3DO7B

X-ray structure of a nf-kb p52/relb/dna complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
293
structure length
293
Chain Sequence
GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRDSDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NF-kapppaB p52:RelB heterodimer uses different binding modes to recognize different kappaB DNA
rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*DCP*DGP*DGP*DGP*DAP*DAP*DTP*DTP*DCP*DCP*DC)-3'
total genus 41
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00554 RHD_DNA_bind Rel homology DNA-binding domain
B PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3do7B02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 3do7B01
5FA4A 3IU3B 3S4SA 4UT7L 5K9JH 1U42A 2H32A 3MGTB 1S5HB 4JM4H 4CADB 3LY6A 4M7KL 4XMPH 5IQ7L 4M7LT 2EIDA 4Z7UB 1S3KL 3CFJA 1RY7B 4B0MM 3AMLA 3MV7E 4L29B 4X99A 1OAUL 1F4YL 4MXQC 4X6FB 1ZEAL 3UYOD 1R3LB 5I6XB 5ACZB 2AEIT 3LKPA 2AABH 2C7UB 3CZFA 2QBWA 3O3BA 3VJ6B 4CJ0A 2NY7L 4GW4A 2W9EL 1CLOL 5FYJL 1P6FA 3BWAA 1LEKB 3VMPA 2W60B 4X99B 4LLYA 4E41D 4TVPE 3FAXA 4YDJA 4RGNC 4BQ6A 4YEFA 3EHBC 4JG1H 4F7MB 4MQXC 1F3DH 3UYPA 3EDJA 1C12A 1WCQA 2EDBA 3LN5B 4X6BA 3LQZB 1XGRB 3G9VA 5EO0B 4GKNA 4AEEA 4L4VA 4G6KH 5JORB 1HZHL 4PJBE 1C1EH 2PKDA 1P7KA 3ARDD 3P77A 5HYSG 4KY1L 1T4KA 1DZBA 3DX9A 4PJGA 1OW0A 1EV2E 1LO3L 4FXKB 2E9WA 2VUOA 3TNNB 5BRZE 1N64H 1I1YA 3SGDI 1MHEB 4LLWB 2CK0H 4MAYA 5F89B 3ROOA 4MAUH 4EUPG 2NXYB 1HINL 1QRND 1EGJL 4YPGA 3BIAX 5C6WH 1HHKB 3BD5A 5GRWA 1TVHB 4N0UA 5F44A 4EDXA 3GHEH 2ZKHL 4IRSA 2IQ9H 4LIQH 3PG2A 1CI5A 3S97C 1NCCH 3QUYB 4WW2B 5DQJB 3V5DB 2H2PC 2R1YB 1P7QD 4KMQA 5K59F 2YMXH 1JGVH 1O7SA 2LU7A 3GMOA 3ARFD 2EICA 3QJFB 4X6DA 4HC1A 1YDPB 1NKOA 4Y2DD 2VSCA 3BH9A 4PJHA 2Z35B 3MRIA 3HI1A 5EC1B 1L6ZA 1KCUL 4ZFOA 1ES0B 1RJYA 4HK3N 1JPFA 3MC0A 4CVXB 3RVVC 3HLAB 5B38B 4PJBA 4MHHG 1F8TH 2J4WL 4TQEL 4F58H 3RWGB 3KXFB 1QOKA 3FQXB 3CSPA 5E2TH 4LHUA 5EOTA 2I25N 4XC3H 5GGVY 4NC1C 5GSVB 3HKFA 2YS4A 4F57H 4D9LL 5EBWA 2C3GA 1UH2A 1RK1B 5I66B 3MLUL 2QTEA 2XICA 3O9WA 4WFEE 1OAKH 2D0GA 2WM0A 2QADB 3UBXG 5GSVA 5DK2A 4L3ED 3RHWF 1FZKA 5I2IA 3MV8D 4OCYH 4PJCA 1BZ9A 2EZ0D 1ZT4B 2BRRH 4NQED 5D7IB 2OMBA 4DGVL 1NH6A 4X7EC 1JWUB 4G9FE 3CFCL 1FZJA 2IADA 5GGUA 1XGRA 3MQIA 1N4XH 1XGYH 3O4LB 3TZVD 2XA3A 2Z93B 1ZHKA 4Q7DA 1PYWA 1G9ML 1YEDA 3BSZH 4H1LG 4NNYA 4Z0BL 3VGBA 5I73C 4LPTA 5FAAA 5I76A 3MLZL 4QRTB 3B8SA 3W9EB 1OB1A 3UZEA 3VWKB 4Y4KB 5GGUB 1HN1A 3JV6B 6FABH 3EFFA 1GJIA 1RZKL 1BIIB 2VDPL 2Q1EA 1FGVL 1A4JB 1AXSA 3GI8H 1AY1H 4NOBA 4Y5XC 5JA8B 5I1LB 3QHZH 1IFHL 4OZGB 4YHPB 4OLUH 5CLWA 1NUGA 4EI6A 1OPGL 2WIIB 1F90L 4PJGF 3IDYB 3RDTD 5GGTH 1MNUL 1YUHB 4WEUD 5FKPA 1MHHA 1Q9LA 5FYLE 3SGEI 1NGWB 3MFFA 3QXWA 1OLLA 4OSUL 3V6OA 3HB3C 4F9PC 4GRWE 4MNHA 4XB8A 3VFGL 2XRAL 3V95A 5C0FB 3Q5TA 4J8RA 1KC5H 5EOTB 1XCQA 3IDUA 3DROB 4NN5B 3WL9A 3T2NL 3SJVB 1IGTB 3QFJD 2DDQL 1CGYA 5CJOH 3L3GA 3ZL4H 2VLKB 3KPNA 4CW1B 2Z91B 5CHNA 1N2RA 5I9QC 2NY0C 1I8MA 1KTKE 2R8SH 1LO4L 5MEPB 5AUMA 4MJID 2WNGA 2X4QB 4CDHA 3IDIB 4HKXB 2D3VA 5I1AA 3HZKA 2MQ0A 4MAYC 3LKOB 2R4RL 2FL5A 2JKXA 4HAGA 3VFUB 3UTSE 3O11B 2DL9A 3MRJB 4JE4B 5E9DE 4OLWH 1FFPA 1D9KB 5KZCD 5E7BA 2Q8AL 4K8RC 1T2JA 3BKCL 1F3DJ 5DJ8A 1YJDC 4PJCB 1KPUB 3NFPA 1MWAL 3VFUA 3CFDA 3VMNA 3RKDC 3RVXD 2H3NA 4DKDC 2YN5A 3IDGA 1BLNB 4PREB 2XN9A 3X3GH 3S36X 4KJQC 5JOPD 4PB9L 2AGJH 4JN1L 4UU9B 3ROLA 1J0HA 4OCXH 4EOWL 4G6AC 3HNSL 3KPSE 4GAGH 1UYWH 4AQOA 5HYSB 1IAIL 2IBBA 4R26L 1L7TH 4PS4L 3ULUE 1EAJA 3WFDH 1IEAB 2D7PA 5E7FA 4PJ8C 3DJ9A 3X11B 1G6RL 5L9DH 