3DNMA

Crystal structure hormone-sensitive lipase from a metagenome library
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
297
structure length
297
Chain Sequence
DTKMDPRDFLQLLKINAEKAEKNLPLDQKRAGMEALCERFPRAEGVELTLTDLGGVPCIRQATDGAGAAHILYFHGGGYISGSPSTHLVLTTQLAKQSSATLWSLDYRLAPENPFPAAVDDCVAAYRALLKTAGSADRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLSPFVDLTLSRWSNSNLADRDFLAEPDTLGEMSELYVGGEDRKNPLISPVYADLSGLPEMLIHVGSEEALLSDSTTLAERAGAAGVSVELKIWPDMPHVFQMYGKFVNAADISIKEICHWISARIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of a novel hormone-sensitive lipase from a metagenome library
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 99
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.-:
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dnmA00
3BIXA 3A2MA 4AQDA 2HL6A 4UBJA 5FRDA 1XZCA 1BS9A 1A8UA 4HAIA 3QITA 2GYVA 2XMCA 1DT5A 4GDMA 1BROA 2JGFA 5FOQA 5ALEA 5C7YA 1XRRA 3V1KA 2Z8XA 1ODTC 1M33A 1TRHA 3DDUA 3WZLA 1WM1A 3C43A 2PU7A 3H18A 3CN9A 4WFIA 2XQFA 4FKBA 4ZREA 1QJ4A 1YSCA 2X76A 3WJ2A 1S8OA 2ZYSA 1NX9A 2IX9A 5AIBA 1YS1X 3D3NA 1DTEA 5AOAA 2C5GA 2OGTA 2GBCA 5AO9A 3WYDA 2LIPA 4E46A 2WU3A 2XUJA 5HFNA 5BWBA 3DYVA 3D2BA 1LLFA 5CXUA 3D0KA 3V9AA 1FFAA 5LYYA 2ACKA 1EVEA 4UBKA 4FTWA 3WKDA 3IUNA 4OB7A 3N0TA 2HFKA 5EHNA 4WFKA 1USWA 4CI9A 2RHTA 2H9YA 4KAAA 1W76A 3PDCA 3H2JA 1XQYA 4X85A 2QOEA 4MWSA 5ALUA 5I9IA 1CUZA 5CH5A 5AICA 3H19A 3QMWA 5J3JA 4HXGA 3R3UA 4QNNA 4B82A 3DJYA 2QUBA 1A88A 4IH1A 1JT2A 3WLAA 4N8EA 5A62A 4BTLA 3WIOA 2RONA 5KBYA 5KWIA 1UK7A 2WQZA 3VVLA 3ICVA 3W9UA 3QBJA 4Z49A 3STVA 3N2ZB 3IULA 3WWOA 4BRSA 3KSRA 5EI5A 1K8QA 1WB5A 2ZJ6A 4PNZA 5T4FA 3RM3A 1NU8A 4HTAA 1MAHA 3FCXA 3BXPA 3W9BA 2Y6UA 4NMWA 1XRPA 5I8PA 1TIBA 5A6VA 1EX9A 1LPBB 1P0MA 2YXPX 4LXHA 3V1MA 1UK9A 2ES4A 3OTQA 5ALOA 3DOHA 3KOOA 3PICA 4I3FA 1WPRA 2JGMA 1ZGBA 5ALZA 3ZLUA 4LXIA 4FLMA 2X8BA 2X5XA 2HA3A 3C5WP 1WB6A 4FNGA 4H7JA 2QJRA 4J0DA 5EFZA 5IVHA 2YYSA 4RGYA 2WFLB 1AZWA 3G02A 2HRQA 1L7RA 1YA4A 3STYA 3DQZA 3RLIA 3C6XA 2CZQA 3E1GA 5AK4A 3TEJA 1Q0ZA 4N8DA 2XDWA 1N8SA 1CUVA 3R0VA 2JGJA 2ONCA 1AGYA 2Q0XA 2VSQA 4Q05A 3R40A 5H3HA 1Q0RA 2V97A 3LS2A 1TK3A 2J3QA 1K6EA 4FBLA 5ALGA 1MNAA 2I3ZA 2XUKA 1YAHA 1E8MA 3ZWQA 4Y2UA 1XQXA 5HZGA 4GXNA 1GQSA 1QONA 4G4GA 4LHEA 2QXUA 1EXWA 3AJAA 4JH0A 4AN0A 2C7BA 4AX4A 5ALHA 1QIFA 1U4NA 4W63A 3TJMA 1VA5A 4WDRA 3PI6A 4HRXA 2O7VA 1F6WA 3T4UA 4BAGA 4KACA 5AM1A 2JEZA 1W52X 4QA9A 4X97A 2XUFA 2G5PA 3O4GA 2PU5A 4ETWA 4E11A 5HQ3A 1YB6A 4C4XA 1B6GA 1CUAA 1L7QA 1Y7IA 4BE4A 3BJMA 2ZSHA 4ARBA 3IIIA 5AKIA 3NUZA 4D9JA 4AXBA 4EY4A 3V1NA 4W1QA 5DLPA 2WIDA 1LBSA 4GWLA 3LIPA 3S8YA 5CH3A 1EA5A 2FX5A 4RNCA 2C58A 5LKRA 5AI9A 4UHCA 1CQWA 3FNBA 2VJAA 2WJ6A 2BKLA 4Y7DA 3H2IA 1SCQA 1E5TA 1N5MA 2RI6A 4MQLA 3KWJA 3R3XA 4UBNA 4UFNA 2WHRA 1CUXA 4BB0A 2UZ0A 2G5TA 3QYJA 3E4DA 2O2HA 4RE6A 4QWWA 3WL8A 1E8NA 2WFLA 1UT6A 3G0IA 3A6ZA 3D2CA 1THTA 1QIDA 3I2IA 3HACA 2H7YA 1ZD2P 3STXA 2R8BA 1MT3A 4EZIA 3D59A 2VA9A 4DNFA 3MGAA 4EY7A 1ZJ4A 4X94A 4J7AA 1R3DA 1BCSA 1XZMA 1LZKA 4F60A 2HA7A 4Y2PA 3M82A 3ZLVA 2XLBA 1FJ2A 1SOMA 5DYYA 2HA6A 3I1YA 4ZXFA 4E15A 4AMYA 1BN6A 2PSHA 1QO9A 4L0CA 2OLEA 1MX9A 3FBWA 1CUFA 1DQZA 4A16A 4IO0A 3WK5A 1J2EA 5JD5A 5JYCA 5AI0A 2YASA 3JWEA 4OB6A 4EUSA 1YB7A 4OPMA 5AI8A 3WK6A 3IB3A 3JW8A 1XZGA 1CV2A 4EBBA 1F0NA 4J0CA 4G8CA 4L3WA 2QT9A 1X70A 1QLWA 1CUIA 4L72A 4CCWA 2Y2UA 4AMZA 1GPKA 4OUKX 4DNPA 5JALA 5CMLA 4C88A 3C6BA 4BVKA 2FJ0A 1MN6A 3W05A 1QIHA 2I03A 2ZVDA 2WUDA 3GBSA 1X2EA 3H0CA 4Q82A 1DU4A 3WKBA 5CT6A 4LKOA 2RAUA 5ALRA 4IH9A 4HS9A 5ALYA 5ALDA 4DSZA 4YK7A 2ORYA 2Z8ZA 5K5EA 1XQVA 2HM7A 4CG1A 5HF9A 2XE4A 3W2TA 3F97A 1UOQA 2OG1A 5A2GA 4OYYA 2GYWA 4B0PA 1BE0A 5A7GA 1QIJA 3ZI7A 3WKAA 4LYDA 1R1DA 4CIAA 1SCKA 1HQDA 3QM1A 1VXRA 3P2MA 1GGVA 4BAUA 2PUHA 3I28A 4Y2JA 1QOZA 3G0GA 5LKAA 2QXTA 2BUCA 3AZOA 3C8HA 1J1IA 4QE3A 2XUOA 3AZPA 4UHEA 4K6HA 2Y1KA 3CCCA 3AINA 5IVKA 1E89A 3G9ZA 4BDSA 3BF8A 1AQLA 2PVSA 4BP8A 1WHSA 4INZA 3VJMA 1FFCA 3G9UA 1UKCA 3FOBA 4I4CA 5HK9A 4OSEA 1EI9A 2XLCA 1XLVA 2QJWA 3WMRA 1EB8A 4MYSA 2JF0A 1RYYA 5JD4A 4X6XA 1PV1A 2XMDA 1CUJA 4QZVA 5IH7A 4P9NA 5LZ2A 2GYUA 1VE6A 3TGLA 1G4HA 1EK1A 3BDVA 1RWQA 3D2AA 3BIWA 3WKCA 5K3EA 4BCCA 3KWFA 2D0DA 1IZ8A 1U65A 3KD2A 2HU8A 4Q3OA 4X00A 2H1IA 4X93A 5JAHA 3H1BA 4JEIA 4B81A 2HDWA 4GLBA 3EIOA 3EQ9A 1E66A 1UK8A 4G4IA 4J03A 5KWJA 3VXKA 5ALLA 1Q84A 5SYNA 1IUOA 2JBWA 5JIBA 3AIMA 4UHBA 3WWCA 4H7HA 1TQHA 5AM3A 1BEEA 3C87A 4Y9SA 3WK9A 4Q3KA 3RARA 3ESCA 3WWPA 5ALVA 3D5EA 4Q34A 1VOTA 4PSUA 5AK5A 2VF2A 5ALNA 2I78A 2OCIA 4LXGA 5AI4A 2E3JA 1EINA 5DYTA 3D7RA 3M3DA 1U8EA 1P0PA 1UFOA 2HFJA 1TAHA 1JJFA 2D5LA 2P8SA 3KXPA 2JGKA 2DHDA 4RPCA 2OCGA 2VEOA 3I6ZA 4DMFA 1IZ7A 5YASA 2WLSA 4U2CA 3AIKA 1MTZA 2CJPA 4BE9A 5K3FA 2W6CX 5C8VA 1J07A 3H04A 1QIGA 1EVQA 1DWQA 1OILA 5E4YA 4DMCA 5IKXA 5AJHA 2AJCA 1Y7HA 5D6OA 4KAFA 5CT4A 1Z68A 4Y2VA 3RK4A 1G5FA 5AKXA 4MXDA 4ITVA 3WJ1A 4GHWA 5ALFA 4UHFA 5FLKA 2HHAA 4FDMA 1LNSA 4X71A 3O4IA 1GKLA 3FYUB 2HADA 3H17A 2BJHA 2GZRA 3L1HA 4MJ3A 1XRLA 5JATA 4Q1VA 3K2IA 4J0IA 2PSDA 3OPMA 4M0EA 1IUPA 3ZPXA 3IUQA 5DNUA 4BRZA 