJA 4CLXA 4L0MA 3FHJA 4JJ8A 4X97A 1OD6A 1WUJS 2HQBA 1WL8A 2PRJA 1U81A 2X7XA 1Y4SA 3D02A 4ZVVA 1JMKC 1K1EA 1JR2A 1HYHA 1YJAA 2NZJA 3G6KA 3P9SA 5AKXA 1NJ8A 5HMLA 3SHWA 4EPWA 4ZEMA 2GPJA 5AKHA 5BNZA 1GKUB 2XUJA 4R83A 1K6XA 2QM7A 4Y6LA 3VX3A 2NTEA 4UCFA 3ZDZB 1XV5A 1LVUA 3IBGA 1MR3F 4JQCA 2WYHA 1FQJA 2GPTA 1KMMA 3STUA 4URXR 1SK9A 4OFBA 2AOUA 4P4UA 3IDOA 4NV3A 2AZTA 2CYBA 5IHPA 4KRGA 4EH1A 5AUNB 1J0CA 2OOSA 4PXYA 2EJTA 1URPA 2F48A 2I3GA 1L3BA 1RI4A 4K9NA 5FOXA 3ROKA 3RSZA 5KO2A 1U94A 3DPUA 4KGDA 2PE5A 2ORIA 2J0QA 2WOOA 4AZ0B 2ZYRA 4QU8A 4EJ2A 3RC3A 4OMFG 3KQNA 4M4SA 1XC7A 3IVMA 2YHBA 3GT3A 1O2DA 1EVZA 3DAOA 4JODA 2F4VB 5EC8A 3L0DA 3GLQA 2PBRA 4NAVA 1QWOA 2DPLA 4JEUA 4MHOA 3HFSA 4F2HA 4DDWA 2XDQA 4CLRA 2FLKA 1MZVA 2VHWA 5IBQA 5DOVA 1U0LA 2BBSA 2BEJA 3HCBA 1NYRA 3UGQA 3V6MA 4IH9A 3DBHB 3TTXA 5B3JA 4HFNA 4D45A 2XB9A 4MINA 4DR1B 5EZSA 3OLWA 3ABOB 4CMIB 1RKBA 4XCVA 1GFWA 3HP1A 3NBYC 3SC6A 1C9KA 1DX4A 1P18A 2YQZA 3UC5A 1TZCA 2CFCA 4Q1CA 3U2QA 1OZAA 1FFSA 4B3HA 3M6AA 1TGVA 4ETNA 5AQ1A 7AT1A 2ASEA 2XA1A 5C7LO 1TRKA 3CUKA 3MVEA 4G97A 1UFOA 1K7XB 1KOJA 2Y4OA 3G6WA 4GMXA 4NATA 2ZT5A 4KWEA 2IZ5A 2I5PO 3GFQA 5HEKA 3SHTA 1JALA 4JWTA 2N1BA 1J5EB 4Z4EA 1PK9A 3WTBA 1G8AA 3C97A 1A5ZA 3RV3A 3CUVA 3IELA 2ORWA 5ELMA 4RKWA 2VTKA 5BMVF 5CVVA 3CLRC 4QVGA 3RG2A 5BN3A 3A4TA 5TC4A 2XJ9A 3DBIA 2AG5A 4IIVA 1QGDA 3OUUA 1XD2B 1JHQA 4NZOA 3SDBA 1ZN9A 4RFVA 2BTQA 1VI5A 4D98A 1GD1O 2YZ7A 5LNK1 5BN3B 4EX7A 5JBIA 1RMQA 5KU7A 2Z1DA 4P3NA 4IRXA 1DQZA 3AXTA 2CNDA 4I1RA 2CYAA 2Y99A 4BZXA 4U0JA 4IHAA 3NYQA 2DR3A 4RD0A 3UNXA 2B6NA 3L7OA 4RELA 1A8UA 1A69A 4WY2A 4EHAA 3RJMA 4BO1A 1M1NA 2P69A 3E22A 5IANA 3BRCA 3VDRA 4Z4HA 4LWOA 5IM4F 2PQMA 2YVAA 2DY1A 4JT8A 4DV6B 3G9QA 4I1UA 1MO5A 4G8DA 4KN6A 3UZUA 2ETVA 4G8JA 5DM60 1JW9B 2QI9F 2WYVA 3WG9A 1LRJA 1SULA 4U3JB 1EXWA 4KQWA 4RCVA 2IIBA 3AUKA 2ZJYA 4IDFA 3WO0A 1VRCA 2WAOA 4B7UA 2QTFA 1ZA2A 2VK1A 5FEUA 4FEGA 4LAFA 1MO4A 1WJGA 1VGVA 1XMXA 1U0RA 4KP7A 4PTZA 1PP4A 3O90A 3NBAA 3KVNA 