2VKWA 2GTWA 4U7KA 5EPMB 2HFTA 4KI1A 3O6FB 3QWOA 2P24B 4P2QD 5JHDE 1E4JA 1P4BL 2RHEA 5T3XE 2I9TB 1XIWD 2H2PD 2ADIB 3QXAB 3HZMB 4DVBB 4GAJH 4JVWA 1Q1JL 5B8CB 4CRPA 2DM2A 4BFIB 4PJ5A 4MXVF 2EYTA 4BZ1H 3G6JA 3ARBD 3PNWA 4XP6L 4TSBH 1B4JH 3MFFB 5LCVL 1JPTL 4HBCL 5IV2A 1J12A 2WIIA 1J87A 4G80A 2OQJB 4KJYA 4WHCA 1HKFA 5IBUB 5FGRA 1PEZA 4JZJA 1MCOL 3SBWA 4J3OC 3K8MA 3F8UB 2QADC 2W0FB 3EYVB 3PF2A 3QXUA 1KJ2A 3STZB 3ALWA 5HHQA 3I2CL 3CFIC 2YPKB 3CVIH 4HK3J 1ONQB 4JZOA 2IF7A 1HOCA 4NFCA 1PKQB 4Y19A 3UTTB 4LVHB 1QLFB 2R69H 4MDIB 1JN6A 4X6CE 3DSFH 3FT4B 3MCLL 2ESVD 5LWYH 4XCCL 1D5MA 4JZOB 4P2YA 3QPXH 5CUSL 5KSUA 4GBXA 5I8EB 2NY2C 1WBZB 4CMHB 1MI5E 2A0LC 3HA0A 5E2WL 3GSXA 5KTEH 2G2RA 2YK1L 1EO7A 4WTXA 1FYHB 1S7XA 5DJAA 4H25A 4UNUA 5KS9B 3PP4L 1JP5A 4YDJB 5BCAA 1AGCA 4JKPL 3NFPB 1DQQA 1HYRC 5L8JB 1NAMB 1JZ4A 5CBEA 2CSPA 1CFSA 2R39A 4H8WL 5L0QB 1RAMA 3QYCA 1RU9H 4P2OD 1IAOA 4AL8H 3IXAA 2BNRA 3G9AB 4KVNL 1CE1H 4XMLH 5T3ZE 4BA8A 5JXED 4FFVD 5M95B 2GITB 4RFEB 1ZT1A 1NLDH 3FB5A 4R8WL 4RAVB 5LXGH 4MA7L 3ULVE 3D39E 4LVHC 4I0KA 2GTWB 1TZGL 2MCPL 4I0PA 3BPLB 3O4LE 3TJHC 3QEQA 5FO8A 1J8HE 3K1DA 1BQHA 2R0WL 1IGMH 1NGQH 4JN2B 3TJEH 2EDLA 2J6EA 1HQ4A 4YGAB 5T33L 3KPRE 3PDDA 5FHAL 3VXPB 5EU6B 5DTFB 4K7FB 4I0PB 1BFVL 1UB6A 4D0CA 1YEEH 2BVUA 5IIEB 2VDQH 1MCRA 2W0LA 5EO9B 5AZEL 4FQ1H 5C0RL 2P49B 4AY0A 1NMCC 5JQ6L 3PWPA 1AI1H 4O58L 5C08A 1RK0A 2SEBA 2VXVH 3BIBX 4Q9RL 5EB9A 1UVQA 3T2OA 4Q58C 1QFWI 3MNVA 4OBSA 1KJ2B 3HHRB 3STZA 4WHYH 5JOEA 2X05A 1MFBL 1MQKL 1MRCH 4XNQB 4Z7QF 5EWIH 2Z31D 2ERJB 2IGFL 4QHKI 4UT7H 5IW6A 3GSVB 3C5ZB 3QBTB 3FT2A 4PJEE 3CX2A 4NM4H 3A67H 2G2RB 3WS3A 4JDZA 3WLWC 3QEUB 2IPKA 1VHPA 4FN0A 4TSAH 2YRLA 1R5WB 1BQLL 5D93B 4QXGH 1I9IL 1V3LA 4LVOB 2BMKB 2W9EH 1CLOH 1XGPB 4Y5VC 3D6GA 4KJPD 5CJBA 4OV5A 4MQ7A 2VLKD 3O4LD 5GS2D 3TZVB 4IRJC 4N8PA 3QFJB 1B0WA 3N0PB 1MCPH 2X1QA 2OXGA 4PJ8D 3K80A 1EZVY 4KDTA 3CZFB 3PV6A 3P9MB 1KGCE 1FZKB 5I2IB 4MGXA 5E08L 3UBXI 3BWAB 1V7NL 1HZHH 4QHMB 2LQRA 3D18B 5IB1B 4NQVA 2LTQB 2I5YH 4FQHB 1FYTB 4Z7WB 2R2EA 4MZ2A 1EO8L 4XNMB 1S9VA 1RZIA 1QTYT 1NGXA 4MAUL 4NN7B 3RU8H 3QNXB 3TIDB 4LSRH 4G3YH 3SOBH 4RFNB 3CVHH 1SYSA 3EOAA 3QCTL 2M8XA 4F7TA 4X6EB 5FDYA 1A6TB 2D31A 4JO4L 4QRUB 3AB0B 4YHYB 4XI5C 5EIQA 1P84K 1NCCL 3IS1X 1NUNB 1X5YA 4N0UE 1FNEA 4YUEH 1R3IL 1MWAA 4PRBA 1JF5A 2LTQC 2RFXA 3EOYG 1XF4A 4WGVB 1VEOA 2HFEA 2HVKA 4WVRA 5CSZB 1H3UA 4GW1B 3NCMA 3HI6L 3QUYD 1UCBH 5CINL 2NR6D 1U92A 4NQEB 3C5JB 6CGTA 3RPIA 3TA3A 4NQDE 1MWAB 4WY7H 4XH2A 5EOCJ 5B38G 5F7NC 1KOAA 1RUML 1WZLA 4ELME 1U91A 1WITA 1WBXA 5H37G 1P9MA 3L3GB 2EDRA 1XF3B 5ILTL 1NGZA 4HGKC 3T8XB 1QFPA 4M5ZL 5LJYH 5ALBL 1SEBB 3DROA 3SCMA 1Q0YL 5TQ2L 3SDCB 3TZVC 4WU5B 5IVXA 3QO0B 1DEDA 2I27N 5GZND 5EA0L 5GRVL 3RZCD 3KPRB 2VITA 4LGSB 2ZUXA 1I8MB 4NHCH 1T20B 2OTUA 4D3CH 4WJ5A 5EU4B 1G7HB 4PJ9D 4HLZH 1PG7H 5C6TL 1JF1B 2MQ3A 1D5XA 1BX2B 3HTLX 1RUQH 3T4YB 3GB7B 3HUJA 4GAYA 5GXBB 4AENB 1T7WA 3MRJA 1YYML 3CSYB 3N50A 4ETQB 4Z7UE 4FTVB 4ZUVA 5EBGA 3QHFH 1PW3A 2ZOLA 2BNRE 2HP4A 4OD3H 5E2UL 2DYPD 2YD5A 5B39G 3WN5A 2YSSB 5DJCA 5KANI 3QNZB 1IE5A 4F37K 3Q1SL 3BSZL 4Z0BH 4LP5A 4JGMA 5KSAA 1FE8H 2GTZA 3PWVB 4KGJA 2KZWA 4S1SH 1FNHA 3HR5B 4HWNA 1QQDB 3TBTA 3FOMB 5JDSA 3BAEH 4HWBL 1KIRB 5I15L 5C7XH 4X98B 1IL1A 3QUZB 1J11A 3GI8L 4NM8H 2Y23A 4IHOA 4YXLL 1UZ8A 3EDFA 2QQLL 3MRHB 4QOKB 4JDVA 5JO5A 4RFOH 5DQJA 3V5DA 2CLZA 1JNHA 1R3JA 5JDSB 4U6TA 2ADGA 3F7VB 1I3GL 4U6YA 1H3TA 4XBEL 4EEEA 3LKNA 2K3TA 4E42B 2G5BA 1B88A 5B39A 2X7LA 2R23A 4RAHA 2YEZB 2W9LA 1ACZA 3ZKMC 5HGAB 4GG6B 2DQIH 5DUBB 