3DNMA

Crystal structure hormone-sensitive lipase from a metagenome library
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
297
structure length
297
Chain Sequence
DTKMDPRDFLQLLKINAEKAEKNLPLDQKRAGMEALCERFPRAEGVELTLTDLGGVPCIRQATDGAGAAHILYFHGGGYISGSPSTHLVLTTQLAKQSSATLWSLDYRLAPENPFPAAVDDCVAAYRALLKTAGSADRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLSPFVDLTLSRWSNSNLADRDFLAEPDTLGEMSELYVGGEDRKNPLISPVYADLSGLPEMLIHVGSEEALLSDSTTLAERAGAAGVSVELKIWPDMPHVFQMYGKFVNAADISIKEICHWISARIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of a novel hormone-sensitive lipase from a metagenome library
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 99
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.-:
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dnmA00
5A7FA 1XKTA 5ALMA 2PSJA 4XVCA 3VXKA 2XUJA 3I6ZA 4Y2RA 1CUUA 5C8ZA 1X70A 1ZJ5A 2C0PA 3WWEA 1MX9A 3R3UA 3LS2A 2PL5A 5AI8A 1QFSA 2C7BA 4Y2YA 4BP9A 2WILA 4X00A 3EQ7A 1QIIA 2XUGA 3UUEA 1YR2A 5CXXA 2GYWA 1S8OA 1YASA 1VZ2A 4DNPA 4AN1A 3WL6A 3CCCA 3STUA 3FVTA 1H2ZA 3BF8A 1AURA 2HU8A 2PSEA 4YPVA 1IZ8A 1J06A 3O9MA 2GYVA 4BYMA 2QMQA 2WTNA 3ICVA 3H04A 2OGTA 3WK9A 1XZEA 5ALXA 4QA9A 5K3FA 2I03A 2R11A 5K3DA 4OU5A 4UBLA 5DYTA 4EY7A 3ESCA 3ESAA 3F9CA 5KREA 3ZWQA 2XUDA 1GPLA 2WLSA 1XRQA 1YB6A 5JYCA 5HF5A 5EIEA 2VF2A 4CCYA 4GXNA 5HZGA 1CUFA 3D0KA 4UFNA 1LPPA 5LKRA 4N8DA 4GDMA 5JZ9A 3EIOA 5LZ5A 4Q3OA 4JYMA 5JZBA 1EXWA 1TAHA 1EB8A 1Q83A 3RKSA 4HVTA 3WA7A 2HA0A 3WL8A 4B9AA 4WJLA 2DHEA 2CMFA 4BRZA 3IBTA 2IIVA 2OCGA 4N8SA 5LIPA 1MAAA 4Q3LA 4UBIA 2OCLA 4Q3KA 2WUEA 2XMBA 4PV7A 1VE7A 3H0CA 3ANSA 4LYEA 5LYYA 5CH3A 1QIMA 3STVA 1MX1A 4PSDA 2DQYA 1WB6A 1QOZA 5A7HA 4KRYA 5AKEA 1F0PA 1P0MA 3R41A 1U4NA 4M0MA 7YASA 5HQ3B 4ZV9A 1CUEA 4NMWA 3ED1A 4U2BA 3ZPXA 2XUKA 3R3YA 3K9BA 1MJ5A 2C5FA 5AI0A 3YASA 1MX5A 5FUMA 4Q05A 5LLSA 4JYPA 2QTBA 3EQ9A 4B85A 1Q84A 4ZRDA 4E11A 4BTLA 2QXTA 4XIIA 2EDAA 3L1JA 1GPNA 1QIGA 4OU4A 1E8DA 1JJFA 1GXSA 1XZIA 3G0BA 4IHAA 2WUGA 3H2IA 2G63A 1LPSA 4X92A 5JATA 1AGYA 4NZZA 5HFNA 2RI6A 6YASA 1YA4A 5AOAA 2DHCA 2VT7A 3EBLA 5AM4A 3AIMA 3C8HA 4RNCA 4YX9A 5ALGA 5T4FA 5DLPA 5EFZA 1CUSA 4BC0A 1UKBA 1JI3A 4MQLA 3BWXA 4QWMA 1A7UA 1ZIXA 4YASA 3DL7A 4F60A 4QZVA 2J3DA 1XLUA 4FBMA 3AIKA 2H7CA 2HM7A 3IDAA 2XUHA 2GZRA 4KE8A 5AM3A 3F96A 2RIPA 3A70A 1MU0A 4CG2A 5C81A 5CT5A 5HF9A 3R3VA 4PNZA 3CN7A 3H2HA 1ZI9A 3HXKA 1TK3A 4PSUA 3W2TA 4HTAA 2ZJ7A 2HA3A 1GQRA 2HA4A 1L7QA 1LPBB 4BC1A 2O7VA 4BAZA 3QBJA 1LPOA 5AP9A 4E14A 4DGQA 2FJPA 2ONCA 5AKZA 1CUZA 4DNFA 3AZQA 2QKYA 4BZWA 1DU4A 3FBWA 2B61A 4X91A 1AC5A 3RLIA 2OG1A 3D4LA 3KDAA 4OB8A 2WG2A 4FLFA 4KJXA 4BZZA 4B80A 2DR0A 2DQZA 5E4JA 5JADA 5ALPA 5AH0A 2PSHA 3I1YA 1A8SA 2O2HA 3E0XA 5BWCA 1K63A 2WJ6A 1EINA 3TEJA 2HIHA 2CUTA 4X71A 4EZIA 3HJUA 1K4YA 1XFDA 5HF8A 1CUHA 3G7NA 4ROTA 3STXA 3JWEA 1DINA 4WDQA 5KBYA 3H19A 4CCWA 1R3DA 2NW6A 3C6YA 4RE5A 2XDWA 1QJ4A 1DQYA 1EI9A 2WTMA 3WQHA 4BVJA 3V48A 1CUGA 5C7YA 2ORYA 4AX4A 1BS9A 1XZBA 4PW0A 4DSZA 5I9IA 3DEAA 2BFNA 5EIAA 4YK7A 2X8BA 4NS4A 2HFKA 2BUCA 5KWIA 1UK7A 4PQEA 3U0VA 4J0DA 1TCBA 1XRRA 4RE6A 5EIHA 4Y2TA 1W6RA 3N2ZB 2J4FA 3RM3A 2ZVDA 5BV7A 5CT4A 1XLVA 5LKAA 1PV1A 5IVKA 4UBOA 3G9UA 4FDMA 1IUPA 1FFDA 2RONA 4OPMA 3SK0A 4A16A 2WUFA 1EX9A 4J0HA 3WK8A 3H2JA 3F98A 3WK7A 2Z3ZA 3O0DA 1UKAA 4HXGA 3HACA 4WY5A 4N5HX 3WJ1A 4IH9A 4Y2SA 3QMMA 3ZLTA 4LXHA 3OM8A 1IUNA 1CUXA 1XZHA 1MPXA 3PDCA 3AINA 1QGED 3D5EA 1NU8A 1RWQA 1JU3A 3WWCA 3KXPA 1XZLA 3M82A 3LCRA 3VJMA 1UK6A 1EA5A 2XUPA 5LZ9A 2VA9A 4O08A 3H18A 4EA6A 2XQJA 3NWOA 3DOHA 1N8SA 1KU0A 3C43A 3WWOA 4KE9A 4WFJA 3BE8A 4B84A 2VJDA 1EVEA 3M3DA 1EK2A 1XRNA 3WWDA 4W1PA 2PUHA 2H7YA 2XQFA 1C4XA 4X3CA 1FFCA 3GZJA 1A8UA 5ALZA 2WFLB 2XUAA 2JGIA 3A2MA 2OAEA 2IITA 3SX4A 3V1MA 5ALQA 5IKXA 1R9NA 4H0CA 1H2XA 2H7XA 1CQZA 2AJCA 3W05A 1BCSA 1IZ7A 2EDCA 4KYVA 3RARA 1DT3A 4WY8A 3OURA 2I3ZA 4QEKA 4CFSA 1F8UA 2QUAA 4JUIA 3FCXA 4EBBA 4IQ4A 1X2BA 1ETHA 2FX5A 4HRXA 4X85A 3DJYA 2HA7A 1GPKA 4WFIA 5CH5A 5AKJA 1E8MA 1ZJ4A 5A6VA 2Y6VA 5DTJA 2QM0A 2JIDA 2PX6A 3WJ2A 4EY8A 3HEAA 4BBZA 5A7GA 1CUDA 1HPLA 1SOMA 5HCUA 1VKHA 1CUBA 3K6KA 4ITVA 4EUSA 3ESDA 3ZI7A 3EF3A 1TCAA 4W9RA 4BAUA 1ZOIA 3WIBA 1QFMA 3H17A 1XROA 2O2GA 4BE4A 2GBFA 3LLCA 4H7JA 2HU5A 1PFQA 2W6CX 4Y2UA 1C7JA 3ICWA 1MAHA 3EQ8A 1N5RA 1UT6A 2VEOA 3IUMA 3DYIA 1B6GA 5JALA 3HYSA 5CXUA 3DDUA 2OPHA 1LPAB 4KEAA 1QTRA 3MUOA 5LZ2A 4AO8A 4QDTA 4X6UA 1J2EA 2RAUA 2QT9A 3G9XA 3W9UA 4B82A 5JD4A 2D0DA 3IUNA 4BVKA 1ZD4A 3WK6A 1BROA 3FSGA 2YASA 4UBNA 1GKLA 1UKCA 2PSDA 3IB3A 1XZJA 3HC7A 4X95A 2P8SA 1IUOA 3DL4A 4V2IA 5AKKA 1D07A 3WA6A 3AFIA 2AJ8A 2WIGA 1HKHA 4PF1A 3MVEA 5JZSA 2BJHA 5K3FB 4B83A 1QLWA 3PF8A 3PICA 4G4JA 4Q82A 1LZKA 3U1TA 1KU6A 3M81A 5ALVA 2XUQA 4X6XA 1R1DA 1ZGCA 2WHQA 2JGLA 3O9VA 5AK5A 3BIXA 3WL5A 1XZAA 4Y2XA 1WB5A 3PE6A 2CEKA 5AKYA 4I3FA 3C45A 4GHWA 1UK9A 3PUIA 5JAHA 5FV4A 4C4ZA 4FBLA 5DJ5A 5AICA 1CEXA 4WCVA 2WIFA 2DSNA 4FTWA 4X94A 1CUIA 4K5QA 4DNOA 4OB6A 3B12A 4ZREA 3STYA 4C4XA 4C89A 1EDBA 2HDWA 3GA7A 4DNQA 3G0GA 4UBKA 5AKGA 1XQYA 3C8DA 2C0QA 2IX9A 1CFJA 5EI5A 2XLCA 3QMWA 2O2IA 1QO9A 4L0CA 