3DNMA

Crystal structure hormone-sensitive lipase from a metagenome library
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
297
structure length
297
Chain Sequence
DTKMDPRDFLQLLKINAEKAEKNLPLDQKRAGMEALCERFPRAEGVELTLTDLGGVPCIRQATDGAGAAHILYFHGGGYISGSPSTHLVLTTQLAKQSSATLWSLDYRLAPENPFPAAVDDCVAAYRALLKTAGSADRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLSPFVDLTLSRWSNSNLADRDFLAEPDTLGEMSELYVGGEDRKNPLISPVYADLSGLPEMLIHVGSEEALLSDSTTLAERAGAAGVSVELKIWPDMPHVFQMYGKFVNAADISIKEICHWISARIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of a novel hormone-sensitive lipase from a metagenome library
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 99
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.-:
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dnmA00
5ALMA 3LLCA 1QO9A 5BWBA 4KE9A 1LPBB 1EK2A 5K3BA 5IVIA 4DMKA 1H2YA 3VJKA 4HTAA 2P8SA 2XQIA 2WKWA 5EIEA 1THGA 3R3WA 3AUKA 2XUAA 1ODCA 4Y7DA 4BZWA 1THTA 1HKHA 4EY7A 4BDTA 1E8MA 3D3NA 4BDSA 1XLUA 3I1IA 1MTZA 3IULA 3IVMA 3GZJA 2Z8XA 1ACJA 5I9IA 4K6GA 2HRRA 4JEIA 4RE6A 5CT6A 4CI9A 1X2BA 3R3XA 1UT6A 5LYYA 3WKDA 1DQZA 4HXFB 4W1RA 1EINA 3KDAA 1DQYA 2HA6A 3HSSA 4ZREA 3V48A 4G4GA 2XMRA 4ETWA 1LPOA 2C0QA 5ESRA 4UBNA 3A2MA 3V1MA 3R0VA 1YS1X 4ROTA 2ZJFA 1A8SA 3I28A 3DEAA 4QDZA 3D2AA 3HRHA 1J07A 4QNNA 5EIHA 4BB0A 5AKGA 5AI0A 3STVA 2G5TA 1P0IA 5AKLA 1QO7A 5A7GA 4GEGA 4FLFA 4PV7A 3E4DA 5ALZA 4DNQA 1EDBA 4BP9A 2J3QA 1CUZA 3ZLTA 1GXSA 3VJMA 4FFWA 1C7IA 1U65A 1ZJ4A 2PSJA 3ESDA 3DYVA 2QXTA 4FBLA 3G9XA 3B5EA 1VLQA 4Q3OA 1VXOA 1GPNA 4BAZA 1XZGA 2WFLB 4G4IA 3MVEA 1O6GA 1AUOA 4QWMA 1E8DA 4X6UA 1LGYA 1SFRA 3IA2A 4UBKA 1QIMA 4KAFA 4H77A 4EB0A 4B83A 2PKYX 3HXKA 3R3YA 4NS4A 5E4JA 4M0FA 5AKHA 3CXUA 2EDAA 4Y2VA 2WJ3A 1CQWA 3G9UA 3OTQA 2WUDA 3I6YA 1S8OA 4B85A 4JH0A 3BE8A 2XMSA 5FDFA 3KD2A 4U2BA 2PL5A 4B6GA 3I2IA 4F5ZA 1A8QA 2WFZA 1MNQA 5EHXA 3QYJA 3ANSA 1QOZA 3WIOA 5DLPA 4HS9A 4OSEA 4A23A 5FRDA 3R3ZA 4J03A 4BYMA 3IUNA 3KWFA 3ZPXA 5J3JA 2NW6A 3DS8A 1LZLA 3PE6A 1EDEA 1ZGCA 2V98A 5LZ8A 2OQIA 1JU4A 3RKSA 5LZ9A 1GZ7A 1WHTA 3PICA 3TRDA 4Y9SA 5H3HA 2Y2UA 1OILA 1UK8A 3PFCA 1O6FA 1GKKA 1E3QA 2ACKA 2C5FA 2QR5A 5JANA 2JGEA 3C70A 2QUAA 1T4MA 1AC5A 3X3HA 2E3JA 1AGYA 1AQLA 4KEAA 1EXWA 2FJPA 3O95A 5K3FB 3K2IA 4V2IA 4XVCA 1T2NA 5AM3A 1C4XA 5DYTA 4AMZA 3W2TA 1CUSA 3F8SA 4RPCA 4UBIA 4Q82A 4AO8A 3PI6A 7YASA 2ZYRA 1W52X 3V1NA 2PM8A 1BRTA 1QIIA 3FLEA 1DU4A 4O08A 1CR6A 1TAHA 2J4CA 4KAAA 1ZIYA 4AZ3A 2DSNA 1XZIA 1TRHA 1NU8A 5AI4A 1XKLA 1BCRA 2Y6UA 5CT8A 4IQ4A 4OCZA 4OYYA 5CT9A 4Y2RA 1ZI8A 3IURA 1UOQA 5HCUA 1XFDA 2GYVA 4WY5A 2HRQA 1DWQA 1DINA 1XQWA 2BFNA 4P08A 1M33A 3FBWA 5EHNA 5JZ9A 3LIPA 4C89A 2C5GA 4J0DA 4FKBA 3DKKA 3TEJA 3QITA 1FFCA 5CT5A 1NX9A 3M83A 5LZ5A 1QGED 2ROQA 4DSAA 2HDWA 2OXEA 4BVJA 3KXPA 3LP5A 1XRLA 4EY4A 2QXUA 4GWLA 4U2EA 4XX1A 3DOIA 1RP1A 3BIXA 1XQXA 5SYNA 5JAHA 4QDUA 3JW8A 1GGVA 3QPAA 4C4ZA 3BDIA 3WLAA 2WFMA 2XQKA 1XZKA 1CV2A 5EGNA 3WKBA 2C58A 3M81A 1A7UA 3JYHA 1YA8A 3L1HA 4DM7A 2XUOA 2HA4A 4DMHA 5A2GA 3V9AA 2Z3WA 4UBOA 5AKKA 4ARBA 5AKIA 4FBMA 4QWWA 5JALA 1LPSA 3STTA 2H7XA 3FLAA 4Q3LA 4EZIA 1LPPA 3QMVA 1B6GA 4C01A 1CUHA 1HDEA 1PFQA 4CCYB 4ZV9A 3O0DA 3HC7A 5AM0A 4N8DA 5C8VA 2ZJ7A 5JZSA 1J06A 3FAKA 4KJXA 5FV4A 5CTAA 2HIHA 1E89A 4BP8A 1CRLA 4FLMA 3B12A 1H2XA 3NWOA 5JATA 4LYEA 2RI6A 5LKAA 5FXMA 2XMQA 1XLVA 1H2ZA 2Z5GA 4QZVA 4K2AA 2Z8ZA 2GZSA 1IUNA 3H1BA 5AKJA 4KRXA 3ED1A 1ZI6A 3QPDA 2ECFA 2QZPA 5ALPA 4N5IX 1YASA 2XT0A 5K5EA 1CUUA 3BDVA 1BN6A 5ALDA 1QFSA 3A6ZA 1TCBA 4BE4A 1ORWA 4CCWA 4WY8A 3C6BA 1JJIA 4K5QA 1L7AA 2H1IA 1JJFA 5DNUA 1Q83A 4EA6A 1XZCA 3H19A 2VF2A 2VT6A 2RONA 2DHCA 4H7DA 3QH4A 3PDCA 2JGMA 2BUBA 3HI4A 5DYYA 3ZWQA 2PSEA 4UHDA 4K6KA 3CN7A 2ZSIA 3WL7A 1IZ7A 4FMPA 4H7KA 1VZ2A 1OXMA 1MX1A 3WL5A 4MEAA 1EVEA 2BUAA 5ALFA 4L9AA 4OUKX 2PSDA 2G4LA 2YH2A 2OLEA 5T4HA 3ANTA 3DCNA 4UFNA 3C6ZA 5I8PA 2RGUA 1Z68A 1WPRA 1L7RA 4G4JA 4YX9A 3IDAA 4GXNA 4ZV7A 1YAJA 3D2CA 2QUBA 4GLBA 3QM1A 1UOOA 1YB6A 5ALQA 3C6YA 5A62A 1DWPA 2ACEA 4MQLA 3G0BA 4NMWA 3R3VA 2BKLA 4H7JA 1CUVA 1ZD2P 1BN7A 1MNAA 5ALSA 1FFBA 4IH9A 4C4XA 2PVSA 3WIBA 1UKCA 2RHWA 4I19A 4IH1A 4EY5A 1YAHA 4L0CA 2C7BA 1R3DA 1AMNA 1CUXA 4AZ0A 2XI4A 1QONA 3AZPA 4UHBA 4JYPA 4FNGA 2WUGA 2PBLA 2DR0A 1ORVA 1LPNA 3WL6A 5LZ2A 2DCMA 4X93A 1N8SA 5FP0A 1ZJ5A 3H0CA 1CPYA 3VISA 3AZQA 4G8DA 4OU4A 1F8UA 5IKXA 4BVKA 1WHSA 5EIAA 3U0VA 2Q0XA 3KOOA 2JF0A 1CUEA 2HL6A 2AJDA 2HA7A 5HF5A 5C81A 1H23A 1EH5A 4B81A 2BGRA 1BS9A 1AKNA 2YXPX 2VAVA 3CCCA 1UK9A 3IB3A 5HKBA 5BWCA 4YK7A 3S2ZA 3WQHA 4KRYA 3U1TA 5BOVA 2QMQA 4J0HA 2PU7A 1BU8A 3IUMA 5HKAA 4X92A 3WYDA 3OURA 3FSGA 5HZGA 2WG0A 3D2BA 3ZLUA 2ORYA 4QLAA 1UKAA 1CUFA 4LYDA 1H22A 2WG1A 2WUEA 4B82A 5DNWA 3E1GA 4F0JA 3EBLA 1CUYA 4EBBA 1EB8A 1QE3A 4CIBA 4I4CA 3WWEA 3WK7A 4J0GA 4S0XA 1ZICA 5CMLA 4BTVA 4PSCA 3QZUA 2OAGA 3GELA 4YPVA 1C7JA 2QJWA 1TQHA 1X70A 1QTIA 4AO7A 2BCEA 2O7RA 5CRIA 1VJ5A 1QLWA 5F4ZA 3FCYA 1MJ5A 4PQEA 1WM1A 2I3ZA 4D9JA 1WOMA 3NUZA 1RWQA 1J1IA 5YASA 3C6XA 3WKCA 4CIAA 1W75A 5AI5A 1XQYA 5ALTA 4KACA 2AJCA 2G63A 2WIJA 2FX5A 3L1JA 5C8XA 1R9MA 1YSCA 1Y7HA 1NU6A 2ES4A 