3SGKC 1ETZB 2XRAH 5E4EB 2CLVA 3OKLB 2R56L 4R7DA 4NQSB 5C0CA 1E4KC 1A3LL 1KN4L 2B1HH 2DDQH 3MLSH 3BI9X 4OTXH 1OGTA 5KN5A 1KJVB 5E8OB 3T1FA 4DZBA 1WT5C 3RWGA 4JFYA 2UY6A 2B4CH 4ZYKA 3QDGA 5HI4D 4UV7H 2J8UF 3QH3A 3KPTA 1U6AH 2PUQT 1BVLB 1S9YA 4QRSB 4GBXD 3NMEA 1JNJA 4O4YL 1OTSC 4OFVA 4ZQKB 2DIBA 2WLZA 2LFGA 1Y6NR 1KF9B 2WIMA 3RWFB 4G8IA 3RWHA 3SKNB 3B5HA 4JFFB 4HQQH 5D7LE 1BBJB 2WAHA 2F5BH 4K3EH 1IGYB 4UTAL 3NACL 5I75C 2EH8L 4FMFA 4KPHL 3ZDYF 3PE9A 2JB5H 1AHWC 3QISA 2X6MA 1VADA 4APQC 2BNQE 4DWHA 2FZ3B 4OIIH 5I8OL 4M8QB 1IT9H 4RA3A 4U0RC 5A16A 3H0TB 3U2SB 5C0AD 1QSEE 5KS9F 1CDBA 1Z2KA 3CGTA 4HDIB 5I6XC 4H26A 4N0FB 5ISZE 2IADB 5ETUB 3HNSH 4Y1AD 2FZ3A 1KPUA 1L7TL 5B3NA 2HJLB 3WFDL 3ZE2F 3RNKA 3DV4B 5JMRA 4HDIA 5JW4M 3MNWB 2XTLA 4U1KB 3C2AL 1FVDB 3C8KB 2NTFB 3CLEL 1K5NA 4O2FB 2X4SA 3TO2B 3C09C 1YECL 2DQEL 4FQQB 1O0VA 4U1JB 3QIBD 2VXTH 1ORQA 4PJFB 3BX7C 1E28A 3INUH 2D7QA 5D72H 2Q7YB 5C2BH 4TSBL 3L5IA 3BH8A 4ODBD 2FBJH 2DLEA 3KLAA 4ESKA 1B0GB 3MV9B 4PJDE 2APWA 5KSBF 1FSKC 2GYSA 2NX5B 5J0BA 4HK0A 3GMPB 3MREA 2QHRL 1AP2B 1BREA 4P9HH 3UC0H 1KGCD 3QPQD 1N5YH 3AM8C 3OWEA 4PJ8B 4S11A 4P5KB 1ETZA 4G6ML 1FLRL 5E8OA 3T3PF 3WNMA 3F12B 5CGTA 2VRAA 2IPTH 3BWUC 2BVPA 1QBLH 2PTVA 1INDL 4OF5A 3VGHA 4EIZC 5GS3A 1OT1A 5ITFB 5JPMB 3T1FB 4DZBB 2R69L 3ES6B 5BOZG 5GS0D 3BUYB 2OI9B 3IDXL 2EE6A 4DAGH 3LEVL 4ZO9A 1U8JB 4ZAKC 4QTHA 1CGTA 4PBXA 3RX7A 3HRZB 5T3XD 5D1ZD 2RCSL 3HNVH 5CUSH 3VFMA 4TYUA 4RSVA 1F02I 1FRGL 2HN7B 1V8HA 1QLRA 1LNUB 2PO6B 3UROR 2VXUH 3QEUA 1TVBB 4UIKL 4JO3L 3C6LC 3KPLA 4FQXD 2KPNA 2XTJE 3V6FB 1QBML 3D39A 1QPPA 3BDYL 1FGNH 4XWOD 5I9QB 2Y06H 4XMKL 3AMKA 4PLOB 5ICYB 5ERWA 5DQ9B 3VH8B 5DMYA 3CX5K 5D2LE 2WANA 3D2UD 3QDJD 2EDOA 5B3JF 1B90A 3P0YL 2FX7H 2NY4B 1U8MB 2IAMB 1HSBA 2HJLA 1K9TA 4J4PA 5EU6D 4TTGA 5GISH 1JWSB 3T0DA 1CS6A 4J3XA 1E6OH 1UJ3A 1DBBL 4XP1H 4HZAA 5I19H 1G1YA 2R2EB 4D8PB 3C60D 3QRGH 3OAYK 3ME0A 4PJFF 2Y5EA 1CFNB 3L1OH 3V6OE 1XFPA 4PJAB 3CH8A 4JHAL 1X5LA 5I1GL 1U3ZA 3PHQA 1T4KB 3L7EB 2DI8A 1U8HB 2A6DB 5IBLD 2FYYB 4WUKL 4PY7B 4AH2B 1BFVH 2YD1A 5FXCH 4YBLC 3V0VA 1RIHH 1NFIA 3JV5A 3RVTD 1JGUL 1VACB 2CD0A 2R0KL 3MV9A 5AZEH 1NSNL 1JZ7A 4MD0A 4NBXB 5GZNC 7CGTA 3RTQC 3EYVA 3CH1B 1G7MA 3CX5J 3MBEB 3O3EB 1T1YA 3DUUB 1MFCL 4NUJB 3W11D 5I16B 4WI5A 5CJ8A 3V0VB 5F21B 4N0CC 2L7UA 4MJIB 3E1F1 4NJ9L 4ZNEA 5I1IH 4I3SL 1H3PH 5EO9A 5FF6A 5I1CH 5IHUL 1BD2D 4HJJH 3BUYA 1E4WL 4KKAC 1BWWA 3SDDD 2J3SA 2HT3C 3G5VA 3P4MB 5TGBB 3TYGL 4DZ8B 2GSIB 5DJ2A 5DA4A 3VCLB 3OX8B 3D39D 1YEJL 1VCAA 1JPGA 4QHUB 1R3KA 2XY1A 2DBLL 4OD2B 1W2KT 4FNLH 1BQLH 2E9IA 2Y5TA 3L6FA 5C0GB 1UQSB 3B9KC 1CD0A 2AV7A 4M1GH 2FIKB 1YMHB 4TPRL 1PLGH 3FN9A 4F7EB 1AJ7H 2HJFB 1AGCB 3C6SA 1E4KA 4DVRL 3S5LG 4YHZH 2PXYA 2MCG1 2FEDD 3O8XD 4PD4K 4X6CF 4MNGE 4U1NA 5HYJE 3UBXA 4HXBH 3LN4A 4LLQB 1INEL 5DI8B 1KCLA 3FMGH 3C9NB 4X6DF 3WEXB 4PTTA 1F6AA 4ERSH 1VEPA 2M26A 3E2HC 1KEML 5BZDB 2Q86A 3S88H 5E08H 4BM7A 4GH7B 1K8IA 2BSED 2XN9E 3LV3A 3Q5OA 5GGVL 4D9RD 1QSFD 4X4ME 1CICD 4ODTH 1KB9J 2YSSA 4P3WA 4JY4A 1EJOH 2PTTA 3ULVH 5TE7L 3GSWB 3HMXA 1I7TB 5IMLB 2FLBT 4XVTL 4PJDF 2I5YL 4QCIA 4K8RH 3DOSA 4MS8D 1U3HC 1EO5A 3QEHB 1WICA 5BO1H 1A7PL 2NNAA 3QUYC 4XWGH 1PFCA 3MOBL 4WFFE 1HH6A 3UTSA 35C8L 1M7DA 4MVBD 1JI2A 3FB6A 1C16A 3T0WA 2DRUA 5EOQL 2V2XA 4QGTA 1FDLH 2IANA 1M6OB 3DVIA 5FGCB 3RY6A 3BO8B 3MBED 4FXKA 3RNQB 4WI6A 2NW2A 2IAMC 5I8CB 2DWDB 3RX5A 1GGBH 4V1DB 5JIKA 3MRNA 3DXAA 1T7YA 4LLVA 3CJJA 3GRWA 3K8KA 3HS0B 3SKJL 1JV5B 2CDEB 3BIKB 1JNHB 2E7BA 2BFVH 5HD8C 4GG8A 4P9ML 5FOBA 5KBNC 1IAKB 4P4KB 1EAPB 5KAQG 