1LPAB 2I3DA 2WHPB 5HF5A 4MEBA 1UK6A 5K3BA 4BVLA 5T4EA 3JYHA 3VVMA 4N8SA 1BN7A 4QWMA 1JU3A 3QZUA 4XVCA 4H77A 1CUBA 3T52A 2ACEA 4EY6A 1UXOA 4W1SA 3PE6A 4IH4A 3LCRA 4G9EA 4AZ3A 1PFQA 4UBIA 4ZGBA 1CEXA 1QTIA 3CXUA 4CFSA 1XKTA 1O6GA 4QDXA 3K9BA 3W04A 3WKEA 4BDTA 5CT5A 4B7ZA 3G9XA 1SFRA 4CIBA 3ED1A 4C4ZA 3G8YA 2DSNA 1YS2X 4BCDA 2V98A 1GXSA 4PO3X 3WK8A 4B6GA 3FSGD 1E3QA 7YASA 5A71A 3I2HA 2O2IA 3HYSA 2GZSA 5DYWA 1QIEA 1LGYA 4KAJA 3WK7A 3FSGA 4ARAA 3BF7A 3EQ7A 5IVIA 1ISPA 2VT6A 2DCMA 3H1AA 4BATA 3L1JA 3U1TA 1QZ3A 1DWOA 1FFDA 1GPNA 1XZLA 2WIFA 1ODCA 4DMKA 1IUNA 1EDBA 3HI4A 5KREA 4B80A 2HU7A 1XKLA 2CB9A 3FCYA 5EHQA 3V48A 4HZGA 3UUFA 1W6RA 1QIIA 1UWCA 2DR0A 1R9MA 2XUGA 1C7JA 2G63A 1CFJA 2OCKA 4UPDA 2VATA 1JJIA 2BGRA 3QH4A 2C4HA 3HRHA 3M83A 3A2LA 4X6YA 3NGMA 1MX1A 3IDAA 3HC7A 3FYUC 3Q8WA 4A5SA 2C5FA 3B5EA 1LZLA 4TVKA 5CRIA 3AZQA 2VJDA 2DQZA 1G42A 3C5VA 5CH8A 1H2WA 2PSEA 2BGNA 4V2IA 4BZWA 3NWOA 1ODSA 1WB4A 2WM2A 4H0CA 2O7RA 3VJLA 3HLKA 2QUAA 3HJUA 5EGNA 3DLTA 2CMFA 3A2NA 4B0OA 3ESAA 5AK6A 1BCRA 2JGEA 1QE3A 4HRYA 5CT9A 2RGUA 3HABA 5LZ4A 1D07A 1EDDA 4HXFB 2WJ4A 3LP5A 5AOCA 1J06A 4C4YA 1CVLA 2XUIA 5JAUA 4U2DA 1GZ7A 1K63A 5CURA 3G0BA 3SC2A 1VZ3A 5AP9A 1RP1A 5EIEA 4KRYA 3VKFA 2YH2A 4KR0A 1XLWA 4W1RA 2Y6VA 3HZOA 2XQIA 3ZV7A 2C0QA 2PUJA 2V96A 4Y2YA 1DX4A 4KJXA 4W9RA 3DNMA 4B84A 4OCZA 3VISA 3OG9A 3STWA 4G8BA 4KE7A 3OC0A 2XMRA 5ALWA 4J0KA 4ZV9A 4X6UA 1WOMA 3CN7A 3F96A 1MX5A 4FFWA 2J4CA 4UUQA 3MUOA 1H2YA 3GROA 2QZPA 3LIIA 3R3WA 4WY8A 4YASA 5LZ5A 1ZI6A 4EA6A 2XB6A 4Q3LA 4TGLA 1CIJA 2JEYA 1CUYA 2Z3ZA 3M81A 2WIKA 4UHHA 1WPXA 1GPLA 3ICWA 2K2QB 2WJ3A 3O95A 4GEGA 4Y2RA 4BVJA 3G0DA 5AKGA 2XQGA 4CG3A 2XMZA 5LZ7A 5DNWA 1ZI9A 4K2AA 4B83A 5D3ZA 1U2EA 4Y2QA 3ESBA 4Y2TA 3R3VA 4F0JA 3BE8A 5DWDA 5AKEA 5E4JA 3EQ8A 1ZJ5A 4TPKA 5LIPA 1LPSA 2B61A 4JYPA 4DYHA 2J4FA 2DHEA 5AOBA 1UOPA 2VJBA 3G7NA 2PSJA 2WUFA 5D3KA 1VA4A 3A70A 4I19A 4XWGA 1LPOA 2WKWA 1VLQA 2AJDA 4DTCA 3W06A 3AFIA 4P08A 4JNCA 2AJ8A 2DQYA 4CCYB 5AM4A 4X95A 4GECA 4ZWNA 1BEZA 4FHZA 2WFMA 1XZFA 3VJKA 3DL4A 5AI6A 3C70A 5K3AA 4G4JA 1CRLA 1GT6A 1HPLA 5ALPA 1KU6A 5JANA 4EY8A 5K3DA 4ZI5A 1QFSA 2CEKA 4J3JA 4KE9A 2XUHA 3DOIA 1IVYA 1W4LA 4H7KA 4ZV7A 5FPPA 3DD5A 4AB1A 5LLSA 4WCVA 4BBZA 1BU8A 1NU6A 1LPNA 3EBLA 3B12A 1K4YA 3ZLTA 2JGIA 2BFNA 1F8UA 2B9VA 5ALJA 4OU4A 1FSSA 1X2BA 1XFDA 4Y2SA 3SX4A 1CUCA 5FKJA 5C8XA 2ZYIA 1MJ5A 2OGSA 4C6HA 3NOXA 2WHPA 2XT0A 2OAGA 4QLAA 2NW6A 2WG1A 3VDXA 1HKHA 1Y37A 1EK2A 3I2FA 3R3ZA 5FPQA 2ZYRA 5BV7A 2WTMA 2QVBA 5HF8A 5JAPA 1SCIA 1CQZA 3WL7A 1GKKA 2CBGA 3GELA 3PF9A 4H7IA 5SYMA 4FMPA 2BUAA 3Q0TA 1E8DA 4BC1A 1TKRA 2DFPA 3WZMA 5EHZA 1ZD3A 2ROQA 1A7UA 1JI3A 1HL7A 2QMQA 3AUKA 1QTRA 5LZ8A 2XMQA 2WFZA 3ANTA 3H2HA 2QM0A 2XQKA 4FWBA 1FFEA 3CCBA 5CTAA 1H2XA 3WI7A 3O4JA 3SK0A 4C01A 5AKYA 3F8SA 1K5PA 4N5IX 3SWWA 4UBMA 1UOOA 4J0JA 1FFBA 4MEAA 4U2FA 1H23A 4WY5A 5A7FA 1ZD4A 3LLCA 1XRNA 5DNVA 2DHCA 1H22A 5ESRA 4GI1A 2XMBA 3B3QA 2XUDA 1HDEA 1MNQA 1YA8A 2IITA 1CUGA 1VZ2A 3WQHA 1XZIA 4HVTA 2OGZA 4DMHA 2VTVA 1XZAA 2WHQA 3O9VA 3OOSA 3RKSA 1BRTA 4UHDA 1C7IA 4E14A 1XZEA 4OD0A 2PL5A 4U2EA 5BOVA 2EEPA 2Z3WA 2JIDA 5ALXA 2VJCA 5AKZA 4UFPA 4DGQA 4M0FA 1HLGA 5BWCA 3PUIA 4AO7A 4WJLA 2GBIA 1AUOA 1UZAA 5JASA 5DJ5A 4NVRA 4BCBA 3C45A 3FVTA 1EH5A 5HFAA 2ZSIA 4NZZA 5ALTA 4H7FA 4F5ZA 4K6KA 4LIPD 4QEKA 3WL5A 4PSDA 2AJLI 3YASA 4M0MA 2G4LA 4C87A 4KE8A 4B9AA 5ALIA 1CUSA 2WU4A 1HBJA 1OCEA 1YCDA 1R88A 3ILSA 3AIOA 2BUBA 1ORVA 1PJAA 1IMJA 1P0IA 3FYTA 5AK3A 1CUWA 5DTIA 3QMMA 4KEAA 5JD6A 2OAEA 4BAZA 1ORWA 4DIUA 5HKAA 2OQIA 4H18A 2JGLA 3E0XA 3IA2A 3I1IA 4N5HX 3DL7A 1XZDA 1TCCA 2C0PA 1O6FA 4FLFA 1VE7A 2ZJFA 1KU0A 5C8ZA 1CPYA 4X3CA 1JJBA 4DSAA 4K5QA 1H2ZA 2WSLA 2CUTA 4K6GA 1XRQA 5FDFA 5IVDA 1TCAA 1XRMA 2HA4A 1XZKA 3DKRA 5LZ9A 2B20A 3WWEA 1AX9A 5HCUA 1G66A 2AJBA 1R9NA 2OQVA 3KDAA 1DINA 4UBOA 3F9CA 1JKMA 1DQYA 5AI5A 3WK4A 5JARA 1A8QA 1CUEA 5AM5A 5K3FB 4G8DA 1QFMA 2OXEA 2QS9A 3IBTA 3FVRA 3F67A 4BYMA 2EDAA 3L1IA 4JUIA 4X7BA 2HA0A 5AKJA 3S2ZA 3BWXA 3O4HA 4GBGA 4PQEA 2VT7A 5EHXA 2V9ZA 2O2GA 2OPHA 4DLNA 5A7HA 2WIGA 3F98A 4QDUA 1LBTA 1LPMA 4OU5A 3C6YA 1ZOIA 3BJRA 2R11A 4YX9A 4QDTA 4JYMA 2WTNA 6YASA 3WL6A 2IIVA 3BDIA 4DM7A 3PFBA 5CT8A 5CW2A 3STUA 5AM2A 1ETHA 5AM0A 3IVMA 3OURA 3IUMA 4KYVA 4YPVA 1I6WA 2WIJA 3FLAA 3I2JA 1UKAA 1XLUA 1F0PA 5I7UA 1EHYA 1QGED 3DCNA 4ZRDA 4QDOA 1N5RA 1ZICA 2XUAA 1QIMA 2RIPA 3I2GA 3WWDA 1C4XA 2VAVA 4S0XA 4UFOA 4P93A 5D7BA 4G1FA 2GBGA 5ISMA 4FOLA 4EB0A 3QPCA 4PSCA 3H2KA 2WG2A 3G0CA 5CBKA 1L7AA 3FYUA 1CUDA 3V1LA 2CKMA 3U0VA 1ZI8A 3EF3A 5HK8A 3AILA 4EY5A 5FUMA 4XIIA 1KEZA 2PX6A 1AC5A 5EIAA 2HIHA 2H7CA 3TRDA 5T4HA 3QPDA 1QO7A 3ANSA 1SC9A 4KRXA 3GUUA 1GQRA 2PPLA 2WG0A 5LP1A 4BC0A 4AN1A 2XQJA 3DKKA 1AURA 3UMJA 2H7XA 5T4BA 5JADA 5F4ZA 2RHWA 1EB9A 3DS8A 4PW0A 2XUQA 4AO6A 4FLEA 5ALSA 1CLEA 5AH0A 4F21A 1XROA 2QTBA 3GZJA 4H7EA 5K3CA 2HA2A 4PF1A 5JZSA 2HU5A 3UUEA 1N1MA 2XUPA 2EDCA 5ALKA 3HEAA 2QRUA 1MPXA 3BL8A 3G9TA 3WA6A 1DX6A 3R41A 1MAAA 4MYDA 2WUEA 4CG2A 4PV7A 5FXMA 4EHBA 5JZ9A 4RE5A 4H35A 4FNMA 2BCEA 1XZHA 3OM8A 4P92A 3C8DA 4XJVA 3IUJA 5FP0A 1W1IA 1ZD5A 3QPAA 5HKBA 