3RM3A 5AM4A 3DJYA 4WFIA 4FDMA 4UBMA 3IUQA 2I3DA 5AOBA 3EIOA 4Y2QA 3R41A 1HLGA 2G5PA 4X7BA 3O9MA 5AIBA 4E11A 3WJ1A 4G1FA 2HU8A 3WZMA 2OAEA 4UHFA 2PSFA 3AJAA 2VA9A 1QZ3A 2VQ6A 5IVHA 3A2NA 2WU4A 1CFJA 1G42A 2JEYA 1JI3A 1KU0A 5ALIA 1FFAA 2I03A 1Q0ZA 4B9AA 3NOXA 5A71A 1AURA 2IX9A 4QLOA 3HEAA 4LIPD 1PJAA 4Z49A 4ITVA 1K4YA 1P0QA 3QVMA 2XUJA 3BJRA 4KYVA 5A6VA 5JAOA 2WG2A 4WDRA 4EY6A 1GT6A 2W6CX 3RK4A 3STXA 3WK5A 2OQVA 4X71A 3GBSA 1U4NA 3EQ7A 4WFJA 2HFKA 4AO6A 2VJCA 2ZYIA 5CT4A 1ZD5A 2JGKA 4BCBA 3OOSA 4X85A 1UFOA 1F6WA 4FTWA 1CUWA 5JADA 5I7UA 5HF8A 5AM5A 4G8BA 3LCRA 3ESAA 4CG1A 1UZAA 4WCVA 1TIBA 1EHYA 4E14A 5EHQA 1QIDA 5HQ3B 1ISPA 4IH4A 4UHHA 5D3KA 4U2GA 3Q8WA 4FFVA 5AICA 4C6HA 1JMYA 1VE7A 1TKRA 3DOHA 4UHCA 1BROA 2GBCA 5IVDA 3SK0A 1EX9A 4OD0A 4GHWA 3M3DA 2OG1A 2V96A 2HA5A 2OCIA 2GBGA 3WK6A 2WIKA 2O2HA 4TVKA 2VSQA 3I6ZA 3DLTA 2JBWA 3G9TA 3DL7A 1Y7IA 4H0CA 3FCXA 5BV7A 2O2IA 5ALEA 1MAAA 4EY8A 2QS9A 5ISMA 4H7FA 5AI6A 4AX4A 3BL8A 2B20A 5ALYA 2BAGA 3G0CA 2VT7A 3FWHA 5LZ4A 4L72A 4E46A 4ZWNA 2OCKA 3WJ2A 5JYCA 4QDXA 2DFPA 1UK7A 4P93A 1CVLA 4X6YA 5FPPA 3CCBA 1ETHA 1W76A 5DYWA 4X91A 2OGZA 4CCYA 3GFFA 1F0NA 2CUTA 2OCLA 1EB9A 1XLWA 1W4LA 3FYTA 3BIWA 2WHQA 4DNFA 3H18A 4B0PA 3AFIA 2R11A 5LLSA 2XUKA 1EK1A 4PO3X 2J4FA 3C43A 5AK6A 4K6HA 1CIJA 4BTLA 1LPMA 4J0JA 5EI5A 4J0CA 1R4ZA 2IITA 2GBIA 1HQDA 2WIGA 3P2MA 5DWDA 4Y2UA 3QMWA 2C0PA 2VAXA 4BVLA 4ZXFA 1ODTC 3WWPA 2XMDA 4HVTA 1G66A 3SC2A 4WDQA 1EDDA 4LXIA 3T52A 3ZI7A 5CH8A 1XZJA 3NGMA 1EI9A 2AJBA 1EA5A 1YB7A 1R88A 3ICWA 4ARAA 4TPKA 5AO9A 2OGSA 1LBSA 5HK8A 2BJHA 5HF9A 1XQVA 3MUNA 5JIBA 5KWJA 4MYDA 3SWWA 5JZBA 3E3AA 1YA4A 5CH3A 1DX4A 2RIPA 2DHDA 4N8SA 3DDUA 2DQYA 1VA5A 4GBGA 1VKHA 2R8BA 3PFBA 1XKTA 3RLIA 4QEKA 3D4LA 2WHPB 4INZA 4X94A 5C7YA 5AHXA 2EDCA 4OYLA 3RARA 5AK4A 3T4UA 2J3DA 1XZEA 1CUJA 1VE6A 4CG2A 2XUDA 4OPMA 5K3FA 4WJLA 1CLEA 3MGAA 4UFPA 3AIKA 5AJHA 5D3ZA 4H18A 4DSZA 3IUJA 5IVKA 3LIIA 3WMRA 2XUIA 3FOBA 4UUQA 2XQFA 4CG3A 5FKJA 1LZKA 4AMYA 2K2QB 4UBJA 4DTCA 3WWOA 3WK9A 4B80A 2JGLA 5AK5A 3F96A 2D5LA 1SC9A 1UWCA 3ESCA 4HXEB 3GUUA 1JJBA 2FUKA 5AKYA 5JD6A 3UUFA 3D0KA 2XUFA 1AZWA 4HRXA 1N5RA 1E5TA 2X8BA 1XZAA 4NVRA 4G9GA 2ZJ6A 1A8UA 1R1DA 5K3DA 1BEZA 1CUIA 3KWJA 1Q0RA 3VVMA 4DNOA 2WJ4A 3O4JA 3F9CA 2GZRA 3V1KA 1WB6A 3FSGD 4XJVA 1U2EA 1CUCA 1J2EA 2WU3A 4DLNA 2PUJA 3I2KA 4HRYA 4C88A 3V1LA 3STWA 2YASA 4YASA 4ZRDA 3UMJA 2H7CA 1CUBA 4IO0A 4F21A 2WFLA 1P0PA 2LIPA 1BEEA 3H17A 3H1AA 4XIIA 4AN0A 1SOMA 3FLBA 1ZGBA 1QIKA 2PUHA 1DT3A 4F60A 2JIDA 5K3AA 1QIGA 3BF8A 3EQ8A 3DL4A 5IH7A 4BATA 1VXRA 3WA6A 4OU5A 1XZFA 3G8YA 3STYA 4X3CA 4OB7A 2WTNA 1CUDA 3F97A 3YASA 4X6XA 4Y2PA 5LKRA 2HM7A 2ONCA 3K9BA 2AJ8A 4M0MA 5D7BA 2XUGA 5ALKA 2CKMA 4Y2XA 4DIUA 4C87A 3ZV7A 2V97A 2CEKA 1N1MA 1P0MA 3ZLVA 1SCIA 1IMJA 1W6RA 2XUQA 2WHRA 4U2DA 4XWGA 3I2JA 1FFEA 5CURA 1I6WA 4E15A 4DGQA 4ZGBA 5EHZA 4EUSA 4GI1A 2HFJA 3WL8A 3WA7A 1TCAA 3BJMA 4FNMA 4C4YA 2WJ6A 2ZYSA 3DNMA 3WKEA 2WUFA 3HZOA 3AIMA 5T4EA 5AOAA 2IIVA 1IUOA 2H9YA 3EF3A 2ZSHA 4Y2YA 1EVQA 5E4TA 4Y2JA 3L1IA 3D5EA 4UPDA 4G8CA 5AK3A 5A7FA 2XLCA 2DQZA 5AKXA 1UK6A 3K6KA 2BUCA 4JNCA 4LKOA 1X2EA 2XMZA 2W22A 4A16A 5FLKA 5AKZA 2WSLA 3G0GA 1FJ2A 5E2IA 5C8ZA 3HABA 3FYUA 3PF9A 1VA4A 5AIAA 3I1YA 4RGYA 3GA7A 1QIJA 3VXKA 2HA3A 2VJBA 4X00A 1F0PA 2HA0A 4H7HA 3HLKA 1K6EA 2QVBA 1KEZA 4MXDA 1XZMA 4AN1A 1GKLA 1CEXA 1RYYA 2JGIA 1SCQA 1ZOIA 2HHAA 2WIFA 4DNPA 3IBTA 3D7RA 2XQGA 5FOQA 2V9ZA 1E66A 1AX9A 1XZBA 3ILSA 4PW0A 2XB6A 1CUAA 3N0TA 4ZI5A 1A88A 3GROA 2JGFA 4W1PA 3F98A 5T4FA 4BC0A 5ALGA 4A5SA 3CN9A 3AZOA 2WHPA 1ACLA 5LZ7A 4B84A 4U2FA 4W63A 4JUIA 4J3JA 4MEBA 5ALNA 1UKBA 4H7IA 5ALRA 5HFAA 4MWSA 1R50A 5LIPA 2JGJA 5KWIA 1VZ3A 5ALVA 1MU0A 1WPXA 5ALLA 5T4BA 3A2LA 1QIFA 3G7NA 3VKFA 3R40A 4W1SA 1TK3A 4FHZA 1MX9A 3C8HA 2Y1KA 4L3WA 5JD5A 4LXGA 2UZ0A 1H2WA 5HK9A 3H04A 5FUMA 5AM1A 5ALOA 1ZI9A 1HBJA 3O4GA 2CMFA 4FOLA 3QPCA 3OM8A 4G9EA 3A70A 3JWEA 3TJMA 4DYHA 3I2HA 3G02A 4NZZA 3KSRA 3Q0TA 5AKEA 1BE0A 5ALJA 4TGLA 2QM0A 2VTVA 4HZGA 4P9NA 3SX4A 4N5HX 5ALXA 4J0KA 2QRUA 2BGNA 4QDTA 4OB6A 1DWOA 1XZDA 3I2GA 1JFRA 1JT2A 5EFZA 4HAIA 4N8EA 2HU5A 2QOEA 1QTRA 1K5PA 2WM2A 1LBTA 3C5VA 5AM2A 4PSUA 1K63A 4Q1VA 1IZ8A 3TGLA 3AIOA 2GBFA 4X95A 4G5XA 1XROA 3AINA 3C5WP 1U8EA 1USWA 4AXBA 3FNBA 3HYSA 1R9NA 4BCDA 1D07A 5CXXA 5JAUA 1LLFA 4PNZA 4PSDA 2VJDA 4BZZA 4BE9A 3WK4A 1DX6A 2WILA 5KREA 4J7AA 1CQZA 5A7HA 2QKYA 4EHBA 1Q84A 4I3FA 1UXOA 1TCCA 4KE6A 4IHAA 4BBZA 4HXGA 2O7VA 3FVTA 2WTMA 2WQZA 3WK8A 1L7QA 2PSHA 2VATA 2XUHA 1XRNA 4W9RA 3HJUA 1OCEA 4BAGA 2XE4A 3PUIA 3VVLA 2XLBA 2Y6VA 2QJRA 1MPXA 3WKAA 4BC1A 3W9BA 4B7ZA 3DYIA 2PU5A 4Q05A 1DT5A 1ZD3A 3EQ9A 4P92A 2D0DA 2JEZA 1G4HA 3MUOA 3H2IA 3B3QA 3I6MA 3OG9A 4U2CA 4FLEA 2EEPA 2CJPA 2HADA 2CZQA 3DD5A 3N2ZB 3VDXA 4JYMA 2PX6A 4QDOA 2RHTA 4QA9A 5AI8A 3C45A 5DTIA 2XQJA 2H7YA 2FJ0A 3BXPA 3C87A 4FWBA 4PF1A 2AXEA 4UBLA 4UHEA 3FYUC 4MYSA 3WI7A 2XMGA 2Z3ZA 4LHEA 2B4KA 3ESBA 2WIDA 2QTBA 4J0IA 5JASA 4MJ3A 4QE3A 1LPAB 1BCSA 4H7EA 1E8NA 3DQZA 3WWDA 5AOCA 3HACA 3W9UA 5ALWA 1B41A 5HQ3A 2OGTA 4B9EA 3O4IA 3WZLA 2GYWA 3DKRA 1GPKA 1HL7A 1DTEA 2QT9A 5DTJA 2XUPA 