3DNVB

Mdt protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords Protein hipA
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3dnvB00
1PERL 4MCXA 1LMB3 1PRVA 4JCXA 2BNOA 2L8NA 1AU7A 3F52A 3D1NI 2R1JL 3QQ6A 1EFAA 1PNRA 1ZZBA 2XSDC 4X4FA 1QP7A 1NEQA 2LYRA 3L1PA 1LCCA 1SQ8A 2XI8A 2JCGA 1RPEL 3CECA 4X4GA 2D5VA 2L49A 1E3OC 3MLFA 1DWKA 4Z5DA 1ZZ7A 1JH9A 1RZSA 2GRLA 1YSEA 1ZZ8A 3OQOA 1BDIA 1R63A 2KPJA 3TRBA 1PRUA 3OQNA 2B5AA 2JVLA 1ZS4A 2KEIA 3G7DA 2AXUA 3UFDA 3FMYA 3B7HA 4YG7B 2KEJA 2XIUA 4FBIA 3EUSA 4J1XA 2PE5A 2IVGA 3IVPA 4PU4C 1IC8A 1QP0A 2IVQA 1POUA 1UXCA 5A7LA 1ZZCA 1UTXA 1L1MA 4IWRA 4I8TA 2PUEA 2O38A 1DW9A 2AW6A 3LFPA 3BS3A 2PUDA 4PU7A 4I6RA 4GHJA 3GBFA 3R1FA 3DNVB 2PUAA 3F6WA 4GQMA 3OQMA 1Y9QA 3JXCL 3O9XA 2HINA 2ICTA 2O4AA 3G5GA 1ZUGA 3QF3A 4IA8A 4Y42A 4IVZA 1Y7YA 4J1WA 2EWTA 1CQTA 2GZUA 3U3WA 2IVBA 1BDHA 3RZZA 3GN5A 2PUGA 1R69A 4X4CA 2AXZA 2HSGA 1JFTA 1UXDA 2LCVA 4I6UA 1CJGA 3FYMA 3SCHA 3QYXA 1QQAA 1ZZ9A 1ZPQA 2IV1A 2LYPA 2EBYA 2MQKA 3CROL 2EF8A 1ADRA 1OCTC 4O8BA 2H8RA 1RIOA 2LYJA 2WIUB 1ZZ6A 2PPXA 4Z5CA 1ZAYA 2PIJA 2AWIA 2AUWA 3OP9A 2WUSR 2XJ3A 1VPWA 1S7EA 1X57A 4YBAA 2BNMA 4X4DA 3ZHMA 4PU8A 2CSFA 2FJRA 3ZHIA 3QWGA 1WH8A 3BD1A 3H5TA 2O49A 4JCYA 1RZRD 3FYAA 2ICPA 1WETA 3KXAA 2OFYA 2MEZA 1WIZA 2BNNA 1LCDA 4Z5HA 2LYKA 4Z58A 4X4EA 4X4IA 4X4BA 2LYSA 3JXDL 4MCTA 2IUOA 4F8DA 1QP4A 3PXPA 2BJCA 1XWRA 1ZVVA 3BDNA 2AXVA 3OMTA 4Z59A 1PRAA 1NERA 2XCJA 2PUFA 4I6TA 1GT0C 1LLIA 2OR1L 2PUCA 1QQBA 3S8QA 1O4XA 3HZIB 4OB4A 3JXBC 3ZKCA 2PUBA 3CLCA 2LYLA 1QPZA 1OSLA 5K98B 3SCFA 1B0NA 3VK0A 4YG1A 4PU3C 1JFSA 1LQCA 3GN5B 2R63A 2CROA 1WH6A 1X2LA 2KEKA 1HF0A 2A6CA 2GRMA 2LYQA 2IU7A 4NDWA 4YG4A 3KJXA 3LISA 4YARA 4X4HA 3KZ3A 1JWLA 2KZ8A 4FN3A 1RZRA 3F51A 4JQDA 3SCGA
chains in the Genus database with same CATH superfamily