1ZGCA 2WILA 3X3HA 1WCYA 1XQWA 2Z5GA 4B85A 5EIHA 1T4MA 1DT3A 3H2GA 2QKYA 1DWPA 1R50A 1YAJA 4WDQA 1CUHA 1P0QA 3R3YA 2FUKA 2HRRA 2XMGA 3MUNA 2OCLA 2VAXA 3D4LA 3K6KA 4W1PA 5ALQA 4IHAA 1WHTA 4Y2XA 3ESDA 5AKKA 1UKBA 3PUHA 2PM8A 1OXMA 1JMKC 1XZJA 3PF8A 2PSFA 1VKHA 1AMNA 1A8SA 4J0HA 4KE6A 5AIAA 3HXKA 1AKNA 1XZBA 1ZIXA 4NS4A 4WFJA 4ROTA 4X90A 2Y2VA 1TCBA 4HXEB 4AZ0A 4CCYA 2AXEA 1YR2A 1CR6A 3GA7A 3STTA 1THGA 2B4KA 5E2IA 1W75A 4O08A 5HF6A 5FV4A 5C81A 2PKYX 1R4ZA 4BZZA 5CXXA 1T2NA 3QVMA 4DNOA 2BAGA 2ZJ7A 5AKLA 3I6YA 4MQMA 3WIBA 1QIKA 3GFFA 3DEAA 4DNQA 3E3AA 1CUUA 4OB8A 1YASA 3WA7A 4OYLA 1ACLA 1VXOA 5HQ3B 2PBLA 4BTVA 4MWTA 4XX1A 1LPPA 3QMVA 2XI4A 4GW3A 4B9EA 5JZBA 5DTJA 5E4TA 5AHXA 4FBMA 4X92A 1JFRA 3FWHA 3PFCA 3I6MA 1VJ5A 2XMSA 2FJPA 4X91A 4G5XA 3WYNA 3C6ZA 3IURA 1JMYA 4QDZA 1ACJA 4G9GA 3FAKA 2QR5A 5ALMA 3O0DA 4IQ4A 2ECFA 3HSSA 3I2KA 4A23A 2VQ6A 2ZYHA 4QLOA 4L9AA 5AKHA 4C89A 4FFVA 3FLEA 3O9MA 4BP9A 4J0GA 4U2GA 1EDEA 3MVEA 3FLBA 4LYEA 5JAOA 2W22A 1MO2A 3DYIA 2J3DA 1B41A 4UBLA 1MU0A 1Q83A 4H7DA 1ZIYA 2HA5A 4U2BA 2WUGA 4AO8A 1JU4A 2GBFA
chains in the Genus database with same CATH superfamily
1E0DA 1XCMA 2QTGA 3DYBA 4F96A 4AQDA 4KWEA 4BLQA 1RLUA 2Z9CA 2JIZA 5TRTA 1RHQA 4W9NA 3QITA 1FNDA 1RCTE 2XMCA 3V34A 3IDOA 2B25A 3RF7A 3V97A 4XVUA 3TLZA 1J0XO 1P80A 1LWNA 4WESB 1QRRA 3JR3A 3WGJA 4BJ3A 1XDSA 5FOQA 3MHTA 1XRRA 4BKPA 3KPWA 2Z8XA 1EX6A 1M33A 3MBIA 1TRHA 2VXCA 4QU5A 4FB5A 1BG6A 3DDUA 3E18A 3WZLA 2QW0X 4X63A 2JIBA 5L9AA 1NMXA 4XB6B 3MXOA 2GEVA 3OZXA 4L51A 3SSMA 3C43A 2PU7A 3DZBA 1B4DA 2BFBB 4R84A 4IDHA 3U3DA 2R96A 3QJGA 4LTNA 3C98A 3GJ6A 1KJNA 2Q9AA 1TNDA 4FKBA 1Q17A 1BHO1 1XTSA 3AF3A 5IJWA 1RAGA 1S0UA 4D0NA 5CLFA 1S8OA 2Y0EA 3LP8A 5KHOC 1BDBA 1IC6A 5I7EA 4A7PA 4FFPA 5BNFA 2FPLA 4LOLA 4AG5A 5ER6A 2UVQA 3GU3A 5AIBA 3PFHA 5BN5B 1U7OA 1N1DA 2C5GA 2OGTA 1AF4A 4ETMA 1RXVA 3VNUA 2XE8A 1N2IA 1I7LA 1M5TA 2GBCA 2WYWA 2IBMA 3C3WA 4D9CA 1MQ9A 4UUMA 4KDCA 3BD8A 3CZPA 3QUQA 1O95D 4WN9B 3OY7A 1W36B 2OVFA 5BR8B 3H9CA 2WU3A 4PO8A 2GKOA 1UMKA 2IU4A 2DJIA 4RC9A 5A5FA 1TU3A 1UAYA 4KNYA 1FXUA 1Q14A 1IAVA 1FFAA 4PLPA 5D51S 1RLTA 1UM8A 2ACKA 2WZDA 3IAAA 4UBKA 5JSHA 3O8OB 2HSGA 2M6RA 4A15A 3VZSA 3I9V1 3EOAI 4KN8A 4G56A 5DZSA 1WEKA 1SH7A 4GPEA 3RAEC 2TSYB 3AEKB 3EDMA 4FCCA 4BGDA 3N0TA 1KAMA 4UU1A 4WFKA 3BWVA 1USWA 4A8PA 3O8BA 1GPYA 3QYFA 1E6MA 1V2HE 1LLDA 1GSAA 5SY4A 3RREA 3ZNOA 4UDYX 3BZBA 1D2HA 3CLSD 3ZKWB 4ZZ0A 4HCJA 4RELA 5LN1A 3F5MA 3R5TA 1VG9B 3H2JA 2WT8A 1XQYA 5TJHA 2PUVA 5I7RA 3HCEA 4DM3A 3ANMA 2X4GA 1Z3IX 2JJ2A 3EJ6A 2JLVA 3DE1X 4DJAA 3RAPR 4JOBA 3FCAA 3RVBA 3I04M 4R1TA 3T5BA 1EWVA 4C4SA 2H31A 1KZ7B 5MN6A 4WAUA 2H2IA 2HUPA 1PNRA 3WLLA 2M1XA 1GGHA 4NEQA 4P33A 3VAAA 1PW7A 4LPKA 4YJHB 3QMWA 3SQWA 1YVDA 4RCZA 2IOFA 2BJWA 1NHGA 3IJRA 1G18A 3B60A 5LP6F 1MC8A 3TTTA 1A88A 2ODNA 4P5EA 3R8CA 3KLOA 1JT2A 4CETA 2BP7A 4EAQA 4BTLA 2OLKA 5KQSA 3I6IA 5C51B 4PC1A 1TJ5A 1KNQA 4CM4B 1BIFA 4TUYF 2PZFA 3GBPA 1MOSA 1W46A 2RONA 5ABPA 1DG1G 2WJIA 4AS3A 4HFNA 5FD8A 3U3ZA 1WKBA 2C3MA 4RSGA 4F2HA 2RH5A 4XQEA 1M0EA 3WIVA 2QVXX 4A8JC 5A9TA 3RASA 5FV7A 1C7RA 5FF9A 5F7OA 2B1RA 2I8LA 4ED9A 1X39A 4F6RB 3STVA 3N2ZB 4I4TB 2CYCA 2ZAGA 1ZUWA 5SZIA 5KOIA 3AESB 3QLVA 4M2LA 1IXKA 4ZC1A 1YXMA 3CLVA 4I4TF 2W83A 3QYAA 4IVRA 4UOZA 4DJDC 821PA 4MX8A 3ZX5A 2H11A 2GF0A 5D5QA 2CXPA 2HAEA 4KMMA 3DD1A 2I29A 2ZYVX 3HO8A 4JX8A 1NU8A 1T9DA 1XLTC 1YR3A 3B52X 3FFTA 3NAMA 3PFFA 4D6YA 4DL9A 1MGOA 3ESZA 1GQFA 1QX3A 1RAEA 4RYDA 3VAZA 4E1AA 3SEAA 4ZC8A 4WX2B 4IJWA 2FPPA 4DJEC 5J63A 5JFOA 3PEFA 2UZIR 1AU9A 2PGLA 5DXJA 1YRAA 1EX9A 1Z0SA 1FLAA 1P0MA 2COUA 2R7MA 3K9LA 2HSWA 3LOQA 2VZLA 4IOJA 4OI2A 4Q7KA 3SHOA 3UKJA 4DQUA 1MEOA 3P2IA 3DCJA 2O4CA 3ENNA 3NHFA 4CGYA 2VZ9A 4IKOA 4AKIA 4X1IA 4HZIA 5EXDA 1EHCA 3KAPA 3OTQA 2ZLBA 4PLCA 5ALOA 3VSDA 5CB4F 5CDUA 1NQXA 5C32A 3PICA 4YRKA 2JGDA 1WPRA 2B5OA 2ZKIA 4PAMA 1I9GA 1KHTA 1ZGBA 2H4HA 2JGMA 1QGUB 4J2HA 1NP7A 3KYCB 4KQGA 3RODA 5JJ5A 2HTEA 2OHVA 3OMWA 4FZ5A 2WY2D 3VKHA 2IXFA 5TQVA 4YWJA 2XNKA 4UVGA 4JQSA 2ONZA 3N2IA 2IPLA 4F72A 1XTBA 5C4GB 1IN1A 1E6CA 3PYXA 3VZCA 1E7QA 4FYHA 3EQ6A 3C5WP 4JJ4A 1P2VA 2NNWB 1XCBA 4X84A 5FUMA 2AOWA 2WVGA 3KQSA 1JG7A 5FR2A 1X13A 4YJFB 1CW2B 1QZUA 2B8TA 2P79A 4RSRA 3TB6A 3URMA 4AZ3B 3QE2A 4Q7QA 1RHUA 2QV7A 1GUYA 1DIBA 2E2WA 3KZXA 3U49A 3B6EA 4IS2A 1PU2A 4Q15A 2J4DA 2P9FA 2B7BA 1GGNA 1OWOA 1NOJA 4KZPA 2Z43A 3M6IA 3PPXA 5REQB 5IM4F 1LVGA 3STYA 3DQZA 1W7AA 4JP2A 5JC8A 2OM6A 3ONEA 3C6XA 2CZQA 2YXBA 3E1GA 1C7FA 3N58A 2CNOA 1KMHA 2VHVA 1S89A 4GZ5A 5J5VA 3UG7A 1NR5A 2PRZA 3AH8A 4EKGA 4N8DA 2CWWA 4Q01A 4QBIA 1GSIA 2CXQA 1IAQA 1N8SA 1CUVA 3O1LA 5CYFA 4BMVA 4GGMX 2H8GA 2MR6A 4D5EA 2O1WA 2JGJA 1JHDA 5K0GA 4S1TA 3K0CA 3KKQA 5I51A 3G0HA 1X1DA 1PFWA 3A6GA 1P7ZA 2R6JA 2BC9A 2VYCA 2VSQA 4BVEA 2NVBA 4U7TB 1NLFA 3AM4A 5H3HA 1Q0RA 2AMFA 1EUDB 4NARA 1V45E 3L7MA 2GWHA 2AVNA 2XNJA 3PDWA 4G1BA 4KODA 3CM0A 1TK3A 4P4SB 4NK4A 3LM8A 2Q6TA 4FBLA 2G0NA 1QRSA 3HXQA 1JDTA 1EQAA 4A2CA 4EYQA 4ENTA 2DWUA 2Z1DA 5C7LO 2I3ZA 1E3JA 1KFEB 2D5CA 4BVFA 5CDYA 5EJIA 1ZVVA 2IUYA 1G7RA 1KMMA 3BIFA 3DDSA 1KKLA 1SVUA 4Z1MD 1RKVA 