1LGYA 2Z8XA 4Y2JA 1MNAA 2DFPA 4DLNA 2XQKA 3GROA 4UPDA 1WPRA 5CT9A 1WHTA 3MGAA 1XZDA 5IVIA 3SC2A 2PPLA 5AKIA 1ORWA 4I19A 3PI6A 2XUFA 1YA8A 3DKRA 2XMCA 3D3NA 5J3JA 4GECA 2ZYIA 1F0NA 3A2NA 3O4IA 3G0CA 1QIFA 5K3CA 1CUYA 2QR5A 3NGMA 2AJLI 4FFVA 5FKJA 4U2CA 3T4UA 4D9JA 2X76A 3AZPA 1XQWA 4X7BA 4P08A 2BUAA 1CUAA 2BKLA 4LYDA 3VISA 1TIBA 1P0QA 1W1IA 4OB7A 5EHNA 1OCEA 3VJLA 1R9MA 3D2BA 3WKCA 2OQIA 2PBLA 1XZFA 5ALEA 1AUOA 1LZLA 3I2HA 4U2EA 1THTA 3ZLVA 2ZYRA 2VJBA 2RGUA 3Q0TA 2V97A 4HZGA 5D7BA 5AO9A 2EEPA 4KAJA 4Y2QA 5FPPA 4G8BA 3R3WA 3WKDA 5D6OA 2QS9A 4BDSA 2ROQA 1AQLA 3FLAA 1UZAA 3ZV7A 4CG1A 4UBMA 1QZ3A 3I2KA 2Q0XA 4PO3X 3P2MA 5AKXA 5AI6A 4MEAA 4B6GA 2J4CA 5FP0A 5K3BA 3MUNA 4BATA 4TPKA 3O4JA 2VT6A 1K5PA 2C4HA 1QIEA 2XLBA 3QYJA 1GT6A 1G42A 2WHRA 1JU4A 4AB1A 5JARA 2WQZA 1BRTA 5SYMA 1UFOA 2RHTA 2V96A 3W9BA 4Y2PA 3IVMA 4H18A 3NOXA 5DNUA 4E15A 1XRLA 2HL6A 5ALUA 3G0IA 5LZ4A 1HQDA 4X93A 2VAXA 3E3AA 5IH7A 1NU6A 2ZYHA 3QPDA 5ALDA 1CUCA 3BJRA 3L1HA 4Y2VA 5DTIA 4U2GA 2OLEA 5AOBA 1CPYA 1DX4A 3RK4A 1ZD2P 1BEZA 1XKLA 2XMDA 4C6HA 4BB0A 4FLMA 4L9AA 2FJ0A 1QO7A 4RPCA 3S8YA 3S2ZA 3FYUA 5SYNA 4PSCA 3DLTA 1R88A 2PSFA 2GBCA 2HHAA 3DQZA 1G66A 5CBKA 4DMHA 2BGRA 5CT8A 1R4ZA 5C8VA 3I6MA 1Q0ZA 1ZICA 4S0XA 4K2AA 4BTVA 1WHSA 5FDFA 5T4HA 4DTCA 2HA6A 1AX9A 2D5LA 5I8PA 4F0JA 1B41A 3TGLA 3ESBA 4UUQA 1FFAA 3I2JA 2XT0A 2XI4A 4AMYA 3D7RA 2UZ0A 4DYHA 5JIBA 1N5MA 4UFPA 4I4CA 4GLBA 4FKBA 4W1SA 4CCYB 3GUUA 1MTZA 3AIOA 4OD0A 2G4LA 1AZWA 2BGNA 3OPMA 3H2GA 4BVLA 1ODTC 3G9ZA 2CBGA 3DNMA 5D3ZA 4B0OA 1FSSA 2JEYA 1ZI6A 4QE3A 4QLOA 4H35A 1CUVA 4OYYA 4G4GA 4JNCA 3BDVA 5LZ8A 3AILA 2OGZA 5CURA 1JMYA 1XZMA 3LP5A 1BN7A 4IO0A 2PVSA 1QE3A 4A23A 1JJIA 5HQ3A 3JYHA 2R8BA 1MNQA 4C4YA 4QDXA 4G1FA 4EHBA 3F97A 4BRSA 3PFCA 3R3XA 5ALKA 4G8DA 4H77A 4J7AA 1GZ7A 4ARBA 2ES4A 2GYUA 3FYUC 1G4HA 4UFOA 1GGVA 5ALSA 4FWBA 3UUFA 2QJRA 3I2GA 2VATA 2XUOA 3WI7A 5CMLA 4ZI5A 5HKBA 4G9GA 3V1LA 1J1IA 4J0CA 2XQIA 1E66A 1CUJA 1LBSA 3G8YA 3QH4A 4DMCA 3HABA 5AK6A 3WL7A 5ALFA 4J03A 1UOOA 3FYUB 1CLEA 4L72A 1VXRA 2XE4A 5AK4A 5ALYA 1YAHA 2JBWA 5JAUA 1YSCA 4P92A 1XZKA 4OSEA 4J0JA 1EDEA 4B9EA 4QLAA 1YB7A 3WKBA 1W75A 2OGSA 4E46A 3C5WP 3IA2A 1WOMA 2JGEA 5AM2A 1CQWA 4J3JA 1TQHA 5ALWA 2XMQA 5IVHA 4OYLA 5AIBA 2VQ6A 2BAGA 5EHXA 1GKKA 5DYYA 1U2EA 4H7IA 3DOIA 2CB9A 2WJ4A 3VDXA 4MQMA 1UOQA 4INZA 3C70A 1SFRA 3X3HA 5ISMA 5AIAA 4KRXA 1BN6A 2G5TA 2C58A 3VVMA 1EVQA 3I2FA 3V9AA 2OCKA 4X90A 5T4BA 3SWWA 3A6ZA 2HRRA 5BWBA 1EB9A 4MEBA 5EHQA 5K3AA 3CXUA 5CRIA 1OILA 3G0DA 2WIJA 3I28A 1A88A 5ALTA 4CIAA 2QZPA 3G02A 3HI4A 5JD6A 1PJAA 2JGJA 3I1IA 3T52A 4AN0A 4N8EA 1N1MA 4J0IA 5FPQA 2OXEA 3WKEA 2ACEA 4LKOA 4X97A 2W22A 1YS2X 1CRLA 2Z3WA 2Y6UA 2ZSIA 2Y2VA 4U2FA 3O95A 1Z68A 3FNBA 1RYYA 2PM8A 1AKNA 3FVRA 3I2IA 1VA4A 4QDOA 3ANTA 4Z49A 3BL8A 4UHFA 5HFAA 5ALLA 1UOPA 4AZ3A 1BE0A 1T2NA 4GEGA 2QOEA 2JF0A 3D2AA 3STTA 3WZLA 4U2DA 4W1RA 4H7FA 1Q0RA 3F67A 1NX9A 5HF6A 4EY6A 1XZCA 1VLQA 1XQXA 4FMPA 4HXEB 2E3JA 1UK8A 5ALNA 5ESRA 1VXOA 1L7AA 4CG3A 1U65A 4AO7A 2WKWA 2GZSA 3TRDA 1ACLA 3M83A 4FFWA 5EHZA 4DIUA 1ISPA 1VE6A 3DCNA 5JD5A 3WYDA 4HAIA 4W63A 3QITA 1KEZA 1WCYA 3D59A 1XZGA 3OTQA 3JW8A 1RP1A 4DM7A 3O4GA 3FWHA 3WIOA 5E4YA 2WG0A 3VJKA 2V98A 1EH5A 1H23A 4UBJA 4F21A 1USWA 1IMJA 4FNMA 1LLFA 3PUHA 2J3QA 2WHPA 4M0EA 3TJMA 4AXBA 4EY5A 1XLWA 1HLGA 4L3WA 2DHDA 3WZMA 5F4ZA 1J07A 5BOVA 3C6BA 3A2LA 2Z5GA 4Y7DA 3LIPA 5K5EA 2JGKA 2HRQA 4GWLA 2H1IA 1DX6A 4LXGA 3E4DA 2XB6A 3CCBA 1ODSA 5YASA 1XRPA 3IUQA 2JEZA 1C7IA 1FJ2A 3FLEA 1JJBA 1QIHA 2LIPA 3QMVA 2ECFA 3ILSA 3H2KA 5FLKA 4LIPD 1A8QA 2HA2A 3WLAA 3PF9A 4M0FA 1MT3A 2AJBA 2PUJA 4N5IX 1X2EA 3O4HA 5IVDA 4FLEA 1VJ5A 2ZYSA 3AZOA 3BF7A 2ZJFA 4KE6A 4C87A 1TCCA 1ZIYA 2DCMA 4B7ZA 3QZUA 5LP1A 3C6ZA 5A62A 5AI5A 5LZ7A 1BCRA 4ZV7A 2WIDA 4DSAA 4XJVA 4AQDA 1QIJA 3UMJA 2WM2A 4KACA 2XMRA 2OQVA 1XQVA 5CW2A 3IIIA 3OOSA 1LBTA 5T4EA 1H22A 1SCQA 1TRHA 1H2YA 1VA5A 3AJAA 3KWJA 4W1QA 3AUKA 1SC9A 5AM5A 3BDIA 4ZGBA 1W76A 3KOOA 3NUZA 1LPNA 4FHZA 2B9VA 4OUKX 3STWA 1M33A 2VAVA 1ZD5A 1DQZA 2QUBA 3QPAA 3Q8WA 2AXEA 3HZOA 5CT6A 2ZSHA 4AMZA 2JGMA 1E89A 3FOBA 5H3HA 3L1IA 2WU3A 2GBIA 4BCBA 2PKYX 4MWSA 3QM1A 2ZJ6A 1ZI8A 2YXPX 3DD5A 1CVLA 4EY4A 4G4IA 5JAOA 3DS8A 1FFBA 1E8NA 3KWFA 3BIWA 3OG9A 5DWDA 1ORVA 2QXUA 4P93A 4B81A 4TVKA 2XMGA 2AJDA 4QWWA 1ZD3A 5AKHA 4Q34A 1CV2A 5JANA 1VZ3A 1JFRA 4KAFA 4MWTA 2HU7A 4KR0A 2Y2UA 3W04A 1UWCA 1DWQA 1P0IA 2CKMA 3WK4A 4HXFB 3DYVA 3N0TA 4UHEA 4F5ZA 5DNWA 1MN6A 3E1GA 2QJWA 2BCEA 2WG1A 5CH8A 1BEEA 1QIKA 3VVLA 1EHYA 3HSSA 2H9YA 4H7KA 1CUWA 2VJCA 4G9EA 2YH2A 2GBGA 2FUKA 4ETWA 5ALIA 4RGYA 1YCDA 3HLKA 4IH4A 2VTVA 2I78A 4XX1A 3B3QA 1OXMA 1R50A 3R0VA 3G9TA 1CR6A 5CTAA 3IURA 3HRHA 1HDEA 1QTIA 3IUJA 4WDRA 4AO6A 4J0KA 4Y9SA 3VKFA 1E5TA 3WKAA 4IH1A 4UHCA 2CZQA 1O6FA 2WFZA 5AHXA 1L7RA 3FLBA 3GBSA 1FFEA 2OCIA 3H1BA 4UHBA 3WYNA 5A2GA 4C88A 5K3EA 2B20A 2XQGA 1QONA 4BAGA 1VOTA 1Y7HA 4HRYA 4MYDA 4J0GA 2WHPB 4DMFA 2JGFA 1EK1A 2G5PA 2QRUA 5AK3A 4AZ0A 3FAKA 5AOCA 1H2WA 1WB4A 1I6WA 2VJAA 3FSGD 4HS9A 1XRMA 3ZLUA 5KWJA 3LIIA 3FYTA 2WU4A 1ZGBA 4OCZA 4GW3A 2XMZA 1MO2A 2K2QB 2WJ3A 3V1KA 5ALHA 2OAGA 