4Q3KA 1MN6A 3STUA 4WFKA 4AB1A 1IVYA 3D59A 5JD4A 1GQRA 1HPLA 4B0OA 5CH5A 2PPLA 1SCKA 5AH0A 3F67A 1JMKC 3AILA 3BWXA 1GQSA 3W05A 2CBGA 4KE8A 1Y37A 3M82A 2VJAA 3QBJA 2X76A 3LS2A 1YR2A 3G0DA 3VJLA 2DHEA 2I78A 3G9ZA 1JKMA 2XMBA 4OB8A 5AI9A 4KAJA 3OPMA 3IIIA 2WLSA 1MAHA 4KR0A 4DMCA 1XZHA 3I2FA 5SYMA 4Y2SA 2ZVDA 3FVRA 1WCYA 5JARA 1XRQA 3QMMA 4GDMA 4MWTA 4BAUA 5KBYA 1G5FA 1LNSA 2HA2A 5FPQA 2HU7A 1UOPA 1KU6A 3PUHA 3E0XA 1MX5A 3WYNA 4MQMA 1JU3A 1GPLA 3W04A 1VOTA 2XMCA 1WB5A 3PF8A 1MO2A 4H35A 1FSSA 1WB4A 5D6OA 5DJ5A 2OPHA 1CUGA 1YS2X 4RNCA 4BRZA 4X90A 2OCGA 3O9VA 4UFOA 5K3EA 3ICVA 5CXUA 4AQDA 3WWCA 5JAPA 3OC0A 3C8DA 5CW2A 5CBKA 1QJ4A 2VEOA 1XRPA 3O4HA 5DNVA 4GECA 2RAUA 4Y2TA 1ODSA 5K3CA 2B61A 1K8QA 3BF7A 5AP9A 5HFNA 3H2GA 2O2GA 4BRSA 4LXHA 2C4HA 2ZYHA 1QIHA 3S8YA 5E4YA 5HF6A 3FYUB 1YCDA 4BCCA 1N5MA 1ZD4A 1IUPA 1XRRA 4X97A 5LP1A 2GYUA 4W1QA 1QFMA 1PV1A 4KE7A 3W06A 2AJLI 6YASA 3H2JA 1XZLA 2Y2VA 1MT3A 2X5XA 4GW3A 5ALHA 4M0EA 4DMFA 2B9VA 2XDWA 2YYSA 3G0IA 3H2KA 1W1IA 1FFDA 4Q34A 4RE5A 5ALUA 1QIEA 1ZIXA 3H2HA 4CFSA 1XRMA 3UUEA 3R3UA 2CB9A
chains in the Genus database with same CATH superfamily
4IINA 1BDIA 2BM8A 2V1XA 5ALMA 6REQA 4TS3A 2MYPA 5JCJA 2CNWA 1VECA 3S1AB 5J2UB 2SECE 4KE9A 4UOZA 5JAIA 3H6KA 1ZXBA 3UWMA 3VYWA 3TDMA 2BFMA 4C78A 4DRZA 5JXHA 4MRAA 3H16A 4RKWA 2XQIA 5SV2A 4RLHA 4YUXA 3R3WA 4XGRA 5A4IS 1Y5IA 5EIEA 4A0FA 1J90A 2O8DA 3BQNB 3OEYA 2XZTA 3DEZA 1THTA 2BCGY 4BZWA 4S05A 3KJGA 4CEJB 4DCTA 1ZEMA 3C3AA 3CUEF 3DMYA 3GEIA 2ECQA 3WRYC 2X0IA 2X3UA 3IULA 1YOVB 2IQ5A 2AEEA 2REXB 2IZ7A 3QW4B 1Q3KA 2Z8XA 3H8SA 1NW9B 1Y33E 1XA4A 4D56A 4K6GA 3M9XA 2E4WA 1S02A 4JEIA 4YJKA 4RE6A 1Q11A 4CI9A 3ZWKA 1IY1A 3ZTTA 3GF4A 3OP1A 3WGGA 5IKEA 2YQ5A 3KR1A 5HE9A 2QAGB 1QF6A 4MJXA 1A69A 2O14A 4GXQA 3VZQA 3MEQA 5AQ1A 4JUFA 1L3CA 1P33A 3O2SB 3WGLA 1O97D 3AUYA 2RGNA 1A9SA 1TVMA 2QVZX 4HXFB 2OHOA 2IEZA 2ZSUA 4QOHA 3UGJA 1J42A 5L3VA 1U0NA 5DXJA 4BTEA 3I5YA 2VK8A 3RW9A 3MWKA 4C0AC 2B9EA 3LF1A 3VNAA 3VYUB 3OIYA 4OP1A 5COBA 5AW3A 1CJKC 1XB2A 3OUUA 4KGZA 2NAPA 3QEOA 4B4KA 3DEHA 5H80A 2A9RA 3LT2A 4LJ9A 3GLGE 3KPYA 2ZJ8A 5TGTA 1EFVA 2V8BA 3DV9A 3H84A 4JY7A 4UBNA 2VDQB 5KKAA 1I51A 4JI3B 1U2DA 3ME5A 4FHDA 4WKBA 4BFTA 4JBYA 5EL0A 3RRFA 2DT5A 2NXCA 1UEXC 2GXQA 3SHWA 5IJZA 4KK3A 2QI9F 1H5UA 5B37A 1PZHA 2Y0DA 3KAPA 2ZATA 4Z86A 2FOXA 1U5BA 4FYWA 2X7XA 1I13A 4A73A 5KYYB 1BMFD 1PEYA 4MUGA 5LQMA 5B53A 4QDZA 2J7PD 1E5VA 3QYFA 1JKFA 1UMDA 1TI7A 3FM9A 1V5GA 2ZJZA 4L5AA 4XJTA 3CVWA 5AI0A 3GN1A 5TQ0B 4WBNB 3FOCA 4HNSA 3AR7A 3NCHA 4B3HA 5F64A 1QO7A 2QZ4A 3K16A 1KMHA 3KQVA 3LF2A 4GEGA 4I08A 5D5PA 1P9NA 2RK4A 4AQYB 1S89A 3ZVKA 4EO4A 1XYVA 2ZUCA 2AR9A 1EDBA 2WJZB 4ITUA 4HH3C 2NXWA 1DOHA 2MSEB 3R9XB 1EEXB 4F04A 1N1DA 4QXOA 4YQZA 4E2XA 3DMHA 3SZMA 2X6QA 1K6XA 2G7MC 1ZJ4A 1HYQA 2EATA 2PSJA 2CL0X 1XTTA 4X5OA 1NVFA 1Y82A 5JCOA 3DTVB 1DCTA 2RBGA 2B5OA 3G9XA 4QYIA 1LFDB 4DLPA 1Z8DA 3CEHA 5FORA 2M6RA 3B5EA 2VR1A 1V9LA 2C57A 3V7FA 4M55A 4OLHA 2JLAA 3H3FA 3NNDA 1EFRA 5KPJA 2Q4RA 1DHTA 3FPEA 3AM4A 4Q3OA 1RQPA 4O3FA 5DULA 3SFTA 3G7UA 4BO1A 2VP9A 5HKKA 1OFIA 4HWRA 1CQIA 4M76B 4N5DA 4TMYA 1PJSA 5DOVA 5SZHB 2DHRA 1FXSA 1O6GA 5SZKB 1AUOA 5EJFA 4PHTA 2B8EA 4X6UA 1G21E 3V4RA 2F8LA 4YXWA 3IA2A 3K0FB 1QIMA 2IFTA 5HRUA 5KNBA 1NG9A 1V9CA 1ISRA 4B3SB 4EYSA 4M1ZA 2VYQA 2PWAA 3G8DA 4EA7A 3GLIA 3E22B 4TL7A 3HXKA 1YHZA 3FB4A 3GJXC 3PENA 2AKYA 2I99A 3KJQA 4LC9A 4MVXA 4W5HA 4CMIA 3HYTA 1DCMA 4B48A 1UBEA 3QWFA 1JQAA 1ZJ6A 4YCLA 3GB9A 5GTDA 4RHCA 1V3TA 2RGBA 4QC2A 4QJIA 1N7IA 1PFYA 5EC8A 2B37A 1SH7A 3EN0A 5A9RA 3OX3A 3NTUA 2C4VA 1P4RA 2DKFA 3AWDA 2VNHA 3JAWB 1ZOSA 2D54A 4ZA2A 2BR3A 1ZK4A 1T43A 2X1MA 3GPIA 1CQWA 5DH9A 3G82C 1CZOA 3MWYW 1DC7A 2H1CA 5BSGA 1KZ4A 2PMWB 2R4UA 1GYQA 4QYSA 3E2IA 4URXR 1DI0A 3E4CA 2DUNA 2WM3A 2ZTMA 3I83A 4PR3A 4UM9D 3RVLA 1CS4C 2XMSA 1MFZA 4IM7A 4AJ9A 4EAQA 3VHXA 5KB3A 1Z4IA 3HU3A 4MQBA 5FDFA 1MF7A 3K8OE 1OLOA 2CHUA 4LX8A 1NFRA 2QTAA 4MVJA 3TLGA 1NW5A 1YQ9A 3Q15C 3A3NA 3HPQA 4F5ZA 1N2JA 1RPAA 3K4HA 3J7TA 4L5CA 3UWSA 2KWIA 3ISJA 3CX8A 2NVWA 4C5AA 1JIKA 2QE7D 4E6EA 2WFZA 2V3WA 5KOIA 2C95A 1DE0A 1NQVA 4GVXA 2J3MA 3ANSA 1ISIA 3CW2A 3F5FA 1Z12A 4HS9A 4MQEB 5DLPA 1RI5A 3WIOA 4CW7A 4BNHA 2XA2A 4I1VA 4MRMA 4OXIA 3I05A 3C2QA 3T1TA 2FZWA 2QGFA 3DZFA 1ZGJA 5FRDA 3W9SA 1VBFA 4J03A 4OI2A 3HBMA 4QICA 3UHPA 4FQ7A 2V5AA 2HJWA 3ZPXA 4V1CI 5IJWA 1I1OA 2BJWA 2FLVA 2P62A 5IFLA 1BNCA 3U3DA 4YIHA 4RQUA 2ZRCA 4J4TA 5J3JA 1NURA 3MHPA 4IUCS 4MS3B 1Y48E 1ZGCA 1WZNA 1M34E 3FTNA 2LWIA 4FGUA 4WXPA 5M3BA 1TW3A 3KPVA 4BMOB 5H9WA 5IHXA 3AUTA 3E3MA 2WWVD 5LZ9A 1GZ7A 2IIPA 3CZMA 4X3OA 3DGFC 1FSZA 3HKCB 4HNHA 4K87A 3UYKA 3WB2A 5BMOA 3K70C 1WHTA 3PICA 1KAQA 1Z4KA 3DEJA 3DQPA 1DWUA 4M54A 2AG0A 2FPLA 2XXAA 4D99A 4ZU3A 3K8YA 3PFCA 4Q4AA 4XFDA 2WM9B 4EGQA 5AJZA 4ERNA 1VGQA 2QR5A 5JANA 1YCFA 4DLTA 4DN6A 1JDTA 1YVDA 2XOEA 1SCNE 4LY6A 3S5JA 1A04A 1HEYA 2YUIA 1M2HA 2P4SA 3OM1A 5BYJA 1TTHA 3ZYCA 4NMHA 4ENTA 3NKVA 1AC5A 3HCCA 4OUDB 4X60A 2DBZA 2FMHA 1F8GA 4ECAA 1VIAA 2G82A 1VB3A 3E2PA 1IVSA 2E3JA 2NO4A 4I50F 1YRQA 1M2NA 1T8RA 1U3GA 2AI2A 1KI3A 3MBIA 3OHPA 5TMEA 3SR0A 