5AXDA 3T5CA 4MI9A 4ZO8A 4GXNA 4BV8A 4LA4A 4LVNA 4CM9A 2DKFA 1YZTA 4XWYA 1QG6A 2RB5A 3OE4A 3BL6A 1JBQA 2AYXA 1K4KA 2QQ0A 3NHRA 4I6JA 5F64A 5JH7B 1QG0A 1GCAA 4RLFA 2O5EA 5AW8A 1JDUA 3ILXA 2FG7C 4PIPA 1W8DA 5SYAA 4BN0A 2OCXA 2PCJA 5C1BA 2CJWB 3GRVA 2P2GA 4NJMB 5ALHA 5IAJA 4EUEA 4DUGD 2FMHA 2J9FB 1BX3A 1U4NA 4ZQFA 5EIBD 3O8QB 1RABA 1P7PA 3EVCA 2DZDA 1KZ6A 1CD5A 3OZRA 4O4IF 2YZKA 4HRXA 4HNRA 1U28A 3JALA 3T4UA 4JYAB 1FXWF 5AM1A 1JEOA 3E48A 5TC4A 5CD1A 4ZP1A 1EDOA 1U28C 3Q7RA 4TV8F 2X2FA 3DTNA 4QA9A 5AVVA 2C1EA 3PC8A 3KYDB 1T8TA 3MWDB 4KVGA 5CUQA 1QPZA 1YL6A 2PU5A 4E11A 1SVLA 1R4NB 2DEUA 1BJKA 1EFLA 4PFSA 1E64A 4NCBA 1AHNA 3BIJA 1AXRA 3BKXA 3QP9A 4OATA 3SSNA 4C0KA 1NRXA 3HNRA 4MTCA 1ODJA 4RZ3A 4URXR 5IX8A 4GZLA 2Z9BA 1GAQA 3ZEIA 2VP9A 5K2MA 4BE4A 1ZBQA 2HV9A 3HGMA 3IKVA 3NAGA 1Z06A 1Y89A 1XQ9A 3RS3A 1VLHA 4WNAB 2ZSHA 3O91A 8ATCA 3DDOA 5AFSA 1N4AA 3BAZA 4XIFA 3NAQA 1JQJC 4J1SA 4ABTA 3HYCA 1NUSA 1SCAA 2IPAB 4D9JA 4BNTA 2BMWA 2F59A 3D5QA 5EIOA 3TB4A 4EY4A 3V1NA 1EIZA 4R2KA 2BKAA 1E9FA 1ZOOA 4MV1A 1H1LB 2DUWA 3NXSA 2HNAA 2IHNA 1EA5A 3ZDYB 2FX5A 1OMOA 4RNCA 1R0KA 4HKTA 3AKDA 1G3RA 3AW8A 3SP1A 3ZDQA 3OEHD 3UAVA 1TD1A 2EYQA 4P86A 3AF6A 1NVVR 2QN2A 3IP3A 1CQWA 4K6CA 1JECA 5E6UB 1QBKC 4GYYA 1TIPA 3GRCA 1F2UB 3FNBA 2PBRA 2VJAA 4O4IB 4U6NA 5HUHA 2VQFB 2V7PA 1TO6A 3KX2A 1YUBA 3HN6A 3X43A 3CPSA 1M76A 2ZUUA 1BWPA 4YMLA 3UMSA 4PG8A 2GFIA 2CXXA 3JD3A 2EHDA 4LVCA 2GK7A 4PPFA 5DW0A 4JYCA 4JJIA 4WPGA 2BZSA 3OH8A 4GC9A 3DAOA 4NR0A 4UFNA 4IEIA 3A9VA 4WBXC 3UMVA 1BZYA 4MHOA 3WQRA 5L6LB 1AV6A 4EI7A 3S44A 4HWPA 2VNAA 1KBZA 2RDMA 3KKKA 2NNLD 3KVVA 4FOSA 3JSXA 3L0SA 4M9CA 3E23A 5AUNB 1DG3A 2Z09A 3WL8A 4F9TA 3KEFA 5EOVA 4L3VA 3AEUB 4KFTA 2NT3A 4OXIA 4EO9A 1E1KA 4TMTA 3ZCQA 4P0QB 1I1NA 1FTWA 1YJ8A 1GZSA 3GAZA 2C5AA 5D1NA 4MV3A 1QIDA 3I2IA 2ZJ5A 3PRYA 2PFSA 2CNBA 5EWLB 4Y1GA 4CV0A 2FZCA 3MPUA 3HL0A 3NHAA 4HQ6A 1CVRA 3X44A 1SM4A 2Q29A 1M6VB 2RHDA 4EQ6A 1DQPA 4ZI7B 2C5LA 2VA9A 4ABYA 4RENA 1CF4A 3FNGA 5EJ8A 1RJ9B 4N4AA 3KQVA 3MGAA 4V0LA 4CKWB 2H48A 3MJFA 4AP9A 5KWEA 1JSLA 1V1MA 4KFRA 4EY7A 1SIWA 3OE7D 3A05A 2NN3C 3H1EA 3F7MA 4JC5A 2XCUA 3SFVA 3FTNA 1E2LA 3T38A 4Q7JB 3GUVA 4WVLA 4JV5B 5BSVA 1Q95A 4W9MC 3GAFA 2PZBA 4XZ3A 4GI7A 2ODPA 1GYQA 1Z5UA 2FEOA 3M6AA 3I62A 3G8BA 1R6VA 3TDNA 2O8BB 2YW2A 3I1YA 4ZXFA 1N57A 1R12A 1DE0A 2X6QA 3CKLA 3BDAA 3DZFA 3IT2A 5EIFA 3TN7A 2J3HA 4NXNB 5EJMA 1TJPB 1M10A 2YWBA 4G1MB 3PWSA 4JN6B 2K7FA 4ZVNA 2X22A 5DYNA 4ER0A 1QGDA 3EPJA 4Y9UA 4DABA 4A16A 2ID9A 3K0KA 4I2VA 5LA6F 4UTRA 5KVCA 3FOEC 3QHQA 2ZUCA 5KOJB 2B2XA 1WCWA 1HQYE 4GZ6A 3VU0A 3EUAA 4Q5IA 2P69A 1T8UA 2N1MA 4XR9A 5DXAA 1WS6A 3W3AH 5LMCA 4KXFB 1XMXA 4CHTA 16PKA 1KAGA 1H0KA 5AOVA 4QPDA 3F7NA 1Q74A 1FP4B 3U7IA 3WAKA 4ARSA 3VC2A 3GLKA 2W2MA 2GX6A 2GN2A 3IB3A 1RYEA 2ZSFA 1KXJA 1Y8AA 3RUDA 1TQDA 2JI8A 1F0NA 1NM5C 2FY8A 1WW3A 2JCYA 2VN8A 1Y1RA 3PUYA 4HDQB 1EE1A 1TZCA 2C4KA 3EA5A 1N75A 1JDPA 1X9HA 5IAEA 1NF2A 4UUOA 4R7GA 4HR7A 3WZ2A 1P31A 4GM4A 4OJTA 3IXQA 1VJRA 2CDNA 3RVMA 3TZQA 4C6TB 5I5EA 4O4IA 4QKQA 1R66A 3QYPA 2Y2UA 1GPKA 2CXNA 2XTJA 2YS7A 3IALA 3MINB 2ZWVA 1RTKA 1VLJA 3ISVA 3OZVA 1U6IA 4ZVRA 2LCIA 1NVBA 1O9BA 5G0SA 1GTSA 4DB2A 3AM3A 5BY2A 1DLJA 2QNIA 3C6BA 1R4AA 2H4WA 2Q5IA 4MQBA 3ETGA 2H52A 3QBDA 2JJ2D 1I5RA 3BMOA 2JIQA 4RW0A 1MN6A 2NQ2C 3W05A 5AESA 2H2DA 1NVDA 3QLVC 2GAIA 2G9QA 4UMVA 3BGDA 4P58A 2QR3A 1FC0A 1ORDA 1JPJA 2GM3A 3DTVA 1Z5WA 1GUZA 2GGSA 2YFKA 1TF5A 4GX5A 9ABPA 3TVYA 2WZQA 1KIFA 4WKBA 5IK2A 2PZKA 1A1SA 1P8JA 3DZCA 5DEIA 3CLUC 3QU4A 1JSRA 2PKCA 2RAUA 4NDAA 2P6NA 1KYZA 4D9IA 5ALYA 1ZWLA 1DCMA 5ALDA 3K71B 4YN3A 2R3SA 4RK0A 3NYRA 3KSBC 4EKDA 5DWVA 1TTQB 1JB1A 3JSAA 2H1FA 4GC5A 3PUXA 5IUKC 3W2TA 2VWPA 4PX9A 4HWRA 1JG4A 2C99A 4IEEA 4TTVA 4IIFA 3SIRA 5C5CA 2BGGA 5JSUA 5G1PA 4OYYA 1ODLA 4LE1A 2HMYB 4B0PA 3GW8A 4GRDA 1BE0A 3IXMA 3KV1A 4WN9A 5BV0A 3HTXA 4B71A 1UMCB 2B6HA 1W59A 3RS4A 2FPOA 4LSZA 4ZAFA 4LYDA 4R8MA 5JS2A 3U4MA 5JWOA 3EZYA 2P4UA 4EHDA 2Q2OA 4N65A 1VXRA 3I4FA 3P2MA 5A5GA 4O33A 1F3LA 5I7OA 3UC5A 4WERA 3C1UA 1MLDA 5CA0B 4YYEA 2XTZA 3CW8X 3V2GA 5FFFA 3G0GA 1B73A 4ITRC 4Y6QA 4X7MA 4GRIA 2ORWA 3SNKA 1CZLA 4D8TA 1H4VB 5JXGA 2ECKA 1V71A 2A5DA 2YC2C 2Q6LA 2XBLA 2ZI9A 3K96A 4D9EA 2QA5A 4LECA 3KVNA 4NAHA 4DEYA 4AMGA 3ZUGA 4KQIA 4GOOD 1Y3DE 3AINA 1TK9A 4KC0A 5K0TA 3L8GA 1IY0A 1GIAA 1PR4A 2AG1A 4ZCMA 1XEXB 5G41A 1AQLA 1FP4A 4JLNA 2PVSA 1W93A 2OQ2A 3G7SA 2IXBA 2NPOA 5G40A 3HKDB 2XDYA 4BP8A 1WHSA 1XTPA 4MGIR 3U80A 2Y1FA 3VJMA 1XFAA 3J7TA 4J9UE 5IBRA 1R5OA 4KHPB 2VPTA 4G2NA 4I4CA 2RGNC 5AVUA 1ICEA 2X6RA 4OQNA 3B1XA 1I0ZA 4TQUS 4DLVA 2A4KA 3ET5A 7ABPA 3OJXA 2A35A 1HE5A 3L6UA 3TD6A 1JR3E 4B3SB 1PZGA 2OORA 3U3JA 1EYZA 1EB8A 4Z51A 4ZEOA 1EZZA 1OROA 1Y6JA 4PS1A 2W6QA 2ODQA 1M2KA 3LH5A 1G6Q1 4MICA 1A7KA 2XMDA 4P3OA 5HM6A 4QZVA 1UC8A 2P4HX 1EEHA 5FWXA 4TLEA 1HTWA 5FUQA 3KVYA 1EFVA 1SU6A 1B6SA 1Y82A 2VNIA 4H1WA 3QVJA 2A9JA 5LZ4A 4P9NA 2NU7A 1DRKA 1NWCA 3GJZA 1C3XA 3FPKA 3TNJA 3AR6A 3DFKA 5F77A 3S2SA 5TSDA 2V03A 3AU9A 1XAGA 1OX6A 1RWQA 3ITKA 1F8FA 3BIWA 3IP8A 5K3EA 2HRZA 3EE6A 4LNUB 4NZPA 4BCCA 3KWFA 1R0CA 1N6HA 2JFQA 4LXTA 