3GZDC 3SX0A 3F52A 1EFAA 2R1JL 1PNRA 3OKZA 2LYRA 3CECA 4X4GA 2L49A 1E3OC 4Z5DA 1ZZ7A 2GRLA 2KPJA 1PRUA 2B5AA 1ZS4A 3G7DA 3FMYA 3EUSA 4J1XA 2IVGA 1IC8A 5DSXA 1UXCA 5A7LA 4IWRA 4HRAA 1DW9A 4I6RA 3GBFA 4GQMA 3O9XA 2O4AA 3G0TA 2PXTA 1BDHA 2PXFA 2PUGA 2XXQA 4DE9A 1ZZ9A 2MQKA 2H8RA 2WIUB 2PXLA 3MEJA 4Z5CA 1ZAYA 2AWIA 4Q2JA 3ME5A 1X57A 2LNMA 2BNMA 4PU8A 2CSFA 3ZHIA 5DRYA 1WH8A 3BD1A 3FYAA 3KXAA 2BNNA 2LYKA 4X4EA 4X4IA 3TELA 1QP4A 4F8DA 2BJCA 4ER5A 3OWQA 3OMTA 2PUFA 3KL4A 3CLCA 2LYLA 4YG1A 1DULA 2LYQA 2IU7A 4X4HA 2PXDA 2M4HA 4JQDA 1LMB3 2BNOA 1AU7A 3D1NI 4DE8A 2HCSA 2XXPA 4EK9A 2JCGA 3MLFA 1DWKA 1U2ZA 1BDIA 1R63A 3UFDA 2KEJA 2XIUA 4FBIA 2PE5A 3IVPA 2IVQA 2AW6A 4EKGA 3BS3A 4PU7A 1Y9QA 2HINA 3G5GA 1ZUGA 2PXVA 1NW3A 1CQTA 3GN5A 1R69A 2AXZA 3VWSA 2LCVA 3QYXA 2LYPA 1ADRA 2PXEA 3CROL 2XJ3A 4OBMA 1VPWA 1S7EA 2O49A 3H5TA 4JCYA 4EKIA 2PXUA 3GZDA 2OFYA 4Z5HA 4MCTA 1XWRA 1ZVVA 3NZLA 1NERA 2OR1L 1LLIA 2PUCA 3HZIB 3ZKCA 1OSLA 5K98B 2XXAA 3M9LA 2GRMA 2J7UA 3R09A 4NDWA 3QOXA 4YARA 1JWLA 1HQ1A 1MFQC 1PERL 3LQXA 1PRVA 3QOWA 1ZZBA 3A9XA 3L1PA 3QFIA 5GAGi 3UWPA 5DTRA 1RZSA 1YSEA 1ZZ8A 3OQOA 4ER7A 2JVLA 2AXUA 3B7HA 3NDBB 5DRTA 4PU4C 1ZZCA 1L1MA 4I8TA 2PUEA 2PUDA 3NXHA 4GHJA 2PUAA 2HCNA 3F6WA 3JXCL 3QF3A 5DT2A 4Y42A 4IVZA 2EWTA 2GZUA 3U3WA 2IVBA 3SR4A 4X4CA 1JFTA 4ER6A 3FYMA 2PXQA 3SCHA 1ZPQA 2EBYA 4O8BA 2LYJA 2PIJA 2J7WA 3OP9A 4YBAA 4X4DA 1QB2A 2FJRA 3QWGA 2ICPA 1WETA 3DM5A 2MEZA 1LCDA 4Z58A 2YBDA 3JXDL 2AXVA 4Z59A 1PRAA 2FFHA 1QQBA 1QPZA 3SCFA 1B0NA 3VK0A 4PU3C 3GN5B 2R63A 1X2LA 2KEKA 2A6CA 4ER0A 5GAHi 3LISA 4YG4A 4FN3A 2PXPA 1RZRA 3TFLA 4MCXA 4JCXA 2L8NA 3QQ6A 2MXDA 2PXKA 2XSDC 4X4FA 1QP7A 1NEQA 5DTQA 1LCCA 1SQ8A 2HFZA 2XI8A 1RPEL 3A9YA 2D5VA 2PXBA 1JH9A 3TRBA 3OQNA 2KEIA 5DTMA 4YG7B 1QP0A 1POUA 1UTXA 2O38A 3LFPA 3R1FA 3DNVB 3TEPA 2VEOA 3OQMA 2ICTA 2LLVA 4IA8A 1Y7YA 4J1WA 2L1PA 3RZZA 4ER3A 2HSGA 1UXDA 4I6UA 1CJGA 1QQAA 2IV1A 4EQZA 2EF8A 1OCTC 1RIOA 1ZZ6A 2PPXA 5JUWA 2AUWA 2WUSR 3A9ZA 3ZHMA 3GZCA 1RZRD 2LLWA 1WIZA 2ODRD 3NROA 4X4BA 2LYSA 2IUOA 3PXPA 3BDNA 3ZPXA 2JQEA 2XCJA 4I6TA 4WVLA 1GT0C 3S8QA 1O4XA 4OB4A 4EZIA 3JXBC 2PUBA 1JFSA 1LQCA 2CROA 1WH6A 3PE5A 1HF0A 1QZXA 3GUUA 3KJXA 3KZ3A 2KZ8A 3F51A 2V3CC 3SCGA