2O7RA 4GI1A 2WUDA 3QPCA 4JEIA 4P9NA 1ODCA 3FCYA 2WIKA 5FOQA 1CIJA 4C01A 4ARAA 5FXMA 5D3KA 5AI9A 4ZWNA 2WFLA 1DWOA 1UXOA 2WSLA 4KAAA 5HK9A 1QIDA 4QDUA 3W06A 4CI9A 3IULA 2C5GA 3R3ZA 5AM1A 5AI4A 3WK5A 4LHEA 2XMSA 5AM0A 1EDDA 3C5VA 3C87A 2HA5A 4MXDA 1WM1A 4MJ3A 5ALRA 1T4MA 3KD2A 5E2IA 3K2IA 1LPMA 1WPXA 5DYWA 2YYSA 3PFBA 1K6EA 2Z8ZA 2BUBA 5C8XA 2Y1KA 2B4KA 4BE9A 1DWPA 2X5XA 4ZXFA 3BJMA 4MYSA 1P0PA 1Y37A 2PU5A 4X6YA 4DMKA 3QVMA 4EB0A 5I7UA 4H7DA 3WMRA 1W4LA 2QVBA 5AJHA 1SCKA 4WFKA 1E3QA 2VSQA 3R40A 4XWGA 4H7HA 4UHDA 4K6GA 5JAPA 3D2CA 1IVYA 4NVRA 1DT5A 1YS1X 1AMNA 4CIBA 1HL7A 1K8QA 4B0PA 4BCDA 4K6HA 2V9ZA 5HKAA 4GBGA 4JH0A 3WWPA 2CJPA 5A71A 5ALOA 2PU7A 1F6WA 4BCCA 4QDZA 4K6KA 5HK8A 1TKRA 3V1NA 1SCIA 3GELA 5DNVA 1YAJA 1ACJA 2HFJA 1BU8A 5AKLA 5EGNA 1JKMA 3B5EA 3DKKA 4FNGA 1W52X 4H7EA 1THGA 2XUIA 1JMKC 4BP8A 1O6GA 5FRDA 5ALJA 3OC0A 4A5SA 4G5XA 1G5FA 2WFMA 5JASA 3KSRA 4BDTA 5E4TA 4LXIA 4Q1VA 1DTEA 1GQSA 3BXPA 1HBJA 2I3DA 1U8EA 4QNNA 2ACKA 4TGLA 4KE7A 3F8SA 3CN9A 3GFFA 3C6XA 3H1AA 1Y7IA 2HADA 1LNSA 1JT2A 4FOLA 2RHWA 3I6YA 4G8CA 4UHHA
chains in the Genus database with same CATH superfamily
3U3DA 1MAWA 1JW9B 1JWAB 3KRTA 5ALMA 5J47A 1ISJA 3TPFA 1TK2A 4EHFA 1NV8A 4GSKA 3VXKA 2XUJA 1NVTA 5ICCA 4B2LA 3QQ5A 4GS5A 3NVKI 4XVUA 3WBBA 2X15A 2QM7A 1CUUA 4KVGA 4GG1A 1IHXA 1X70A 4IQGA 1ZBDA 1SM4A 2ODBA 3T0FA 1MX9A 1XXHE 4C1NA 4EY3A 3L7AA 1TYCA 5LBUA 3SC6A 3OHMA 2F17A 2YV2A 5DHQA 2JLZA 1EEXB 1QFSA 1YWGO 2C7BA 2O6LA 4Y2YA 5EVCA 4TS4A 4ZD6A 5HP4A 4X00A 3RT1A 3M1IA 3EMBA 1N2IA 3L82B 5JS1A 2RHLA 1S8OA 5DLEA 2ZRGA 3K2QA 3DM5A 1YASA 4W6ZA 4EJMA 1E1MA 2I2AA 1VZ2A 1M2VA 3UMGA 4TLMB 1TFUA 3WL6A 1VPTA 3NT5A 3GGGA 5LLDA 2F1OA 3AEQA 3IT2A 3I9V1 4B3RB 4CMHA 4W5WA 1AKMA 1E1QD 1JB1A 2BMWA 2W6NA 3HZRA 3OZCA 5BSWA 4YO7A 4CLRA 3NVMB 3SBXA 3WGQA 4TT3A 4MHSA 1ZA1A 4BYMA 2VIIA 2XWBF 1EWYA 3ADKA 1KJWA 3GNSA 4JMLA 3MWLA 4UUMA 3Q3JB 3RS0A 3TRKA 5I51A 1DRUA 4PCAA 1X9GA 3KOUA 2Z4RA 3W6PA 2YFQA 3ZWBA 1XZEA 1BAPA 3KHUA 4RLFA 4YI3A 2JASA 4OREX 4E30A 3RVDA 2V9CA 4IGAA 2I03A 1NMQA 4R1QA 1T13A 3I64A 2R11A 3ECSA 1U2ZA 5K3DA 3QEOA 2PUGA 4DSUA 1SWVA 1BDJA 1GUYA 2X6TA 3OZTA 4UDYX 2CEAA 3PIDA 4AVYA 5UKDA 3ESAA 3F9CA 1H2RS 4BNDB 5KREA 3FPGA 3SX0A 1DEOA 1TFRA 4M6WA 1ZGHA 3HVJA 2XUDA 3VFDA 5EZYF 2AHOA 2HXGA 4B3DA 2YV4A 1R0XA 2GGSA 2W2VA 2O2EA 3MFYA 3UJ3X 4PN7A 4KGVA 4EB3A 2OXRA 2Q3LA 3TOZA 1C0PA 4AURA 4IIBA 2J67A 5GVSA 1K6JA 3P4YA 4O4HB 4EI7A 3A2KA 4ASUD 3P1JA 5LKRA 4N8DA 4ZQBA 3QE4A 5CDUA 3SJ7A 4BNUA 1VBNA 1KIMA 5E9JA 2V7GA 1W4AA 1Q14A 2PS9A 3EMKA 4EPXA 4L0MA 4O1IA 4BNWA 2ZIZA 1EXWA 1MV8A 4K3VA 4CEJB 1TAHA 3LG2A 4OYHA 5JLAA 1PFYA 3JTEA 3EDYA 4I50A 4QYXA 2BEKA 3H3FA 2B3DA 3IPRA 4URVR 1PT5A 3THXB 3SZOA 4ALMA 2HA0A 1AOXA 1NULA 1X8KA 5BPHA 3DMFA 1KORA 3LLSA 1Q2XA 1T2FA 1BHQ1 4HB4A 1D8TA 3GJ3A 3HJCA 4YP0A 3OQVA 4URFA 4N8SA 2ZE5A 1RWMA 4UBIA 1Z73A 1XXHA 3ETLA 2WWFA 2WICA 1CRQA 2TSYB 3VZCA 5KSOA 3EVAA 2NYUA 3AI2A 3GUHA 1UBEA 2XRYA 2C07A 3PGA1 1G2QA 1ZL2A 2ZPAA 2NACA 4PV7A 1VE7A 4IS3A 3V00A 4KOEC 5KNDH 4ENWA 4M3NA 1WXQA 2AR9A 1K8ZB 1P2FA 4MEJA 4OBEA 3H0CA 1O03A 5DHAA 1U2GC 1EVIA 1U98A 3P9CA 4TTVA 1JHPA 3AXSA 1V6CA 5CAEB 1RQGA 2WJIA 4ZKEA 4P7GA 1JB9A 4N5DA 3RVJA 2NXWA 5CH3A 2DPMA 2C7GA 1VPWA 3A9UA 3DVQX 4PWYA 1ECPA 4Q00A 4KR2A 4MVJD 3SXJA 1OLOA 1E9DA 1P1IA 1QOZA 3B3AA 3PDIA 1H6CA 3UAOA 3WGVA 3DLAA 4KRYA 3GOQA 2C84A 3DHEA 1PD1A 5B6PA 1PTJC 3CE9A 3W1VA 5HQ3B 2EV9A 3CRRA 5JZMA 1Z6ZA 2B2CA 4MI1A 1S01A 3ED1A 4U2BA 4F9TA 1DOHA 2QB5A 4QO8A 2C5FA 2AK2A 3HWSA 3RVQA 2GF2A 3H4TA 3DM9B 5GGXA 2GN9A 1G8HA 2WLTA 3WTBA 4D02A 1GPDG 1T91A 4PQYA 3QTTA 4JHLA 1RXSA 4MS3B 5FD8A 3V5NA 2GA8A 3LC0A 3WNDA 2XBMA 2GEDA 4YUYA 1U6IA 3WB1A 1E9FA 2P1RA 4MKHA 5IWCA 2H2WA 3INRA 2VNKA 4Y1EA 2VDLB 1NJGA 1VL2A 2QTBA 4LHVA 4BO7A 4D3XA 5JVDF 1U4SA 1RJEA 3A9RA 1RM5A 3CRVA 3DOOA 3IVXA 3OTWA 2GCIA 1R6XA 2QNRA 1Q84A 3N6RA 2CBZA 2Y67A 1CYDA 5IHPA 1VE1A 1M6WA 2NQ2C 2PRSA 4CMGA 4BX0A 4WLEA 2BZ0A 2FN3A 4LNUB 4ONEA 1N0HA 3GYGA 1ZN8A 4TM8A 4B33A 3H1GA 2JBHA 4XIIA 3NPMA 3GFBA 3KYCA 1V6SA 3AUTA 2ID9A 2DOKA 4KC0A 3BSYA 1ZMOA 1QIGA 2XRMA 5EIFA 2ZRJA 2FDRA 3QVSA 4EA7A 2ZUEA 3EOBI 3KKNA 3WRXA 1MDBA 2AWOA 1BEUB 1X1EA 4J8PA 2LPMA 3ZD6A 4ZDJA 3I92A 1E6KA 4G07A 4HXYA 1HZJA 4ZEOA 2QA5A 1MFZA 2EF1A 4RD3A 4ZQIA 1EFPA 2VXBA 1AGYA 1V5FA 3Q1LA 1ZC4A 3HGMA 4NZZA 4O4IF 1FBNA 1JG7A 1TJ3A 3ITDA 4B4UA 1QQBA 4HH1A 2J8ZA 2VDWA 3AFOA 2QX6A 4KQ2A 2KJQA 5CGZA 1YKGA 3R75A 1P2GA 2VT7A 3RFXA 2C9DA 4DG9A 1MQ8B 1OXXK 4HWSA 4TS9A 1MC4A 5IAEA 5L8VA 3LUJA 5ALGA 4Q24A 4ZO7A 2QZ4A 3I39X 2K5UA 3JQ7B 1CUSA 4QBTA 1UKBA 4EUHA 5MFPA 2ZRFA 1YZKA 1Y4ZA 2YWJA 3O31A 5F1KA 2QLNA 4MQLA 2RGRA 1KOFA 3HU1A 4G0NA 4U0JA 2Y4NA 2DWCA 1UUFA 1A7UA 2BLNA 4YJGB 5BMVF 4OK5A 2QTRA 3B82A 3C7CB 3I01M 4KYTA 2J3DA 4FBMA 4AUNA 4HQOA 1G8KA 5M2QA 4CQNA 5C1OA 4RZHA 2CXSA 1J0DA 2NXNA 3KT3A 3IEVA 2JFBA 1PVOA 2RH8A 2HM7A 3A1UA 3FPKA 1LD3A 3EXIB 3I3SR 4X0EA 4IHJA 5C7IO 1LC3A 1OFUA 1G21B 2F6RA 1MOSA 2GBLA 3Q9LA 3SQNA 3K09A 5AM3A 2OV6A 2XE6A 3IAEA 4TUYB 5BORA 1EFDN 2QTVA 2Q3BA 1FF9A 1HDRA 1N8TA 3ME5A 2VEDA 2XE8A 3Q8MA 5F5XA 1MU0A 4NF2A 1IN6A 1KYYA 