1GNRA 4X65B 1QU3A 1JQBA 3HY3A 2WOJA 5E0OA 1R2QA 4AKHA 2D0DA 1U65A 4MITA 4F56A 2HU8A 3EW7A 4HVLA 3MMSA 4AQYB 2DYKA 4YQFA 1K8ZB 4FC6A 3SYRA 3GEEA 3JASB 4XVRA 2ZM6B 5H70A 3F6YA 3KLMX 4JEIA 4B81A 3S29A 3CBGA 3IEUA 3TOXA 1E1NA 1EFAA 2CLKB 1ZK1A 3MTDA 3W5VA 1MZPA 1USIA 4TL6A 1HE1C 4OFZA 3B2EA 5AT1A 3EIHA 2XDAA 2VAWA 3QTBA 3ABIA 3CNHA 3PPYA 3IHTA 3EQ9A 4ZT4A 5B7PA 1X77A 2AEJA 4KWIA 2G36A 5L3SA 3KFVA 4LBVA 4LHXA 2IYSA 4J03A 1G60A 3OUUA 2RHCA 1V1MB 4UMEA 1N8TA 4JJ8A 3VXKA 5KWJA 1Q84A 3AF0A 4J3NA 2PN1A 3OPNA 1W49A 2J33A 4G0MA 1ZD9A 2R2AA 4HGRA 1J97A 1JI0A 2FPSA 3HG7A 4GU5A 1PO7A 2IGTA 3WWCA 4IDAA 4RDIA 4H7HA 4IHJB 4X1YA 3WNVA 2OZVA 1YI0A 1HFEL 3EULA 3LY7A 2J3MA 4WBNB 4MMZB 4MR7A 1P1BA 4UPVA 4AZSA 1DSSG 2BHSA 4MGZR 2C95A 3ESCA 3LCUA 1HSZA 3WLRA 3OZDA 3WWPA 1RD4A 4JBHA 3RW9A 3W77A 1VOTA 3VSCA 5L7TA 2IOYA 2ILVA 2ZTLA 5HUQA 3LYHA 4D9BA 4Y9TA 2W2VA 2JFNA 2WAMA 4NU5A 2ZZKA 2VK8A 3WMGA 3QUSA 3PX2A 2E3JA 3FCEA 2F90A 3AXSA 5BSEA 2EJUA 2VP4A 1II8A 2PLAA 5M5BA 2PJZA 4EF6A 3RYHB 3A9TA 4JWKA 3VTAA 3LMKA 3NH9A 1P0PA 3R4VA 3O2NA 2JPDA 1PR9A 1GU7A 2G3YA 2HFJA 3O9ZA 3TLGA 5KC8A 1MUUA 3DBHB 5DI3B 4AYWA 2QTAA 4FIZA 4ZU6X 1RC1A 2QJTA 5KO2A 2O23A 2MHCA 3HA7A 3FDZB 3KXPA 3CZQA 1UBEA 3AR4A 2P41A 3EEFA 1EQ2A 2Q4DA 3NH6A 1ZUNB 2HDOA 4DYDA 4BP3A 4RVFA 2P3SA 2VEOA 4ZVUA 5IRCD 4NENA 3QXSA 1R37A 4LGYA 4B4UA 3M6MD 1IZ7A 5YASA 4CIYA 4MS1B 3RYTC 3S8EA 2OA0A 4NOKA 3ED5A 3AIKA 1JIUA 1MTZA 2F1KA 1Y5IA 2RHHA 1PWHA 2B21A 2BE9A 5C35A 3FIUA 2VEDA 2QN9A 3P71T 2BF4A 5AHRA 2YIMA 5FIUA 4H08A 4QG7A 3AHJA 4ZT2A 4Z9YA 1KAOA 1QDEA 3HBNA 4EO4A 3M89A 5BR4A 4MJLA 5JRZA 2O6LA 1OILA 4DMCA 1YK0A 3O2QB 1VHDA 3BBLA 4ZOLB 3RNLA 3JVVA 3LHDA 3V6LA 4BQRA 4AF6A 4DDWA 2O2EA 3B70A 2TECE 5AJHA 4JB2A 3KKLA 4MV0A 3UY4A 2J3LA 1TM2A 2YN2A 1PR5A 2G06A 5FTJA 1Y7HA 3OIFA 3IOEA 3PYMA 3S99A 4BN5A 1NVGA 1VMKA 3SIXA 2AKYA 1JPVA 5DT9A 1R6BX 2Q49A 3FIJA 2F43B 2QJFA 3W8EA 3IOYA 1OTYA 2O20A 1PEYA 5AVKA 4Y2VA 5L3RA 4H4CA 3MWJA 3W8RA 2QTVB 4DR3B 1ZA1A 2FDRA 2CJWA 2WJYA 4AG3A 1O77A 4BKUA 1X1RA 3D8TA 4KG7A 3O8QA 1XUOA 2C4UA 1DCFA 1AK2A 4ITVA 4AF8A 2O2YA 2CXTA 2VDVE 4CLOA 2EW2A 1C1YA 4GHWA 4MKHA 1DS6A 2I2BA 5ALFA 3A1CA 1XD2A 4O02B 3VR2D 3B6IA 1ONNA 1YR8A 3OX2A 4UHFA 4QG3A 2D06A 2HHAA 1Y5RA 3P26A 3W5SA 1L8QA 3CPJB 3WR5A 1LNSA 2DBQA 4WE3A 2ZUTA 3K5PA 2IYAA 2FLKA 2H2WA 5TJ9A 4KWCA 2DLDA 1NRWA 1PHPA 1XMIA 2F3QA 1QKKA 2PL9A 4XSVA 4C0SA 2BSQA 1YV9A 4DLKA 3FYUB 1HYEA 1BJRE 1B14A 2KB0A 5SY6A 2QD2A 3OPVA 1FMTA 5KJ6A 1G2IA 2F3SA 3BJIC 1PJBA 4MV8A 1DHRA 4X1YB 5IBPA 4YY3B 3MQ4A 1EWQA 2GF2A 3SC2B 4D57A 5A2QA 2OK8A 4ISBA 1MVLA 3ZYCA 1TVKB 1XRLA 2VC2B 5JATA 2PRKA 2PX2A 4YJ3B 1G1AA 2PSDA 3RBVA 3HZZA 3OPMA 4HQKA 5HS6A 1IZZA 3T3PB 1O96B 3EDYA 4M0EA 5IN5A 1IUPA 2KW5A 4OBWA 2C1XA 2ZS9A 3TSAA 1LRKA 4CF4A 3FVVA 4QVGA 4EB6A 3LVRE 2DBZA 4I50B 3PIDA 4ZJUA 2RJOA 2HF2A 5KTYA 3EQ2A 5TLSA 1L7VC 3HN2A 2WHPB 4LQ4A 4CEHA 2BONA 3ONWA 3MERA 1ZD1A 2V3WA 2HZBA 3DMHA 1LCIA 3FKSD 3UV6A 1X1BA 2QP3A 1T9HA 3MBOA 5JG7A 2FN9A 2R8XA 1IG0A 1TF2A 1WMBA 4NCXA 2LNDA 5FFNA 3T3OA 3HKEB 4PG6A 3KPJA 1C3VA 2ID7A 2A14A 1LQ2A 2NYVA 2P4EA 2E6UX 3LOPA 4FW9A 4R3WA 3RYFA 3V32A 1G9SA 4QUBA 4A36A 3SBXA 4OM8A 1R7RA 2G9NA 1JU3A 4QYTA 3UEOA 3QZUA 1HDYA 4DQKA 4XVCA 4CMJA 2W0MA 4ZI7F 1RPAA 4G89A 4J0CA 3T52A 1CZOA 4MWDA 3O4RA 4W1SA 2AF3C 1ARZA 1P2TA 3PE6A 4OLHA 3T15A 2YOGA 3BWYA 1PFQA 4K9QA 3C3EA 4IIUA 3CNOA 1CEXA 4IPTA 2DERA 3E9CA 1XKTA 1O6GA 4CFSA 5K8IA 1ZNYA 4TV9A 3SCZA 4BEBA 2GTIA 5FX2A 5IJ9B 4JXJA 3W1WA 3AJ8A 4BRWA 1FYXA 4U63A 3HQ4O 3WGHA 5ERYA 3X1KA 3LC2O 4BDTA 1E5LA 2CF6A 3I8XA 1YTLA 1VG8A 3LGXA 3CUVA 2R6HA 1O94D 5A4DA 1U0LA 4V03A 4OIMA 3P9YA 3ZU5A 2B4TO 3P9KA 5BNIA 1A4RA 4OXQA 4D4JA 1KY2A 4XIGS 4QUIA 2X5NA 4XB1A 4ANFA 4D56A 4PZ0A 4DBVO 4Q4JA 1E1RD 1N5IA 4QTUB 3NC1C 3UYLA 4OQQA 5JFGA 4OX9Y 1ZG3A 1T9ZA 3P45A 3SICE 3OCXA 4RVUA 3CS3A 1PV2A 1PX0A 2ZBDA 3THYA 1DTWB 2YV4A 1AKEA 2Q1SA 4I9GA 1M6EX 3KRTA 2ZRFA 4O2BF 3WK8A 4FGJA 4B6GA 2VT2A 2IUEA 3FSGD 4BO6A 1DAGA 3JQGA 3BMCB 4B3HA 4YBZA 4IEFB 5TY0A 1QGUA 3EIEA 4AT1A 4CU5A 1NJGA 7YASA 3UPDA 3FHLA 2FPUA 5A71A 3UNXA 4ISCA 3HYSA 5JNSA 1H2FA 2ZIUB 2W93A 3ETDA 4X5OA 2PZMA 4R2HA 1QIEA 4BO0A 1SWVA 3DZJA 3Q10A 5CA0A 3WK7A 4ARAA 2WEKA 3EQ7A 1TO2E 4CODB 4PYNA 2NZUG 1PRYA 2ZDQA 3GDWA 4RIEA 5CLHA 3U44B 2VYVD 4NV0A 1ZJZA 2EFCB 3UQYS 4UTOA 4BATA 4WD3A 4BGIA 3RVNA 5COBA 2ZJ1A 1DWOA 4QOJA 3H4IA 2R85A 1QKJA 4P80A 3NBYC 1KORA 4JC4A 2OP1A 3MILA 3DV2A 3S2GA 3HVRA 4BXOB 1G8GA 2H4YA 5K05A 3L1UA 4CDRA 4DSNA 1A77A 3Q7PA 3B53X 4BY9E 1Q21A 3OIVA 2W8BA 5EXSA 4IQFA 5KREA 1E6WA 4G5YA 3VMFA 3GFVA 4JVNA 3M5CA 2GVDC 1TJYA 5EAIA 1FDOA 5C3MA 1SUAA 2I7VA 3G8AA 3LPNA 3FCYA 1M7BA 5BWNA 1XVVA 3RS9A 1IM2A 2ZRCA 3GP5A 4L9RA 4TZTA 3TSCA 1LW7A 3V8MA 3T9CA 2GJSA 3K70C 9MHTA 2YMPA 4MAFA 1WUHS 5FWYA 2LDBA 1HYBA 1A5SB 3TQQA 3P4UA 2ARKA 1C7JA 3HZRA 4D6XA 5JDCC 1KJJA 2EF1A 1YF3A 2VATA 2VPXA 4JGGA 3MYYA 1OXXK 3K0CC 4UHJA 1MC4A 5D5HA 4AK9A 5JNRA 2CL7X 1P2BA 1ZGAA 2YWJA 2WYUA 1KZHA 3IL2A 5JS7A 3CVYA 1Q7TA 1JEAA 1MAUA 4K7JA 3FROA 2DCUA 5A4JA 5JR3A 3EXG1 4Q4LA 4ZQCB 4FE3A 3NGMA 1MX1A 3QF4A 2UZ3A 3IDAA 4M22A 2B36A 