3DNVB

Mdt protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords Protein hipA
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3dnvB00
2HSGA 1NERA 2L49A 2EBYA 3GN5A 2KEKA 4JCYA 3BS3A 2ICTA 2KEIA 2MEZA 3QWGA 4PU4C 4Z59A 1CJGA 2IU7A 3L1PA 4F8DA 1ZZ7A 3SCGA 4O8BA 2IV1A 4X4HA 2H8RA 1R63A 4X4IA 1R69A 2PUFA 1X57A 2CROA 2XCJA 4FN3A 3JXDL 3SCHA 1QQBA 3LISA 1Y7YA 4JQDA 4MCTA 1ZS4A 3CROL 3F51A 1PRVA 4IWRA 4X4DA 1CQTA 3ZHIA 2LYSA 1XWRA 2AXVA 3KJXA 3EUSA 3BD1A 2PUEA 3H5TA 2IUOA 2GZUA 4X4EA 1BDIA 3ZHMA 3FYMA 1ZVVA 1ZZBA 2LYJA 1POUA 4Z5CA 4IVZA 2OR1L 2AWIA 1EFAA 1UXDA 2GRMA 3U3WA 4PU3C 3FYAA 2FJRA 2D5VA 2AW6A 2PPXA 4I6RA 1RPEL 3F6WA 1ZPQA 1AU7A 1DW9A 2L8NA 1RZRA 4YG7B 3HZIB 4JCXA 2AXUA 3DNVB 2A6CA 1PNRA 4OB4A 4I6UA 4GQMA 1JFSA 3OMTA 3GBFA 3TRBA 1GT0C 4I6TA 1ZAYA 2GRLA 2IVGA 2LYRA 4J1WA 4X4BA 2R63A 4Y42A 1RIOA 2KPJA 1QP0A 1L1MA 1PRUA 2XJ3A 2EWTA 2B5AA 2EF8A 2OFYA 2LYQA 3D1NI 1QP7A 1JFTA 2LCVA 1IC8A 2JVLA 3UFDA 4Z58A 1WH8A 2O49A 3KXAA 1PERL 1LCDA 1ZZ8A 1UXCA 4YG4A 3OQNA 1S7EA 1ZUGA 4J1XA 1WETA 1OSLA 3JXCL 1B0NA 4Z5HA 1VPWA 2IVBA 2MQKA 4IA8A 1E3OC 2PUDA 4X4CA 1WIZA 3VK0A 1JH9A 3G5GA 2PUGA 2BNNA 2LYKA 2WIUB 1Y9QA 1RZRD 1RZSA 3JXBC 1LQCA 4MCXA 2AXZA 2AUWA 2R1JL 1HF0A 3RZZA 4GHJA 2PUCA 3ZKCA 1SQ8A 5A7LA 2XI8A 4PU8A 3GN5B 2BNMA 1QP4A 4I8TA 1ZZ6A 1UTXA 1PRAA 1X2LA 3FMYA 1ZZ9A 3QF3A 3QYXA 2PUAA 1YSEA 4YG1A 3B7HA 2KZ8A 4X4FA 2O4AA 2LYLA 4FBIA 4X4GA 1JWLA 2KEJA 1LMB3 1DWKA 1WH6A 4NDWA 4PU7A 2BNOA 3G7DA 3PXPA 3O9XA 1LCCA 2WUSR 4YARA 2ICPA 3CECA 3SCFA 3OQOA 2PUBA 1ZZCA 2XIUA 2XSDC 2PE5A 3QQ6A 2CSFA 2PIJA 1LLIA 1QPZA 3F52A 3OP9A 1O4XA 2JCGA 3KZ3A 3LFPA 3MLFA 4Z5DA 1QQAA 3S8QA 1OCTC 5K98B 3IVPA 2LYPA 2HINA 3BDNA 2O38A 2BJCA 3OQMA 1ADRA 1BDHA 3CLCA 4YBAA 1NEQA 2IVQA 3R1FA
chains in the Genus database with same CATH superfamily