5IW6B 4LLAA 5TDOA 1QYGH 1XT5A 3D85B 3HI6H 3RX8A 5IESH 1VPOL 5ACMA 5SWSE 5CJXA 2BVTA 4OD2A 3V8CA 1WBYB 4Z76A 4R0LB 4K94H 4KK5C 5DRWA 4ZS6D 2RFXB 3IKCA 1FJ1A 3GSVA 2JCCA 3WO3B 5C0EB 4O5LH 4R7DB 2GFBA 4X4YB 1R3LA 4Y2DB 1KFAL 1VGEL 4KK9C 2COQA 5CEYA 1EXUA 4CMMA 1U92B 4NQEA 1Z0NA 8FABA 2VQ1A 4ZTOL 4KRNA 1T1ZB 3S96B 4F37F 4X5XB 1YMHA 4FABH 4FA8A 2EDTA 3BT2H 4MCZA 4XHQA 1DQDH 5IGXH 1HHHB 3BZFB 1XGUA 1UURA 2Q76A 2XNAA 1FVEB 2WWMD 2ORBL 3FQUB 4XP5H 3ILQC 5CJ5A 5C6TH 4KI5F 3Q6GH 3QEQE 1K8IB 3LV3B 1KBGL 5INCA 5C71A 2HLFC 1XF1A 3NGBC 3MRLA 3NCCB 3KYKL 5TF0A 3W5NA 5JR1L 2A6IB 3BXNA 4KUCD 3CSGA 1IGYA 2NXYD 5EFIB 1WAAA 4WO4D 1FIEA 3RGHA 3NZHL 4XPFL 1YYLL 3ARZA 3CK0L 4YWGL 1A6WH 1SMAA 3O81A 3U0PA 3L5XH 1TIUA 4ZO7A 4JANB 2QSCL 4DQOL 4N0FA 4OCSH 3P40A 2X4RA 1YPZE 3OKKB 4PRHD 5I17B 4M3KB 5CKAA 2D7OA 1KB5B 1U93B 3IU4L 2X4SB 3RA7L 3DX8A 2FNBA 4JANA 3VFTB 4NP4H 2CUMA 4XTRC 4UDUA 4Q6IC 5HI4C 5CMAB 2F8XC 5C09E 3RTQB 3U6RB 2X9XA 1IGCH 3BJLA 1U2HA 1CCZA 5KOMC 2AJUH 1GL4B 4E0RA 1K2DB 4CJ1A 3PGCA 3RJDA 1JCKA 1NBYB 4NZJA 3UTQB 3VFWA 1XF2A 4YHKL 1U8QB 5E9DD 1NUFA 1R3JB 3QJFA 1IZKA 4P4KA 1GOGA 3MJ9H 3QUXC 2ZSVA 3QP3A 3PIQA 4ENED 1T2QH 3FQTB 3HI1B 3MRQA 1Y6KR 1AHWB 1HIML 3GIVB 4OLEA 4APQD 3KYOA 3JWOL 1MHHB 2WQ8A 2NY4D 2YC1B 2XXMB 1T0MA 3BPOC 2AK4E 4GKZA 4IIQC 3S35L 1Z9MA 4L9LC 4P3DB 3N06B 5H94A 5D1ZA 3V4VL 1MRDL 2K7PA 3IFPA 3OKNA 4NIKB 3UO1L 3OR6A 4O4YH 3RBGA 3PV7A 5F1NB 5ADOH 1T1ZA 9CGTA 4HUXB 3O4OC 4JFEE 2YC1A 2ZUSA 4OCMC 1KJMA 3GSNL 1KJ3L 2IFFH 4HQQL 5H2BB 4JFYB 4ZYKB 4N90D 1E4XH 3GJFK 4UIMA 3NACH 1U8JA 1LO2L 2NY5H 3RY4A 3VRLE 1MCDA 5JHDA 2A1WH 2X42A 2A6KB 3G04A 3E8UL 3LIZL 4P2QB 2NY1B 4PJIA 4L3EA 1RSFA 4MQXD 1D5XB 4TUJB 3TT3H 5IBLC 2QSQA 3QNZA 1IEHA 7FABH 3RWDB 1JNLL 3HUJF 2DTSA 3H42H 3DO7B 3X12A 3PWVA 3A6BH 1FZJB 1EEQA 1U3HA 5TDNA 4CVWA 1H5BC 3KLHC 1OAYH 3KPQB 3MRRB 1UZ6F 3U0WH 3IETB 4PRID 4ZSOA 1QFWM 4ZOEA 1MVUA 3J8F7 1PZ5B 5C70A 3U83A 2F19L 1OSPH 4UV4L 1EUUA 3VXTA 4Y16B 1J1OL 1A9EA 3OAZK 3U7WH 1UM4H 1TVDA 2FATL 3OGCA 4JDVB 4L4TA 4OCWH 4NC1E 5E6IB 4U49A 4Z7UF 4JPVL 5I17A 5T5FL 4MSWB 4MHHI 4BH8A 3DARA 3RUGF 2KH2B 1KB5A 1U93A 1A9BB 4NKIH 1YECH 1U8MA 2E7CA 2IAMA 5DURD 3T65B 3L9RA 3M17A 5FCUL 1W0YT 3ZE2E 3RNKB 1BAFH 4F8QA 5D72L 2DLHA 1AR1D 2E7LA 1QSFB 4EQ2A 3V5KA 2IWGA 1I1FA 3RI5K 4JM2C 5I30H 1DVFC 4K7PY 1UXWB 4GKSA 4EVNA 3BP5A 4YXHL 3Q6FB 1IQDA 1FP5A 3P9WB 3NA4A 5FYKE 4HJGB 4H0HB 3MA7B 1S9XA 1UM6L 1YJDH 5C0AE 1I7ZA 5DGRA 1X5AA 3MLPA 5EU7C 4HGWA 5D1ZB 5BVJA 1XCQB 2OX5A 1YN7B 4QRRE 5I18L 2HLAB 4OFPA 1CE6A 2DI7A 4YDKH 5GGSA 4QRRB 2DM7A 4PJXA 2Y4SA 1S9YB 3V4PH 3ETBF 5T3ZD 4QRPD 5DMKA 5A3ID 2DYPB 3RBSA 2L0DA 3HE7A 1CGVA 5FM4A 4IBLT 4X80H 1I75A 1OLZA 4HMEA 1U3HD 1W0VB 3DUSB 2NZIA 1CE6B 2ZG2A 4FQ2H 4P46A 3O11A 1A7OL 1OP9A 3O6FD 2VOTA 3D3VA 3JTSA 2VLJD 1TQBC 3NCFB 5ITBL 1RJZA 1QBMH 5J1SC 3EAKA 3CD4A 1FIGL 2ZOKA 2I07A 1AXTH 3B6SA 3HPLB 3R06A 3IDJB 4XMKH 1OAQL 2JF1A 4HS8H 4MXVE 1CTNA 4XXCC 2WBJB 5LGHL 3TGXA 1YN6B 4JZJC 4P2RB 2V17H 5H35A 2IQAB 1U41A 3KPOA 4ODXA 1CDCA 4NWTL 1P4IL 4GMSH 3DYMA 1KN2H 4H5SB 1A6PA 4JKLA 4U1LB 3OXSB 3WFEH 2F54B 4WWKA 2OR9H 5FYKH 1OD9A 3S3SA 4F9LC 5C92A 2HRPH 4IS6B 1WSST 5CD3B 4LQFH 5H35B 1T66C 2GT9A 4ODUB 1I1AA 5CEXB 1YEGL 4RFEA 1LE5A 2HH0L 1A6UH 4CNIB 1MHPH 4F33A 2Q3AA 3H3PH 3OJMB 3BKMH 4M9OA 2OL3L 3LDBB 4JR9L 3TYFA 2M1KA 3MRGB 4GJTB 5IKCB 4U1GB 2CGRL 4DTGH 2J8UA 2A9ML 3ZE1F 5IHZB 3UJJH 1CGXA 4XCYA 1BMGA 4FQXB 2F53B 3GZKA 1TPXC 3B2UD 2D9CA 1JN6B 5BVJB 3V2AR 2C1PB 2R1YA 4QTHB 4X6DE 5F7YC 3NN8A 4P5TC 4PV9B 5AWNL 3RDTB 3CC5B 3LAFA 3REVA 