1Z6QA 2NU9B 4OG2A 4CMGA 5IT9A 3RUHA 1NF3A 4M36A 3EYAA 1C4WA 2ZJ0A 4JOQA 4XR4A 4QUHA 2ATXA 1L5HB 5FBRB 2NZYA 4WZAE 1XZ8A 2V7QA 1IXZA 1I10A 4F2WA 4R2LA 2C8KA 2B8JA 4EG1A 3B5EA 4RHXA 2X8WA 1RDFA 2D4HA 2O0JA 3BORA 3SSOA 2R1TB 2W6NA 4EMUA 1J70A 4U0KA 3ZZ1A 4PINA 1ZSVA 3IX7A 1NV8A 1W4BA 4PFKA 4S2EA 2ZK7A 3AB7A 1FTGA 5G3YA 4A0GA 1ZLXA 3C5VA 3NRJA 1I1OA 5AW3A 3N53A 5K8UA 2BGNA 4M8KA 4IP0A 2V7TA 3K6RA 3QU2A 4OVKA 1X80A 4F1WA 4ND5A 3NWOA 4BZWA 4I4LA 4LJ9A 1I4WA 4EWLA 5HOEA 1WXDA 4EX6A 3QMPA 5I48A 1SN7A 2VH5R 1NUAA 1XX6A 2BTQA 1DDIA 3H8VA 3I3SR 3WMFA 2YFYA 2DPLA 3IODA 4OK5A 4FZ3A 2DT5A 2WM2A 3BQMB 2ZG6A 1GNLA 3RFTA 4K9RA 2AQHA 4N3NA 1PEDA 2B94A 2CMFA 1K3UB 1Y4ZA 4EYSA 3B2QA 1A9XA 5JCXA 1ISRA 1Q6ZA 3A2NA 3ESAA 5AK6A 2NADA 4HNHA 4OQEA 4AWXA 2YXLA 1QE3A 5BW8A 5I7HA 2ZCUA 3F6CA 1AGNA 2NO1A 4HRYA 3GT4A 2IKSA 2QORA 2A5GA 1QF7A 3HABA 1SXJC 5CK4A 4AAYA 1YRQA 2C3UA 2JGAA 2H7VA 1EFPB 2AXQA 2UYGA 5LBUA 3H0EA 3VC3A 1Q0TA 1SIOA 2QL7A 2WJ4A 4F11A 1CU1A 4URUR 3LP5A 1IBMB 1J06A 4DAOA 4AMUA 1FYVA 2REBA 1NXVA 2ZTUA 3BXEA 3HJBA 3IRUA 4LDRA 4Q3NA 2H18A 4RVOA 4DHEA 5IWAB 2QE7D 2G8LA 3SU8A 1JBKA 4TXHA 3MAAC 2JLQA 5ILOA 2XEXA 2FYTA 4YVFA 1A2OA 2COKA 4MJXA 4TSFA 4OHUA 3AVYA 2AMVA 2G88A 2W8BB 1TVKA 2EJWA 3ANYB 3PHGA 4LZAA 2VSNA 1E32A 4IFBA 5CURA 3SX0A 1XZQA 3SR0A 1KI2A 1DQNA 2ZR9A 4DIMA 121PA 2GN9A 3CF0A 1GNQA 1GA4A 3DB2A 3LNCA 3Q3IA 4IKPA 2GILA 1XU4A 2YN4A 4PE5B 5F3WB 4IGAA 1WUKS 4FONA 1ZHHA 1NVVQ 4KRYA 5HDBB 2OSBA 1OA1A 2Q41A 3L2OB 1C8VB 1R6UA 1VFPA 4R01A 1L1FA 2G1PA 1BGVA 1FFXB 1XDGA 1XLWA 1YB2A 5EXXA 5CDFA 3U3XA 5FWYB 3W8NA 4XQGA 1QZXA 2VBFA 4I36A 4EZBA 3G5MA 2Y77A 2GXUA 2Z83A 3HZOA 3AVTA 4MLZA 4Q02A 3DW1X 3L8EA 2C0QA 1WE2A 2PUJA 4RPHA 3WV5A 1AHIA 3E7DA 4KVAA 3IBFA 5T8KC 2ST1A 1DX4A 1Y9ZA 1R6XA 1Z26A 2GZ3A 3DHVA 3ZIAD 5CG1A 5JQGB 2PGIA 2QRJA 3NBMA 1ZM7A 3FZQA 5KQPA 1S01A 2NUAB 1MIOA 4LYAA 2BM0A 4ERXA 3LO8A 2ZDHA 4G63A 2SNIE 2DETA 4M49A 4OHWA 4QDJA 5EP4A 4GOND 5DDIP 2AV6A 4ZI7A 3STWA 1FOEB 2J6HA 3CNNA 1P5RA 3I1FA 4PZZA 3ZHSA 4LC9A 1YH3A 4EUKA 4TMVA 1OGJA 1FP1D 1DZ3A 1KGSA 5CVJA 4CLDA 4IDQA 4BNDB 1M8FA 4DCCA 1JHQA 3SVLA 1XU9A 4KH1A 1B8VA 3GEIA 3AR9A 3HUDA 4FDAA 1RPJA 1U2ZA 3CN7A 3F96A 1FEZA 1SVMA 4IMIB 4LZLA 4QU9A 1WKCA 2GN4A 5DHTA 5KYKA 3NRBA 5M34A 1LK0A 5KTSA 1IZ0A 5AJUA 2OKGA 3FKSA 4DV7B 2FOLA 3HA2A 2XYVA 3R3WA 2JVIA 4QPNA 3ANXA 3MQFA 5FYQA 1NBME 1QPGA 1EKXA 1U7PA 3AR2A 3L07A 1X3SA 2J45A 4EA6A 1FFWA 3GLHE 2FSVA 2YV5A 1Z45A 4TGLA 1CIJA 1QK3A 2JEYA 2QX9A 4R81A 1MB3A 4BUZA 3LWBA 4ZYZA 3M81A 4OHCA 1GPLA 2HMVA 4K46A 4BMDA 1ODIA 3KKEA 1CKEA 3LLVA 2QVLA 1LV7A 1UJCA 1YZ3A 1MA3A 5J23A 4RZIA 2R751 1N9GA 2EFGA 3LSYA 1E4VA 4GPBA 4Y2RA 2GK6A 1I1QB 4MUHA 1PGJA 1XG5A 2VI5A 3G7UA 4DG8A 2QQFA 3NHYA 5ITZA 3TIFA 4DLBA 4B46A 4YBRA 4ZZIA 3GBVA 2X0DA 1U31A 2OP0A 3GRKA 2AN9A 3AR8A 3GZNB 1G59A 3ADOA 3QSGA 4MIOA 5BXYA 2HT6A 3OIWA 5EZQA 2Z6UA 3AUYA 3CZ5A 3FA2A 3ZZTA 3T5PA 2XMZA 1RI4A 3NLLA 3PPIA 3NGXA 4EYOA 4CEHB 3R75A 3W78A 3H4TA 4OF4A 2J0QA 1YL5A 1DBWA 2QUKA 4E2YA 5KYYB 1JXOA 2HK6A 3EEBA 4UVEA 5G0WA 1C3OA 2GCPA 3W5DA 2IZ6A 2I76A 4L5BA 1UEIA 1U2EA 2PAAA 3ESBA 4UCFA 3VOBA 2ZAMA 5K8TA 2VCEA 3DVAB 2IY9A 1RZRA 1SELA 2SKEA 4OXNA 1SQ6A 5LIPA 2L18A 4CMAA 5JVDF 3TLYA 3A1UA 1LPSA 1SUEA 4PRZA 1QHHA 1TZ2A 2B61A 4JYPA 5KYUB 5FAKA 4DYHA 1ZL0A 4BEVA 5KTMA 2EGHA 1DTSA 3PEUA 1GTL1 1L5SA 5AOBA 1GILA 1UFRA 3HJRA 1R4MA 4MWZA 1W19A 1Z56C 2G70A 3G7NA 2PSJA 2WUFA 2X0NA 5D3KA 1VA4A 2G0AA 2XB9A 3A70A 3WGVA 8ABPA 5GONB 4QOSA 3IHKA 3LDHA 4WGGA 3V8PA 1WP9A 1XPOA 3RV3A 3KTAB 1F1BA 4K8RB 4U00A 1IIRA 2PUEA 3DTVB 1VP9A 3P7MA 4XKJA 1XSEA 1R74A 3W06A 4CMKA 1BSVA 1XA3A 4Z1MA 1XCJA 3F46A 3ETCA 3LU1A 4JT8A 4P4GA 4AZ0B 1YDGA 5AM4A 1OI3A 3GO4A 3FPBA 1I3OA 1R18A 4B34A 5FI0B 4RL6A 3VHRA 3RVJA 4GECA 4YT2A 3PT5A 2QTMA 1KK3A 1UUFA 2J5KA 3NYWA 4LCBA 1ZH8A 4YREA 3H7AA 2Y4NA 1JDNA 3FNFA 3HKCB 4L0QA 1NXPA 3DCIA 3NZEA 1M6VA 3HE3A 4JT2A 4M21A 2R6DA 2AX4A 2GVNA 3E2MA 3LQYA 5AI6A 5CCBA 4M54A 1GT6A 1KQOA 2IXEA 3P9XA 3DNPA 3PDUA 1MJGM 5KPJA 2H1LA 2I4LA 3ZY5A 4DGSA 3AP1A 1NATA 1JILA 3F5SA 3NWJA 3KALA 2R5NA 5IT4A 1JDZA 4HYQA 1PVOA 3W2GA 1HRDA 4JMPA 1SOUA 1YDFA 4GE3A 4RV5A 3L9XA 4HAWA 3AB8A 5KTRA 5M3BA 2H0RA 4RY9A 3R7DA 2NOAA 1ACMA 4DBLC 2CV1A 1E2NA 3IRVA 3BSWA 4EHKA 4EPWA 1ECFA 3CX4A 4DB4A 2ZB2A 4B3IA 2DH6A 3DD5A 4C7BA 3P2OA 1JPNA 1L6RA 2DTXA 3OM9A 2G6TA 2D13A 3QUAA 4EGAA 2PX0A 3W5UA 5JSYA 3MD0A 3Q3VA 4WCVA 3TWOA 1D9XA 3HDHA 2VF7A 2YZ2A 4OMCA 2D1YA 5FPYA 2PV7A 3AHCA 2VVTA 1E9BA 1ZU5A 4ND8A 4REMA 2G07A 2DWCA 5GZ6A 4I66A 3RJ5A 3KB1A 2YJ5A 3GJ3A 1NQUA 4OU4A 2WPNA 1FSSA 1U8YA 4HNAB 1XFDA 2IPXA 1SUSA 3Q5DA 3FN4A 4Y2SA 3SX4A 2NAFA 3GLSA 3IPLA 4JT4A 4OHKA 1B1AA 4EEKA 2Y92A 3R5KA 4AS1A 2HWKA 3D6MA 2UUOA 3IEPA 1KEEA 1KYIA 5ENVA 3COWA 1GJRA 1COWA 2A1IA 4OXRA 2ZYIA 1MJ5A 3RIHA 2XF8A 3NIWA 3UUWA 3ZY6A 2ZSUA 3KUDA 3O38A 4QTTB 1W36C 1ML4A 2P2CA 2F8TA 2WHPA 1M2VA 4MPDA 2YWHA 2NW6A 4RKYA 3UXEA 2SECE 1BA3A 5KMGB 1T5SA 1S2LA 1I7PA 4U7FA 5JYEA 4MDEA 3EIFA 3DHWC 3TINA 1QQ7A 5K51A 1PUIA 4MUAA 5KTPA 3OPYA 2ZYRA 2RGNA 3WGNA 1NGSA 2HJVA 3VV2A 2IEDA 2SKCA 2HN9A 2V0CA 4JXZA 4CQMD 4EHIA 1EM8B 