1PKEA 4ZOCA 4C05A 3MJ4A 2Q7DA 2PZKA 4IQFA 3TGWA 3QOFA 2SKEA 4FOSA 1L2TA 3KVYA 3VI3B 3CNLA 4LBVA 2CFRA 1AUPA 3KZOA 3HL4A 1XMXA 1PNQA 1TK3A 1ECBA 1WX1A 2R1VA 1G6KA 4B47A 1WETA 1GO2A 2AEFA 3GWZA 4YDSA 1JQ5A 4OHRA 2ZIEA 1PL6A 4Z2AA 3A6EA 3VU1A 1H4TA 2GZMA 3DVRX 2NADA 2B25A 4GP6A 1Z45A 3VU9B 4KMSA 4JT4A 4PZCA 3T34A 3BT7A 1G8JA 2WJGA 4YBRA 5AP9A 2EX0A 2H17A 1HFKA 2GT1A 3CF2A 4P2BA 3JASB 3Q12A 4IIJF 3A0UA 4UD2A 1X9HA 2XNCA 5EVJA 3R7WA 4OFZA 1QK3A 4M60A 1GLNA 1HYEA 2ADMA 3GK3A 3NW9A 5DOVA 4TWBA 1Q7GA 5EJFA 1CUZA 1W8IA 2C4WA 4H3VA 3FBWA 4P7JA 5HRUA 3R9XA 1WDTA 2CLLB 3EXIA 3NH9A 1EGQA 4X91A 1CR4A 1OHHA 1UIMA 2AG8A 3D4PA 4QFMA 1ICIA 2B8NA 3EZ2A 4ILKA 1AC5A 2AF4C 2QAGA 4KLCA 4OFWA 4R1OA 2LCQA 2FMHA 3KDAA 4OB8A 2IP1A 3QV2A 4FLFA 7MDHA 5GZ3A 3JVEA 3DCJA 2YUTA 2DR0A 1EBFA 3X1JA 2PQ6A 1W93A 2HN9A 3ROMA 3OQBA 2EW8A 4FI3C 3LQQA 1AV7A 1W9HA 1Z25A 2RH4A 4OQMA 4TLDA 2X0JA 3E0XA 3M4XA 4XIGS 2P2CA 1K63A 2CD9A 2QK4A 1ABEA 1VLVA 3DEHA 2YWEA 1HORA 1AU9A 2HIHA 3PENA 2FI1A 4JJAA 4B48A 1YFJA 4U7DA 1JLLB 2CUTA 2JHFA 2PHZA 4EG0A 1QJCA 1KMCA 1KEPA 1YIDA 5H83A 4EZIA 4CM4A 1XO1A 3DHVA 4ZQGA 1D04A 2CGEA 2G06A 1K4YA 4O6VA 4CDMA 2XGJA 3KJEA 5KVAA 4B4OA 4FYWA 1KO5A 3VGPA 4BMOB 4Z7QB 4G37A 3B7WA 1A69A 1B6RA 1KMMA 1DBVO 3TD9A 5L3VA 3QW2A 4CUKA 1JECA 3L7KA 1SU4A 4WDQA 5KBYA 1RJ9A 2WHEA 4XCVA 5TPZA 2SKCA 3H19A 3KQPA 4CMBA 2ZJ3A 4QTUB 4CCWA 1YS7A 2X3UA 1RM3A 1VDZA 2QE7D 1M2VB 3A7EA 3H8VA 3WJAA 1I51A 4X1KA 3KK0A 4RE5A 1RS0A 1Y4AE 1QJ4A 2PGAA 5FPTA 3A3KA 2R6FA 3E84A 4YMHA 2XB2A 1DQYA 3V1UA 3A1DA 2AOWA 3I9KA 4CLDA 2M6KA 1YQ9A 4RQBA 2XKKA 3IAXA 2WMOB 3WGJA 3AW8A 3EUWA 1PWXA 2QORA 4NL4H 4AMGA 3PWSA 5JI2E 4HOYA 2P4QA 5DI9A 4HI0E 4PX3A 1YFKA 1NG9A 4PW0A 3ND5A 4DSZA 1XPRA 3DOUA 3FUWA 3D4IA 3KEOA 2PS1A 1SB8A 3A06A 3VBEA 1AQ6A 3TAXA 3DEAA 1RC8A 2ZBDA 1M0EA 1OIXA 2RGNA 4KFRA 2VQEB 4MW4A 1K8YB 1YNSA 1NVGA 3M1AA 4DR2B 4TQAA 1C3OB 1OFVA 4X3OA 4B3BA 1DKOA 2GWRA 1QTQA 3UPDA 1XVIA 2RKOA 1NZFA 4C78A 1W36D 1TB4A 3OMLA 3UMSA 3FPLA 2COKA 1MAVA 5HE9A 3WTCA 1P7PA 2EJBA 3U0VA 1TCBA 1T36A 2BFDB 5M04A 5IDVA 2H4YA 3WYGA 1HI9A 5H4GA 2H2DA 1H1LA 4II3A 5TQ0A 2P0AA 2PNFA 5A5EA 4BO3A 3BRCA 3VHQA 1DJLA 1ISSA 3P0HA 4H1VA 2NSLA 4UCFA 3RM3A 3S28A 2ZVDA 3L77A 2WF8A 5BV7A 1QF7A 1NW8A 3MCTA 1SVLA 1XLVA 3HKEA 4D2IA 5IBQA 1IM2A 5F51A 5HIIA 1T6XA 1QVVA 2I3AA 5IVKA 1NVFA 1T2VA 2XNJA 2IYYA 3KLOA 4UBOA 2KWIA 1GNVA 2YBDA 3A1CA 3DF9A 4KPUA 3D3WB 5IARA 4ZGWA 3RADC 2CFOA 1CY6A 1S2MA 3G9UA 1KBZA 3E5RA 1JFVA 1UDWA 3CVXA 3LSYA 2LZ0A 1RXYA 4P33A 4XYMA 3QYAA 4E5DA 2WBLC 1F14A 3ITKA 3QHPA 2XRZA 2SNIE 1A9RA 1U02A 1DBSA 3D5QA 1FMFA 2H9AA 1J1ZA 3PNKA 3L6UA 5TQVA 3LP6A 3WK7A 2JJMA 4AZ3B 4PSKA 3RCBA 2JBAB 4KZKA 4XSHA 3BXGA 3CM0A 4R9RA 5C4GB 1PW5A 1XRSB 4JBYA 4BKQA 1NUPA 4KXFB 1RQLA 1XHEA 4G1MB 4AULA 5F9FA 3WGTA 4GOXA 1VYVA 2G36A 1THMA 4QG7A 2GN0A 4B4KA 4GZ6A 8OHMA 1G8GA 4PRYA 2Y77A 3I8XA 3NBKA 1U0JA 4G2NA 4LXHA 3ZLTA 3DR3A 2PT9A 2CY0A 1ISMA 3LUDA 4P34A 4RKRA 5T8KA 1YNOA 3C3BA 1QBGA 3ZKWB 5AVTA 1XZHA 5CLHA 1MPXA 1M2KA 1ZXBA 3N2KA 4NOKA 3CLRD 2CL0X 2X2FA 3OIVA 2ZB8A 1VBFA 2FXVA 2VYQA 3MB5A 4WZBB 2JAXA 3N2IA 4GVLA 1NU8A 3DHYA 2VPZA 3OD1A 5IT4A 4OXQA 3QIVA 3HCOA 2IH2A 1KH3A 2EQBA 2YXEA 3V2HA 2A2ZA 3PXUA 5FLEX 1RWQA 1JU3A 3M70A 4PLPA 1BCSB 2MDTA 4G24A 3TSWA 1XZLA 3DJFA 2WWRA 2POQX 3HKEB 2RGXA 3LCJA 1W9MA 3LCRA 3V4RA 3VJMA 1BVUA 4HNGA 4CF3A 3M5WA 2IXFA 4KV9A 1BXGA 5DM0A 1J8YF 1X14A 2XUPA 4OJTA 2NU9A 2YZKA 2H48A 1DQRA 1P5RA 5I7OA 2FNAA 4KCGA 4EA6A 4URXR 3CZCA 3MRVA 2YMQA 3DOHA 4K9RA 1OJLA 1F7UA 1H9CA 1FQJA 5KOHA 3KQYA 4ZI7F 2D1TA 3HZHA 2ZZNA 3VUFA 1JA0A 1EVEA 4R5MA 1S0UA 1XRNA 1VPEA 3QE9Y 1RPTA 2VOJA 3JQBC 4ZOLB 3UVEA 3FUCA 5FPYA 1GDTA 3WWDA 5KYTA 1OGIA 2PUHA 5DNAA 1PE0A 3U44B 1DKQA 3KKOA 3RVPA 2H7YA 5D5QA 3WWYA 5FNVA 3KLMX 1L5GB 2O7QA 1C4XA 4X3CA 4BRUA 4DBVO 4OL0A 4LK2A 1EPUA 2VPXA 4ZA2A 1KJZA 4BV2A 1THZA 2AF3C 3NOVA 1Z0IA 2RAPA 4FGSA 3OFKA 1S3IA 3ZHBA 2WFLB 2ZWOA 2NUAB 3SMVA 5I3CA 3VNVA 5T5QA 4WL0A 4K9KA 4CM9D 4R3NA 2LBPA 2OAEA 5CXQA 4PLVA 3F78A 3PXBA 1C3VA 3AVOA 4H0CA 5ENZA 3SSOA 5FUQA 1KK1A 5JISA 2H7XA 3RSFA 5EHGA 5TPWB 2QZSA 4JLWA 2YZMA 3E9NA 3PEUA 4KYVA 1U0BB 4WY8A 5ITWA 1CZNA 4BEVA 4QEKA 3LCUA 4CFSA 1F8UA 5EPEA 1ZJ6A 4L8WB 4JR1A 3FI0A 4OV6B 2QUAA 2BI7A 2FW8A 3MOSA 2JIMA 4JYBA 1L7EA 1PL0A 4XYLA 4QOHA 1ETHA 2CXPA 4DJFC 4EG6A 1KYZA 1M8FA 2PWBA 4X85A 3E81A 3T38A 5DP1A 4ADSG 3IP7A 4PY2A 4WFIA 2UZAA 3IQXA 5DE3A 1QP0A 1U3DA 2A5YB 2CN1A 2XT9A 5AKJA 3PPYA 1PYDA 1UPTA 2JGDA 1AF7A 4UC0A 1VC2A 4AG5A 1RKXA 1Z08A 2YJ3A 4JEUA 1IDOA 4EY8A 1ZNXA 4KWCA 3GZNA 4TSFD 3W78A 2R8XA 5FOSA 3T7AA 2B1JA 2EIXA 2QYHA 3MMZA 5JJKA 1C0KA 2VPQA 3C7DB 1HPLA 3KPYA 1ECFA 1GL7A 2R84A 1T1SA 1CYEA 3D8BA 2ECOA 5IP5A 2QF7A 1N3YA 1XFAA 5JAIA 3F49S 3DKPA 1MIOA 2PUWA 2WKQA 3L0PA 1ZG3A 1DC6A 1E3EA 1GRQA 4Z7OB 2BMAA 1BWRA 1GNTA 1QE5A 3KQLA 2ZPTX 5BW8A 1AS2A 2FWBA 3C3PA 5B4TA 1C9EA 2P11A 3NFYA 1I5RA 4NNJA 1UZUA 3G3EA 1Q22A 1JIJA 1CY1A 1R3UA 4GMGA 4LE1A 4G67A 5C37A 3H11B 1SEPA 1XZQA 2D2FA 3JQAB 4Y9UA 1C7JA 4AP6A 3GD7A 2WP0A 1GCIA 3B36A 2PVCA 3PWTA 5D3MB 4UUBA 5LA6A 4BWFB 5LDGA 4AC9A 1RYHA 1DUSA 1UT6A 3BAFA 