chains in the Genus database with same CATH topology
1PERL 4MCXA 1LMB3 1PRVA 4JCXA 2BNOA 2L8NA 1AU7A 3F52A 3D1NI 2R1JL 3QQ6A 1EFAA 1PNRA 1ZZBA 2XSDC 4X4FA 1QP7A 1NEQA 2LYRA 3L1PA 1LCCA 1SQ8A 2XI8A 2JCGA 1RPEL 3CECA 4X4GA 2D5VA 2L49A 1E3OC 3MLFA 1DWKA 4Z5DA 1ZZ7A 1JH9A 1RZSA 2GRLA 1YSEA 1ZZ8A 3OQOA 1BDIA 1R63A 2KPJA 3TRBA 1PRUA 3OQNA 2B5AA 2JVLA 1ZS4A 2KEIA 3G7DA 2AXUA 3UFDA 3FMYA 3B7HA 4YG7B 2KEJA 2XIUA 4FBIA 3EUSA 4J1XA 2PE5A 2IVGA 3IVPA 4PU4C 1IC8A 1QP0A 2IVQA 1POUA 1UXCA 5A7LA 1ZZCA 1UTXA 1L1MA 4IWRA 4I8TA 2PUEA 2O38A 1DW9A 2AW6A 3LFPA 3BS3A 2PUDA 4PU7A 4I6RA 4GHJA 3GBFA 3R1FA 3DNVB 2PUAA 3F6WA 4GQMA 3OQMA 1Y9QA 3JXCL 3O9XA 2HINA 2ICTA 2O4AA 3G5GA 1ZUGA 3QF3A 4IA8A 4Y42A 4IVZA 1Y7YA 4J1WA 2EWTA 1CQTA 2GZUA 3U3WA 2IVBA 1BDHA 3RZZA 3GN5A 2PUGA 1R69A 4X4CA 2AXZA 2HSGA 1JFTA 1UXDA 2LCVA 4I6UA 1CJGA 3FYMA 3SCHA 3QYXA 1QQAA 1ZZ9A 1ZPQA 2IV1A 2LYPA 2EBYA 2MQKA 3CROL 2EF8A 1ADRA 1OCTC 4O8BA 2H8RA 1RIOA 2LYJA 2WIUB 1ZZ6A 2PPXA 4Z5CA 1ZAYA 2PIJA 2AWIA 2AUWA 3OP9A 2WUSR 2XJ3A 1VPWA 1S7EA 1X57A 4YBAA 2BNMA 4X4DA 3ZHMA 4PU8A 2CSFA 2FJRA 3ZHIA 3QWGA 1WH8A 3BD1A 3H5TA 2O49A 4JCYA 1RZRD 3FYAA 2ICPA 1WETA 3KXAA 2OFYA 2MEZA 1WIZA 2BNNA 1LCDA 4Z5HA 2LYKA 4Z58A 4X4EA 4X4IA 4X4BA 2LYSA 3JXDL 4MCTA 2IUOA 4F8DA 1QP4A 3PXPA 2BJCA 1XWRA 1ZVVA 3BDNA 2AXVA 3OMTA 4Z59A 1PRAA 1NERA 2XCJA 2PUFA 4I6TA 1GT0C 1LLIA 2OR1L 2PUCA 1QQBA 3S8QA 1O4XA 3HZIB 4OB4A 3JXBC 3ZKCA 2PUBA 3CLCA 2LYLA 1QPZA 1OSLA 5K98B 3SCFA 1B0NA 3VK0A 4YG1A 4PU3C 1JFSA 1LQCA 3GN5B 2R63A 2CROA 1WH6A 1X2LA 2KEKA 1HF0A 2A6CA 2GRMA 2LYQA 2IU7A 4NDWA 4YG4A 3KJXA 3LISA 4YARA 4X4HA 3KZ3A 1JWLA 2KZ8A 4FN3A 1RZRA 3F51A 4JQDA 3SCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PER L;  4MCX A;  1LMB 3;  1PRV A;  4JCX A;  2BNO A;  2L8N A;  1AU7 A;  3F52 A;  3D1N I;  2R1J L;  3QQ6 A;  1EFA A;  1PNR A;  1ZZB A;  2XSD C;  4X4F A;  1QP7 A;  1NEQ A;  2LYR A;  3L1P A;  1LCC A;  1SQ8 A;  2XI8 A;  2JCG A;  1RPE L;  3CEC A;  4X4G A;  2D5V A;  2L49 