4BNJA 5JAPA 1Z37A 4KLAA 1W44A 3UOAB 1Q44A 3QF4B 4IV5A 3W8FA 3GELA 1N6OA 2AT1A 4LQDA 2Z2IA 9LDTA 3H8WA 3MWEB 2GN0A 3SVZA 1GV1A 1KOLA 1M5RA 2I7DA 4BC1A 1M0TA 1TKRA 4ASUD 4D3FA 3DO6A 5HIAA 3SS9X 1ZGJA 3EIQA 3B36A 4TLLB 2Q6IA 1JLSA 5IN4A 3O6VA 1I2CA 2QM7A 1TX4B 1WXFA 4BHTA 2X1HA 1K4MA 3JATA 4NCNA 4OEHA 1L5GB 4G4SO 1SC1A 3GA0A 3TW0A 5A5DA 4RV9A 1T8WA 5EFOA 3ROZA 2AE2A 5IYZF 4ESHA 5IDWA 5U9CA 4PZAA 2UZ1B 3BBPA 4R1QA 4YB8A 3AUKA 3EVDA 2BV3A 1QTRA 5LZ8A 3RFVA 4C06A 2BFOA 8OHMA 1U5BA 3OFKA 1EFCA 2OFFA 3TKLA 2CMGA 4FYYA 4EPVA 4FWBA 4CL3A 3G3EA 1E77A 1HGXA 2H9IA 3FJ1A 3CRW1 5I8WA 1JA1A 2EATA 4Z86A 2KSQA 2PLFA 1TUEA 1QR6A 4BX8A 1P4HA 1T5LA 1A7JA 1JQDA 4JX9A 3ADKA 1BS1A 4FFRA 5GZ1A 1LEHA 1JEYB 3OJLA 4N5IX 3KNZA 3SWWA 1U63A 2CHFA 1PYOA 1DWUA 5ERGB 1VFNA 5AR1A 2PRIA 3W9SA 2TMDA 3LO5A 2Y1GA 3ZY2A 1HLPA 1UOOA 3A4NA 4XDYA 1T15A 1JKIA 4MV9A 4NS1A 5C1DA 3K1JA 2DQKA 5TE9A 3H9BA 1NBIA 3F90A 4PWZA 4B4DA 3OY2A 4RD6A 1QCYA 5JYDA 3ROGA 3FWZA 3OTIA 3LRPA 2FFBA 1J39A 3L6OO 2XDQB 4H27A 3NM6B 4N0DA 1ZD4A 3LLCA 1XRNA 4Y0VA 1P7WA 2NPFA 3ZHYA 5DNVA 4AWAA 2V7WA 2P91A 4LSMA 1XZNA 3KEQA 4L5YA 4KYUA 4AJOA 1KI8A 3T7CA 3D2LA 2GCOA 3PA8A 5H0IA 1HE3A 1OI4A 4J4BA 3CT4A 4KI0A 2R7LA 3MJ4A 4OTZA 4POAA 3EAFA 3GY0A 5ECWA 3B3QA 2XUDA 1E4OA 4RJTA 3ROMA 4M8IA 9ATCA 3IJPA 3C1AA 2IITA 3MIIA 1JQEA 1CUGA 4MSUA 1W88A 3NG1A 2FWAA 2ZGVA 1MV5A 1JV2B 2Q1UA 1VZ2A 4OY3A 3WQHA 4ZCLA 1IZYA 5A04A 4HVTA 3VKVA 1NJ6A 4AZWA 2VTVA 1XZAA 3QTTA 3PXBA 5AW6A 1IEWA 1V4VA 2Q62A 3NHKA 3KFXA 3SVTA 4LBYA 3RKSA 3RUCA 3CZCA 1HLFA 2OFPA 5F5XA 3D7SA 1R0BA 1PJSA 3UJNA 4BB9A 1W2WB 4E14A 1XZEA 4ZO9A 2YV3A 2QSJA 4ZYYA 2X0JA 3OOWA 4JLBA 3IVXA 4LXQA 4MWBA 4C3VA 3K9FC 2VHYA 2PL5A 5JZMA 1OZ0A 3AR5A 4C21A 1BHJA 1OKKA 2Q4RA 3ZOZA 2W6JA 3MRSA 2Z3WA 1TXGA 2CNDA 3LDAA 3UJPA 3KETA 5BWLA 4NCJA 2FFJA 2J9YB 3E27A 4DCJA 1V4BA 2RKOA 2GPJA 5AKZA 1DEAA 1FNBA 3SR4A 3WQSB 4C2BA 4UFPA 1K86A 3KQYA 1OE0A 2REQB 3EVNA 4JELA 3L8HA 3CEJA 5BW6B 5DMHA 5CR9A 4P7JA 4JC0A 4NK5A 4GOMD 4YRTA 5KI6A 2KJQA 4JL5A 5BQXA 3H5WA 1ATZA 1Z0JA 2G6BA 4E03A 3PXDA 3RF6A 1R5BA 2J30A 2GBIA 1P9NA 2RB4A 2XAUA 2YDXA 3DFMA 3MS7A 1T6BY 3HY4A 3TZBA 4DEXA 1QSGA 5FPHA 5LQSA 4W8GA 1JE0A 3HWWA 5FOWA 4OO3A 4NVRA 3BYZA 1OFGA 4NOMA 5HMMA 3TO5A 2JGDB 4L5CA 4NYJR 4QHTA 1PZHA 1Q16A 1EH5A 1NFRA 1YVUA 1ZGZA 4CDGA 2PS1A 4YJGA 5DP2A 2JCXA 2JLRA 4QO8A 1T25A 2GNAA 1WNTA 1RZRD 1QE0A 4H7FA 2P68A 4RJJA 2HKIA 5ICEA 4IDNA 5KNDD 5BPFA 3GNQA 3G2LA 1TRKA 3RIGA 4C3OB 2QY6A 1TT5B 4Q19A 4ARIA 4C87A 4RADA 1J25A 4HHEA 2XODA 3PNYA 4D92A 4DILA 2H5LA 3TE7A 3LFTA 3GT3A 3NXKA 4Q93A 3R3HA 1E5DA 3F2VA 4B9AA 1P9OA 3RROA 3O3OB 1CUSA 2WU4A 5JXWA 2PWZA 3FNQA 1AGPA 1P39A 2ZWPA 2E4XA 1TA9A 3NB0A 2J5BA 1JH8A 5IUNC 1FF9A 1ZOLA 2PQ0A 3ILSA 3LRTA 5PNTA 3V2HA 2XHZA 1A27A 4E07A 4EG5A 4V0KA 3M6FA 4MWGA 2BCGY 3NVKI 1OLSA 1IMJA 1AOXA 5FNVA 2OXRA 1BGXT 4EW6A 2YJTD 3LPAA 1P0IA 1WBDA 1PN3A 3MCZA 2GJ9A 4NU8X 1M2FA 3HFGA 3QMMA 4ZDWA 2AB0A 4BASA 5IK2D 3AT1A 4MA0A 2I34A 4BAZA 5HKAA 2CY0A 4JL8A 2OQIA 3CRRA 4H18A 2WHXA 1JAZA 3Q9SA 4YROA 4MV6A 4BBJA 3VJRA 3D4OA 5JQGF 2QROA 1DJMA 3TFWA 3DT8A 3E0XA 4MW6A 2VLBA 1B42A 1FSPA 4MLCA 3A26A 4RTQA 1E7SA 1VGQA 4FLFA 2IUUA 1L1RA 3IIEA 3TPCA 1E0JA 1X7GA 4KOEC 3OUZA 4D9NA 4HQLA 3SQNA 1CPYA 2BR3A 3KCQA 2WF8A 1XMVA 4R8VA 2O5VA 3I52A 2V9PA 3DLHA 3U4QA 4PRKA 3ZWNA 2YQ5A 4HP8A 4B17A 5LVAA 4UCXA 1Y1KE 2DUMA 5E6UA 5LJLA 4K6GA 1CIPA 4X20B 2YVLA 1E3EA 1XRQA 2VHZA 1GTVA 3RT9A 4ESEA 5FDFA 5IVDA 5KOHB 1GTRA 2H2HA 2VSXA 4TV9B 1XRMA 2UV8A 3S3TA 2HA4A 3U37A 2EG9A 3ZVMA 2IBTA 5BQPA 3SF8B 3GP8A 2QUJA 4HPWA 2O0HA 3ANNA 4M0KA 4JI7B 4NU0A 3L4EA 2NYUA 1DMRA 3JARA 4GVLA 5HCUA 2B3TA 2JFWA 2UYYA 1ZHOA 1ZH0A 3OZTA 2BFWA 4IVNA 3II6X 2AEEA 1U1DA 3PUKA 4M87A 3UPTA 1JFFB 3SHQA 1JKMA 1DQYA 2GN8A 3BH7A 3BQNB 3FUXA 3HJAA 3QLUC 3H3XA 3K0FB 1E7WA 1PF7E 3PHIA 1AB6A 3U26A 4TMWA 4WZBA 4YMTA 3AM1A 5TXGA 3WK4A 1XTKA 3DEIA 1JB9A 1GCUA 2P4SA 2QW8A 4H4EA 3G68A 1OI7A 3A14A 3MWKA 2R65A 3OQJA 1V7CA 2HXSA 4AIRA 1BO6A 3FYDA 1ZVJA 2BH9A 1ZUHA 1AN0A 3HKBA 3KYIB 4G8DA 4UE2A 4BKMA 4CMEA 2FR0A 3OTOB 2OXEA 1YZKA 4HDAA 4ZAGA 1HK7A 2HHJA 3QNUA 3V2UA 3FNRA 3ZDCA 2CHVA 1UC9A 2WVHA 3GGSA 3N0VA 5BORA 1V8FA 2AHRA 2WTXA 4I5EA 1AUQA 5HMLA 1M9NA 3A1FA 1SUFA 1GSHA 1AHPA 3S7ZA 1YZVA 1DL5A 4JA2A 2I67A 4NYIQ 3RC2A 3KCNA 1KI9A 4S2UA 5CP8A 3MD9A 5ENDA 1KPHA 3HHEA 4MYHA 2HA0A 3VGPA 3WNDA 1EA7A 4X7PA 1BKYA 1ADBA 1T1JA 5J9FA 3RS7A 3V7UA 4EA8A 3S2ZA 1FRZA 1T2AA 1UBNA 3P97A 4DCMA 4WCDA 5LOVB 3DP7A 4HBGA 4PQEA 4MO2A 4ZQIA 1AIPA 2VT7A 1RADA 3AI7A 1BC5A 4C78A 1KS2A 3WHLA 4N6NA 1KQ3A 3NTUA 1SNYA 4XI9A 3ZN2A 1IDN1 5HCIA 1G8KA 4JBYA 1LFAA 4C4PA 4L78A 2WIGA 4ER3A 5LBTA 1NTRA 4KSBA 1L5VA 2OMKA 4D8WA 3IR7A 4OOFA 4HB0A 4BGEA 1LPMA 3BGOS 4PHTA 3L4KA 1YCHA 1M2WA 3C6YA 1E61A 2R11A 4YX9A 3CNLA 5EP1A 5IJZA 6YASA 2YHUA 2GRAA 3ZQUA 3SJCA 5AVQA 4I6EA 4DJFC 4F5YA 2IIVA 5K8VA 4YAFA 3H0KA 5AW1A 4J1QA 2PBFA 1LVUA 3RIEA 1JDVA 1I8TA 2BGUA 3E5NA 3A4VA 4FNOA 1ULTA 3BD7A 5JW6A 2CLFB 3K53A 5D00A 4Q3CA 5D6NA 4LJYA 4MUGA 3WMWA 2FH5B 3MWFA 3KDSE 3E22B 5SY9A 4NSNA 3KU4A 4TVSA 3RCBA 4A6DA 5J1SB 4PN3A 1LFDB 2VJPA 3DUFB 