2HSGA 3GN5A 2KEKA 1DULA 3BS3A 3QOXA 3QWGA 4PU4C 5DRYA 3L1PA 4F8DA 1ZZ7A 2PXEA 4X4IA 2PXBA 4HRAA 2MXDA 3JXDL 3LISA 3CROL 4IWRA 3ZHIA 2LYSA 2AXVA 2PUEA 2IUOA 2GZUA 3SR4A 1NW3A 2PXKA 2L1PA 3U3WA 1MFQC 4PU3C 3MEJA 2FJRA 4Q2JA 4I6RA 1RPEL 3F6WA 1AU7A 1RZRA 2AXUA 4OB4A 4GQMA 3LQXA 4I6TA 2GRLA 4J1WA 2HCSA 1L1MA 1PRUA 2LYQA 2OFYA 3D1NI 2LCVA 1IC8A 4EK9A 1ZZ8A 1WETA 2IVBA 3TELA 3VK0A 1JH9A 2LYKA 2WIUB 2LLWA 3JXBC 2AUWA 1HF0A 3ZKCA 1SQ8A 4I8TA 1ZZ6A 3QYXA 1X2LA 1ZZ9A 4ER3A 2KZ8A 2LYLA 1JWLA 1LMB3 1LCCA 2BNOA 3CECA 2PE5A 3KZ3A 3LFPA 1OCTC 2HINA 1QB2A 1ADRA 1BDHA 4YBAA 1NEQA 2PXVA 3GZDC 2MEZA 1CJGA 3QFIA 4O8BA 2H8RA 2PUFA 3NROA 1X57A 2CROA 2XCJA 5GAGi 4JQDA 4ER7A 1PRVA 3SX0A 1CQTA 3BD1A 4X4EA 3M9LA 2VEOA 2XXQA 5DRTA 2OR1L 2AWIA 2PXDA 3FYAA 5GAHi 3DM5A 2PPXA 1DW9A 2L8NA 4JCXA 3HZIB 2A6CA 2R63A 2PXLA 2PXTA 4EKGA 1PERL 4YG4A 4WVLA 4EZIA 4ER5A 4X4CA 3GUUA 2LNMA 4DE8A 3RZZA 2PUCA 3GN5B 2BNMA 3FMYA 1UTXA 4YG1A 3B7HA 2O4AA 2KEJA 5DSXA 3NXHA 2WUSR 3SCFA 1ZZCA 2CSFA 2XXPA 1O4XA 3OWQA 4Z5DA 2J7WA 1QQAA 3S8QA 2FFHA 3A9XA 2BJCA 3OQMA 3CLCA 1NERA 2EBYA 2ICTA 2KEIA 5JUWA 4Z59A 2IU7A 3NDBB 2IV1A 1R69A 4FN3A 3SCHA 1Y7YA 3F51A 1XWRA 3KJXA 3H5TA 3ZHMA 3FYMA 1ZVVA 2LYJA 1POUA 4Z5CA 4IVZA 1UXDA 2GRMA 4EQZA 2D5VA 1ZPQA 3DNVB 1JFSA 3OMTA 1HQ1A 3TRBA 1ZAYA 2IVGA 4Y42A 1QP0A 2XJ3A 2EF8A 1QP7A 3PE5A 1JFTA 1WH8A 3KXAA 3GZCA 1LCDA 1UXCA 3OQNA 1S7EA 4J1XA 1OSLA 3JXCL 1B0NA 3ZPXA 4Z5HA 2MQKA 1E3OC 2J7UA 1WIZA 3G0TA 3G5GA 2PUGA 1Y9QA 1RZRD 5DTRA 1RZSA 1LQCA 4MCXA 4GHJA 5A7LA 4PU8A 1QP4A 1PRAA 3QF3A 1YSEA 3A9YA 4X4GA 1DWKA 4OBMA 3OQOA 3ME5A 1U2ZA 2XSDC 3QQ6A 1LLIA 1QPZA 3OP9A 3MLFA 5K98B 2PXFA 3BDNA 2O38A 2LLVA 2IVQA 3R1FA 4JCYA 2L49A 3GZDA 2YBDA 4ER6A 3QOWA 4X4HA 2M4HA 3SCGA 1R63A 1QZXA 1QQBA 4MCTA 1ZS4A 3TEPA 4DE9A 4X4DA 3EUSA 1BDIA 2PXQA 1ZZBA 3R09A 1EFAA 3TFLA 4ER0A 3VWSA 4EKIA 2AW6A 4YG7B 2PXUA 1PNRA 4I6UA 3GBFA 1GT0C 2XXAA 4X4BA 2LYRA 1RIOA 2KPJA 2V3CC 2EWTA 2B5AA 2JQEA 3KL4A 2JVLA 3UFDA 4Z58A 2HCNA 2O49A 1ZUGA 3NZLA 1VPWA 4IA8A 2PUDA 2BNNA 2AXZA 2R1JL 2XI8A 2PUAA 3A9ZA 4X4FA 4FBIA 1WH6A 4NDWA 4PU7A 3O9XA 3G7DA 3PXPA 3OKZA 4YARA 2ICPA 2PUBA 2ODRD 2XIUA 5DT2A 2PIJA 2HFZA 3F52A 2JCGA 5DTMA 3UWPA 2PXPA 3IVPA 2LYPA 5DTQA