3JQCA 1IMOA 2PX5A 4QHYA 5AUQA 3CWZA 1H93A 3GLQA 3U7EB 2Y1DA 1SAYA 1U1IA 2OEPA 3V2UA 2V4ZA 2P6UA 4EP1A 1ZMTA 4EDFA 3PT5A 4MO2A 4PPFA 2VDQB 4PRKA 5J2UA 2IH5A 5A0VA 1U8TA 3DDUA 3I04A 4RPHA 4H1HA 2VPWA 3BRQA 3K70B 3NAMA 1B26A 3FZYA 3ZWPA 4F4IA 3FDIA 2H1VA 5HJ5A 2IYUA 4QTZA 4OFBA 1FSGA 5A1TA 1LPAB 4KEAA 4J1SA 5CB6A 1VLJA 4YRRA 2FEAA 1SG9A 2O8NA 1OZFA 8ADHA 2B8EA 4R68A 4JU8A 2VDRB 2C8JA 1RHRA 5B1YA 3VNAA 5KX5F 5ABPA 3KS9A 4YJ2B 2J7PA 5JSHA 4X6UA 3OZSA 5IJ9A 4FFNA 1Y3IA 3ROXA 3IP6A 1E2HA 2CLFB 4QLBA 4EFKA 1C4KA 2J0SA 5B3AA 4Z4FA 5JD4A 2XGOA 1JLSA 3ND7A 2FZ5A 4JI8B 1G63A 1V8ZA 3KZVA 4OHPA 4RK0A 2IPNA 1QXSA 2JL1A 4RJJA 1G6Q1 3PWKA 3A3NA 1DQNA 1VCNA 4DFDA 4ZAYA 5EY5B 5KKAA 3V2IA 2P3LA 1MX3A 1NUAA 3ET5A 3EZGA 3GDOA 4WXRA 3CJTA 3SIWA 2Y1OA 4EQ6A 1GTZA 1IZ9A 4FDVA 1R6TA 4MWGA 2VJMB 4UBNA 3UV6A 1HE1C 3OZFA 1AIPA 4PC3A 3KXDA 4N12A 3N28A 4INJA 3C16C 1DMRA 4MP6A 1JPJA 1D1SA 2F2TA 4FN4A 3ETGA 4E6EA 2P8SA 2H3HA 4GSYA 3JQFC 4PAWA 4Q1DA 3FMIA 3KOWA 2HRCA 2ZJ2A 3DT6A 2ZYVX 4WEOA 1D07A 1ECGA 3WA6A 1AY0A 2AJ8A 3HRIA 4F46A 2RARA 3M5DA 3KSUA 4PF1A 5DRTA 2OCPA 4F3CA 1RWOA 3ZZMA 3QWIA 3CLTD 5K3FB 1RSZA 4D9IA 2V54A 1FS4A 1A95A 1HZZC 1YS6A 1ZONA 2AXNA 1HLDA 2G6TA 2F00A 4N1AA 2APJA 4U2KA 3BD8A 4FHGA 4CI0B 5LQAA 3U1TA 4HZIA 3GEMA 4EKYA 2GESA 4FS3A 4H59A 1RAEA 1T3ZA 3EXHC 4M9XA 2WSSA 4X8LA 5F7OA 1FFXB 3CKMA 1YRQA 3TAUA 5ALVA 1FBTA 3UHAA 3KKKA 4X6XA 2VNAA 3T9FA 5CVCA 2WHQA 4YV1A 1JVSA 3M6WA 3O9VA 1MXFA 3BN3A 3AVQA 1LI4A 2CMGA 3L4KA 1I4DD 1O94D 4R2JA 2D13A 2J3MA 3H0EA 3I37X 4LMRA 2ZS7A 5DXAA 1O9HA 1F7VA 4E21A 4PN3A 1GAEO 1VGVA 4YV7A 5EAIA 2I4OA 3C45A 1ZR2A 1RLTA 1IFXA 3PUXA 4R84A 2O2YA 3FJ1A 5JAHA 1QX4A 2C8LA 2FWPA 4FBLA 3C1AA 4LGCA 4QOSA 1XF1A 4JI5B 4XWWA 4E5YA 3QVUA 4HQ0A 1TA9A 2Z58A 1H0SA 4EECA 2O1XA 2JIRA 1RHQA 3MCUA 1T1GA 5TS2A 1RLMA 4EF5A 4RGQA 4UCWA 1TDJA 3N5CA 2RHRA 3PR1A 3QLUC 4EBFA 5KCZA 1YZFA 4F3NA 4KNYA 1EP2B 1K68A 2H3EA 2JJ1D 3B12A 4IV5A 2HY7A 5DCWA 4I14A 1QAOA 4Z54A 4NBRA 2JLUA 1NVDA 3HVIA 1MDFA 4FMCB 1JR2A 5TF0A 2Z95A 5LR6A 4F9FA 4MIYA 3SHTA 1H8HD 5ERYA 3QVKA 2O8DB 1V5WA 3BXXA 1DXQA 3NATA 4QSHA 3EVTA 1FNMA 4DJAA 3ZEIA 3RS2A 2B2XA 1ZCAA 2GJAA 3MK31 1RKQA 3UK0A 3AVTA 1U0EA 1K0FA 3OT1B 2VCEA 5H4HA 4L0CA 1UZLA 4FXOA 4DIOA 4QSMA 1J90A 4ZTZB 4BFZA 2QBYA 4FP9A 2GB4A 1YZGA 2Z8XA 4HAUA 5FPKA 3DFUA 2A6PA 1VG1A 4NABA 1T8TA 1H2AS 4QRDA 4IHKA 4JLDA 5FTWA 4AG6A 3OX4A 4IICA 3O83A 3GIDA 3E2PA 5CJJA 3LNTA 1J5PA 2R7KA 5LQDA 1RLUA 3VYUB 1ZUIA 3OA2A 3U5TA 2FSSA 1I0IA 2AZMA 1XZDA 3X43A 4D3DA 3PHCA 2IS6A 1XDGA 2DUWA 2FCRA 5AW7A 3ZCXA 3R0QA 4I19A 1O3YA 3A9CA 4C7JA 3DKRA 4M0KA 2XMCA 5IU6A 2I7TA 5K0GA 3T5TA 3MJRA 1G6HA 4DUYB 2O8CA 4D9MA 2P9EA 1DMSA 2ZYIA 3IQHX 3FM9A 2V7PA 3EAFA 1K75A 5C46F 4BNJA 1QIFA 3HKDA 3GFRA 2TMYA 3BD7A 4EGJA 1MABA 5HUHA 3BFKA 1DG1G 4MKRA 4FK8A 4X41A 5E3HA 2BEUB 3KPVA 1JXQA 1ZGAA 1NVAA 3EHEA 3NM6B 3HV2A 5FKJA 1XQWA 3ENKA 4XGNA 3VI4B 3ZJVA 4U39A 1IE3A 2OE2A 5SY9A 5K8CA 1YBFA 4D81A 1C30A 4XSVA 3SLRA 3EG9A 4FSXA 3NXSA 4P08A 1VBKA 2PRYA 3U62A 4AT1A 2BKLA 4GMFA 3VISA 3WIDA 4EZEA 4A15A 1UINA 4NJMA 5FHRA 4ECAA 2D2XA 4HP8A 3UQYS 1LX7A 1W1IA 1YACA 2HDNB 2RHMA 3DPIA 4OB7A 3HWWA 5IC5A 3UY4A 2G71A 3CRMA 5EHNA 3B2EA 1SKYE 3D2BA 2C3OA 3UTCA 4Z4CA 2PBLA 2GPSA 2IEYA 4Q47A 4R2MA 4Q1BA 3PS9A 4ZCTA 4IJQA 1Z7WA 2WK1A 2OO7A 4BYGA 2VP2A 4ZAXA 2B37A 2W2MA 4N76A 1THTA 1TYEB 4CHGA 5A2QA 5L6LB 1ORTA 2VXCA 3FROA 4AROA 1IUKA 4CM1A 2FG5A 4WE3A 3MHTA 1CR2A 3D8RA 5D7BA 3G1TA 4EHLA 4F4DA 4ARIA 2PJDA 5L40A 4BHTA 2ZBQA 1MA3A 1UC8A 1D9XA 1H5NA 2JW5A 2OHXA 4IGIA 1W6UA 3HDYA 4G8BA 3KQWA 1U4OA 3MMPA 4Y2QA 4Z3KA 2FGJA 3I9LA 1F3OA 4PSVA 3WKDA 3DUFB 4EABA 3TTTA 2NV6A 4ED9A 4Z8XA 4I8DA 4W4TA 1T3LA 2AVNA 3CLUC 4ITUA 3ZCRA 1P18A 3SXUA 1N2XA 2NV0A 2D54A 1D4AA 3K72B 3IELA 4M38A 5GZ6A 4WVFA 2QPOA 4CFZA 2Q6LA 3R2JA 1FNBA 3OFJA 3UAYA 5LU9A 4YJKA 3AP2A 2O3RA 4M8IA 3I2KA 3BCSA 4MUGA 2ZSBA 4RJIA 3AY0A 4PO3X 3IRVA 4Y6OA 3P2MA 4KOAA 2E21A 2NTJA 2XA2A 4WZBA 5AI6A 5AKXA 4JLJA 2J4CA 1FU7A 4GP9A 1T43A 3OQHA 5K8UA 1YONA 2O2SA 4LYAA 4JJ4A 2WC1A 4NBNA 3NBAA 4DN6A 1SZDA 1UL1X 2VK4A 2F67A 2FP3A 1MF7A 2QLMA 2ECQA 2P77A 1EK5A 1CQIA 3O4JA 2VT6A 4ZV4A 3PDIB 4ZI2A 2QRQA 3OP4A 4G8JA 2C4HA 3SPXA 3ZS8A 3CXRA 1WP4A 4JXKA 4WMLA 2XA1A 2PZFA 1X7YB 4FNAA 5IKOA 3NRJA 4EHAA 1K86A 4CM3A 1G42A 1N77A 1TQ2A 2PLAA 2VNJA 2BFCA 2PD6A 2W83A 3AEKB 3NUGA 2CJWB 3MTQA 5GIPE 2FSGA 3L2OB 4W7HA 5JARA 4CTNA 3ER8A 1FQKA 1T25A 3KEQA 2GPYA 2AH5A 2WVHA 3LRTA 2R4QA 4DA9A 4EG8A 4NBVA 3RS9A 3UO8B 2CMHA 3W1WA 3W9BA 3I5YA 3FA2A 4Y2PA 5HJ7A 3IVMA 4IUBS 5FR2A 5B36A 1UZMA 5DK6A 4KQEA 3WLNA 2HYIC 3L8HA 4L8LA 5D6NA 5G0UA 4L6AA 1C81A 1NJ2A 4RACA 3H75A 4IDEA 1WABA 4YUAA 4M8KA 1B14A 1I7LA 4O2LA 4R5HA 3TQFA 4QXOA 1NU6A 3SE7A 5CVVA 3FH0A 3GXBA 5ALDA 1CUCA 1I01A 3NG1A 5AMXA 4ZRNA 1XNRB 1E1LA 3L1HA 4MWBA 4L4YA 1C1XB 4L5BA 1LDGA 1JNXX 4BQNA 1A1VA 2OLEA 3O8LA 1FL9A 1K6IA 1GU0A 1MV5A 1GZHB 2RCYA 3RSQA 2BTQB 2CB0A 1CPYA 2Q6TA 5F76A 4DVJA 3L01A 3VO9A 3BQ9A 2OCYC 1GLVA 1BEZA 1YUMA 2QUHA 4KQWA 5LL6P 3ODGA 2J87A 4MLZA 2XMDA 2DBVO 3DAFA 1VCOA 1N5KA 4MCAA 3AC0A 1YR3A 1DSSG 3A6FA 4B32A 4EG5A 3DD1A 