1NLMA 5TMPA 4EW3A 1YZNA 3OURA 2CW5A 5EVJA 1S8FA 1N5KA 3AFNA 3WO0A 1A9SA 2YX1A 4JLSA 3EZGA 2UZAA 1MTOA 1VYTA 2I1QA 3EWAA 4ZT5A 5ELLA 2VNKA 1NMQA 3M1IA 2J6BA 3RUAA 4NFHA 3AF5A 2WJZB 4G0ZA 3GCXA 2BIFA 3TBFA 5SZHB 3EC7A 5IJ0B 3HXOA 1LTHR 2ZSBA 1EHYA 1SXIA 4ER7A 2I7XA 1N5RA 4ZYLA 1DPGA 2ZS8A 2IHJA 1SBTA 5K99A 3I2GA 3KQQA 4YACA 1JLLA 4QXOA 2EYUA 2QTVA 5GJBA 2VXYA 1PJ2A 1U6KA 5KSZA 4ZK2A 1JJ7A 4UFOA 4XIJA 4MYTA 4XUDA 4NX2A 3LX8A 4F8JA 1W5FA 2R6AA 2AG6A 2V6JA 1ZVKA 1HE2A 5LM3A 2XGMA 4ZV4A 4M7WA 2AD1A 2VSYA 3EA0A 1F2VA 4MOWA 3RU7A 3CB2A 4A3SA 5K6AA 3VOAA 4ZI2A 1MMFB 4QBHA 4RTJA 4ZK6A 1R8XA 3OSZA 5LDHA 2BMVA 3AVUA 3U9SA 3CX6A 4U7GA 3K0HA 2C7OA 4EMBA 1ECPA 1UPFA 3IBGA 3FPFA 5B4UA 3FYUA 1X8LA 1VPTA 2R00C 4V0ME 2VS1A 4IRXA 1P7YA 2I80A 3Q6NA 4J0EA 1SQFA 4YAGA 5IDYA 3EUFA 2JAOA 4H31A 5F2OA 4B35A 4MHSA 4TX1A 4WI1A 3TLBA 2I1WA 1YOBA 4BPRA 1Z8DA 4MPTA 1ND5A 3CKYA 3HYRA 4X6LA 1LI5A 4L7VA 4QM6A 4Q3BA 3TRDA 4OGGA 5EQTA 1CYEA 4TM7A 4MCIA 3QQPA 5L3QA 4IHKA 5AK0A 5F9HA 4OHMA 2B8WA 1TE2A 3D0OA 5B58T 3LBHA 5FI5A 2W6JD 3X1JA 4D41A 2ODTX 3QXXA 4LDNA 3T9BA 3QEBZ 1UBLS 1Z82A 1C0IA 3LWNA 1GVHA 2ZE6A 2IOFK 1QP4A 3DEKA 3DWEX 2XQJA 4DLUA 4F8YA 1VHJA 4CT5A 4YPFA 4P0TA 5KQGA 1YO6A 3GFPA 4NTZA 4MULA 3DBOB 2EZ9A 3G2QA 3LSTA 2P5SA 2IW1A 4HBZA 5DWQA 3UMJA 1RLJA 2UZ4A 4W7IA 1Z4MA 2GZDA 2PS3A 3A4YA 3AO0B 3OEHA 2C7VA 1LW6E 1N6KA 1VYHA 3BMQB 4D80A 2H57A 2QD5A 1Y6FA 4MGEA 2RHBA 3K5WA 4AO6A 4S1VA 1HA3A 2GDZA 2E5WA 1IU9A 1CLEA 2E0IA 2GJKA 1C9MA 1XROA 3A7DA 4PS0A 2B1GA 4D46A 2IP4A 1KDTA 5LD2B 3JQRA 2QX7A 4H7EA 3BX1A 1L4NA 3HDTA 1LBQA 3DXZA 1JQ5A 1JQLB 3W0LB 4AJHA 2XVAA 1ZNZA 5AW2A 3A2KA 1X38A 5K3CA 2HA2A 4W5RA 1DIGA 1PQYA 5JZSA 2OHIA 1VSQA 3QFHA 3SZOA 3NPMA 4QARA 4R9SA 2XGJA 1N1MA 3BZWA 3KUCA 2PWPA 1QHNA 4NESA 5BXQC 1AV7A 3TQHA 5J2TB 4C0HA 2P6MA 1Q2UA 3F4KA 3G2NA 5E7QA 5ES4B 5HEKA 5A5VA 1D5CA 1M67A 3HCPA 3BTSA 5KQMA 3WA6A 4I1PA 1AE1A 1MAAA 3D4NA 3LCVB 1IWPB 5C2JB 2YY7A 3T5DA 5EQDA 3VOTA 1Y3AA 4HX2A 1WNFA 2A0XA 2MTBA 4ZIRB 4PV7A 4RD3A 4RE5A 1NY5A 4Z7OB 5TQ2A 1HYQA 1QXSA 4QYIB 4BIMA 2A3RA 2YBEA 4FNMA 2BCEA 4MYRA 3I3OA 1EK6A 1MABA 1IOWA 1EWKA 1XZHA 4XCQA 5HHTA 1YFZA 5A4MS 2NZ2A 2WP8J 4XJVA 5KTKA 4YT5A 2F1OA 2FSHA 4LYJA 4YMIA 4JI6B 3UKDA 2PJRA 4JI4B 1I3MA 4GXRA 3O0TA 3NIBA 1LVHA 5KVVA 1ZD5A 3HR4A 4M1ZA 3ZEAA 3EEYA 3TQRA 4HRVA 3EN0A 4R2JA 2WTUA 1U8ZA 3MRXA 1ZR2A 1Z5GA 2TYSB 4X1KB 3AUUA 4JLOA 2C78A 2PMEA 3MTIA 4DR6B 1YB5A 1WXWA 1XQWA 5EY5B 4X64B 3PHBE 2G77B 5CGZA 3VU9B 4R8SA 4ON9A 4O5AA 1K7XB 1SR8A 4GR5A 1P4JA 1CEYA 1P9WA 3UWKA 1ADYA 1UWLA 4WJZA 3ZJVA 1PZEA 3U7QA 3GVHA 4YUAA 4F8EA 1YC5A 4ND6A 1VSVA 3OZFA 4ND3A 4NYJQ 2WPDD 1ESZA 1YHZA 1RYMA 2BGIA 3LUKA 3CRQA 3MUNA 4TKLA 5TMBA 4JU8A 5HIKA 1VIDA 2WAXA 4EJSC 4Z53A 1HC7A 4KK4A 5IS2A 3D4LA 5ALQA 1WZIA 1WHTA 3MCUA 4HSGA 4IHAA 5EP2A 5HGJA 5AKKA 4ECAA 4F4JA 4UJ5A 1I33A 2JIOA 4OQFA 1X6VA 5HQJA 1EFPA 1WHSB 2PM8A 2G71A 2Q3FA 3SXUA 1XZJA 1JMKC 5E8JA 2VP5A 1OFUX 4PGGA 4NYMQ 1HURA 1RJ9A 2J08A 2ZUSA 4TTQA 1AMNA 2C3YA 4JWTA 4CKWA 4MRMB 1SC4A 2HBYA 5AYVA 3UFBA 1A8SA 1JIKA 2VP2A 2XWBF 4KE6A 4Y6GB 4DRXB 1RXYA 1O5OA 3QWIA 2CFIA 2C2ZA 4BL5A 1ZIXA 1CJSA 2X5KO 4DY4A 4GKJB 4ZZ1A 3K16A 1DEKA 1U7UA 2QENA 4ROTA 5C31A 1T3GA 3ANLA 5GGYA 2FMUA 5CYOA 4CCYA 1WSWA 1P62B 3ONNA 2PUFA 1SKQA 3E8XA 2EFEB 1G3UA 1CR6A 4RNDB 3GA7A 4IGEA 1FSZA 3GFQA 4D9MA 1AB5A 3B82A 2ADOA 5FTLA 1P7CA 5IASA 4PZLA 3WY9A 4ZPXA 2Q27A 3G1TA 4WT7A 5FI3A 3VC7A 4QQNA 1MPTA 3A6LA 4JAVC 4O08A 5HF6A 2BM9A 2PAFA 5B1EA 1XNQB 1PBNA 1MR3F 1OV6A 1O6CA 2CB0A 2QZSA 1U3DA 4X1OA 1JN0A 4KV7A 4RWZA 1ZVMA 2H1HA 1VI5A 3BXZA 1J56A 1G6KA 3STHA 3VPDA 3VR5A 4MUYA 4YP5A 5LYJB 4BNKA 2PGJA 1NVAA 4AKGA 5CIWA 1QCCA 3EVTA 2W7TA 3TRHA 3GPLA 4M0PA 3LXRA 4ALKA 1MOPA 3REOA 4BNUA 1A5ZA 4MQMA 4PYRA 1TMKA 2QTCA 1QIKA 3FFAA 1E92A 4RGQA 4PCAA 1JG2A 1TPZA 2WKQA 3GFFA 3LZ6A 2OD2A 3DMNA 2Q99A 2GK3A 3MGGA 3E3AA 1X1CA 1XA4A 3UC9A 4DNQA 3D3KA 2ZUWA 4OL9A 2N47A 3A6EA 4CKZA 1YASA 1F8GA 4ZQHA 1IN8A 4U5QA 3RGWS 4TS1A 2HO5A 4PZPA 3D8RA 2V8BA 1ACLA 5J2UB 5HQ3B 4Q47A 1Z35A 2PBLA 3DOEA 2CD9A 1M1NA 1QUFA 2G1JA 4IXMA 3QWFA 4JB3A 4RK7A 4XUGB 3RBAA 3UHJA 4BTVA 4D8XA 2XMPA 1JUDA 3CRMA 1VP3A 3G6KA 3IAM6 1T4DA 1OZGA 1T0PA 3B1VA 4MWTA 4YWHA 5A02A 3QBEA 4OFWA 3PC8C 2WA2A 4XX1A 5T57A 3SKYA 3UQZA 3EFBA 4D81A 4KI7A 3GJ0A 1U9ZA 1IJEA 1LSSA 2JLCA 5ULLA 3DO8A 3FUUA 3MWGA 5TF4A 3FX2A 3WDLA 3V8QA 4OREX 3VPHA 4EEXA 3NIDB 4AG6A 4CVNA 4CL8A 4WEQA 2ILTA 1VPEA 4KO3S 3UFXA 5JZBA 4DE5A 3EZXA 1ZH4A 2G83A 2GRJA 2BKUA 4PR0A 2D7DA 1D2AA 2L82A 4FBMA 4HTFA 1JFRA 3C3KA 2KLHA 3PFCA 5IMSA 3I6MA 1AQIA 2W6PA 3AOGA 1K75A 3QIVA 3PKJA 2FJPA 1Y9EA 3GB9A 4X91A 4Z0TA 1R0WA 4URZR 2PT5A 5LQNA 1XMSA 3OIGA 1U2PA 1T5BA 2IYPA 2VTEA 5I3CA 3QV2A 3S0JA 5IT5A 4YRNA 4HNAA 2ZBUA 4U9HS 3SQXA 2AOTA 3WLPA 2P5YA 3T5TA 3IO5A 4KNVA 1R0YA 3PIIA 5J1TB 3IXLA 4G9GA 1M34B 3WWZA 1BMFA 4L5IA 3WLJA 3TM4A 1E1QA 5H80A 2XJ9A 1KO5A 3OMXA 4TROA 4XW2A 3ZXYA 2N9UA 2W8ZA 4KV9A 4OSPA 4CPDA 3GRYA 2OK7A 1XN4A 4IQ4A 3PRJA 4FB4A 1FDWA 1B43A 3K70B 4FYPA 3ZWCA 4AROA 5DNYB 1IHOA 3FRHA 4RD2A 3H65A 1NBOA 3PEVA 3TNDA 2X0RA 4UHKA 2VQ6A 3U7RA 3NEYA 3OOJA 5A4AA