chains in the Genus database with same CATH topology
2HSGA 1NERA 2L49A 2EBYA 3GN5A 2KEKA 4JCYA 3BS3A 2ICTA 2KEIA 2MEZA 3QWGA 4PU4C 4Z59A 1CJGA 2IU7A 3L1PA 4F8DA 1ZZ7A 3SCGA 4O8BA 2IV1A 4X4HA 2H8RA 1R63A 4X4IA 1R69A 2PUFA 1X57A 2CROA 2XCJA 4FN3A 3JXDL 3SCHA 1QQBA 3LISA 1Y7YA 4JQDA 4MCTA 1ZS4A 3CROL 3F51A 1PRVA 4IWRA 4X4DA 1CQTA 3ZHIA 2LYSA 1XWRA 2AXVA 3KJXA 3EUSA 3BD1A 2PUEA 3H5TA 2IUOA 2GZUA 4X4EA 1BDIA 3ZHMA 3FYMA 1ZVVA 1ZZBA 2LYJA 1POUA 4Z5CA 4IVZA 2OR1L 2AWIA 1EFAA 1UXDA 2GRMA 3U3WA 4PU3C 3FYAA 2FJRA 2D5VA 2AW6A 2PPXA 4I6RA 1RPEL 3F6WA 1ZPQA 1AU7A 1DW9A 2L8NA 1RZRA 4YG7B 3HZIB 4JCXA 2AXUA 3DNVB 2A6CA 1PNRA 4OB4A 4I6UA 4GQMA 1JFSA 3OMTA 3GBFA 3TRBA 1GT0C 4I6TA 1ZAYA 2GRLA 2IVGA 2LYRA 4J1WA 4X4BA 2R63A 4Y42A 1RIOA 2KPJA 1QP0A 1L1MA 1PRUA 2XJ3A 2EWTA 2B5AA 2EF8A 2OFYA 2LYQA 3D1NI 1QP7A 1JFTA 2LCVA 1IC8A 2JVLA 3UFDA 4Z58A 1WH8A 2O49A 3KXAA 1PERL 1LCDA 1ZZ8A 1UXCA 4YG4A 3OQNA 1S7EA 1ZUGA 4J1XA 1WETA 1OSLA 3JXCL 1B0NA 4Z5HA 1VPWA 2IVBA 2MQKA 4IA8A 1E3OC 2PUDA 4X4CA 1WIZA 3VK0A 1JH9A 3G5GA 2PUGA 2BNNA 2LYKA 2WIUB 1Y9QA 1RZRD 1RZSA 3JXBC 1LQCA 4MCXA 2AXZA 2AUWA 2R1JL 1HF0A 3RZZA 4GHJA 2PUCA 3ZKCA 1SQ8A 5A7LA 2XI8A 4PU8A 3GN5B 2BNMA 1QP4A 4I8TA 1ZZ6A 1UTXA 1PRAA 1X2LA 3FMYA 1ZZ9A 3QF3A 3QYXA 2PUAA 1YSEA 4YG1A 3B7HA 2KZ8A 4X4FA 2O4AA 2LYLA 4FBIA 4X4GA 1JWLA 2KEJA 1LMB3 1DWKA 1WH6A 4NDWA 4PU7A 2BNOA 3G7DA 3PXPA 3O9XA 1LCCA 2WUSR 4YARA 2ICPA 3CECA 3SCFA 3OQOA 2PUBA 1ZZCA 2XIUA 2XSDC 2PE5A 3QQ6A 2CSFA 2PIJA 1LLIA 1QPZA 3F52A 3OP9A 1O4XA 2JCGA 3KZ3A 3LFPA 3MLFA 4Z5DA 1QQAA 3S8QA 1OCTC 5K98B 3IVPA 2LYPA 2HINA 3BDNA 2O38A 2BJCA 3OQMA 1ADRA 1BDHA 3CLCA 4YBAA 1NEQA 2IVQA 3R1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSG A;  1NER A;  2L49 A;  2EBY A;  3GN5 A;  2KEK A;  4JCY A;  3BS3 A;  2ICT A;  2KEI A;  2MEZ A;  3QWG A;  4PU4 C;  4Z59 A;  1CJG A;  2IU7 A;  3L1P A;  4F8D A;  1ZZ7 A;  3SCG A;  4O8B A;  2IV1 A;  4X4H A;  2H8R A;  1R63 A;  4X4I A;  1R69 A;  2PUF A;  1X57 A;  2CRO