4FLMA 3GJXC 1V71A 5A3VA 5B1IA 3U19A 2VP6A 5C31A 2ZQYA 4L9AA 1F1BA 3X1YA 2Q7OE 2GK3A 2RHGB 1IY1A 3TR6A 2NZ2A 2PUDA 3CUEF 1G5IA 1Z22A 2O1SA 4PG5A 4PSCA 5SYNA 4EHDA 4Y9RA 5DLDA 4HVCA 5MN4A 4C1BA 1IJEA 1G19A 4YAEA 2QN9A 3BX1A 2A0YA 4L4SA 4GMHA 3GNQA 2GVNA 4QJ5A 2UVPA 1SVUA 5EA2A 4WV3A 5CBKA 1X86B 2HWUA 3PIRA 3GA5A 4C3UA 3VOTA 4RDXA 4HUQB 3VPHA 1NI4B 2ONKA 4GDFA 1R4ZA 3I6MA 1U3VA 1Q0ZA 4BZQA 2XSZD 3ANYB 3V80A 1KEEA 2O3QA 2NU8B 4BECA 2X2OA 1JZSA 1YVDA 4DTCA 5IX8A 1XCPA 3O0TA 5DHTA 1URPA 2RH5A 3WYAA 1Y8QB 4O4IB 1CEQA 1TJPB 3JAKB 3KHSA 1GVNB 3RC2A 1BW9B 2D1FA 3URKA 2O59A 3FDJA 4PANA 4DV5B 3SLGA 4DQKA 1NP6A 2D5LA 4X8HA 4F0JA 4WUVA 2FPUA 4W5QA 2IY7A 4LDRA 3ESBA 3CB2A 1GPH1 2IZOA 1CNFA 2HCJB 5KQLA 4P5EA 2IOQA 2X1VA 4OXYA 4HQLA 4AJ2A 2VHQA 1R5BA 1X15A 4NCJA 2UZ0A 4YMIA 1C9DB 1A72A 3AOGA 1DIGA 3IR5A 4LZWA 4H3KB 3AB3A 4DZZA 4AI6A 2FEPA 1T9GS 1PR0A 4H0NA 1RJ9B 4PZAA 5DP2A 1B16A 1PT6A 1M0SA 3RU9A 4R8VA 3ONWA 3RC9A 2P1ZA 1SVSA 3AGPA 3W2IA 5H8WA 3AIOA 3LYHA 3OD5A 3L7DA 4JENA 3CIFA 3LHKA 1WIWA 2J0EA 2XF8A 2BEVA 4KU4A 3GDGA 3H2GA 4L8YA 5DTRA 3SE0A 4F92B 1WSAA 4JBIA 3PXGA 2XD9A 3FW1A 2CBGA 3G9ZA 3LYLA 5D3ZA 3T5GA 3G2QA 4B0OA 2JHPA 1HL3A 1VQ1A 3V7NA 1P5FA 3HXQA 2NAFA 4B31A 1EIWA 2EKBA 3ELUA 4URZR 2BELA 2BBOA 2IPLA 5DDIP 5JYDA 4JC5A 3WHKA 4DBZA 2C4UA 2DLNA 1NQUA 3O2JA 4JNCA 5IRCD 4K9LA 1Z6QA 5E6UB 1MH1A 3JWGA 2A3NA 1WHSB 3PZRA 4RADA 2XPCA 5LZ8A 3W5BA 1QR2A 5CURA 3PGXA 3FOCA 2RKBA 4UE3S 3I09A 4X5OA 2WTXA 3LOUA 1QV9A 3LP5A 2C04A 1L5ZA 1CULC 2FEWB 1UJCA 2PVSA 1Q74A 4BMXA 2IS1A 1YC2A 3ESRA 2D62A 4A23A 2IIPA 3ON5A 3A6KA 3QKTA 4RK4A 1ZLYA 3A6HA 1T3GA 3U3KA 2RD2A 1V8FA 4A2CA 5K0ZA 4QC2A 2H1OA 3HUFA 4J4TA 4UQOA 3NOQA 3QELA 4BRSA 5F5LA 3RRYA 2AZTA 2QUJA 2VYNA 3OA0A 3OUZA 1KO4A 1VRWA 4V0OA 1JHZA 3ASZA 4PU0A 1O95C 2ES4A 3D0QA 1I6LA 2W42A 3ZXSA 3P71T 1YE8A 3MBIA 5BPFA 4QYTA 3OLVA 5KYXB 1BNCA 1E9RA 4HHEA 4N48A 1X6VA 2WF5A 4A0HA 3MZ0A 1KMIY 4INAA 4BQIA 4ZRMA 2SECE 4F91B 2Z1DA 1PGJA 4MV8A 4BLRA 5HKBA 5CM2Z 3UV3A 1VCHA 4J0CA 4ZOLA 4DY4A 3O1LA 1FW8A 1L5SA 4GPEA 1ZRNA 3MTGA 1AK1A 4YAUA 4CIVA 1E6CA 3OIDA 3WXBA 2ZQ5A 2BP7B 4XEUA 1L5NA 2XE7A 3I5UA 2NM0A 1CUJA 3EODA 4PC6A 3I9OA 5TMBA 2BSXA 2ATEA 3PPIA 2CNNA 3HQ4O 1PNTA 2ZPUA 1ADYA 2V6GA 3G8YA 3O73A 1ML4A 3K0EA 3QH4A 3WGYA 1OKKA 3T7DA 1R4MB 3UOAB 1U2QA 3PVZA 4J03A 1CLEA 4GYKA 4KK4A 3GW8A 3WOVA 2OB2A 1AKTA 5KNBD 2XE4A 1IBLB 1OQAA 3EZYA 5JW6A 4B6PA 2VA8A 4BV8A 2ZBPA 5IG2A 2VBIA 3VUEA 2EXXA 1MVLA 2GXSA 1CCWA 1JQLB 2E5FA 3ASVA 2XJ9A 4WBXC 3W3ZB 4LV5B 3ZKWA 2J3IA 1NNSA 2RHBA 2IYSA 4FILA 2VNHA 2FUNB 1DPGA 3MF4A 1YB7A 1V25A 5LJLA 2EFYA 2QVCA 2W0SA 2OGSA 2R7NA 5IYZF 4Z3DA 2JGEA 1RRVA 3I5MA 4IUCS 4J3JA 1WXIA 1ZLXA 1TQHA 4ISCA 3C6QA 3T3IA 2V74B 3GT7A 3TW8B 4EYQA 4GKAA 4PGFA 4Q1AA 1ORHA 4OYLA 5AIBA 2C83A 5BSGA 1PJ3A 3CF0A 2VQ6A 4R1UA 3EC7A 4RHFA 2J32A 3RYCA 2AL7A 5IJWA 4DTIA 2JLVA 1P3JA 5JNUA 2IYQA 3U9SA 5KOIA 2QP3A 5EE1A 5BWLA 2AKEA 2MR5A 2NO1A 3NC4A 1UXHA 3UMBA 1GNLA 1S4QA 1QFJA 1TUGA 3TKYA 3ROEA 1NAIA 1UBUS 4DPKA 1TC2A 4MQMA 1VHTA 1K4KA 4I46A 3O3CA 2AOTB 1ATIA 2Z98A 1ZH6A 1UOQA 2C78A 2UUOA 4INZA 3C70A 4FZ3A 3BZBA 2J3JA 4FUTA 1ZOOA 2A57A 1J2YA 5FUXA 3I4FA 1PRYA 3ONEA 4RABA 4ZFNA 3R0JA 3IPLA 3VSAA 2BDUA 1KQPA 3ILXA 1T2AA 3W3AH 3JQ8A 1SKMA 2ODWA 5KYVA 4ER6A 4X64B 3X3HA 2BGIA 3O2QB 5ISMA 4S3MA 3LBYA 4TMKA 4Z3OA 2BEWA 2KM1A 3VVMA 2YQ5A 4HCJA 1II8A 3RHTA 2DR3A 3CUSA 1E6LA 4MQBA 3T9BA 4GI2A 1XJ0A 3V9AA 2CXXA 1N78A 4C2TA 2GAIA 1CP2A 5T4BA 3E3LA 3AB8A 1XEWX 2FGKA 5AHOA 1SULA 1QQ6A 5BSHA 6Q21A 1Q0SA 1Q7CA 1T6NA 1UMCB 2A9FA 2JZNA 3MCVA 3TLBA 1I1QB 3DXYA 2P5UA 3AQIA 5C51B 2YW9A 3TLZA 2J07A 3Q5EA 4ZOBA 1EB9A 3BHMA 4CG0A 5K3AA 3JVVA 2MJLA 5EJMA 1OILA 4TS3A 3I28A 2A7XA 1A88A 1UKEA 4RANA 1TU0A 1TTQB 2JZCA 2FN7A 3F90A 1Y3HA 3UJ7A 1ZDMA 2J9FA 3G02A 1YB5A 3ZQJA 5DNDA 4YPOA 4I1YA 3OWXA 3DLBA 3N3AC 1E96A 1EHIA 5JD6A 2H4WA 5BURA 3LM8A 2ZULA 3R5FA 3I1IA 3HBMA 1V26A 4KO3S 4MRSA 3ZOKA 1XVVA 4KRFA 1RYEA 5HM6A 2B1RA 1EWQA 3A3PA 2IXEA 2O2ZA 3SR0A 1S9DA 2Y71A 4UARA 1ODIA 2J31A 1DBPA 2Q1SA 3QPUA 4FIZA 3VDMA 2A1IA 1ZMBA 2BZGA 4HWTA 3WKEA 1JR6A 2F59A 4RVGA 3L1VA 1N7IA 4LKOA 4X97A 2R8ZA 1QRUA 4M99A 1YS2X 2RGCA 3F3KA 1CRLA 2DH6A 1UPAA 2ZSIA 2A59A 5F2KA 2W2LA 2Y2VA 1VHQA 4U2FA 5BT8A 3O95A 3L0CA 1O94C 1Y1TA 2I87A 2C5HA 3MS4A 2PM8A 3FPJA 2J0QA 5M3BA 3UHPA 5ES4B 1JS1X 1UBNA 4DLAA 2D06A 1AKNA 2YS6A 1N75A 1NY5A 2QL5A 1M8KA 3FVRA 1PJ4A 4JVLA 4NESA 1BRMA 1O5TA 4ER3A 2H7VA 3I2IA 1RXEA 5DX1A 3D6AA 2CKDA 4RTQA 4AWBA 3BULA 2O57A 1HETA 2RGGA 4Z49A 3ZU2A 4RAOA 4GL2A 2EAUA 4RVSA 4AJ9A 3BL8A 4AJNA 4RF2A 4CKCA 4XGKA 3E0QA 1BE0A 4RA9A 1DTSA 1FMCA 1T2NA 2P3SA 1UJ4A 3BRWA 4EZBA 1NNUA 4V0ME 1KOLA 3EIWA 1U7UA 2JF0A 1NONA 4U2DA 1TF7A 2VYCA 3P19A 3FTQA 3W5IA 5JJCA 2NTNA 1R4MA 2YR0A 2D2VA 3HU2A 2P5YA 2IK8A 4JYZA 1WNFA 1Q0RA 3TIFA 1E0SA 1NX9A 4NTZA 1TI7A 2EW2A 2D5BA 1N25A 3HJFA 1XDBA 3UB3A 2DWQA 1Q20A 1VLQA 3ASUA 1KARA 2A5FA 4FMPA 2ZUCA 2DF8A 1W0JA 1SXJC 2H11A 1GT91 2C2YA 1MJFA 3U3OA 1D2RA 4MUNA 5LA6F 1WBDA 5F5NA 2WOOA 4CGZA 5EIOA 4KL8S 2IUEA 5ESRA 2NPIA 3CX7A 1L3IA 3RTCA 3EUFA 3ZUPA 3E7PA 3I72A 3A3OA 2VJLA 1XMIA 2MSKA 