3V32A 4AJOA 3BAZA 1SXQA 5G0WA 3Q3EA 3T61A 4EATA 3QJ5A 5I9MA 1I3NA 1P4HA 2XCTB 3G5UA 4C4RA 4E09A 3A9CA 5K3FB 3K2IA 4G8JA 2W6ID 2JARA 3R44A 3WYCA 4V2IA 4RPGA 2H4FA 2GZ3A 1T2NA 4E31A 5AM3A 2XVYA 2CLLB 1EUDB 1GPMA 3Q2OA 1Y1LA 2QQGA 4FGWA 5KTNA 1BCRB 5LD2C 4TQUS 2D2VA 3MCZA 3N6RA 5EMJA 4RPCA 4UBIA 3NTXA 4B8WA 4DWVA 4F7DA 4RDXA 5KVCA 4Q82A 1CY4A 1L7DA 2ZYRA 1HZZC 1W52X 1D1SA 2PM8A 3I52A 1DKLA 1U5BB 4URHA 4WLUA 3SF8B 3T1OA 1BRTA 2W83A 2X41A 3BB4A 4P4NA 3FLEA 1DU4A 2H54A 1VE5A 3ACBA 3KSMA 4O08A 2SCUA 3TMAA 3TINA 4DJFC 5ICGA 4URYR 3KB1A 3LYHA 1KI7A 1PJLA 1RS0A 4KR6A 4LF6B 1ZIYA 2C9BA 3AR5A 3IPCA 2R6ZA 3NKFA 2HO5A 3LX6A 1JG3A 2FSFA 3EZGA 4R01A 3UC5A 3DWGA 2Y6UA 1XEWX 3DMGA 4N0EA 5CT8A 1YJAA 3INGA 3P26A 1EHIA 1EVKA 3PFHA 3FMGA 1PWZA 5ITSA 1L5QA 4UU1A 4HFMA 4L8VA 4Y2RA 1XA0A 4R2XA 1M34A 3DAGA 5E1BA 1DAMA 2VQSA 4RA6B 1Y7LA 3OETA 1I5RA 2TECE 5CA0A 2NNWB 2PZBA 5BQXA 4K46A 4WY5A 1WG8A 1W48A 1DWQA 1JIIA 2UXCB 3ZCXA 1NPDA 3GLHB 5IZCA 4HNAA 5GINE 3QA9A 4B3GA 3IR5A 3JQFC 5KQPA 1VKNA 3BVPA 2W2KA 2EX4A 1YI0A 3LWDA 5TVKA 4ND8A 4YJFB 3ZKAA 1IOVA 2DPMA 4BLOA 1JB1A 2C5GA 4OFXA 4FKBA 2IZ5A 2A6PA 3AB3A 2OP0A 3TEJA 2WWXA 3CH7A 4FZRA 5J2UA 3D02A 2NO9A 3T34A 4MW6A 5K0GA 4BVGA 2JI6A 2H29A 1B15A 1DDOA 4LZOA 5CT5A 3IVAA 4WASA 3M83A 5DGTA 4CQNA 5A3RA 5K0JA 4JI4B 2R44A 3U4QA 4B5LA 2IP2A 2ZRAA 3LHSA 3A1WA 1BFKA 3BGWA 2HDWA 1ATIA 3OFSA 3C5EA 4OXKA 2FEOA 3GLUA 2QB5A 4I81A 2X4IA 2FLWA 2HTEA 3ROFA 1PFWA 3MT9A 5FI3A 2BYTA 5HTOA 1SIUA 1JFFB 3Q7QA 4HLDA 4GWLA 4D57A 1N2SA 3IOMA 1IWBB 3HYNA 3IRVA 3OZDA 4U2EA 4IGAA 1ZUWA 3BXZA 3DOIA 1ILWA 4KI7A 1L5HB 4CMJA 2P79A 4QG7A 5SYNA 4B5KA 4V03A 5CJ2A 3AH8A 4FUTA 2IXBA 4QDUA 5FR1A 4EI9A 1I1QB 5I7RA 3I37X 3BDIA 1J0DA 2I1WA 1ENYA 1V2GA 1N9GA 2BZ1A 2X42A 3GRAA 5DCUA 3UHJA 2CFRA 4TZ0A 3WLAA 4M87A 4UZFA 3UK1A 4C9BA 4Q24A 5F9FA 4COOA 1AS3A 2JI4A 1OV4A 1V9SA 4ZVPA 4YLEA 4R71A 1RWVA 1D4ZA 2W0MA 2IC5A 3M81A 1J0XO 4D80A 4XLZA 4D9MA 5TT1A 5IKOA 4DLLA 1L6RA 1L9XA 1QUEA 2R7MA 3L1HA 4DM7A 4A6DA 4EGAA 2B99A 5B3KA 3KTAA 1HTWA 5F5NA 3U44B 2QTMA 2CDNA 3VV3A 3MJRA 4FI3F 4DMHA 1FXUA 1D2AA 5CLJA 2XA1A 4M0PA 4ZO8A 1WZ2A 4LV6A 2YRXA 3G2KA 3DHEA 2CJYA 3V9AA 4D3ZA 5I7OA 1LV7A 2J67A 4N3GA 1W36C 2ZZMA 3NWJA 3N1UA 4D4MA 2REQB 2V3CC 4C7OB 2C94A 2BL4A 1PDWA 2O0KA 3EBOA 4P80A 4X1YB 3QX7A 4G0PA 4U3JB 3T41A 1T0JB 5FUQA 4FBMA 4W5JA 2QM8A 4J94A 2QP9X 5GGYA 3IDFA 4RLQA 3PS9A 2A9OA 1ECGA 1AXRA 1FVHA 2X13A 3EDCA 5JALA 4MS1A 2IYAA 5WRFA 2GPSA 3GV0A 4LDQA 1GIAA 1E7WA 3V8MA 2Z9CA 4K03A 2MMGA 3AEUB 4EYOA 5KMGA 2AYXA 3CNLA 4LHYA 3L84A 2HH9A 2ZJ2A 1IXKA 2DZDA 3WGQA 3QMVA 2PX4A 2GJ8A 1I2ZA 1KKLA 2VAMA 3L6BA 2VQFB 3I76A 3FDJA 5FAXA 2B2CA 2WJIA 3AFNA 1WD5A 4BO7A 3VOSA 1DB3A 5DHSA 3NB0A 2QLBA 4G1VA 1DIRA 1C29B 1YFKA 1N2BA 2E6KA 4ZV9A 4ZVSA 2KS6A 4HZUA 6ADHA 3MM4A 3OX2A 1J8FA 3O0DA 1FFGA 4UOQA 1GKUB 2AGVA 2F1HA 5JAQA 3NBQA 3SBOA 3D5TA 4ALLA 2RC6A 3RTAA 2B7BA 4JDPA 1J06A 1IBSA 4KJXA 4Q3DA 3UJNA 3HVRA 3EIFA 5A4MS 2CFIA 2R6CA 2VRWA 3WYGA 3ESQA 3LUBA 4KXLA 1E1QA 3N0WA 3LCJA 2HUPA 3KT6A 4L50A 1CRLA 4FLMA 3B12A 2QTNA 2Z6VA 3ASUA 3L4EA 2R25B 3KEMA 5JATA 4KVFA 1SKUA 1P62B 3BQMB 4X66B 3LO8A 3R9KA 5C3MA 1XJCA 1ADCA 1P2DA 4HDNA 2P90A 1M7GA 1HA3A 3ESZA 3BGOS 4RVFA 2HQ1A 2Z5GA 3BRQA 2EZ8A 3L7JA 2Z8ZA 4WAUA 4DQUA 2EW8A 3SHQA 5IF9A 4B4OA 3KQLA 4HPXB 1E20A 1K7YA 1X7HA 2GF2A 2XB2A 1WW8A 2XTNA 2GEVA 4PWZA 4ZI7F 3OZUA 2WV7A 4EL0A 5H81A 4ZZIA 2OUKA 1KMMA 2V5UA 5ES3A 4D2IA 2WLTA 4NH4A 5FUWA 3TTTA 1ZI6A 3DSRA 4UCWA 3JWPA 2IBSA 3GUYA 5AMXA 3U7HB 1U9YA 3NWBA 1LTQA 2WTXA 3BGSA 4G09A 3EJWA 4KQMA 4N5IX 4XYEA 1M1YB 2QRHA 1NDHA 1QZUA 3ZWMA 3HYLA 4NABA 3T3MB 1Z6ZA 5B58C 1CUUA 1FVOA 3A32A 2DWOA 3X1MA 4ZCLA 4D9NA 2V4MA 3COZA 1JV2B 1KVSA 3K1AA 1OT3A 3R5JA 2ZUSA 3LGSA 3NXSA 4MVJF 5ALDA 4D79A 1FRNA 1TCBA 3DTVD 4YV0A 3MMNA 2C9CA 3R0JA 3K7EA 1ORWA 2ZKLA 4I1SA 1EZ4A 1WKBA 1XMPA 2OZEA 3GJZA 1BQ4A 1PS9A 2ZDQA 3IS3A 4IJQA 4ZMRA 2G28A 1TA9A 4LQ4A 4ISCA 4MWGA 3VR5D 3NHYA 1CJSA 4K5QA 3ZQ6A 4RD0A 1JJFA 4NMLA 3DDCA 4TV9A 4EW1A 4MVCA 5DNUA 3PTZA 5LCXA 1Q83A 1AV6A 2VF7A 4IJ6A 3RC2A 3REQB 5EMHA 3AT1A 4EA6A 1JGTA 2BFEB 3D3WB 2BOVA 3U7EB 3EVCA 3RVSA 1QYRA 2NQ2C 1YZNA 4WPGA 1P2SA 4X1IA 5KC9A 2VT6A 4EA9A 2V7EA 2DHCA 1QQBA 2ACWA 3CUSA 3DUFB 1UADA 1ZJZA 2GO7A 3R7SA 2JGMA 1T5BA 2EBUA 3ITNA 3L4BA 3GGPA 4NONA 1JHXA 4G26A 1JWBB 4TLEA 4YAKA 1UXGA 2Q4EA 4MV8A 3M4ZA 3PEVA 3PYLA 1NBEA 1PZNA 3HM2A 4FMPA 4R9SA 4XGKA 3ZY5A 3QW2A 1IZ0A 1UPCA 4DBVO 4EFDA 2TYSB 1QH1A 3CB2A 3GRCA 1PL0A 2EG9A 2H2IA 1IJKA 5I3ZA 4WKCA 4LPSA 1TA0A 3E3NA 3UY4A 3F4KA 3OO1A 3KLMX 2QZSA 4L9AA 4FBGA 5DNAA 2ZE8A 2G4LA 2YMLA 4C7MA 1YT5A 1AE1A 4Z0TA 1U02A 2DMRA 2NO0A 2VBGA 3BSFA 5JR3A 4NCHA 5BYBA 2ZB7A 2ZTHA 3JVVA 4KBFA 4UFNA 4N5LA 1OV6A 3C6ZA 5AJUA 2Z09A 4Z9FA 4P3PA 5JD3A 3NWEA 4NE2A 1Q92A 2RGUA 1Z68A 1NVKA 4K81B 4RGQA 3ZWYA 3RU9A 4FDTA 2ZSBA 4OQXA 3IPRA 3IC5A 4P0QB 4P81A 1PDVA 4RZSA 2C59A 3OCCA 5CBPA 1RTKA 1B0AA 4YX9A 4AY3A 1PP4A 2ZW9A 3IDAA 4L4UA 5GZ1A 3KQOA 1OBFO 2CHGA 5EJIA 1OAOA 3KKZA 3A28A 1VMAA 3K0CC 4ZV7A 3TLMA 2HIAA 3JTEA 1PNRA 5GJBA 2YWEA 1XVAA 3G0OA 3TB6A 2AOVA 1TLLA 2GCGA 2EFHB 3MQFA 3QM1A 4RMGA 