A;  2XCJ A;  4FN3 A;  3JXD L;  3SCH A;  1QQB A;  3LIS A;  1Y7Y A;  4JQD A;  4MCT A;  1ZS4 A;  3CRO L;  3F51 A;  1PRV A;  4IWR A;  4X4D A;  1CQT A;  3ZHI A;  2LYS A;  1XWR A;  2AXV A;  3KJX A;  3EUS A;  3BD1 A;  2PUE A;  3H5T A;  2IUO A;  2GZU A;  4X4E A;  1BDI A;  3ZHM A;  3FYM A;  1ZVV A;  1ZZB A;  2LYJ A;  1POU A;  4Z5C A;  4IVZ A;  2OR1 L;  2AWI A;  1EFA A;  1UXD A;  2GRM A;  3U3W A;  4PU3 C;  3FYA A;  2FJR A;  2D5V A;  2AW6 A;  2PPX A;  4I6R A;  1RPE L;  3F6W A;  1ZPQ A;  1AU7 A;  1DW9 A;  2L8N A;  1RZR A;  4YG7 B;  3HZI B;  4JCX A;  2AXU A;  3DNV B;  2A6C A;  1PNR A;  4OB4 A;  4I6U A;  4GQM A;  1JFS A;  3OMT A;  3GBF A;  3TRB A;  1GT0 C;  4I6T A;  1ZAY A;  2GRL A;  2IVG A;  2LYR A;  4J1W A;  4X4B A;  2R63 A;  4Y42 A;  1RIO A;  2KPJ A;  1QP0 A;  1L1M A;  1PRU A;  2XJ3 A;  2EWT A;  2B5A A;  2EF8 A;  2OFY A;  2LYQ A;  3D1N I;  1QP7 A;  1JFT A;  2LCV A;  1IC8 A;  2JVL A;  3UFD A;  4Z58 A;  1WH8 A;  2O49 A;  3KXA A;  1PER L;  1LCD A;  1ZZ8 A;  1UXC A;  4YG4 A;  3OQN A;  1S7E A;  1ZUG A;  4J1X A;  1WET A;  1OSL A;  3JXC L;  1B0N A;  4Z5H A;  1VPW A;  2IVB A;  2MQK A;  4IA8 A;  1E3O C;  2PUD A;  4X4C A;  1WIZ A;  3VK0 A;  1JH9 A;  3G5G A;  2PUG A;  2BNN A;  2LYK A;  2WIU B;  1Y9Q A;  1RZR D;  1RZS A;  3JXB C;  1LQC A;  4MCX A;  2AXZ A;  2AUW A;  2R1J L;  1HF0 A;  3RZZ A;  4GHJ A;  2PUC A;  3ZKC A;  1SQ8 A;  5A7L A;  2XI8 A;  4PU8 A;  3GN5 B;  2BNM A;  1QP4 A;  4I8T A;  1ZZ6 A;  1UTX A;  1PRA A;  1X2L A;  3FMY A;  1ZZ9 A;  3QF3 A;  3QYX A;  2PUA A;  1YSE A;  4YG1 A;  3B7H A;  2KZ8 A;  4X4F A;  2O4A A;  2LYL A;  4FBI A;  4X4G A;  1JWL A;  2KEJ A;  1LMB 3;  1DWK A;  1WH6 A;  4NDW A;  4PU7 A;  2BNO A;  3G7D A;  3PXP A;  3O9X A;  1LCC A;  2WUS R;  4YAR A;  2ICP A;  3CEC A;  3SCF A;  3OQO A;  2PUB A;  1ZZC A;  2XIU A;  2XSD C;  2PE5 A;  3QQ6 A;  2CSF A;  2PIJ A;  1LLI A;  1QPZ A;  3F52 A;  3OP9 A;  1O4X A;  2JCG A;  3KZ3 A;  3LFP A;  3MLF A;  4Z5D A;  1QQA A;  3S8Q A;  1OCT C;  5K98 B;  3IVP A;  2LYP A;  2HIN A;  3BDN A;  2O38 A;  2BJC A;  3OQM A;  1ADR A;  1BDH A;  3CLC A;  4YBA A;  1NEQ A;  2IVQ A;  3R1F A; 