3EJYD 2Q7NA 5JW5A 4R4ND 2YBRA 3DRTB 3CPLB 4ZFOB 1QKZH 2Z31C 5DWUH 2GUOA 4OM0H 1Q9OB 2MNUA 1MCEA 1PLGL 2WUCH 5FOJA 4DK6A 4RDQF 3AU1B 2GJ6B 2R2BB 3MCG1 1MRFL 3NVQA 4MJ4A 3H9ZA 5DMJB 2RR3A 2YBRB 4S1QL 3K4DA 2WBJC 2VUYA 4HFUL 4XNYL 2V9RA 2X1XR 1GOHA 4HWZB 5MEOA 5KSVB 3FMGL 3RWEB 2PYEE 5ID0A 1C5CH 5HGHA 3DETD 4NOFA 1NAML 4YC2C 1KPVB 3S88L 4OI7A 4L4VE 5C07B 2BHYA 2I60H 1CFSB 3LEXA 4KI5D 5H37H 3CXDL 1NJ9B 4BJLA 3VW3L 4OBRA 1I9EA 2OP4H 1J8HA 4M48H 3ULVL 3WEXA 4W70A 4AENA 4YHLL 1T83A 4U7SA 4LSQL 5DD0L 3RI5F 1IJ9A 2YD2A 3C09B 4CU8A 4MB5A 3UTZB 4IS6A 4UQ3A 4X8XA 1WZMA 3ZTJH 2NLJA 3G08A 4DN4L 5IMOA 5EOQH 1I1AB 3DI3B 1LDSA 1FDLL 1OAUH 4MA8L 3V0WL 4G5ZL 1N26A 1QQDA 1YEIL 2F58H 4JFPB 1RZJC 3TEUA 5B22A 5DYOA 3WJLC 1IM9D 3K81A 3WYRA 4N8CL 1BJ1J 3SKJH 4F15B 4PJFE 1EHNA 2WINA 3OZ9L 1BF8A 3I3DA 3O6KL 4LEXH 1JWMA 4YGVB 1PG7X 5FGBA 4G8EB 4HPYL 3CCHB 3BJ91 2CDFB 1GIGL 1A7QL 4S0SD 5ENWA 4LLUB 5E8EB 3BRDA 4DUVA 4KHXL 5EIIB 3TWCH 4LSUH 3QG7L 3UYRL 3WHE0 1DQMH 1J8HD 1OL0A 2A74B 4K94L 4PRBB 2ESVA 2G9HB 4DZ8A 3GMOB 1RUPH 3HE7C 5FA4B 1UZ6E 2ED8A 2RQ8A 4O5LL 3RWCA 1ZANH 4ZFOL 1KFAH 4LCIH 2DQJH 4C57C 3D85D 4ZTOH 2X40A 1QSEB 2HT4C 1WBYA 4AT6A 1WFOA 3DIFB 5KG9B 3SGDH 5F7HA 1TQBB 1N59A 4KZEH 1T83C 3MLRH 2GJ6A 1G6RB 3T77B 3TNMB 2JCCB 3SGJC 1FCCA 5GIRA 4XNXH 3LKPB 4FFZH 4YJZL 3P73B 5CJQH 5EBMA 2R4SH 5BS0B 3Q6GL 3GBNL 1KBGH 2CMRL 1VEMA 3OV6A 3MJ8A 1PQZB 4XVJL 2DI9A 1OAXL 2W38A 4XVSH 5F1OB 3C08L 1LGVA 1IC4H 4GRLA 4NSKB 4QHMA 1A3QA 4XPTH 5HHMD 1DBJL 1F13A 4BQBA 4GO6B 1U3HB 3NH7L 4OGXL 4PJGB 3JWDC 4YWGH 5CAYB 1DEEA 4HG4J 4TVPD 1RJLA 5D1QD 1YQVH 3QHTC 1X6LA 4N8VA 2W07A 3PJSA 4D9QD 1PEWA 3MUGB 1NBQA 3WNLA 4JFDD 3GNMH 2AK1H 5DHVH 2DQGH 2Y36H 1M7DB 4LU5L 4GOSA 3S35X 3S9DB 3FO2B 1PYWB 4NNYB 1K8DA 2EIZB 1N8ZA 1CL7I 3HC0A 1LEGB 1M05A 2FLRT 3FKUS 4RGND 1BIHA 1T6VN 1KB5L 1GGIH 3SGEH 2VQUA 5FYLH 3V5KB 5EU6E 2DAVA 1EBAA 5I8CA 3QO1A 4M7ZB 3HZVB 2YWYA 5E99H 4L5FH 3EO9L 4TVSa 2XFXB 1K4DB 3QDHA 4A6YL 1MSPA 5I1EL 5J4MA 4OZGA 4H88L 3VFNA 1FNLA 1EEYB 3SE8L 4QYOA 4Q6IB 1A2YA 3DYOA 4YIQB 2F53E 2YXFA 4Q0XL 5MEND 2UZYB 3CFKA 1XGYL 3SCMB 4F2MA 1U3YA 5B39B 4OLYH 2H9GA 5HSFA 2HFFA 3MLZH 3SDCD 3REWB 3FO9A 3WLBA 5DZOA 1MRDH 2AJ3B 1LQSR 1CXIA 4ZMAT 2IALA 4JREC 15C8H 4Z77A 3QAZB 2X1PA 1EEUA 1SY6A 3P2TA 4HEME 2JK5A 1KJ3H 2IFFL 3D0LA 3KNBA 4AIZA 1P2CA 4XAWL 1E4XL 3O9WC 1AO7D 2VLKA 5IWLC 3GJFA 1KXVC 3DNKA 3CXHK 2H2SC 1OHQA 5DD6B 4YX2L 1GGYA 4XNUH 4U3CA 3S3JA 3WUZA 4JFQA 4G8GD 1CGUA 4JFDE 1GAFH 4XC1H 4NN5C 4R6UA 3V8OA 4F7PA 5DT1H 1QFWH 2NPLX 3G5XA 5DJZB 5IVZB 1W8NA 3BGFC 4RBPK 4XPHL 1AR1C 4X6CB 5DA0B 4BH7B 5L2KD 4JDTL 1ZVSA 3A6BL 3ZKSD 1LDPH 2O5ZH 4QRTA 4BFBD 1BPVA 3ZKNC 5EZJB 4X0KB 5J57B 1KV3A 2UZXB 1MCIA 3EFFB 4L4VB 1J1OH 5ELIA 3BP7A 2V2WB 4PJ5D 5HI3C 1KXQE 3U7WL 5CJOL 2MFNA 1KLGA 1ERNA 1RUKH 3KGRA 2HVJB 3ZL4L 2XQYG 3VH8A 5I1KL 4LHUB 3MRHA 4NKDA 3W9EA 4OQTH 5HYIA 4XNZB 1C5BH 5T5FH 1MELA 5IB5A 3MGOA 4LLDA 3FB8A 4P2CG 1BBDL 3NABH 1UWEL 2MMXA 1JYXA 4BSWB 3WFCL 3WN5C 5FCUH 1DBKL 1TLKA 1N0LA 5E2JA 3GI9L 4E0RB 4OF8A 4JPWL 1JGLH 1QO3B 4PG2C 4G9DA 3EOTH 5ESQB 5D4QA 1LEGA 1YEHL 1QNZL 1YEKL 2YPVH 4M5YH 3DV6A 5HGBA 3QULA 2NX5E 3JVGA 5GGSY 1KIQA 5C0JA 4YXHH 4U1IA 4APQA 4OFYA 4OZHB 4IRZH 4AMKH 3ARPA 5J1TC 4YC2B 3RVTC 4P23C 2N7BA 2R1WA 1U8HA 2A6DA 1YJDL 1LE9B 4BFEA 5HHVL 4ISVB 4C56E 3QXVA 2CLVB 1YDPA 5IV2B 1XMWA 1N6QL 3KR3L 2G60H 5CS7A 4ODWA 1I7RB 3PGDB 4Z18A 5HDLA 3KPSB 32C2A 1F45A 4PGBB 3MRKA 4GRMA 4PS4H 4FMKA 2JK5B 5KANG 2OZ4L 3UDWC 5IG7A 2XZAL 1BQSA 3NGBB 1G1CA 4JVUA 3I9GH 4FQJH 4ZUTB 4TUKH 5JHDB 3BMVA 