2WY2D 1PVVA 2B1IA 1PU2A 1A72A 4CMHA 3QW2A 1ZC4A 3QENA 2QPOA 4ND8A 2ZSEA 2Q0QA 1QRTA 4YVFA 2NAPA 2XRFA 2C42A 3C6YA 2D8MA 4GUDA 4J29A 3UV3A 5BUCA 4EY3A 2BKXA 3IOEA 3CEPB 1V2HE 4QNMA 3MMPA 3CVVA 4DOMA 4JX8A 4WRRA 1VIMA 1V7PC 1R9GA 2SICE 3QIAA 4DYHA 5C8XA 4LF9B 4P81A 3HPRA 4WD3A 3OJOA 2NNWB 1R5BA 1DP4A 2QV0A 3V8BA 1L4EA 1MAVA 1SH7A 3LHKA 5HF8A 3VPXA 1GO2A 1NF3A 4GZ3A 4I81A 2P2CA 1U1CA 4I8DA 4RA9B 5HDQA 3R7AA 3TEFA 3TIGA 4HD8A 4CIWA 3CZPA 3I9KA 3OCCA 4IV5A 1M7GA 1ZMRA 2B5OA 3ZVMA 2VSOA 4ZVPA 2MCFA 4NCJA 4QUKA 1LBHA 2AE1A 3LQ1A 4CQLB 4G41A 3UJ6A 4HDSB 1CUCA 1MC1A 4B3FX 2VP4A 4G8CA 3U7IA 4EELA 3C6KA 1GHTA 5FOVA 5LIRA 4L76A 3Q8MA 1J1UA 1G98A 1E0JA 3B2EA 3TQFA 4LYJA 5FA6A 1Z3IX 5HYVA 1FIUA 4Q4AB 4B83A 3WAJA 4YIKA 3JVIA 1QGYA 1R6TA 6ADHA 3K0CC 3JRNA 4MUXA 3RE1A 1I2BA 3A4LA 4DJDC 2P67A 1ODIA 4XYBA 5TS2A 2QWXA 1U99A 5EPOA 1KVSA 4G5RA 4JENA 4PS1A 2EFCB 5AHOA 2HA0A 3DFZA 3RUEA 4LTNA 1BMQA 3X2EA 4BQPA 1UBMS 4JOSA 3ZKWA 1JVSA 4II7A 1YZFA 2G9QA 4DLKA 1U2DA 4NICA 2GYUA 2NPOA 1BE8A 4RV4A 5AUQA 1N1GA 3JR3A 4XXHA 1QTQA 3AK4A 3OKPA 4CGYA 2YOGA 3WSVA 2JC3A 4P6VF 1OI7A 4HQRA 3WRXA 5EXDA 3CTPA 4BB9A 1SXGA 1T3SA 3HU3A 2B7BA 4LXGA 4RIHA 2OOKA 3F7NA 5CM9C 3T99A 3VR2A 4JU9A 2AEEA 1P72A 3UENA 2XCSB 1W5BA 4NBRA 5KX5A 3UG7A 1TD1A 4F5ZA 3L4EA 2AKYA 4RKFA 1FNDA 2W6NA 4JUIA 4I5IA 4P22A 2P6NA 4V1CA 2Q50A 2XCQA 9LDTA 3LDHA 2JGDA 3OD1A 2BSXA 2OCXA 4WESA 4DJFC 3RARA 1NJFA 4LXTA 3IURA 4P4NA 3V34A 2AUTA 1M6VA 3J81k 3OWXA 2QPAA 5K8VA 3TR0A 1XLVA 3TM5A 2R0QC 1XEXB 3M6LA 3UYLA 5EPUA 3R0JA 1Z5OA 3PV0A 3BE8A 4I4IA 2QD3A 4FLEA 1JPUA 2NTJA 3MRTA 3O8LA 5FKJA 3R9XA 4A27A 4AU1A 1IQRA 2VHVA 3W2EA 3K92A 2ORED 2WZDA 4GL4A 4NCIA 4FGUA 4A26A 3MNFA 1LJUA 2ZBDA 3UJCA 5FBLB 5I4CA 1DFHA 1HBJA 2DHRA 1IPHA 3PKIA 1FW8A 2O5VA 2R68A 3SEFA 3B36A 4ZQFA 1W4AA 4HWGA 1JIVA 2FI1A 3EBLA 2VZ9A 3NC4A 4PZDA 1FQWA 2ZAYA 3H8VA 2BUCA 2FWPA 1HX7A 2G7ZA 2I55A 5E1MA 3BTSA 2FNAA 5I8ZA 3V2HA 3BRQA 3QSGA 1H2HA 2WFMA 3R7FA 3N2YA 5WRFA 1E2FA 5JS2A 1GGVA 2GVZC 