1KZ6A 4E4RA 1Y3AA 2FMUA 4GPD1 1UOOA 5ARCA 4AX8A 2HGZA 3AEYA 3JD1A 1YB6A 2FZEA 3BA1A 4J4BA 1L5HA 4DTIA 4FZ3A 4ZCTA 1KQGA 2V1UA 3LQQA 3NT2A 4XUDA 4B4VA 3OTOB 1DWPA 2ACEA 3ONVA 1C7FA 3G0BA 4MDYA 4BUJA 1PVVA 4NMWA 3EVTA 2AR7A 2EXXA 4R41A 2X2OA 3SLGA 5BWOA 2R47A 4IDNA 2QRVB 3IJPA 4ZAWA 5C0OE 1OUMA 3W6ZA 3L8YA 3W2IA 1N2CE 4NJEB 3ODGA 2OD9A 3AL2A 4QGHA 3MMXA 3RVDA 2VN8A 2OO7A 4P4TA 1FFBA 5GP1A 1ZH4A 3QU4A 1XTUA 3V42A 2ZUFA 1U7PA 1NLFA 2IXEA 1LS1A 4C4XA 4DJDC 1QP8A 2PVSA 1XVIA 1TZJA 5KWVA 3I3OA 1L3IA 3E7DA 3NBZC 5FWAA 3ZW8A 3MQ2A 1RLMA 2F3PA 4I19A 1SBNE 3CMMA 5B3JC 3IIMA 1R3DA 3RFXA 3AI7A 1ZM7A 2ZAMA 2ZI3A 2DWQA 4R3NA 5JRZA 1PWEA 3OQ1A 2R79A 3UKOA 3ENVA 2NXJA 2WJJA 2XI4A 3QE4A 4EX7A 1QMPA 3ZV5A 3U7GA 3QEBZ 3PFWO 5DW0A 5FOTA 4LYJA 4DA0A 2AD5A 3P9ZA 3CX6A 5BOSA 2VT3A 1K0UA 2VHZA 4KPGA 3ZD8A 2PBLA 3ZJYA 2O3TA 1RRGA 2WU8A 3UTDA 3I6QA 5LZ2A 1IXYA 1MC4A 3K2QA 4X93A 1A5TA 1N8SA 2AVDA 3U5ZB 2V4ZA 4RACA 4DPKA 5AJTA 4LK2A 1RI1A 1VCIA 3H0CA 1CPYA 1PZXA 4IP0A 3BHNA 3VISA 5I9NA 3KCNA 4I14A 5K8IA 4G4SO 2C8JA 3EOBI 3FTPA 3GPCA 3HDQA 2R00A 3OWHA 3ZQ4A 4F97A 3PX7A 1O87A 4BVKA 1WHSA 3F7MA 2Q0XA 1QR2A 3E8MA 1DP4A 3VKGA 3KOOA 4REMA 2Q8PA 5DV9A 1SZDA 2C78A 2OCPA 3ZDEA 2HL6A 2AJDA 4DV0B 2ZUVA 3FSJX 4MZXA 4R3UC 3ZY3A 1BS9A 1T9BA 2J5BA 4G5SA 4Y1GA 1GPDG 4BMXA 3R0IA 3VDQA 2PKRA 1GGMA 3DAOA 1E1CA 3DCYA 1FRQA 1UK9A 4FGJA 3DTYA 1T4GA 3L6DA 1FFHA 3O90A 1CEQA 2OHXA 4HAOA 4UC0A 5BWCA 1H2EA 2PUCA 4R9NA 4U8GA 1D6SA 4YK7A 4DC9A 3PXUA 5BNIA 3AR3A 3L8MA 4KRYA 4EJ0A 3K5WA 3MWEB 1IIBA 3EIXA 2ZJ1A 3USES 2Z58A 5KOHB 4JLAA 1OKKD 3OF3A 5HKAA 3CFYA 3GRRA 3IMCA 1OTHA 3OURA 5HZGA 4JP3A 3D2BA 3AEKB 3CSUA 1SIBE 3GYBA 4L5BA 3ZLUA 4YRDA 3NDBB 4MWDA 3QOWA 1A9XB 1P3JA 2E4AA 4A3SA 1UKAA 3NV9A 3TAHA 2EZTA 1OF1A 2Q3FA 5A3QA 3T5CA 3ND6A 3W78A 5LIRA 3WMGA 4CTKA 1AO0A 4S24A 1H4QA 1CUFA 3ZLBA 1ZZEA 2E37A 1GCOA 4NJOA 1QRDA 3HO8A 4JLBA 2WG1A 2WUEA 5JROA 5LP6B 4II3A 5DNWA 2RAVA 2OO3A 3OLWA 5EUBA 4R7TA 3FFWA 3QPWA 4F0JA 1XMXA 1RJGA 1PTJC 3KUKA 4EHJA 5ANRB 3CX3A 3EBLA 1FUKA 4WNCA 4CEHA 7GPBA 1CUYA 3UXYA 5K0TA 2PT6A 2W6JD 4Q0MA 2ZYAA 3AUSA 4CIBA 3DDWA 3KZKA 4QU8A 4QDKA 3WK7A 3A6DA 2R3SA 2IELA 1ECPA 3V1YA 3ZU3A 4E2ZA 1I7NA 1T6BY 3RSGA 3GPBA 2GCNA 4S0XA 5EKSA 3I04A 5CMLA 4ZGWA 4JASB 1PR5A 3NG1A 1NXVA 3HXPA 4PSCA 3Q8MA 3QZUA 2EU8A 2ET6A 3AY7A 5DIZA 2JI8A 2W2VA 2B4QA 2FN7A 2QQFA 3DMTA 3NV7A 1N8NA 2B8JA 1C7QA 4DLVA 1QP0A 2YVAA 1QNFA 3CMCO 3EZ7A 4AO7A 5A9SB 2WI8A 5CHEA 3E9YA 3QIAA 4L07A 1M9NA 3AP3A 3U6KA 4K6OA 2BCEA 1BOFA 4K6FA 4IOKA 1F5NA 1IBRA 4MCHA 2H31A 3DLAA 1VJ5A 4YT8A 1JR4A 1XNRB 1JZTA 1GVHA 2CDRA 3FCYA 4J8PA 4IDQA 4PQEA 4CTNA 3KLPX 2R8PA 3CUKA 2E18A 2YJ3A 5M2QA 1AV7A 2HREA 1WOMA 2OY0A 2NVUA 1RWQA 3JVIA 1GL9B 3FMVA 2KJQA 3MIIA 3NUZA 4MB0A 4YCMA 1FPQA 3QU9A 3UK7A 1IQ0A 3ESXA 3W8NA 3BX1A 2W2LA 3EPHA 2CWDA 2Z2XA 2QJOA 2G63A 3ICPA 4JMPA 4CF6A 3RS2A 2NZ8A 2YFHA 1Y7HA 1NU6A 1ZQ1A 1K8ZB 2P65A 3OT4A 5AM4A 3RM3A 4B6JA 4FDMA 1XDWA 3WX0A 1ZSYA 2AQIA 2BF7A 4JT9A 5LUBA 3IUQA 5CVDA 3ROMA 1JDBC 3VHLB 3RK0A 2XYPA 3EIOA 3K0BA 5EQFA 3IXLA 1X7WA 3HYRA 2WB2A 3G2PA 4JUAA 4Y7CA 2GASA 1SNYA 3S27A 4J16C 4UDOA 3NHJA 2G5PA 1E2PA 1O97C 3BREA 3LGXA 4N41A 4G23A 3NDRA 4G1FA 2HU8A 4KDCA 2ZZKA 4DL9A 3CR7A 4NCIA 3U19A 3DPUA 1UIMA 5KAPA 2D7DA 5AVOA 1A76A 1QVVA 5IVHA 3KFLA 1QXSA 2ZPUA 3A2NA 2C7GA 2FFJA 1KEEA 2OLKA 1CFJA 1OH8A 1IU9A 3W90A 4U7PB 3D9QX 4CMKA 2JC3A 4XQCA 1QRAA 1KU0A 1YR3A 3IYLW 3SIXA 2VDPB 3LT0A 2YIMA 3BA6A 1FFAA 1X13A 2I03A 4WLFA 5GZ3A 4NS1A 2IUSA 3T7CA 1EQAA 1JW9B 2IJGX 1K5GA 1SWVA 2QNBA 3ORSA 3C4VA 4MDHA 3RWOA 5IUJC 4MSUA 1E9VA 2HPZA 2QIPA 1C9MA 1NYLA 1SKYB 1CVIA 2DR3A 4RK0A 1Q6YA 4YI5A 3CJRA 4ILKA 1K4YA 3EDYA 3GK3A 1B0UA 1ZAKA 2XUJA 2ZSDA 4KYVA 5IW8A 4U7JA 3PNKA 4B85A 3BXEA 5JAOA 4QNRA 2E6UX 3THWA 3JQ6A 2HIGA 4WDRA 4GU5A 1RJWA 4IIEA 5DF1A 5H9VA 4EZEA 4F46A 5FBRB 2XRZA 1TYDE 3FH0A 4WACA 3V55A 2HYIC 1GT6A 3B2EA 4IGFA 3WK5A 2FQWA 1PO7A 3FGPA 1CR1A 3FOWA 3TM4A 1NR7A 4IIDA 3IKJA 4AK9A 3LPAA 4PTYA 1G7SA 4PYMA 1SVMA 2XDYA 3AY3A 1ESZA 2H2AA 3RS5A 1KYQA 2VSNA 4V0RA 3C41J 4JP2A 3LL7A 2VQDA 4E5UA 3A4VA 3PDIA 3UAZA 4AP9A 2FG7C 4NYJQ 2YY6A 4Z53A 5GY7A 4FYIA 2MYNA 3MMSA 1LV8A 3PJGA 2XTMA 5E9JA 1Q7BA 3RYIA 4JITA 5CT4A 3A6FA 4CUKA 1P75A 2ZT7A 2NSHA 4GR5A 5EN4A 1SG6A 2HSJA 3ZQJA 2VG8A 4EW3A 2G8NA 2FSHA 3L8GA 2B25A 4J76A 4X85A 3FPGA 2OFFA 1X3LA 5B6IA 1F6WA 5MN6A 3KSZO 5LQUA 4CVNA 2O7SA 3LV8A 4JKIA 3OJWA 4WTOA 4WE3A 5JSQA 4MQFA 5HF8A 1YJBA 1PG0A 3WNCA 5IEBA 3N2GB 5JH7A 2BGWA 4YJDA 3ANLA 3IVXA 3MTJA 4ZOEA 1HE8B 3QV2A 3EZ6A 3VQTA 1XQ6A 4Y2HA 3HJRA 2G9ZA 4B8YA 1COWA 3I01A 5EHQA 2J9XB 3PWTA 3Q0EA 3I5AA 3KAQA 2VK2A 4BVEA 1UEIA 4KQCA 1NXTA 1ISPA 1VCMA 4NOLA 4UHHA 1DKMA 4H6WA 4YMSA 4HNVA 1IG0A 3HADA 1I0LA 4AIRA 3DOHA 1YB5A 3LK6A 4EECA 1K97A 4R68A 4G0MA 4DZZA 1A9TA 4DJAA 1MQ9A 2VKTA 3CRVA 3L7MA 4FI3C 2HCBA 1TX4B 4A2QA 1CRQA 4PC6A 2CUZA 2LKCA 5G4KB 1YS4A 4A8JB 5KYNA 1AB5A 1J2TA 1W0KD 1RADA 1YFJA 3LMKA 1Q7CA 4TRJA 1WXIA 4CM3A 5FWNA 5DP2A 1BE1A 2IIQA 2FWBA 1EVLA 1EFVB 1YI8A 2QUKA 3CZ5A 4RSMA 2OWDA 3AFOA 4G0XA 3FPLA 3WK6A 2VSXA 2VNIA 3SYKA 3TN7A 2O2HA 4RD1A 4MARA 3N74A 