5K9KB 2RBLA 3MRDB 4OCRH 3RDTA 1Q9OA 2YPLE 4X9GA 2EIEA 5I1AB 3RDTC 2UYLA 2ERJC 3O6LL 1FN4A 4LNRA 5BRZD 4KV5F 5TF1L 3KWWA 2OTPA 3AC0A 3RKPA 1I85C 5JW3H 5ITBH 5ADPL 3UCRA 3RL2B 1T66D 1NDMA 4FQCL 4LVNC 2YUZA 5K9KA 4L3EB 5L2JA 4LF3A 4M43H 1AXTL 4PGZA 4Y2DC 1DP0A 4J6RH 2QR0A 3ZE0E 4NKMB 4LNVA 3DMMB 5FYKD 1PY9A 3KG5A 2E6QA 4GW5B 2HMID 2BC4A 2QQKL 4ONFL 2CLRA 4TULL 3RIFK 1S7QB 5D7IA 4RIRA 4CU6A 2HAZA 2PETA 4PTUA 5E8DH 2V17L 2LVEA 3JSSA 3EDDA 5BXFA 2VLLA 3TT1H 3VRJA 4PJGE 1ZTXH 2P45B 4P23A 4ZXBB 1OARL 3VXTB 1D6EB 4LARL 2OR9L 4XVUD 5DVMA 3BZEA 4PJDA 5EH1A 2OK0L 4RWYH 4MQSB 5T5NF 3VE0A 4UT6H 5IMOB 1WVZA 3GSWA 2VXSL 5IMLA 3KLAB 3QPXL 2ZJSL 4XP4L 1MHPL 3ULUD 2O5XL 1A5FL 4JZJB 1B0GA 5EZLB 1NMBL 2X4OB 4Y88A 5JIIA 3WHXB 3FB6B 5DJ0B 1NGYB 4U31A 2XG4A 2GK2A 1JFQH 3BPCB 3BISA 3VD7A 3CDYA 3KYNB 4KRPC 5C0NC 5HVWA 5LBSL 4AG4L 4XX1E 4XZUB 4BUHA 5F6IB 1H15A 1H3VA 3MA9H 4NO3A 4RMWA 1S78D 1KACB 5FV2A 1JZ3A 3TLRA 4R8WH 4G9FB 4MA7H 1KLFA 3GBLA 5I8EA 3LSOB 5ACLA 1HQRB 4PJXB 4P46B 2IPUK 1RPQA 4ZG1A 3NCBB 2XG5A 3CSBA 4PP1D 3EYUH 3HFML 4U7MA 4QHKJ 4JCMA 2CRMA 2ADFL 2AJVH 2YUVA 3QIWA 4O2EB 3U46A 5C08E 1GXEA 4PG2A 1QD0A 1R6VA 4E41B 4RMUA 1S7WA 4XNYH 2YZ1A 5SX4I 1IGFH 4K23H 4FQ1L 1FLTX 3FJTA 4ZAKA 1AE6L 1B0RB 1C5CL 5D1QB 3BKJH 1HYSD 4FFYL 4N8VG 1IKFH 3QUZD 4Q97A 5DMIH 3MGAA 2IH3A 2H3NB 4M02A 3UZVB 1PG7W 5EUKB 3I84A 4JM2B 2CIIA 3MRMA 4M48L 2ZCHL 2YWZA 1CFNA 3GJEA 3VFPA 4EN3A 2IGFH 4ETQA 1HQ4B 4KHTH 4RRPA 3GMMA 3UZQA 3WV0A 2FHBA 3I3BA 2DQTL 2V6HA 4NRYA 5TE6L 3WIIH 3WDHA 4D8PA 1MHCB 3MUGA 3A67L 4EXPX 4AH2A 1HXYA 3QEQB 5HDQH 5FO8B 2MPAL 1ZGLM 1G9NH 3ARGC 5GS2H 4DN4H 2P24A 5F3HB 5DEZA 4MA8H 1P7KB 4X4ZA 3OJDA 3HR5A 1I9IH 4HFWB 4M7JL 4ONHA 4XPGL 5BZWB 3EO1B 4XNMA 1HXYB 4QEGA 5DGQA 2NY5C 1NBVH 4OLXL 3FO2A 2EO1A 4YQXH 5FGSA 3QNXA 3NFSL 3VFTA 1KLUA 3O6KH 2CLZB 2X44D 3VGAB 4MXWL 3RZCB 4NGHH 3N9GH 1AIFA 4HPYH 5BZWA 1ZVYA 2HG5A 1UVQB 5C08D 1IAOB 3QEQD 3RP1A 1CR9L 5J13B 5J12C 1VFUA 4I4WA 3CPLA 1QRNE 1JIBA 3TBSA 3BRFA 5F7EL 4NO2A 3LPWA 4YO0B 3LHPL 5DUBA 5D2NB 4M00A 2NXZC 2N56A 5F7KC 4JY6A 5CSZA 3TV3L 2Z9TA 1MJ8L 2VYRE 1V7MH 2H32H 3ULUH 4WFGE 3LEYH 4KK5D 5SWZE 1T3FB 2IALB 3KJ4C 3SY0A 2Z4QA 2NW3A 4WV1C 4P0DA 2FD6H 1MJUL 4U33A 2IMNA 3DGGA 3EFDH 1BJ8A 2UZIH 1XF3A 1SJXA 3FQXA 4YHML 3AM8A 5A2IH 1JZ8A 2IBGA 3P0GB 4HKZB 5CJQL 3ZYIA 2R4SL 1ZLUK 3SY0B 3OMZA 4LKXB 2EXYD 2IH1B 1KG0B 4ZAKB 1XCTA 3MV7B 1HKLH 4N9GB 4ELMA 2W9DL 3OB8A 4JM2F 5DEFB 3NOIA 5E24E 1QP1A 4EDWL 4AQ1B 1EHLH 2RIKA 1E6JL 2DWEB 3EYQD 1CICA 4NQXA 2P5EA 4UB0L 3MRBA 5IW1B 2IPUG 1FYTD 3LKSB 4Z7NE 2VDRH 1OD7A 1RUMH 3O41B 3OR7A 1RZGB 4HF5H 4DFHA 4DGIL 4KMTL 4NQVB 5E56A 5GRJL 3DX9B 1CBVH 3VXUB 1JBJA 1XGTA 5ALBH 3MRBB 3HRPA 4I2XB 1DUZA 1Q0YH 1ZLVH 2H45A 1NGXB 2CRIA 4KK6C 1IEBA 1KIUA 4BSVB 43CAB 2WK2A 1A66A 3GMRB 5CZVL 5KSBA 1FNFA 2V9QA 3OGCB 4L4TB 4HFWA 5C3LD 4NJAH 1OB1B 4U1KA 1HE7A 2BMKA 3FB8B 2X4RB 1JWMB 2GY7B 4G9FD 2VH5H 4D3CL 1MLCA 4HMDA 2D31B 3F6IA 5CP7B 3HG1B 3UAJC 4DGYH 5EC1A 4A6YH 4N90E 4M1DL 4YXKH 3P9MA 5JXEC 3RTQA 1LP9E 5KSBE 1ZLWH 5GZOC 3EYFB 3S34L 2P8LB 1ZKAA 2PW1A 2APTA 4Q0XH 4M7KH 12E8H 1CL7L 2AK4B 3PGDA 1A21A 4NQTA 3GDBA 4LSSL 2Z31B 3C6LA 2YD8A 4MCYB 4OFIA 4OB5H 1ZEAH 2ITDB 3GIZL 4HLZG 2H32B 4X4YA 5GJTL 1S7RA 4HWBH 2P5EE 2V5RA 3JWOC 4AT6B 2NY7H 1RZ8B 3KYOB 2KBGA 4C58B 3DMMD 1HWHB 1CU4L 5K33A 4M03A 1SYVB 5GIRB 1Y6MR 3R8QA 3QH3B 3VXRB 4XCFL 1ZK9A 3ZTJG 5D7JC 3F65A 4I5BB 1S9KC 3SKOA 4XBEH 4ZQKA 2NXZB 4RGOL 4H1LH 3UX9B 4LDOB 4WO4C 3TN0D 3KYMA 1M7IA 2NY3D 3G5ZB 4G6KL 1LNUA 2PO6A 3U0TB 5LKNA 3H7BB 2VJXA 2DQIL 4WW2C 