A;  1E3O C;  3MLF A;  1DWK A;  4Z5D A;  1ZZ7 A;  1JH9 A;  1RZS A;  2GRL A;  1YSE A;  1ZZ8 A;  3OQO A;  1BDI A;  1R63 A;  2KPJ A;  3TRB A;  1PRU A;  3OQN A;  2B5A A;  2JVL A;  1ZS4 A;  2KEI A;  3G7D A;  2AXU A;  3UFD A;  3FMY A;  3B7H A;  4YG7 B;  2KEJ A;  2XIU A;  4FBI A;  3EUS A;  4J1X A;  2PE5 A;  2IVG A;  3IVP A;  4PU4 C;  1IC8 A;  1QP0 A;  2IVQ A;  1POU A;  1UXC A;  5A7L A;  1ZZC A;  1UTX A;  1L1M A;  4IWR A;  4I8T A;  2PUE A;  2O38 A;  1DW9 A;  2AW6 A;  3LFP A;  3BS3 A;  2PUD A;  4PU7 A;  4I6R A;  4GHJ A;  3GBF A;  3R1F A;  3DNV B;  2PUA A;  3F6W A;  4GQM A;  3OQM A;  1Y9Q A;  3JXC L;  3O9X A;  2HIN A;  2ICT A;  2O4A A;  3G5G A;  1ZUG A;  3QF3 A;  4IA8 A;  4Y42 A;  4IVZ A;  1Y7Y A;  4J1W A;  2EWT A;  1CQT A;  2GZU A;  3U3W A;  2IVB A;  1BDH A;  3RZZ A;  3GN5 A;  2PUG A;  1R69 A;  4X4C A;  2AXZ A;  2HSG A;  1JFT A;  1UXD A;  2LCV A;  4I6U A;  1CJG A;  3FYM A;  3SCH A;  3QYX A;  1QQA A;  1ZZ9 A;  1ZPQ A;  2IV1 A;  2LYP A;  2EBY A;  2MQK A;  3CRO L;  2EF8 A;  1ADR A;  1OCT C;  4O8B A;  2H8R A;  1RIO A;  2LYJ A;  2WIU B;  1ZZ6 A;  2PPX A;  4Z5C A;  1ZAY A;  2PIJ A;  2AWI A;  2AUW A;  3OP9 A;  2WUS R;  2XJ3 A;  1VPW A;  1S7E A;  1X57 A;  4YBA A;  2BNM A;  4X4D A;  3ZHM A;  4PU8 A;  2CSF A;  2FJR A;  3ZHI A;  3QWG A;  1WH8 A;  3BD1 A;  3H5T A;  2O49 A;  4JCY A;  1RZR D;  3FYA A;  2ICP A;  1WET A;  3KXA A;  2OFY A;  2MEZ A;  1WIZ A;  2BNN A;  1LCD A;  4Z5H A;  2LYK A;  4Z58 A;  4X4E A;  4X4I A;  4X4B A;  2LYS A;  3JXD L;  4MCT A;  2IUO A;  4F8D A;  1QP4 A;  3PXP A;  2BJC A;  1XWR A;  1ZVV A;  3BDN A;  2AXV A;  3OMT A;  4Z59 A;  1PRA A;  1NER A;  2XCJ A;  2PUF A;  4I6T A;  1GT0 C;  1LLI A;  2OR1 L;  2PUC A;  1QQB A;  3S8Q A;  1O4X A;  3HZI B;  4OB4 A;  3JXB C;  3ZKC A;  2PUB A;  3CLC A;  2LYL A;  1QPZ A;  1OSL A;  5K98 B;  3SCF A;  1B0N A;  3VK0 A;  4YG1 A;  4PU3 C;  1JFS A;  1LQC A;  3GN5 B;  2R63 A;  2CRO A;  1WH6 A;  1X2L A;  2KEK A;  1HF0 A;  2A6C A;  2GRM A;  2LYQ A;  2IU7 A;  4NDW A;  4YG4 A;  3KJX A;  3LIS A;  4YAR A;  4X4H A;  3KZ3 A;  1JWL A;  2KZ8 A;  4FN3 A;  1RZR A;  3F51 A;  4JQD A;  3SCG A; 