#chains in the Genus database with same CATH topology
 2HSG A;  3GN5 A;  2KEK A;  1DUL A;  3BS3 A;  3QOX A;  3QWG A;  4PU4 C;  5DRY A;  3L1P A;  4F8D A;  1ZZ7 A;  2PXE A;  4X4I A;  2PXB A;  4HRA A;  2MXD A;  3JXD L;  3LIS A;  3CRO L;  4IWR A;  3ZHI A;  2LYS A;  2AXV A;  2PUE A;  2IUO A;  2GZU A;  3SR4 A;  1NW3 A;  2PXK A;  2L1P A;  3U3W A;  1MFQ C;  4PU3 C;  3MEJ A;  2FJR A;  4Q2J A;  4I6R A;  1RPE L;  3F6W A;  1AU7 A;  1RZR A;  2AXU A;  4OB4 A;  4GQM A;  3LQX A;  4I6T A;  2GRL A;  4J1W A;  2HCS A;  1L1M A;  1PRU A;  2LYQ A;  2OFY A;  3D1N I;  2LCV A;  1IC8 A;  4EK9 A;  1ZZ8 A;  1WET A;  2IVB A;  3TEL A;  3VK0 A;  1JH9 A;  2LYK A;  2WIU B;  2LLW A;  3JXB C;  2AUW A;  1HF0 A;  3ZKC A;  1SQ8 A;  4I8T A;  1ZZ6 A;  3QYX A;  1X2L A;  1ZZ9 A;  4ER3 A;  2KZ8 A;  2LYL A;  1JWL A;  1LMB 3;  1LCC A;  2BNO A;  3CEC A;  2PE5 A;  3KZ3 A;  3LFP A;  1OCT C;  2HIN A;  1QB2 A;  1ADR A;  1BDH A;  4YBA A;  1NEQ A;  2PXV A;  3GZD C;  2MEZ A;  1CJG A;  3QFI A;  4O8B A;  2H8R A;  2PUF A;  3NRO A;  1X57 A;  2CRO A;  2XCJ A;  5GAG i;  4JQD A;  4ER7 A;  1PRV A;  3SX0 A;  1CQT A;  3BD1 A;  4X4E A;  3M9L A;  2VEO A;  2XXQ A;  5DRT A;  2OR1 L;  2AWI A;  2PXD A;  3FYA A;  5GAH i;  3DM5 A;  2PPX A;  1DW9 A;  2L8N A;  4JCX A;  3HZI B;  2A6C A;  2R63 A;  2PXL A;  2PXT A;  4EKG A;  1PER L;  4YG4 A;  4WVL A;  4EZI A;  4ER5 A;  4X4C A;  3GUU A;  2LNM A;  4DE8 A;  3RZZ A;  2PUC A;  3GN5 B;  2BNM A;  3FMY A;  1UTX A;  4YG1 A;  3B7H A;  2O4A A;  2KEJ A;  5DSX A;  3NXH A;  2WUS R;  3SCF A;  1ZZC A;  2CSF A;  2XXP A;  1O4X A;  3OWQ A;  4Z5D A;  2J7W A;  1QQA A;  3S8Q A;  2FFH A;  3A9X A;  2BJC A;  3OQM A;  3CLC A;  1NER A;  2EBY A;  2ICT A;  2KEI A;  5JUW A;  4Z59 A;  2IU7 A;  3NDB B;  2IV1 A;  1R69 A;  4FN3 A;  3SCH A;  1Y7Y A;  3F51 A;  1XWR A;  3KJX A;  3H5T A;  3ZHM A;  3FYM A;  1ZVV A;  2LYJ A;  1POU A;  