1RE1A 2W9XA 1YKGA 4NCXA 2YKGA 5JJLA 3UJ7A 3L0IB 1SVSA 3DS8A 3G79A 4NOMA 1ZITA 2NO9A 2GBCA 2QMEA 3EQ2A 3KLMX 4QFBA 1PLLA 4NJOA 5GM1A 3KYCA 1N3BA 1MH9A 1Q91A 1M1UA 4M83A 4UPEA 3GN1A 3O4FA 4JEIA 1ONBA 1MT3A 3L7BA 2P4SA 3CM0A 3KAQA 3KR1A 4J8PA 5AW0A 1JP7A 4MQBA 3WLJA 2OLEA 3PNQA 3Q88A 4CI9A 4DLUA 1EX1A 1JR6A 2PNFA 4UFOA 2UUAB 4QDTA 3RAEC 2Q3DA 4IQ0A 721PA 4D0RA 3EMDA 2A14A 5T3YA 1QSGA 2DFNA 1RI1A 3GZTB 3PRYA 3RFVA 4X7PA 2GFIA 2PZ8A 3K9BA 4D9JA 1EUDB 5J2UB 1EK6A 5FHQA 1EQAA 2Y6UA 4WNIA 3CBGA 4K03A 2B61A 2SKDA 3QLVC 1PGOA 2AEFA 3GR6A 2G72A 3LCUA 4MQUA 1H1LA 2NG1A 3BSSA 3EY9A 3PHHA 5IEBA 4JSTA 2DFPA 2WK1A 1CR4A 4NJEA 4ZXFA 4H6XA 4TWJA 5U9CA 2VZ8A 5BVGB 1NUTA 3E48A 1E89A 3BULA 5IJXA 5IDWA 4U63A 3TIVA 4NBVA 4QXQA 3SJBA 5JSZB 4KC0A 2X4GA 4NIMA 3E1KA 1F5SA 4E3ZA 4Z7OB 4GR5A 3FKJA 4UHBA 4HDCA 4M0CA 3C14C 5AM0A 1SUSA 2XUFA 3MBKA 4KWCA 4X20B 4OBWA 2JCYA 3QLEA 3TRIA 2EP8A 1MIOA 5J2UF 3NTRA 3WRYC 1Q21A 1OVGA 2KLHA 4BQSA 3TL6A 2BM9A 4WLVA 1SUCA 4UTZA 1XLTA 1G3QA 1SCUB 2EJVA 4BPRA 2IF0A 2GT1A 4DCTA 4EMSA 3NI2A 4MWBA 1F5NA 4QODA 1F9EA 3ZYCA 3AJRA 5ITVA 2P3LA 3LL4A 3ZN2A 4FI3C 2YH2A 3DR3A 3DMHA 3EXEB 3VMMA 1ZXLA 3RCBA 4NQZA 1HRKA 5AVYA 2YY5A 5B2EA 2DQZA 3CW8X 1YI0A 2AX4A 2FR8A 2V7BA 2YMMA 1QGZA 3OQ6A 5AHXA 3WADA 1X80B 5C3MA 4K0KB 1B23P 5BWBA 1A98A 5EJ8A 2QQ0A 2HADA 2L82A 1KC3A 1AQ6A 1XTKA 1GCGA 2XE4A 2V9ZA 3KXLA 4TLAA 4OBBA 5DOZA 4YPVA 1ESDA 3L7JA 2FX3A 1T5BA 3ORQA 3QG5A 4FI3F 4E4RA 1I4LD 1DRUA 1DBIA 3EDRA 4ZCRA 3GBPA 5LJIA 1QG4A 3A28A 3T3HA 3U4AA 1FU4A 4GLFA 3BDAA 4R7TA 4IDEA 1WW8A 2R60A 1ZH2A 2J3JA 1YSCA 2W8BA 4RK7A 5B2FA 2BGMA 3P4XA 2P27A 2R8BA 4KX3A 4O1MA 4V3CA 2TMKA 3LFTA 2XTJA 4FFBA 2HK9A 4ZQHA 2I7VA 2OB2A 4UQPA 1CUVA 1ZK4A 3BJEA 3QG1A 4CCYB 4FFVA 1ZMOA 2K2WA 2Y68A 4ZANA 4AUMA 3BGWA 1AN9A 3QEJA 4FXPA 3KR9A 4UPVA 3Q98A 2NZ8A 1XPOA 3PX7A 3N2EA 3UH1A 1SXHA 3W3AA 4NVRA 1WBBA 3IAUA 3DBRA 3SLGA 1YOVA 4WE3A 3IT3A 1WULS 3A6DA 2NAFA 4FHEA 1GGHA 4KPFC 5LMNB 1E61A 4I1SA 2GD2A 3OZVA 4HX5A 2BGJA 3QGMA