#chains in the Genus database with same CATH topology
 3GZD C;  3SX0 A;  3F52 A;  1EFA A;  2R1J L;  1PNR A;  3OKZ A;  2LYR A;  3CEC A;  4X4G A;  2L49 A;  1E3O C;  4Z5D A;  1ZZ7 A;  2GRL A;  2KPJ A;  1PRU A;  2B5A A;  1ZS4 A;  3G7D A;  3FMY A;  3EUS A;  4J1X A;  2IVG A;  1IC8 A;  5DSX A;  1UXC A;  5A7L A;  4IWR A;  4HRA A;  1DW9 A;  4I6R A;  3GBF A;  4GQM A;  3O9X A;  2O4A A;  3G0T A;  2PXT A;  1BDH A;  2PXF A;  2PUG A;  2XXQ A;  4DE9 A;  1ZZ9 A;  2MQK A;  2H8R A;  2WIU B;  2PXL A;  3MEJ A;  4Z5C A;  1ZAY A;  2AWI A;  4Q2J A;  3ME5 A;  1X57 A;  2LNM A;  2BNM A;  4PU8 A;  2CSF A;  3ZHI A;  5DRY A;  1WH8 A;  3BD1 A;  3FYA A;  3KXA A;  2BNN A;  2LYK A;  4X4E A;  4X4I A;  3TEL A;  1QP4 A;  4F8D A;  2BJC A;  4ER5 A;  3OWQ A;  3OMT A;  2PUF A;  3KL4 A;  3CLC A;  2LYL A;  4YG1 A;  1DUL A;  2LYQ A;  2IU7 A;  4X4H A;  2PXD A;  2M4H A;  4JQD A;  1LMB 3;  2BNO A;  1AU7 A;  3D1N I;  4DE8 A;  2HCS A;  2XXP A;  4EK9 A;  2JCG A;  3MLF A;  1DWK A;  1U2Z A;  1BDI A;  1R63 A;  3UFD A;  2KEJ A;  2XIU A;  4FBI A;  2PE5 A;  3IVP A;  2IVQ A;  2AW6 A;  4EKG A;  3BS3 A;  4PU7 A;  1Y9Q A;  2HIN A;  3G5G A;  1ZUG A;  2PXV A;  1NW3 A;  1CQT A;  3GN5 A;  1R69 A;  2AXZ A;  3VWS A;  2LCV A;  3QYX A;  2LYP A;  1ADR A;  2PXE A;  3CRO L;  2XJ3 A;  4OBM A;  1VPW A;  1S7E A;  2O49 A;  3H5T A;  4JCY A;  4EKI A;  2PXU A;  3GZD A;  2OFY A;  4Z5H A;  4MCT A;  1XWR A;  1ZVV A;  3NZL A;  1NER A;  2OR1 L;  1LLI A;  2PUC A;  3HZI B;  3ZKC A;  1OSL A;  5K98 B;  2XXA A;  3M9L A;  2GRM A;  2J7U A;  3R09 A;  4NDW A;  3QOX A;  4YAR A;  1JWL A;  1HQ1 A;  1MFQ C;  1PER L;  3LQX A;  1PRV A;  3QOW A;  1ZZB A;  3A9X A;  3L1P A;  3QFI A;  5GAG i;  3UWP A;  5DTR A;  1RZS A;  1YSE A;  1ZZ8 A;  3OQO A;  4ER7 A;  2JVL A;  2AXU A;  3B7H A;  3NDB B;  5DRT A;  4PU4 C;  1ZZC A;  1L1M A;  4I8T A;  2PUE A;  2PUD A;  3NXH A;  4GHJ A;  