4YCDA 5LN1A 3E1SA 5EGSA 2H85A 4A8TA 2QZJA 1DZIA 2JAOA 3B9PA 3DLTA 3DA8A 5LYJA 2BH2A 3TDKA 1MO4A 3EPPA 1FUYB 1N0IA 3LZCA 2ZQ5A 4LV8B 3WGOA 2DUWA 1KPHA 3OFNA 4QOIA 4AT1A 5BV7A 2H3EA 3TBFA 1XKXA 5JYDA 5E2BA 3AVUA 4IDHA 4TL6A 3IL2A 1AD2A 1XF9A 4HN9A 2F55A 4Z4QA 2HV8A 1LA2A 5J2TF 1WXDA 1P4GA 4P82A 3L6OO 4H7FA 4BWFB 2EQBA 1CNEA 3BL8A 3W9YA 3EVGA 3DW3X 5BN1A 1QG4A 1W6UA 1WUTA 2O2DA 1G20E 2ZYVX 2A7XA 4PPYA 4QPDA 2D5BA 3SEAA 4GR9A 1H66A 2WT8A 3LQYA 5BW6B 5ENDA 1KDTA 1U3VA 2GTPA 4L72A 2VFAA 3VV2A 4EPVA 2C04A 3L8DA 4XRGA 5A9SA 1VLMA 1LFAA 1P7ZA 2Q1SA 3DTVA 4ZWNA 2JLZA 1UWKA 2DPXA 2XJ4A 4TZKA 3W5CA 1KY4A 1Q95A 5JYCA 5JDIA 4MRNA 2E4YA 4PGAA 1Z13A 5EG5A 1IHOA 2DFPA 2YIJA 3AERB 4LJKA 4PM4A 3OAAA 1NNSA 2FTKE 2YNMD 4JYCA 4JX9A 3OPQA 4B4WA 2PRKA 2FYTA 1WUYA 2Z9DA 2JRCA 1TUGA 4R1UA 4X6YA 5DRTA 5FPPA 3CCBA 4MVJP 4NK5A 3I61A 2XF2A 2V55B 4P58A 1P45A 1U2PA 4X91A 1H1LB 1XYGA 2Y1OA 4G9BA 2JBAA 4CCYA 3GFFA 4RMIA 4G37A 1YVPA 4PBSA 2ANBA 1EB9A 3IKTA 3S5UA 5AUQA 1WMDA 3FYTA 2HZBA 1E2DA 1U7OA 2XV1A 1SBIA 4DNFA 2C97A 3H18A 2A9JA 3H5LA 3VNSA 3AFIA 1OXUA 2R11A 3BHMA 4ZOAA 2ODAA 4DY4A 2LUOA 4LTNA 2XUKA 4KWTA 4WCFA 3TRIA 1OROA 3GLIB 4EPWA 1Z6YA 3KKNA 2GAFA 2I4TA 4K6HA 4OLJA 4EKEA 3L8EA 3E9QA 1ZESA 4J0JA 3VU9A 1ZU5A 4R54A 1CYEA 2ZE7A 3F74A 1BJTA 2R48A 3ZE9A 3QE3A 2Q1XA 4J0CA 4YO8A 3WAJA 1X1DA 5H82A 3ZBPA 3K0AB 4I8IA 4IQ0A 2PFSA 1CS0B 2QQ5A 1OAAA 5EOVA 4B47A 3P2MA 1N5DA 5CR9A 4DLAA 4YTEA 2BPOA 2G36A 1K5DA 2C0PA 2CGEA 1RT9A 5IC5A 3RASA 5I8ZA 4BVLA 3OI7A 3C3XA 3DHWC 4LJ6A 5EAIA 3VR1A 3TSZA 2W2NA 3WWPA 1Y4SA 3P9YA 4CM9D 1S2LA 2XMDA 1QC5A 2AQKA 2V6FA 3AKCA 3GOQA 2IV7A 5U9CA 1ZIDA 2FSGA 2JBHA 4PPGA 1E2LA 4L73A 4C7VA 5IN5A 1DV2A 1B1AA 2VPZA 3LCCA 2P6OA 1DQNA 4N6GA 4QO7A 3NCTA 2QM7A 3DL0A 5TLSA 3SC2A 1HFEL 3FE2A 4D3DA 4U39A 2O8EB 4DR7B 1NXSA 1GA4A 2XY4A 2FSUA 3AEKA 3SFZA 4GLFA 5EMNA 2H11A 1XVVA 1GP2A 4DDUA 5KYTA 5MN5A 2AHRA 1XZJA 2ZDHA 1U6JA 2J3JA 3NGMA 1Z33A 3BE6A 3QEJA 2AJBA 4LQCA 4MS4B 4AJLA 2OZVA 3GIDA 3KYCB 4UCQA 4YCBA 4EDHA 2QPLA 2XA9A 2M6KA 4LBYA 1NN0A 4Z8YA 1EQUA 4JJAA 5EQJB 3H9GA 3PDJA 3NBAA 2AZDA 3ICWA 1ZOOA 1NVVQ 5CEFA 3C5HA 1CTQA 5DISB 3BMOB 4ARAA 2EYQA 1HNNA 1QK5A 3PYXA 4JU9A 4TPKA 4G0ZA 3OA0A 4GF5A 2I87A 2PMDA 1BCSB 1I6LA 1U7DA 4IOJA 1LBSA 3AETA 2XSZA 1VL2A 3ZW9A 3W1EA 4XSHA 2JLSA 4LWOA 1HTTA 3TL2A 1Y6RA 2ZB2A 4BV8A 1ACMA 4PIVA 2NO1A 4C4AA 2ZXEA 2OKGA 3X1XA 1SXPA 4GBJA 4CL0A 9LDTA 2QP4A 3CVOA 3GHYA 3BMCA 4I1RA 2C88A 4MVJM 1HUQA 2BM1A 2EERA 2PX3A 4L85A 5E0OA 3V7NA 3HTXA 2OBBA 8GPBA 5LP6F 1QLJA 3KO8A 4L9SA 1RKQA 3V33A 3IUEA 4KKXB 1YA4A 1U8AA 4AKGA 2QD3A 1JDSA 2Q3DA 1PGJA 2WNHA 2RIPA 2DHDA 1BJKA 2RK3A 3DPSA 3H9EO 1RI2A 1UBMS 2AG6A 3PV0A 4KUEA 6Q21A 1HDYA 1Z2OX 4IF4A 2DQYA 2R8RA 1VKHA 4YR7A 2WJAA 1SVSA 4R5HA 4TV8A 1YZKA 4CR8A 2R8BA 3WLQA 4H08A 2XCSB 5IJ0A 3QLUA 1MJGA 1V96A 3TZHA 3VPFA 3DE0X 4BNWA 2BTEA 1FFXA 3G2OA 3H97A 1P7YA 1QKIA 4QUDA 3SU8A 5IZ4A 1UL1X 3NBMA 1VCOA 1AXGA 2NTNA 3WO0A 4F2GA 3CLUD 5EWMA 2CL5A 2H4XA 3KUUA 4EG5A 1JSXA 2OFWA 4AF7A 2V03A 2PG3A 1IN7A 1A98A 2YY7A 4BNJA 5ITWA 4QJ5A 3RARA 3NIBA 1JEAA 4HEA6 1NN5A 3H9QA 5KJCA 2QV7A 2QLNA 3ETLA 3ORFA 3IXMA 4Q1CA 2QL6A 1JPUA 4Y9RA 3RRBA 3T6KA 3AOEC 1C1YA 2EHJA 3J81k 2CK3D 2CDCA 2LCIA 3SHTA 4ENUA 1OWMA 2C77A 2CKDA 2XUDA 3RYFA 1ENPA 1QYCA 1Y3FE 2Q1YA 3D8UA 1PBTA 4UASA 1AKRA 1VLJA 2YVLA 3W0LB 3BMQA 2J6BA 1PWYE 2R751 1I4EB 2O3QA 2XKBA 2N47A 3PU6A 3H5WA 2DBRA 2FGJA 1U1GA 4XM1A 2VJYA 1SKQA 1NXXA 1VLHA 3K9CA 5JU6A 1YCGA 2FEXA 5DBOA 3EEYA 4UMDA 3IUJA 3HJHA 4DR5B 2I3AA 4UXJA 2WF7A 3WRXC 1B3BA 2XUIA 3HNRA 5H59A 5IN4A 4HAXA 4WVLA 4YUAA 3FDZA 1DC8A 4PYRA 2IUUA 1X1BA 1CJCA 2RG1A 4HB3A 1SHTX 1Z8FA 3M7IA 1G17A 2IPLA 3RVQA 2FZ4A 2GNAA 1DO8A 2WWGA 2Y9MB 2EFGA 2K2QB 5A4KA 2A8YA 2CVPA 2DT8A 1XPUA 4DTCA 2GZMA 1NYRA 3WK9A 1HSZA 4BEBA 3LQRA 1BYIA 1T6ZA 3IMKA 1QRSA 5AK5A 1X15A 2D5LA 4Y30A 3T5MA 1SC3A 2HEIA 1WXWA 4N0MA 1R8XA 4UMEA 1P1BA 2EX0A 1U3TA 5K3OA 1AT1A 2B30A 2P6UA 3LQFA 2HHJA 3DDSA 1WXQA 4B6RA 1YTLA 3N28A 2ID4A 2TMDA 1XDUA 4RQAA 1MIHA 5JS2A 5KQMA 2OBYA 4WMLA 3FR8A 3BRWA 5GM1A 2NPFA 4EIWA 3K70D 3RAEC 2UZ1B 2ERYA 3EBPA 3JPYA 3JQRA 4HWTA 4O0LA 2NYUA 4PG6A 1N5RA 4QUEA 4EQZA 5JJBA 1AQNA 1Y34E 3OCWA 4KXYA 4DADA 2PZGA 1QHFA 2IGBA 3C5CA 2OYCA 5TMPA 4NPAA 2Y1FA 1JFVA 5GAJA 3NXKA 5A3VA 5E0KB 4B75A 5KC8A 1AK1A 2GVDC 4G9GA 4L51A 4X20B 2ZJ6A 5AJXA 4CM8B 4DLSA 1BEZA 1Q0RA 1CHDA 5DLQC 2VS1A 4XCQA 1PD1A 4AL4A 1QFXA 3NDJA 4QO8A 3VSDA 5H70A 2C2MA 1PYDA 1WB6A 4KG7A 1NQ5A 4I0WB 4DSNA 3SMVA 5F51A 4JODA 5EWLB 2QGNA 4F1KA 3O47A 2WSIA 3U3OA 2Z43A 3CPJB 2NMVA 3RJ5A 4Q5IA 5BNTA 1TC1A 2WU3A 3IR6A 4JU8A 3WWYA 5JY6A 1VPTA 4OSPA 3ZHOA 9LDBA 1T5OA 1ZR2A 3KVOA 3B1ZA 4HRYA 3RIGA 1Q1GA 1DQRA 3T3PB 3OFND 4DCPA 4NP6A 4YGYA 2C2XA 2IZ1A 1YXMA 1E92A 5A3SA 3RIHA 2B1JA 4NK4A 2ILVA 5ER9A 1ZRHA 3I4LA 3RK1A 4GVLA 1S2DA 1XD2A 3P19A 4DCSA 2H7CA 4OI0A 2VHXA 1LSOA 3HGMA 5AW9A 2HDHA 3I0MA 4F21A 3CB4A 5HM8A 1XQ9A 4JB0A 3GP8A 1JDZA 1UM9A 3LC2O 1H0HA 1CR2A 4W5WA 4JI5B 3CHYA 3H17A 4XIIA 2NV6A 4MIKA 2PK3A 4PX5A 4D4IA 4FOOA 1ILEA 4CT4B 4D6YA 1X0XA 3D7NA 3SQXA 4RF3A 1JR2A 3N8HA 4TN5A 1ZH0A 1P2TA 3R77A 2DR2A 