4Z5C A;  4IVZ A;  1UXD A;  2GRM A;  4EQZ A;  2D5V A;  1ZPQ A;  3DNV B;  1JFS A;  3OMT A;  1HQ1 A;  3TRB A;  1ZAY A;  2IVG A;  4Y42 A;  1QP0 A;  2XJ3 A;  2EF8 A;  1QP7 A;  3PE5 A;  1JFT A;  1WH8 A;  3KXA A;  3GZC A;  1LCD A;  1UXC A;  3OQN A;  1S7E A;  4J1X A;  1OSL A;  3JXC L;  1B0N A;  3ZPX A;  4Z5H A;  2MQK A;  1E3O C;  2J7U A;  1WIZ A;  3G0T A;  3G5G A;  2PUG A;  1Y9Q A;  1RZR D;  5DTR A;  1RZS A;  1LQC A;  4MCX A;  4GHJ A;  5A7L A;  4PU8 A;  1QP4 A;  1PRA A;  3QF3 A;  1YSE A;  3A9Y A;  4X4G A;  1DWK A;  4OBM A;  3OQO A;  3ME5 A;  1U2Z A;  2XSD C;  3QQ6 A;  1LLI A;  1QPZ A;  3OP9 A;  3MLF A;  5K98 B;  2PXF A;  3BDN A;  2O38 A;  2LLV A;  2IVQ A;  3R1F A;  4JCY A;  2L49 A;  3GZD A;  2YBD A;  4ER6 A;  3QOW A;  4X4H A;  2M4H A;  3SCG A;  1R63 A;  1QZX A;  1QQB A;  4MCT A;  1ZS4 A;  3TEP A;  4DE9 A;  4X4D A;  3EUS A;  1BDI A;  2PXQ A;  1ZZB A;  3R09 A;  1EFA A;  3TFL A;  4ER0 A;  3VWS A;  4EKI A;  2AW6 A;  4YG7 B;  2PXU A;  1PNR A;  4I6U A;  3GBF A;  1GT0 C;  2XXA A;  4X4B A;  2LYR A;  1RIO A;  2KPJ A;  2V3C C;  2EWT A;  2B5A A;  2JQE A;  3KL4 A;  2JVL A;  3UFD A;  4Z58 A;  2HCN A;  2O49 A;  1ZUG A;  3NZL A;  1VPW A;  4IA8 A;  2PUD A;  2BNN A;  2AXZ A;  2R1J L;  2XI8 A;  2PUA A;  3A9Z A;  4X4F A;  4FBI A;  1WH6 A;  4NDW A;  4PU7 A;  3O9X A;  3G7D A;  3PXP A;  3OKZ A;  4YAR A;  2ICP A;  2PUB A;  2ODR D;  2XIU A;  5DT2 A;  2PIJ A;  2HFZ A;  3F52 A;  2JCG A;  5DTM A;  3UWP A;  2PXP A;  3IVP A;  2LYP A;  5DTQ A; 
#chains in the Genus database with same CATH homology
 2HSG A;  1NER A;  2L49 A;  2EBY A;  3GN5 A;  2KEK A;  4JCY A;  3BS3 A;  2ICT A;  2KEI A;  2MEZ A;  3QWG A;  4PU4 C;  4Z59 A;  1CJG A;  2IU7 A;  3L1P A;  4F8D A;  1ZZ7 A;  3SCG A;  4O8B A;  2IV1 A;  4X4H A;  2H8R A;  1R63 A;  4X4I A;  1R69 A;  2PUF A;  1X57 A;  2CRO A;  2XCJ A;  4FN3 A;  3JXD L;  3SCH A;  1QQB A;  3LIS A;  1Y7Y A;  4JQD A;  4MCT A;  1ZS4 A;  3CRO L;  3F51 A;  1PRV A;  4IWR A;  4X4D A;  1CQT A;  3ZHI A;  2LYS A;  