4EN3C 1X5IA 3T0EC 1I8KB 3N1FC 5F97E 1LWRA 2HFGL 5L88L 3G5XB 4LPCA 3V5HB 3PWPE 2CLRB 4OTXL 1EGJH 1DTUA 3T4AA 3UTSD 1C5BL 5L0QC 2YA0A 3MR9A 2VLME 2A38A 3K8LA 4OZFA 4LBEA 1J1PL 2IQ9L 3IETA 1PGRB 1MHEA 4LLWA 1H3GA 4ZNCD 3BW9A 5D6DC 5A2JH 3KPRA 1A9EB 5DC9B 4G6FB 3K0WA 5A2FA 3DXAD 4GAFB 4UBDD 1BJMA 4L8SA 4PGDB 3VFWB 1JGVL 5DJYB 4LLDB 4UTAH 2OTUB 1MJ7L 4UUJB 2EH8H 1DQTA 4QNPF 5EZLA 4ODUA 2ZSVB 2BX5A 3KPSD 4IRZL 5D96B 2JB5L 3OKDA 2XA8H 1BZ9B 4OIIL 5I8OH 3IDMB 4OJFL 1XF2B 5IB4A 1E28B 4L8SB 4PGDA 4HUUA 5EU3A 5HGBB 3GSQB 1F8TL 5A2LH 2G75B 4TQEH 5DJ6B 3L3KA 4RZCA 2X4OA 1N7MH 4N5EC 2EXWC 2HFFB 3KR3H 4TNVF 1TTUA 1Z3GL 1NMCB 4PJHB 3QG6A 1WAAF 3TH2T 4PRHE 3UP1A 4RX4D 5CZKA 4M6OL 1EMTH 3JZ7A 1OQXA 4OGYH 1T04B 1SJVA 1UACL 4P49A 3RHWK 3FT3B 2MKLC 3OR6B 3F5WA 3P4MA 5TGBA 5BVPL 3C5SA 2E27H 1D5IH 4P59H 1CK0H 4FXLA 1WK0A 1VFBA 2AJXL 3ILQD 2O93L 5JW3L 5DHVA 2BRRL 4MD4B 3OPZL 3P11H 4FQCH 1T22A 1QHPA 3GSUB 1ZLSH 2QV2A 2PN5A 1NMAL 1B0RA 2YRPA 1X5GA 4J4PD 1N4XL 3PWJB 1VFBB 1N5YL 4Y5YB 3ULUC 5DC4B 4UAOC 3A6CL 3BGMA 4ONFH 2D0HA 1H0DA 1XR8A 4PRIB 5HDBF 3BP7B 4M3JA 3L5HA 4I48A 3GFUA 2D4DA 3FZUC 1BVOA 1E0OB 3VXOA 1QRNB 1KCVH 1O7VA 1U8LA 5DLML 4G7YH 4J1UB 3HCVA 1CFTA 2D4FA 1ZHKB 4V1DD 4KV5E 4JM2A 4KRPD 4M6ML 4BFIA 5CGMA 1LK2A 5FECA 4GXVH 1KENL 3W81A 3IXAB 3C5ZC 1KTLA 4OLUL 1T1WB 3EJJX 2UWEB 3OHXA 4Z5RA 5E4IA 3T65A 2ZJSH 4XP4H 1HSBB 2JCCF 3VFVA 2CQVA 4RQQB 4TNVK 4HPOH 4O02H 5GGRA 2VXUL 2FGZA 2CJUH 4NYLB 4OSUH 1ZGLA 4HSQA 3G08B 4Y4FA 4HJ0D 2HTLC 2QEJA 5LAXA 2XWJB 1KC5L 1KULA 3VFVB 3LS4H 3O2DL 5EORL 2CUHA 3KJ4B 4HHAA 3U9PL 1PX4A 3L3KB 4RZCB 5SV3A 4KKLD 2X09A 2H1PL 4I0PC 2X9WA 2ATPB 3TF7C 4RGNE 3ESVF 1TETH 5E9DB 4NWUH 4G8FA 4IDLA 3THMH 3DMMC 1Z5LB 5IFAL 4ZFFA 4WFHD 2FX7L 5HHPA 1KB9K 2CR3A 5K9OA 1DBAH 1A0QL 5CZXD 1B6UA 2R4RH 4Z7NF 3RGVA 4JKMA 1Q9KB 2GK0A 3VXMD 1FNGB 2FWOB 5DHVB 3STBA 3BPOB 3MJ7A 3TBSB 1CQKA 1YNTA 3L1OL 3VD3A 3EJYC 5AUMB 3O6FC 1ZHBA 4GBXB 3SE9L 5KS9A 3BKCH 2A83A 5DFVD 5L6YL 5TQ0H 1HK6A 2W65B 2DIJA 2EDNA 4WUKH 2VDMH 1EX0A 4JFOB 1BOGB 5CEYB 4CMMB 3AS2A 1IBGL 1H0DB 1XR8B 5TDPA 2BC4B 4U0QB 4K23L 3U4EA 2R0KH 2VTFA 3X3GL 3T0EE 2X70B 3KLSA 3HI5H 4G7VH 1M71A 4Y5XB 2OYPA 4OCXL 4WHTA 2ZUQB 1NLBH 4WCYL 5EOCL 4AJ0A 1T7ZA 4PRIA 1DLHA 3FQUA 4U4BA 2B5IC 3I02B 1FFOA 1JNNL 1UKSA 4OZIE 1TJIL 2ZCHH 5EO1B 2UUDK 4L8CA 2EC9T 4QXUL 2BSSA 4QRPE 2GITA 4P23B 5DO2C 2KDGA 1Y18A 4GAJL 3QSKB 3STLA 3WIIL 2EYSB 3PHQB 4WO4A 4P9HC 1E4XI 3SCMC 5EU6A 5GRXG 4XP6H 5GGRY 3OR7B 3LH2L 3L3OA 5DJ0A 5JNYA 1EHAA 1CDUA 2J6EH 3IKKA 3X13B 1AJ7L 3DUUA 4NUJA 1JHTA 4WW2F 3P9LB 4YHZL 1NBVL 2Y1VA 5C6PB 3I50H 5MI0B 1MLCB 3NCJL 5T1MA 3BPNB 4WTZG 5JZ7D 3NFSH 1RMFL 3SDXF 1IGJA 4MXWH 2YUXA 3WXVH 3RVWD 2AXGB 5IOPB 4GQ9L 4W81A 3QO1B 3CC5A 4KQ4H 3REVB 5JUEH 5GGVH 5TH2A 1CR9H 1YY8B 3UPRB 1EFXD 3DSFL 4L1DA 1TJHH 2WUBL 4D0BA 3BGFB 4JDZB 1EJOL 2EDDA 3TN0A 3DUHA 2Q20A 3BZ4B 4HWBA 2DIAA 1FG2B 2FIKA 3I6LD 4X8JB 1L0QA 3SDDA 2UVEA 1RHFA 1T1XB 4KRPB 4ZS7H 2CPCA 3EYQC 2NY6D 1A7PH 3LEYL 3OAUL 2WP3T 1FL6B 4HUMB 1RJYB 1VSCA 5HBBA 1MREL 2WBJD 3EFDL 3FCTA 1CDHA 4E5XB 5C0EA 2AJSL 1A7RL 5ACZA 3EYSH 2BERA 2V2TA 2FCBA 1A8JH 1S7WB 1BF2A 5EDXA 1JJUA 4HUXA 1GGBL 1RZJH 2CKBL 2CK2A 5EUKA 4GXUN 1HKLL 1P2CB 3O2VL 1CE1L 3JVGC 3PDGA 4QO1A 3ULSA 4O00A 4EDWH 2X4UA 3TBYA 4F7CB 1QYGL 4RMRA 5BS0A 1FV1A 4JQIL 3NBNA 3TCLB 4ZODA 2VDRL 1SVCP 2E7LC 4ZUSB 1BZ7B 4S1RL 3H7BA 5ANMB 2FB4L 4MQTB 3C5ZA 2NYYD 4KMTH 3B9AA 4TUOB 5FHAH 5DK3A 3WJLA 5I8KH 3DX6B 1MCSA 2XN9D 4I77H 4M7LL 2Y25A 43C9A 3LKSA 2IANE 2DF3A 2NQCA 3WIHH 1AGBA 4LL9A 4OLVH 3MV7D 1LP9A 