2PUA A;  2HCN A;  3F6W A;  3JXC L;  3QF3 A;  5DT2 A;  4Y42 A;  4IVZ A;  2EWT A;  2GZU A;  3U3W A;  2IVB A;  3SR4 A;  4X4C A;  1JFT A;  4ER6 A;  3FYM A;  2PXQ A;  3SCH A;  1ZPQ A;  2EBY A;  4O8B A;  2LYJ A;  2PIJ A;  2J7W A;  3OP9 A;  4YBA A;  4X4D A;  1QB2 A;  2FJR A;  3QWG A;  2ICP A;  1WET A;  3DM5 A;  2MEZ A;  1LCD A;  4Z58 A;  2YBD A;  3JXD L;  2AXV A;  4Z59 A;  1PRA A;  2FFH A;  1QQB A;  1QPZ A;  3SCF A;  1B0N A;  3VK0 A;  4PU3 C;  3GN5 B;  2R63 A;  1X2L A;  2KEK A;  2A6C A;  4ER0 A;  5GAH i;  3LIS A;  4YG4 A;  4FN3 A;  2PXP A;  1RZR A;  3TFL A;  4MCX A;  4JCX A;  2L8N A;  3QQ6 A;  2MXD A;  2PXK A;  2XSD C;  4X4F A;  1QP7 A;  1NEQ A;  5DTQ A;  1LCC A;  1SQ8 A;  2HFZ A;  2XI8 A;  1RPE L;  3A9Y A;  2D5V A;  2PXB A;  1JH9 A;  3TRB A;  3OQN A;  2KEI A;  5DTM A;  4YG7 B;  1QP0 A;  1POU A;  1UTX A;  2O38 A;  3LFP A;  3R1F A;  3DNV B;  3TEP A;  2VEO A;  3OQM A;  2ICT A;  2LLV A;  4IA8 A;  1Y7Y A;  4J1W A;  2L1P A;  3RZZ A;  4ER3 A;  2HSG A;  1UXD A;  4I6U A;  1CJG A;  1QQA A;  2IV1 A;  4EQZ A;  2EF8 A;  1OCT C;  1RIO A;  1ZZ6 A;  2PPX A;  5JUW A;  2AUW A;  2WUS R;  3A9Z A;  3ZHM A;  3GZC A;  1RZR D;  2LLW A;  1WIZ A;  2ODR D;  3NRO A;  4X4B A;  2LYS A;  2IUO A;  3PXP A;  3BDN A;  3ZPX A;  2JQE A;  2XCJ A;  4I6T A;  4WVL A;  1GT0 C;  3S8Q A;  1O4X A;  4OB4 A;  4EZI A;  3JXB C;  2PUB A;  1JFS A;  1LQC A;  2CRO A;  1WH6 A;  3PE5 A;  1HF0 A;  1QZX A;  3GUU A;  3KJX A;  3KZ3 A;  2KZ8 A;  3F51 A;  2V3C C;  3SCG A; 
#chains in the Genus database with same CATH homology
 1PER L;  4MCX A;  1LMB 3;  1PRV A;  4JCX A;  2BNO A;  2L8N A;  1AU7 A;  3F52 A;  3D1N I;  2R1J L;  3QQ6 A;  1EFA A;  1PNR A;  1ZZB A;  2XSD C;  4X4F A;  1QP7 A;  1NEQ A;  2LYR A;  3L1P A;  1LCC A;  1SQ8 A;  2XI8 A;  2JCG A;  1RPE L;  3CEC A;  4X4G A;  2D5V A;  2L49 A;  1E3O C;  3MLF A;  1DWK A;  4Z5D A;  1ZZ7 A;  1JH9 A;  1RZS A;  2GRL A;  1YSE A;  1ZZ8 A;  3OQO A;  1BDI A;  1R63 A;  2KPJ A;  3TRB A;  1PRU A;  3OQN A;  2B5A A;  