4AO7A 2AIRA 4KPGA 4QOGA 4IZ6A 3QOWA 4LKRA 4W8HA 2N1MA 3MGKA 4YUZA 2I6FA 1PAUA 2OC9A 1HNXB 3GEBA 2POCA 4PCLA 3ZZUA 3D8TA 3X44A 4C30A 4DRZA 5JWOA 4FFWA 4MS4B 4X1IB 1M34B 2ZJ0A 2GN1A 1W0JD 5EP3A 3GJ7A 2ZDGA 1Y3DE 1MVOA 4BIMA 4ZAFA 5JNLA 2C98A 3DCNA 2ANCA 2P6PA 3E5HA 5JD5A 3GFVA 1I24A 4XXHA 4V0MA 1JLKA 3CUWA 4W63A 2D5IA 4HX2A 3QITA 5DW3A 4ZHSA 1PZGA 2ZZKA 1WCYA 3X1XA 1M0WA 3D59A 3EA5A 3LWDA 3CNHA 2BR4A 3BGSA 1J0CA 5DSZA 2H06A 2FZGA 4DM7A 2DKNA 3NGXA 5BP7A 4C3VA 1LQ2A 1M72A 3QBEA 3SZRA 3AY7A 1NRXA 2DWOA 3JX9A 4QEDA 3UQZA 4JJEA 2EZ4A 5IDXA 5AVWA 4F6RB 2VRCA 3MHPA 1ID8A 3HB0A 1Z2EA 2PN1A 1E2FA 1USWA 2H07A 1BH2A 1MUUA 3E48A 3GUVA 4KKXB 2VH5R 4FNMA 4OI4A 2QUKA 4BVFA 4DCSA 3K0FA 5PGMA 3AR4A 3BXZA 3OPVA 2DETA 1RQRA 3IAUA 3GB9A 2B8WA 2AYXA 3M6UA 4M0EA 1TGVA 4HQKA 4AXBA 2VP3A 5I7HA 1PV4A 4P84A 4OGKA 4L57A 3GJSA 3ABRB 1XTKA 1HLGA 3T1VA 2VG8A 4LY9A 4MW7A 1QRSA 2VXYA 2E6UX 2GXAA 1RBZA 3P0IA 1K88A 3N8HA 3ORQA 3WGMA 1OU0A 5BOVA 2PLWA 2VBFA 2WU1A 2GK4A 3C6BA 2C1EA 3EUEA 4EHJA 3A2LA 1UWVA 4KNWA 2A5JA 1SK9A 1SG0A 2RGBA 1EMDA 3EA4A 3FMGA 4ZT4A 5CA1F 1DV2A 3HCAA 4RV4A 3DEKA 4MA0A 3RVBA 4FDAA 2HHLA 5ILQA 2V5UA 3IX7A 2JGKA 1TQ4A 3K4HA 5K5EA 3JQ7A 1XHFA 1BQ4A 5LYJB 3LTNC 2ZRAA 4FWTA 1PFWA 2IA5A 1AK9A 3A1WA 3WX0A 2X23A 3LQ2A 4LRXA 1BJRE 2DR2A 5DYNA 3IAS1 3ZBPA 4EATA 5JCZA 1XRPA 2PZEA 3CZ4A 3HXOA 4G41A 2X0KA 2FKNA 2Q28A 3DMTC 3OPNA 2WU8A 4XUGB 5B5SA 5BV8A 5TT1A 5P21A 2OOKA 4GPAA 3WHIA 3VPGA 5B7NA 1WV0A 4IPTA 2SKDA 3E1KA 4IEIA 3K9WA 1IEWA 3H9CA 4IDNA 1B0ZA 4DL9A 1XKQA 2LIPA 2FSHA 3ZTTA 1LS6A 2I67A 4AQ7A 5U1PA 1RWNA 4LQ4A 3QPWA 4ZJPA 1V3QE 3K31A 5EJEA 4DV4B 1JZTA 4XWAA 3NUQA 4NR0A 1LJUA 1QAMA 3KP1A 2GD0A 3DBIA 3WQSB 5EE9A 3UJCA 4MYCA 3WP1B 5L3SB 1SIOA 2DX7A 5FADA 1F20A 3IMKA 1U0LA 2X2EA 4Q7KA 1T2EA 5IW8A 2YNMC 2QRJA 3G6WA 4GNRA 5F21A 3VV3A 4JX9A 1EG7A 2G9UA 4LOAA 2HLPA 4B75A 3QG5A 2I4RA 2AJBA 2PUJA 3EGDA 4DY6A 1LU9A 3B6ZA 2O54A 4GKBA 2FPGB 3R4VA 1KZ9A 1X2EA 3I1FA 1JHQA 2IIBA 3MEQA 3T35A 5JQWA 2QP9X 2D2EA 4P4SA 2I2XB 3O4HA 4TYMA 4WT7A 5IVDA 1AGPA 2FWRA 1WXEA 5CFOA 2G4CA 4A5OA 2HNAA 3U1VA 3ZCVA 1VJ5A 2AWNA 4I8IA 4DF3A 4C87A 4G25A 3UHOA 1T0BA 1IIRA 1YRLA 2ODPA 3JZAA 2RHCA 4UVHA 1N2EA 2CXQA 4QBFA 5AVKA 2Q50A 3SJZA 1CJSA 3MXTA 5EWLA 5CFMA 2L0XA 5JJIA 5TQ0B 3NVDA 4NMXB 3TEFA 4DABA 4M9CA 3OEHA 3LZDA 3C6ZA 2E5WA 5HTOA 3LY5A 2X5JO 5GP1A 5JDIA 3C39A 3HR7A 3MFQA 3T9EA 2OWDA 3TRIA 2P2LA 1Y5LA 3S44A 5JWRA 1E0DA 3ZWAA 1JSZA 4EWLA 1L5OA 1IWBB 3N70A 3E7FA 4A8JA 4BQPA 4LHYA 3LDHA 3QLVA 2CNOA 2VSFA 3KM0A 3QRWA 4QOIA 4E5VA 4DSAA 4DB2A 4HYYA 4BMYA 1ISGA 4RPKA 4MA4A 2Y1LA 3S2GA 4ZVPA 2FSUA 2HQSA 4E1VA 1SH7A 2XWJI 1I2BA 1S1MA 5CDHA 1WB9A 4YRMA 2XMRA 4BOYA 1NJ6A 4JVOA 4FGLA 3BAZA 3WLFA 4MK4A 1BMDA 1RJGA 2X8JA 2ZTUA 1AZSC 1DRKA 4WNCA 5J63A 1HFJA 1K98A 1NA5A 3HA2A 5LQJA 1QRTA 3OOSA 1LBTA 4PYQA 5I9LA 5EXEA 1T5LA 1GTVA 4ZZ0A 4XLTA 1H2YA 1U0OC 3RIMA 1S7GA 1SHUX 4BNIA 1Z6AA 2Z57A 1OF1A 2C3YA 1K7FB 4RTRA 4Y2HA 1GU7A 4RF3A 4IZHA 3TB4A 4E0BA 4IY1A 2X14A 2LGJA 3AUKA 4W1QA 4P3PA 2HMYB 1LBIA 1NUTA 1JKXA 3BDIA 2QTCA 5K0SA 1JTFA 2VJOA 4EO9A 4I5EA 1E99A 3OZAA 1UXIA 4UNIA 4WNAA 5CGQB 3NUZA 3W9YA 4RO0A 4MS1A 4XVQA 3G2LA 1ZC3A 2Q9AA 3QBVA 5J2UF 1IY9A 1M1YA 1NMXA 2QMOA 4YJFA 1NBEA 3P9XA 5HCIA 2CLMB 4F3YA 4LF9B 3LXMA 2FMFA 3RS8A 4EGAA 4OAQA 1L4KA 2OAP1 3D6FA 3K9NA 2PRIA 3QPAA 1OBFO 1OYYA 1L4FA 2HV9A 5JTUA 2ZANA 1YRHA 4EHKA 4JQSA 2GNAA 2AW3A 3DV0B 3PR3A 1KDPA 3VU8A 4EDHA 3OZVA 4AMZA 2B9EA 4URYR 4RULA 3ZZ1A 3BMCA 3ZK9A 1NN5A 3N8IA 2QRKA 3FOBA 4ASUA 1QO0A 1C0IA 3I52A 3WOHA 3NTLA 1J20A 4WFQA 3TLCA 4KODA 5HILA 1K3FA 2R86A 2CVPA 1WMSA 2TRSB 3C14C 1TCUA 4XARA 4XIJA 3VPFA 1NBWB 2ZJ6A 4KSYA 3LECA 2MWMA 1CTQA 4PCUA 3SDSA 1QCDA 3VX4A 4F06A 3UGTA 121PA 4G4SO 4MKGA 4LJ6A 3SZGA 5JAOA 4DB4A 3QXHA 4INPA 4Q4DA 2EZ9A 1GKIA 4G09A 2AFHA 2EFGA 5TQ2A 4E88A 2V6JA 3S55A 2ZI3A 4DHEA 5A3JA 3BIWA 3WGGA 2X0IA 3EARA 3EW9A 3DOCA 1J70A 3KKMA 1YCFA 3ZH9B 4O4LA 3OG9A 1RQPA 1HMPA 2ADOA 4PC7A 1L7VC 4C06A 3KB8A 3ZI4A 1AUXA 4P93A 1QOPB 1JLMA 4BUJA 2RKWA 2AD5A 4KPEC 5EEHA 3RRJA 4WNYA 2XMGA 3V4FA 3A25A 4P38A 4YAWA 1P4RA 3A14A 1QOQB 3EIEA 4G6ZA 4ZQHA 3RT9A 4IL5A 5KOYA 3K70D 1SK8A 3VOSA 3VNBA 2P41A 2VP9A 4LXXA 3SSAA 3RAJA 4EM6A 4GWKA 1E0AA 1ZD3A 3OFSA 4N65A 4MNTA 4X1IA 1OASA 3HNOA 3UAWA 2HSJA 3LOQA 1FSFA 2PMCA 1ESEA 3LXRA 4QGAA 2VF4X 3QENA 3LH5A 4PPGA 4TKZA 4H31A 2GHIA 2Q6VA 4M2LA 3T5MA 4EFLA 1VZ3A 4OA8A 4F4JA 1DIAA 6NULA 1LTQA 2WE8A 4N0MA 2ZLBA 2CXTA 1TZ2A 4C20A 5K03A 2GJKA 1HYBA 1E7QA 1UPXA 2GQ0A 2OO5C 5ENDA 5CDFE 1UWCA 1YVRA 1R5NA 1P0IA 4MYHA 5HGJA 2I65A 1JIQA 5JAZA 2CKMA 2VOEA 1WXHA 4GM4A 3CBQA 4H3SA 4FOOA 1GOTA 3DYVA 1ZM2A 3N0TA 4GZ3A 1M75A 3DBHA 4F5ZA 2OM6A 4MUXA 4MZDA 3LX8A 5AW4A 2QGFA 3O4FA 1DV1A 1OC4A 3F2IA 3H05A 3F7MA 2ZJBA 4KMOA 4LBYA 4PLTA 1U7ZA 2BCEA 4YP7A 1WR8A 3L84A 3FSRA 2WG1A 1OWNA 1WLSA 1NR5A 4FE4A 4AMBA 4CT0A 4E7PA 3NDBB 4KB5A 1FYDA 5GM1A 1OXKB 4MJXA 2BF7A 2WM3A 1Y3CE 4R1SA 4LV8B 3ZGOA 2B35A 2V4MA 3LUBA 3IR6A 2C7OA 2XYVA 3ZWCA 4OK3A 4YJ3B 3KKLA 2R7LA 2V7QA 4YJGA 4PXSA 5I7WA 3DE1X 4FYYA 1G21E 4CUJA 5WRFA 1CJUC 1QB8A 1CUWA 1ZXLA 3CTMA 2EJUA 2PFGA 