3N3BC 1ZGBA 3A58B 2PTGA 3FVVA 4B6EA 4N48A 4ARUA 4O6VA 1J2UA 4G81A 1YI1A 4EX6A 3PGJA 4EQ6B 3ZX4A 1E1MA 2VDWA 4L78A 4B8ZA 4KQ9A 4S0ZA 4BGIA 3GFVA 3BF8A 4L4YA 4QBTA 1ESEA 2YV2A 3LKZA 3Q7SA 4UTVA 3H5NA 4WK4B 4L57A 4EEKA 3D4BA 1KO7A 3DB1A 1M67A 2ONJA 2GO1A 3ZV6A 3RRJA 4BATA 4KNYA 1Z6AA 5CLGA 4NBSA 1ZONA 1V95A 4UUOA 3L7CA 1M72A 4WZZA 4OU5A 4F8YA 1VBMA 4YMIA 1LLDA 2H63A 3STYA 1M1UA 2CHVA 1KY2A 3COVA 1G3MA 1V1MA 1O4VA 3ILYA 3V7YA 1RZUA 3IAXA 4JAVC 4X3CA 4OB7A 5U4QA 3NP9A 2C7VA 2OILA 1CUDA 1NI4B 5CFZA 2ZTSA 5JMOA 1I4TD 2ZRFA 3EC2A 3BFJA 1DKNA 3CLSC 1LWOA 3L7LA 4D42A 3RTBA 2HQBA 3NH6A 1GDTA 1P9RA 3UMGA 3CLUC 4LYGA 5I7HA 4MWOA 1GITA 1PK9A 2XUGA 5D7BA 2H08A 1C4OA 3PXGA 4B87A 1A4IA 1A50B 3U6BA 2R1VB 4NH0A 4JC4A 4IOMA 1N1MA 4DF3A 1AH2A 5JY1A 1FMTA 4XJSA 4O8ZA 5BR8B 3EYWA 2OCAA 4WLNA 2BIFA 1EUCB 4BO0A 1EG2A 3L18A 4E51A 4ARVA 4CM9A 1N3LA 5JSHA 4INAA 2VEDA 2A2ZA 2OFPA 2WHRA 4U2DA 5CX1B 1ZGZA 4ZAVA 2BKEA 1Z17A 1PLJA 2P9YA 5JYBA 4NU5A 4EUHA 3VH2A 4N7BA 1I6WA 4E15A 4F1JA 1JJVA 3MFQA 1ZVJA 1SQ6A 5EHZA 5JS8A 4FFBB 5NULA 3ANMA 3DBLA 4G65A 1KK2A 2JJ1A 1IHDA 1SXJC 5JOQA 4DCNA 1FUUA 3IIEA 3WL8A 5MFZA 3O94A 3PFIA 3RHSA 3V2GA 4OJYA 5EHIA 2GJ4A 4C4YA 5IM4A 3TO5A 1F4PA 5BQFA 2A5YB 1AKYA 4RM2A 1W46A 1YQGA 3DAHA 3OPXA 3RE1A 1C3LA 1IAVA 3H1TA 4GPTA 3HZOA 4G0VA 5CFRA 3GP3A 4KR9A 5T4EA 3KZVA 4IVPA 3FPAA 4BJ1A 2AMJA 2HRZA 3HVKA 4B6SA 3QP9A 4C0HA 1L1EA 1V5WA 1BVHA 1VIVA 4URFA 1QX4A 1IUOA 2H9YA 1TECE 2IZ6A 3UAXA 1YDMA 1DPFA 1QDLB 2XBUA 5CDYA 3A27A 3IE2A 4Y2YA 2AKAB 4ETIA 3CS3A 5EE5B 2Q7OE 1EVQA 1UFQA 3CRRA 2TMYA 3T5AA 5K1ZA 4FJ2A 5ICEA 5ENVA 4L08A 4A91A 3ZDBA 3NTVA 1RRMA 2CY0A 3O9ZA 5IABA 1R9JA 3TECE 5J4HA 4F3CA 1TF5A 2QN6A 1T3SA 1SUCA 2A94A 3NM6B 3K6KA 5C4GB 4HUQB 2YYZA 3OLQA 4WGGA 3RCBA 4I5FA 4CBVA 5JSZA 1JR3D 5FL7A 1IVNA 3LPNA 1JSLA 2XMZA 4D5EA 1SZPA 1YRHA 3JWGA 5L3SB 1GQOA 2WA2A 1XEXB 2QN9A 1WV1A 3AFHA 3FCEA 5AKZA 5AT1A 2X23A 4HJXA 1BWQA 2N42A 2RGXA 3CISA 1WTAA 5JE8A 2H6EA 5BSTA 1NBOA 5B57C 5BN3B 5KSWB 2H5IA 2J8ZA 3O8OB 3WYAA 3NHMA 4N3AA 4O3MA 3FZNA 3R9WA 4A0RA 4EYQA 1SOUA 1QBKC 3GA7A 4UAJA 1TF7A 4C2AA 4DDTA 4YCAA 3VXKA 1S2MA 5DDIP 4CDNA 1SC4A 4EOGA 2CXXA 3GRYA 2Q4TA 2VJBA 4JSTA 2DERA 4A2WA 3Q41A 1E62A 1R74A 1F0PA 1JR6A 2QD5A 1CE8A 1S01A 1C7EA 1RXWA 3HB9A 3KUCA 3QGMA 1VKOA 2IWHA 3HLKA 2V5VA 3W6NA 4TXNA 1L1RA 4Y98A 3QG5A 1MC5A 4UM8B 1BXRB 5DLEA 2YC2C 3UENA 3DBHA 2J30A 5HGJA 4B4UA 4Q4LA 4Q37A 1YOBA 2GVNA 1E2IA 1QCYA 2C2BA 1XXLA 2LW7A 3Q9UA 4O0MA 4Q4DA 3SLRA 1V37A 4A8HA 1J70A 3W1WA 2A0XA 1P1RA 3BTVA 4AJNA 4B3BA 3ZZUA 1T6NA 1MVOA 2BRUA 3OLYA 2DWUA 2Y71A 4XWWA 4UCFA 1T34A 1MP0A 3FB1A 4CDMA 2B0CA 5HRCA 1Z36A 1NFFA 4ZPJA 4DNPA 3PPIA 1OI4A 4MGYR 2BMFA 3NONA 4DQDA 1GOTA 3OJCA 1PJRA 1VJRA 2WWYA 2SNIE 1XZBA 4K40A 1Z63A 4FJ0A 3ILSA 3ZU2A 5K6AA 2XB6A 1CUAA 1US8A 1KJ8A 4L4RA 4DZTA 3WXMA 5TMBA 4F11A 3SKVA 2A88A 2WHXA 3CBGA 5E6UB 2QW1A 1AK2A 1II8B 5F23A 1ZWKA 2V9CA 4EF4A 3TVDA 1YMUA 5B3AA 2HK8A 2NUPB 1VG8A 2X77A 2N46A 5ITZA 2GM9A 1O1YA 1VG0B 4XB2A 2R4TA 1E3LA 4KQJA 3IQGX 3H86A 2QTWB 4QATA 4RA9B 1M2KA 3VI4B 2BELA 3VZRA 2Q4OA 2PQ2A 2XPCA 3H0EA 3LDAA 4NENA 3H42B 4B84A 5D2CA 4U2FA 5F77A 4ND7A 3TPZA 5CVTA 1PL7A 4H6VA 3VUEA 1SK8A 3OQBA 3O21A 1C0EA 2V7QA 3U9TA 2ZANA 2QDXA 4NJEA 4F45A 3QFHA 3WDLA 1WNTA 3RSLA 1D3AA 5HFAA 1XA3A 4HDAA 1SBZA 1R50A 2FWJA 4OQEA 4JN6B 4C0QC 2JGJA 1IEQA 5A1JA 2PLAA 2AOUA 4V24A 1U8YA 4N01A 2RARA 2L42A 4BN0A 4MZDA 5ILQA 1K4MA 2GETA 4IJWA 5K0NA 4JI6B 4CR6A 3ZGVA 5C34B 3CGGA 2G6BA 1WUJS 2DTEA 5T4BA 5TQ2A 5F3DA 2VJNA 4RZIA 5H7XA 3H8JA 3SYRA 4BBAA 4EB3A 2E5FA 5GJCA 1TEVA 4KGDA 1SN7A 3GPLA 1LCIA 2PEZA 3PE3A 2G80A 4KQWA 4EH1A 3DBVO 3P20A 4L3WA 5EYPA 3IPLA 3MTIA 1L8AA 2PGLA 1MZPA 3MGCA 1LX7A 3D6AA 4TKUA 2X8JB 2R5FA 3V8RA 3KXIA 4YRLA 1H2WA 5HK9A 1EXVA 1IN1A 4HEJA 1HH4A 4JMLA 2ZWOA 4RX1A 3ASZA 3AHDA 3B1XA 5DM4A 4BPRA 3R9XA 3JD3A 4PHCA 2A4KA 1I7QB 2RH8A 1MC1A 4M1WA 1OJLA 4EHDA 5ALOA 3EZ2A 1L4HA 1HBJA 3UT6A 1H1DA 2YZNA 4IVNA 3T5GA 5KIAA 2CMFA 4DDMA 1JQEA 1T2DA 2GWRA 2RGDA 3GA0A 2DFVA 3OZAA 3ZTWA 4XWYA 2HJVA 3LX8A 1EZ1A 4D0NA 1U4OA 1NXOA 3TTSA 2OGWA 4AU1A 4B3JA 4NKRA 3BH0A 3KSAC 4CFYA 1MRNA 1QHEA 2AK2A 1YB1A 3BGDA 4RELA 1YFZA 4IMPA 2C2KA 4BASA 3AK4A 3T3IA 3G23A 3RSHA 3WLRA 3ZHCA 1KVRA 5D5QA 4XE5A 1RHMA 4W9NC 5LUAA 1Y1PA 2QYHA 2FPSA 1E0DA 3N05A 4X20A 3UJCA 4DGSA 3WB9A 2J0UB 3EW7A 4ND6A 521PA 4FX2A 3FFAA 1Y81A 2AOWA 3KSRA 1CQPA 5GGXA 3FDFA 4ECEA 4FUQA 2F8SA 4ARSA 1KAEA 2QM0A 2X19A 2VTVA 1N6IA 1P4JA 1VYHA 1P6UA 3MPOA 2GF9A 4HZGA 4R8LA 4WT7A 2F59A 5ALXA 4D82A 1QO0D 4LYAA 2REBA 3CT4A 1NZJA 3IAS1 4GYKA 1SUWA 4DXHA 4HMQA 3OZGA 5FFNA 3A26A 3GN2A 1NP6A 5EFZA 721PA 1JEDA 1R27A 1SXJB 5DGDA 1A4RA 3E22A 3ZDXB 5JNVA 5B6PA 5CDFE 1X6VA 2YYAA 3UGTA 3D8NA 3UGKA 3CRNA 3LSYA 3QFFA 4KO2S 4DYDA 1ZRSA 3RS7A 1E4EA 1QTRA 2Y8EA 4DAOA 3HUTA 1K5PA 5IK2D 3GEBA 4IIUA 5E7MA 4OHYA 4RAQA 1Q20A 1Y6QA 1MR3F 3BE4A 3KX2A 4ALNA 1WOYA 3UM9A 1IK6A 3KE8A 4DRXB 2NU6B 5CDGA 4OXQA 3D8HA 1RCTE 1UDWA 1L4NA 4QM7A 4F8EA 1UM9B 5EFOA 4Q1VA 1C1XB 4C2BA 2GBFA 4C04A 3TL6A 1I3CA 2AUNA 2HSZA 1XBTA 4KRFA 2IH5A 2PMKA 3F73A 3OZFA 1U8EA 3KV1A 4MULA 1C7ZA 