2JVL A;  1ZS4 A;  2KEI A;  3G7D A;  2AXU A;  3UFD A;  3FMY A;  3B7H A;  4YG7 B;  2KEJ A;  2XIU A;  4FBI A;  3EUS A;  4J1X A;  2PE5 A;  2IVG A;  3IVP A;  4PU4 C;  1IC8 A;  1QP0 A;  2IVQ A;  1POU A;  1UXC A;  5A7L A;  1ZZC A;  1UTX A;  1L1M A;  4IWR A;  4I8T A;  2PUE A;  2O38 A;  1DW9 A;  2AW6 A;  3LFP A;  3BS3 A;  2PUD A;  4PU7 A;  4I6R A;  4GHJ A;  3GBF A;  3R1F A;  3DNV B;  2PUA A;  3F6W A;  4GQM A;  3OQM A;  1Y9Q A;  3JXC L;  3O9X A;  2HIN A;  2ICT A;  2O4A A;  3G5G A;  1ZUG A;  3QF3 A;  4IA8 A;  4Y42 A;  4IVZ A;  1Y7Y A;  4J1W A;  2EWT A;  1CQT A;  2GZU A;  3U3W A;  2IVB A;  1BDH A;  3RZZ A;  3GN5 A;  2PUG A;  1R69 A;  4X4C A;  2AXZ A;  2HSG A;  1JFT A;  1UXD A;  2LCV A;  4I6U A;  1CJG A;  3FYM A;  3SCH A;  3QYX A;  1QQA A;  1ZZ9 A;  1ZPQ A;  2IV1 A;  2LYP A;  2EBY A;  2MQK A;  3CRO L;  2EF8 A;  1ADR A;  1OCT C;  4O8B A;  2H8R A;  1RIO A;  2LYJ A;  2WIU B;  1ZZ6 A;  2PPX A;  4Z5C A;  1ZAY A;  2PIJ A;  2AWI A;  2AUW A;  3OP9 A;  2WUS R;  2XJ3 A;  1VPW A;  1S7E A;  1X57 A;  4YBA A;  2BNM A;  4X4D A;  3ZHM A;  4PU8 A;  2CSF A;  2FJR A;  3ZHI A;  3QWG A;  1WH8 A;  3BD1 A;  3H5T A;  2O49 A;  4JCY A;  1RZR D;  3FYA A;  2ICP A;  1WET A;  3KXA A;  2OFY A;  2MEZ A;  1WIZ A;  2BNN A;  1LCD A;  4Z5H A;  2LYK A;  4Z58 A;  4X4E A;  4X4I A;  4X4B A;  2LYS A;  3JXD L;  4MCT A;  2IUO A;  4F8D A;  1QP4 A;  3PXP A;  2BJC A;  1XWR A;  1ZVV A;  3BDN A;  2AXV A;  3OMT A;  4Z59 A;  1PRA A;  1NER A;  2XCJ A;  2PUF A;  4I6T A;  1GT0 C;  1LLI A;  2OR1 L;  2PUC A;  1QQB A;  3S8Q A;  1O4X A;  3HZI B;  4OB4 A;  3JXB C;  3ZKC A;  2PUB A;  3CLC A;  2LYL A;  1QPZ A;  1OSL A;  5K98 B;  3SCF A;  1B0N A;  3VK0 A;  4YG1 A;  4PU3 C;  1JFS A;  1LQC A;  3GN5 B;  2R63 A;  2CRO A;  1WH6 A;  1X2L A;  2KEK A;  1HF0 A;  2A6C A;  2GRM A;  2LYQ A;  2IU7 A;  4NDW A;  4YG4 A;  3KJX A;  3LIS A;  4YAR A;  4X4H A;  3KZ3 A;  1JWL A;  2KZ8 A;  4FN3 A;  1RZR A;  3F51 A;  4JQD A;  3SCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...