1OFGA 3G2MA 2GBGA 4RKFA 1KI1A 1KK2A 1STOA 3GEDA 4E6PA 4WIAA 2HX1A 2XGMA 3S5JA 5IKMA 1EK0A 2G7MC 2G1JA 3G23A 3FOAA 1LTKA 2L2QA 4K26A 5KC8A 5K4GA 2VTBB 3HLKA 5FFMA 2UZ1A 3Q2KA 4AX8A 1G20B 2W2PA 1N9KA 4CU2A 2OMEA 1JIKA 4HBZA 2I78A 3P2OA 3VZQA 1KK0A 3JSAA 5J5CA 4HDAA 1R50A 2DTXA 4YMLA 1HMYA 1DHRA 5JS8A 3E9RA 1IRIA 1CB7A 1V5EA 3R0VA 5BN1A 4QXAA 1WA5A 2CBXA 2JG3A 3VR4H 2HCBA 9LDTA 1HEIA 2BFPA 3O5AA 3PPVA 1T5TA 4HWOA 1KMNA 1W46A 1D2MA 3HRHA 1N32B 3IUJA 1G2IA 4OVKA 2XW6A 3RK0A 4PPNA 1PFGA 1ZK0A 4L07A 3PXCX 4MVJI 3ROTA 3ZVRA 2C5BA 1VYHA 4J0KA 4B7UA 2B83A 1S2DA 4NHEA 4IH1A 4UHCA 2FK8A 4F3RA 3EXAA 4BNYA 1NX6A 3RYFA 3UA4A 1L7RA 4L3OA 4RUKA 5U9CA 1XPJA 4N3NA 2VZ9A 2R4UA 3VH1A 1JDJA 2O06A 1FFEA 1ID1A 5J1SB 2HZ7A 1G7RA 5K8VA 4UHBA 2BMEA 3WYNA 1F5NA 1CQIB 1C3JA 3WLEA 1YE5A 1PN3A 4UDNA 1GU1A 1QONA 3D31A 4BAGA 4EIWA 4Q01A 1C1DB 4YRQA 3RSHA 3H8SA 1YRAA 1O5OA 2IV2X 4CT5A 3ZGZA 4V39A 4TMTA 3V8BA 5J4VA 3RDPA 5D1HA 1KAGA 1HE5A 3C24A 5ELMA 3KYIB 2JAWA 3CW9A 3RWBA 4PS0A 4GM1A 4TT8A 4ZI3A 2X0RA 3G1WA 4MUIA 3LXUX 3VAYA 4HRYA 3W4KA 3I2YX 2WHPB 4NONA 2G9QA 2X6QA 4IGFA 5LPNA 4DMFA 3MOGA 4ESOA 4F6CA 2PMFA 2EBHX 2ZR8A 3QU4A 1AGXA 5BY2A 5DYGA 1YZQA 4CV1A 5CA1B 2Y3IA 3E7WA 3N2LA 5AK3A 1DJPA 4HUTA 2YJZA 3OAAD 3OX2A 1A2QA 2XD4A 1V35A 4ZZIA 1WB4A 3N2GA 4BFUA 3BJIC 1I6WA 1UC5B 1X13A 2VJAA 3B9BA 3BDAA 2ZATA 3FGNA 3FSGD 3HKCA 3K9HA 3PRKE 3BZWA 4LTMA 4P4LA 4WCDA 2VDKB 4WINA 1SUPA 1VRCA 2HQBA 4AU1A 2WU4A 1U8UA 4ZO8A 4D9HA 2G1UA 4BMPB 1F38A 1VSTA 3WLPA 2IZ0A 2EYUA 1JA9A 2Q45A 3N5KA 3D8NA 4GW3A 3TB6A 1RVDA 3H42B 1T9BA 3EOAI 1HYHA 1L5VA 3K05A 4UASA 3TLJA 1LJ8A 2O7RA 3V1KA 2EATA 3L8ZA 3L6BA 2GDZA 2F7SA 2Q4TA 4IJUA 4FW8A 3ZD9A 2QN8A 3ACBA 4HRAA 4M9UA 1C7EA 2OD2A 1RTTA 1ODCA 1TTPB 4YAJA 5F1OA 1E9SA 1E9AA 2ZQZA 5THQA 4OP1A 3H84A 1X1AA 3GJ4A 1CIJA 1Z6TA 3E8SA 4XCXA 5FXMA 3U49A 5D3KA 2J3LA 4YH1A 4M9RA 5IHXA 1DEXA 1QHFA 2FQXA 1SELA 1GGNA 2H92A 1IQ0A 2JEOA 3HU5A 4TOIA 5EKDA 2YC2C 1T26A 4G26A 4CMCA 1M5RA 4DMGA 1D2AA 1QIDA 3P7MA 4AL4A 5HK9A 3HH8A 4BO4A 3PQEA 1BMFD 2CDNA 5HMLA 4DANA 3HDGA 2YWGA 5AT1A 5IT5A 3IRUA 4ZVMA 3QA9A 4CI9A 4MV4A 5F7XA 3NBXX 1UBMS 5LP6A 2Q49A 3R0IA 3C85A 1Z28A 1D2NA 2DFKB 3DNPA 2Q1WA 3CMMA 4RDHA 3WK5A 3FPFA 4LHEA 4ZVQA 2NUBA 4D97A 3IP9A 4DUGA 1U3UA 4JAVC 4F12A 2J5RA 3JQRA 4FFBB 1UMBB 3PUYA 1IWPB 1VI6A 2QZJA 3AFHA 3AV0B 2E7ZA 4DPMA 3L8EA 3QQPA 1A8HA 2P91A 4J7XA 5JMTA 1Q0PA 3O47A 1GGKA 4C7BA 3LUPA 4LC1A 1EA7A 1GR1A 1OZ0A 1V1MA 2BMDA 5ALRA 5EQDA 2WD9A 2ZUWA 3QKUA 2ZP1A 2FWIA 4U9UA 2EJTA 4F5EA 5JZOA 2W6OA 1NF9A 3GGCA 4G0ZA 2ZEJA 1MOQA 4GI7A 1LPMA 2YW2A 2IDJA 3HY3A 1W2HA 5AYVA 3ZWVA 1OI7A 1QGZA 4ZCQA 1MG5A 5JECA 2GVZC 4A7PA 4E7OA 4D0SA 3IUEA 5LMZA 3SQDA 1K6EA 4D96A 1AXEA 4RQUA 2Z8ZA 2FFBA 1J97A 2DY1A 2Y1KA 2ZUSA 3NX4A 2QL6A 1DEKA 2YVQA 3I12A 3VR2A 1KR2A 4YAKA 2KLHA 1N4DA 1AKVA 1C8BA 4F1WA 1GN8A 4RX1A 2R1VB 1N0IA 5IYZB 5C35A 5L6MB 3OE1A 3ED5A 1PJ2A 1K7SN 4DMKA 1YFZA 1CS0A 2H08A 3QVMA 3TIGA 2IVFA 2XYQA 2AQKA 2B6HA 4ARZA 4UDXX 4H7DA 1KC3A 2W8ZA 3GMSA 1KY4A 3ILYA 3M4NA 3ZHSA 4BKRA 1RAGA 3T0IA 3OOEA 4YUXA 1LWOA 4OHKA 5BYKA 2DPXA 2XCOA 3L46A 4Q3EA 4HAZA 1FDOA 1P19A 2PT5A 3K73O 1E4VA 5KX5A 1GL9B 1QGAA 4UHDA 1Q12A 1TZKA 4GWGA 3HI6A 3JD0A 2Z2JA 3D2CA 3KCQA 1XCMA 2GCOB 2WYWA 3P9QA 4GSLA 4M9QA 3WDSA 4ZCRA 2PUEA 4NVRA 3KJFA 3L93A 3R3SA 3GFSA 1E3TA 1PL8A 4GYJA 2QR3A 1GSIA 1PGQA 3RSSA 1Y42X 1GG8A 1HL7A 1T9ZA 1XKXA 2RC6A 4CV2A 3T7RA 3LW7A 3UEOA 3LWZA 4BZXA 5DCYA 4B0PA 5ENVA 4BCDA 2ZDQA 3MD9A 4AP5A 3NNDA 4K6HA 1LW6E 1M2OB 1T24A 4U6QA 4F6RA 5HKAA 1IH8A 2GBLC 2IXTA 4MVCA 4UJ5A 3CR3C 1MCZA 3JASA 3B1YA 3ZCPA 5IF3A 1QHSA 3MG9A 1Y33E 5FYDA 2VHJA 2QE7A 1SUIA 5KU7A 1WDWB 4PIVA 4K6KA 3X1WA 5DVZA 3V8QA 2F62A 4MW5A 5C1BA 5FL3A 2XTJA 4WESB 2IXGA 1M2JA 3ROGA 4Q1FA 3GQBA 5JVDA 3FYHA 3N39C 3W0LB 3EK2A 4OGLA 2AQIA 3A32A 2QW8A 1RWKA 2LKDA 2OZPA 4MVJH 3NHWA 4B5KA 5K8IA 1ZP6A 1QRRA 1YB4A 3PUVA 3AI7A 5EGNA 3TDKA 2H9IA 3D7LA 1JKMA 3QEMB 2WYIA 3DKKA 4BFYA 3TG2A 4QYMA 4DAEA 3BWEA 4LRSB 2BL4A 3UGJA 4ZHQA 4A0GA 3D4NA 1Y6FA 1G5QA 1JVNA 1RR6A 1L1QA 3JD1A 3OPYA 4XD2A 1WUYA 3RBAA 5IN4A 1VG8A 4H1UA 3KTAB 2XV1A 2DEUA 4JT9A 4EI8A 3RYCB 1FTWA 2J9ZB 1J1UA 2B92A 2ZTVA 3CZAA 2V59A 1ZYUA 2XVYA 2ZAGA 2XH8A 3GLHE 4HDRA 4NBKA 2OFFA 3NORA 2J9RA 2X4DA 3B13B 4NC9A 1G8AA 4DDTA 2G07A 5DB4A 1UKZA 3ITNA 2GPNA 1EFAA 1GD1O 2PRKA 3B1VA 3MWEA 4BDTA 1GZ5A 1FRQA 5ARBA 4Y18A 5KNCA 1X9IA 2B98A 3I23A 2NP6A 3QGMA 1HFWA 1DTEA 1OXTA 2HAEA 1QUEA 1WY7A 1BHO1 3PQ4A 2I9PA 5EYPA 1CF2O 1TM3E 2AC7A 1FA9A 1JH9A 4DA0A 1HBJA 2I3DA 1DAKA 4LZAA 4CQMB 5KKNB 2XVZA 3IUPA 5GV7A 3OE4A 1JKJB 4W5TA 3QF4B 1CIPA 3FPEA 5DNCA 2CLHB 1DTWA 1QWSA 5BV2P 1TMGE 4OJKA 1GTG1 3I4CA 3RVKA 3UXHA 3G17A 4F86A 4KE7A 4LVUA 4KHPB 4QT4A 4HWPA 4O3FA 2ZOSA 1K5DA 3L0DA 3LQYA 4I9UA 1K5HA 3GJZA 2L82A 4P35A 3H1AA 4GNKA 2LXNA 2PX0A 3C1UA 4UXIA 5SZIA 1LB1B 1YQGA 5DN6A 5AFSA 4LZLA 3SI7A 2AI2A 2PZLA 1IBSA 1ZEMA 3K0AB 3F1KA 4FOLA 1RIFA 3CONA 4B2IA 2V7QD 1JEAA 2C5SA 4BMCA 3L7LA 4UM9D 5J3JA 3K0BA 3QFFA 4QPPA 1F0KA 4JZYA 2HJSA 2PSJA 4XVCA 1DXHA 3OEWA 2B6NA 5GINE 1YUNA 1EXDA 2P68A 3G8BA 4K03A 1NM5A 3PITA 2HUPA 4CRWB 1QVZA