1G8FA 2NUAA 1USWA 1W73A 3F3YA 5SZIA 1VL1A 2AD1A 1XN1A 2QY6A 3RRNA 5L4SA 2BWJA 3DDNA 3NTQA 1R9NA 2ZUTA 1L1FA 3VC2A 4FT2A 1KFJB 2QMYA 2HMAA 3UMCA 4QD3A 3IE0A 1J33A 1T8TA 4PNZA 3JSAA 2H2FA 3FWYA 1J9EA 3QI2A 2VJDA 4BZZA 3HUUA 3OT5A 3A0UA 1XZ8A 1KH1A 1GT91 1Q7RA 1XIVA 3QFTA 1BW9A 3Q7EA 2WILA 4ALIA 1R0YA 1N2HA 1O5OA 2JZCA 5ED0A 4OHWA 3ER8A 3KYDB 2IH2A 4PGMA 2DBYA 3I4CA 1RYFA 3NANA 2RHJA 2X9QA 1EX1A 3O8DA 4J7AA 4YLYA 2FV8A 2WP0A 1V6SA 2QQ0A 1T91A 1W4ZA 3BIJA 1ZA2A 1R37A 1I7DA 2A0YA 1YJQA 3CKLA 4Q3BA 3QVGA 5T6BA 4DQLA 2JAUA 1FS4A 3UANA 1XTIA 4CLRB 1OAOC 1E3DA 1RQNA 1ISHA 3V6MA 5D3MA 2OHVA 4DSUA 2C7QA 3P2JA 2HRDA 4IR7A 1DXOA 1YOVA 2AMVA 4IOLA 5HBRA 4IHAA 4HDMB 4LA4A 4X1KB 4QXAA 3VAZA 4ZAXA 3HCRA 3I32A 2Z6QA 2WQZA 2AC4A 1CEEA 2IDKA 4KXFB 3V7UA 1WBJB 1UBHS 5CJPA 1IZZA 1GZ5A 4KX3A 4PG5A 1M1ZA 1ZN9A 4JBWA 2N1BA 1R8YA 1OI7A 4FSDA 4L7VA 1UDBA 2KB0A 3TI9A 5AW1A 2KX7A 3GAZA 5H4HA 3RSZA 4L74A 2FEPA 3P94A 4XIJA 4QTZA 2Y76A 2PSHA 2IYEA 2VATA 1R18A 2AX3A 4Q9AA 3DGEC 4AULA 2E4XA 3PITA 3MYRA 4BAGA 3PUIA 1WXHA 1Z5VA 3BK2A 1NRJB 3RUDA 4QSHA 3G7SA 4NG5A 2IPAB 3ZS8A 2QSYA 2WMDA 5C7IO 2QJRA 1JA1A 1MPXA 4YO7A 2ZBRA 5KI6A 3WKAA 2VK4A 3KOWA 3D0QA 1F8FA 3EUWA 2AN1A 4Q05A 4PZEA 4BFVA 1QX3A 1G9XA 3MWDA 4YPOA 1UFVA 2ONKA 3LQ4A 1SXJE 3U3JA 4B79A 3D43A 4P92A 2D0DA 2JEZA 4PR0A 1EVYA 1Z2NX 3HO6A 4JJFA 3B3QA 4JQCA 1A7JA 3SC6A 2OG2A 1HZJA 3IQIX 4RTNA 4EMUA 1IY2A 4FT4A 1HG1A 2OV6A 4L2IB 5IX8A 3W4KA 2H0QA 3RF6A 5LXTB 1BRMA 5F7OA 3KHSA 1GUDA 221PA 3N7TA 3REOA 3VR3D 5TPWA 1YHNA 3IJRA 4BJHB 2WYWA 2D1QA 1D2MA 1FLAA 2PCLA 4PCLA 2GSDA 4AF6A 1QTNA 3Q3IA 3P8ZA 3SI7A 2VYVD 4EMTA 3F3SA 1O94C 2ADMA 2PX6A 1NAHA 1D6JA 1RABA 2Q1WA 3CWZA 4I99A 4K9MA 3RD5A 4D43A 2HLDD 3W5BA 5AI8A 4LFBB 4MW1A 1J8VA 3VHRA 1FFYA 1UEJA 1XOIA 4MQ5A 4MGHA 2OV3A 1WXXA 2H7YA 2WJWA 1GSAA 2XYHA 4ZDJA 1E59A 3RG8A 3UAWA 3L8ZA 2FJ0A 3BCHA 3BG5A 4HGZA 5FA8A 4YDRA 4KLZA 1PG5A 4LCEA 3OE7A 4BGDA 1JHAA 2BMWA 4QYIB 1TL7C 1TVKB 2Z3ZA 3GP5A 3NIDB 3PQ3A 1WXEA 2Z2ZA 2B4KA 3ESBA 3D81A 5IMBA 3HU5A 2QU8A 2KLHA 2VH5R 2NZYA 3PNYA 3AI1A 5CDTA 1O03A 3FPSA 4QE3A 1LPAB 2C1EA 1XELA 4LI0A 1PW5A 3EY9A 3U4AA 3B70A 5AVVA 1CR0A 5BT9A 2O3UA 1W34A 4ER3A 1S3SA 3IQXA 4ZEOA 3EA0A 4G5FA 3WE7A 4J0EA 2YQ4A 2OGUA 5ALWA 3BD8A 5AUNB 3QKIA 4RTQA 2H0AA 4RWEA 3TTYA 2OLJA 3RGWS 2C9YA 1G8GA 1XWIA 1JHOA 2J31A 3CA8A 1ISJA 3L05A 3ADBA 2CCKA 1NASA 2WMOB 1E1YA 5P8WA 4BGVA 2ZXUA 3PG5A 5GV7A 5E1MA 3QKWA 4ID3A 1SVWA 4ZOLB 3UMMA 4KUHA 1BIFA 2ECPA 3DKRA 1GPAA 5GONF 3G2HA 1NF3A 4LYYA 2QT9A 4LGVA 5CD1A 1C30B 1O08A 3GVHA 3THOA 3CRW1 1U04A 4WOBA 4ZO6A 2I91A 2CLOB 4WWHA 5BRAA 5B4TA 1OH7A 2CNLA 5FQOA 5AUOB 1KS9A 4I3GA 5JD4A 3AB7A 3RYCA 4Q9KA 5HJEA 2QSZA 3CY6A 3DE6X 2Q2WA 1C0IA 1W4RA 2PH1A 1WVGA 3GY0A 4W4TA 1QYXA 1KH2A 4NL4H 3WB1A 1RSZA 1KE1A 4KXUA 3P45A 4AJJA 4CQMA 2XWQA 1UJ2A 1GKYA 1C4WA 1GN8A 2PPLA 1SCKA 3I9MA 4MA0A 1G9TA 1SXJA 2JAXA 4HN4B 1U80A 3K35A 4FN4A 3SDSA 1ODFA 2I2XB 1JMKC 5G0SA 5CM2Z 1EWTA 4OM7A 1GQSA 1II8A 1AIPA 3LKVA 3QLVC 2LCFA 4W9MC 1YS7A 4N9QA 4FYYA 4WBXC 2ZI4A 2CBGA 3RIMA 4CM4A 2HOQA 4UATA 4UTXA 3EVAA 3IAUA 5J59A 3M82A 2QUJA 1DC6A 4DBZA 1OIVA 2BP7B 5G1PA 4V1CA 1HF3A 1KR5A 2NT4A 2VJAA 4JGBA 3E84A 1JLKA 1LH0A 2C8LA 3DUWA 1UQTA 3BICA 4RXMA 4ZOQI 4F92B 5JNSA 4ARCA 2IOYA 5CVVA 4GRIA 3WGZA 3TLBA 1SQFA 3G0DA 3VJLA 4OJTA 1A71A 1CY0A 3HPRA 3KQPA 1ID1A 4H7PA 5TGZA 5BMVF 1JKMA 1H6DA 2O1EA 1QP7A 3T1VA 2Z30A 2H92A 2XMBA 5G2OA 2GUWA 3T9BA 1L5ZA 1PD0A 2X4GA 4KAJA 3WP1B 1LSJA 4KXNA 1X7DA 3IAAA 1T25A 1WCXA 1ZP6A 2PPVA 4HD8A 1V71A 1XZHA 3I2FA 2DPYA 5G1NA 1N3YA 4ZQGA 4BFWA 4QJ3A 1JA0A 1NT4A 3AGPA 3IIJA 2F43A 3EVEA 2PFGA 2D1YA 2QMEA 1ODIA 1QAMA 1ZVVA 4DR3B 3A4TA 3ASYA 4BNNA 1B73A 2GEDA 5BWNA 1T0IA 5JXWA 4NDNE 2SHKA 4XSGA 4I4TA 5CGQB 1YKGA 1WO8A 2PT5A 4X1YA 3ZK9A 3RS9A 2HU7A 2WPNA 5CPFA 5TARA 4UE6A 3N5CA 3Q12A 4YUWA 1KJYA 5SY9A 2OZPA 2P2NA 3A3KA 1G2PA 3KVRA 4GOJA 2LCQA 2ZVQX 4G07A 2XZOA 1ECBA 3E0XA 3U7FB 3HA2A 3HZZA 4WV3A 2JH8A 4CKWA 3E05A 1JU3A 3ZDDA 5LWHA 1ZVQA 2GA9A 4D41A 1J00A 1VOTA 2VPYA 4Z99A 3ZWBA 5AVTA 3ISTA 5C9ZA 1KKMA 1F9AA 2XMCA 4L22A 4DVGA 3ZLJA 3VBEA 3BCRA 4KMRA 3HWRA 5CNJA 2VBCA 3RS3A 2HB6A 5DE3A 1K8RA 3UB3A 3OLCX 4UVEA 3PEUA 4OHMA 5D6OA 3W6PA 1H5NA 5LVAA 1K8XB 2AYYA 1CZLA 1Z0ZA 2Q9CA 1ND6A 4ZYXA 1B8OA 2IHJA 3RRYA 2GM4A 3C7AA 4Q9NA 5H02A 3EQZA 2B8TA 3JSXA 3MBKA 3O9VA 5CVCA 4G86A 4IFIA 4DLBA 4RJTA 3HUFA 2O8FA 1AKEA 2I66A 5CAEA 2YL2A 4ZVRA 1KFKB 3MMZA 3PXAA 4PG7A 3T9AA 4B45A 5CBKA 1JTVA 1NBMA 5B12A 4GOXA 5DN6D 4IQFA 4QUHA 2VEOA 4US1R 4HC4A 1Z39A 1LWNA 3TNLA 4KI0A 2FZGA 4DR1B 1WL8A 2EJWA 3KOXA 3N76A 3SR3A 4YUYA 3HB5X 1E0JA 4QELA 5HFJA 1ISSA 3A6PC 3CF6R 3EH1A 4OV6B 2HMUA 1X8KA 1FVFA 3LVBA 5DW3A 5CB4B 2OAQ1 1MQSA 4JVOA 4O4LF 1D9ZA 1NVGA 1NUSA 4Y8VA 2J07A 3GNQA 4ENSA 3IOEA 5DHFA 4YMUA 5KYUB 5K3CA 1P4SA 2XWPA 3CH4B 1CZRA 4P32A 3VPDA 4F6RB 2PKCA 5UKDA 4R6XA 3KYCA 1Z8HA 2TMKA 2ZIUB 4LXHA 1KPIA 1D2CA 2YINC 1QIHA 4IF6A 3MUFA 3S8YA 2HU2A 1V16B 4CKZA 2WD8A 5B7QA 3K32A 3OEED 4MQUA 1SA0A 1WLSA 3O93A 1YCDA 4F9TA 1B6RA 1WX1A 5IM5A 1U5CA 2EFCB 3EQ6A 3ND9A 3TTVA 2WVGA 2V7QD 2FXVA 4IEFB 4F5WA 4TLBA 2MHCA 3BH7A