1XWR A;  2AXV A;  3KJX A;  3EUS A;  3BD1 A;  2PUE A;  3H5T A;  2IUO A;  2GZU A;  4X4E A;  1BDI A;  3ZHM A;  3FYM A;  1ZVV A;  1ZZB A;  2LYJ A;  1POU A;  4Z5C A;  4IVZ A;  2OR1 L;  2AWI A;  1EFA A;  1UXD A;  2GRM A;  3U3W A;  4PU3 C;  3FYA A;  2FJR A;  2D5V A;  2AW6 A;  2PPX A;  4I6R A;  1RPE L;  3F6W A;  1ZPQ A;  1AU7 A;  1DW9 A;  2L8N A;  1RZR A;  4YG7 B;  3HZI B;  4JCX A;  2AXU A;  3DNV B;  2A6C A;  1PNR A;  4OB4 A;  4I6U A;  4GQM A;  1JFS A;  3OMT A;  3GBF A;  3TRB A;  1GT0 C;  4I6T A;  1ZAY A;  2GRL A;  2IVG A;  2LYR A;  4J1W A;  4X4B A;  2R63 A;  4Y42 A;  1RIO A;  2KPJ A;  1QP0 A;  1L1M A;  1PRU A;  2XJ3 A;  2EWT A;  2B5A A;  2EF8 A;  2OFY A;  2LYQ A;  3D1N I;  1QP7 A;  1JFT A;  2LCV A;  1IC8 A;  2JVL A;  3UFD A;  4Z58 A;  1WH8 A;  2O49 A;  3KXA A;  1PER L;  1LCD A;  1ZZ8 A;  1UXC A;  4YG4 A;  3OQN A;  1S7E A;  1ZUG A;  4J1X A;  1WET A;  1OSL A;  3JXC L;  1B0N A;  4Z5H A;  1VPW A;  2IVB A;  2MQK A;  4IA8 A;  1E3O C;  2PUD A;  4X4C A;  1WIZ A;  3VK0 A;  1JH9 A;  3G5G A;  2PUG A;  2BNN A;  2LYK A;  2WIU B;  1Y9Q A;  1RZR D;  1RZS A;  3JXB C;  1LQC A;  4MCX A;  2AXZ A;  2AUW A;  2R1J L;  1HF0 A;  3RZZ A;  4GHJ A;  2PUC A;  3ZKC A;  1SQ8 A;  5A7L A;  2XI8 A;  4PU8 A;  3GN5 B;  2BNM A;  1QP4 A;  4I8T A;  1ZZ6 A;  1UTX A;  1PRA A;  1X2L A;  3FMY A;  1ZZ9 A;  3QF3 A;  3QYX A;  2PUA A;  1YSE A;  4YG1 A;  3B7H A;  2KZ8 A;  4X4F A;  2O4A A;  2LYL A;  4FBI A;  4X4G A;  1JWL A;  2KEJ A;  1LMB 3;  1DWK A;  1WH6 A;  4NDW A;  4PU7 A;  2BNO A;  3G7D A;  3PXP A;  3O9X A;  1LCC A;  2WUS R;  4YAR A;  2ICP A;  3CEC A;  3SCF A;  3OQO A;  2PUB A;  1ZZC A;  2XIU A;  2XSD C;  2PE5 A;  3QQ6 A;  2CSF A;  2PIJ A;  1LLI A;  1QPZ A;  3F52 A;  3OP9 A;  1O4X A;  2JCG A;  3KZ3 A;  3LFP A;  3MLF A;  4Z5D A;  1QQA A;  3S8Q A;  1OCT C;  5K98 B;  3IVP A;  2LYP A;  2HIN A;  3BDN A;  2O38 A;  2BJC A;  3OQM A;  1ADR A;  1BDH A;  3CLC A;  4YBA A;  1NEQ A;  2IVQ A;  3R1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...