1KLUB 5FK9B 3GGWA 4BH8B 3VXUA 5JXAH 4QRQB 4XBPA 1AR2A 2UWEF 2VAJA 1Z9LA 4JRXE 1CXKA 1QEWB 3IS0X 3HC0B 4WENB 1MQKH 1JI1A 3DV6B 3O6ML 1MRCL 2XTJD 4XPBH 5EWIL 1I7UB 4KUZL 5J11B 1FORL 4OUUB 1P5VA 5HHNB 1T6WA 2HG5B 1EAPA 5BS0D 4K55A 4MB3A 3BPNC 1MEXL 3LD8B 1CL7H 1PSKL 2EH7H 5DUML 4JY4B 3H9SA 4PJ9B 4LLMA 4TSAL 1Q9LB 3K3QA 2E5EA 3IJYA 4UILL 2FBOJ 4GRWH 4WU5A 5DSCA 4JY6B 3WNKA 4QXGL 3S4SB 3NZ8A 3V6ZA 3VWKC 3WDIA 5F6HI 1JPSH 3WJJA 3FO0L 1I7RA 4JFFD 5I73B 1FVEA 3B83A 2FECI 1MIEL 3LQAC 3OJVC 3QO0A 3MV7A 1N59B 2WZPD 3PL6A 4EDXB 1B2WL 5TE4L 1MCPL 4HKZA 5JHLH 3RUGB 2AJUL 3TA3D 5MHSE 1RIVH 2C3XA 3O3BB 3VJ6A 3HE7B 3D3VE 1FNEB 2FRGP 4U1NB 4GMTL 3QFJA 2VKXA 5DRZB 3FFCD 1NANH 1P9MC 3D3VB 3JTSB 4QWWC 2AI0H 4HKJB 5E94B 4ZS6C 1P69B 4ZOBA 3MJ6A 4HJ0C 5DD3H 4RGNB 4BZ2H 4LF3B 3RPKA 3FQWA 3AS0A 3TPKA 1P1ZA 4FZEL 5KW9H 4TUJA 5IT2L 3A0OA 1FC2D 2MTPA 3RVUD 2EKSB 3ZKND 4HH8A 5I1DA 3TBVA 2FSEA 5JO5B 4Y2OA 1NAKL 4JFDA 4PJIE 3QRFM 5F9OL 4RA0C 2XWTA 3SJVD 1BIIA 5CIPB 4LGPB 5DJXA 3UTQA 4XB7A 3I6GB 2VL5A 3A6OA 5FECB 3LKNB 3K2MC 4EI5A 5HI5C 4YHPA 4IRSB 1JUFA 3ZYZA 3OBAA 1WFNA 2OM5A 1HNFA 5BV7H 5CIPA 2CH8A 2AXFB 3C60A 5KSAD 3OB0K 2A77L 4KAQL 4X9BA 4WY7L 3MXVH 1DCLA 2DLFH 4MAYD 5LGJB 3M8OH 3V7AE 2VDOL 2DQHL 4RAUA 1LILA 1N7ML 5C09D 1F6FB 4JG0L 4KZDL 1Z3GH 3J7HA 5C0BD 2ZCKH 3ZSSA 5INDA 2AXFA 2HT2D 1FH5H 1VFMA 4PR5B 1BVLA 3L5JA 1AHWA 4YFEA 4M6OH 3MMEA 3PWPD 5KSAB 1UM4L 4OIBA 1CN4A 1QFUH 1S5IL 3REWA 3AREC 4A6YA 3L3DB 2HT4D 3ZDXE 3HG1E 2VLMD 3BQUC 2C1PA 4ZFZB 4QRSA 3VXRA 2XPGB 5BV7B 1M7XA 4NKIL 2BSTA 2QKIA 3EJZD 3W0WB 2AJZB 2OTWB 3GRWH 4FFVC 1G7JB 2I9LA 4C55A 3S96A 2APBA 2ZSWB 2JB6A 1OF2A 1WJ3A 2X89A 4OF0A 3U6RA 3MFGB 3O3DA 4Q9QL 1Y0LB 1YNTB 3KS0J 3H0TA 3U2SA 3QHFL 1ZLSL 3FN0L 3W0WA 2X70A 3D69A 3OGOE 4MA3A 2ZCLH 1ED3B 4QOKE 1FN4B 4LNRB 3LN9A 3DUSA 2R0ZL 2BXYA 4Y19D 2FO4A 2GJZA 5HYEA 5E94A 4F9PA 1ND0B 4M93C 4LEOB 3FL7A 4OFKA 4KTDL 5D1QC 2AV1A 5DLMH 3Q0HA 3UTTE 5C7XL 1AQKL 4LPVA 4AM0B 4OIAA 3VRIB 2QQLH 4JKWA 5E5MA 2GIYA 4YDKL 3LDBC 1WISA 3KJ6H 3MLVL 3U4AA 1QG3A 4R2GC 2IQAA 3WKMH 2EIBA 3Q3GB 1P4LB 1X5HA 2V7NB 5DXWA 4ONOA 1ZA6B 5J06A 1ZT1B 3FRUA 2VNCA 1I8IB 2VISB 5LQBH 1EEZB 1S7UA 1UJ3B 4NRYB 1SJEB 3FN3A 4O51A 5CMAA 2ICWA 3HPJA 1KNOB 4S1DC 4IOSD 1KIQB 1KTDB 3O2DH 1TDQA 2R1WB 4X7SL 4BFGA 4KI5E 4HS8L 4RMQA 1KN4H 2B1HL 1JRHL 5EU3B 3MLSL 3U9PH 3HPJB 3O2WH 5DD5L 3D87B 4CGTA 2H1PH 1R0AH 1WWAX 4UV7L 5LAXB 1WIPA 1YY9D 4PPTA 3EZJB 4LASH 2VZOA 4D0BB 4K2UL 4GMSL 1UWXK 4LRNL 1KN2L 2W59A 2F8OA 1MF2H 3P4NA 3SJVA 1A0QH 4X8JA 5FYKL 3FQRA 3BUTA 1A6VH 1G9NC 5EPMA 1G0XA 1F97A 5AAMA 3EIFA 5CHNB 2QJDA 4ELMF 1T22B 4GXUM 1IM3A 3SKMA 2HH0H 3Q5YA 3WIHA 5IK3B 1TFHA 3UTTD 4C54A 2E9BA 5H2BA 3WS6C 1S5HA 1R3KB 4GW5A 2HJKA 3FB7B 4LCCA 3TJHD 3QA3A 4XCEA 4C56D 4P46D 1GZPA 3T0XA 2I07B 3U4BH 1FO0L 3T77A 3TNMA 4Q9BA 5SX5H 5FUCC 2A9MH 3F58H 3HCVB 1K3ZA 4RNRB 5FO9B 1NCWL 2Z8SA 4U1MB 5A16B 1SMOA 3IJHB 2ICEB 4OV5B 1TJIH 2OLDA 3QIUD 3DO7A 4W68A 2P46B 3OG4B 3T04D 4N9GA 1AGEB 5CGYD 4Y1AB 1N5AB 4M1CD 2ZUTA 3CLEH 4WHTB 2P43B 3SE3C 3Q3GA 5F3BB 3SO3B 5T5NG 4WWKC 4BUGA 2R0LH 4QRRA 5HDBE 4PGJA 1WIUA 3VI4E 3FFCB 2KKQA 4NCC1 1FFNA 3ALXA 3TCLA 4PJEB 5E70A 2B2XL 4Y1AA 4GKNB 3CVHA 1BD2B 1QACA 3B3IA 4XX1G 4OM0L 1RJLB 5J8OA 5CEZD 3TYFB 4U1SA 2FH6A 2APVA 4R3SB 3ZT6A 3UC0L 4HXAH 3L5WB 3MYZA 5E95B 4PJFA 1HXMB 5ESVB 5CWSA 4HIXH 5MERB 1QSZA 4TOYL 1RMFH 5JNYB 5ISZD 4MJ6A 5IKCA 1S7SB 1WCBB 1QBLL 1XIWA 3ZMRA 1NAMA 4GQ9H 3B8YA 1NFAA 3QUML 3RWIA 5T1KA 1EZVX 2I60L 2PW2A 3L7FB 1AQDB 1IRAY 5CP7A 5DQDH 3LEVH 3KHOA 5B4MD 3NIFF 1Z5LA 4OQTA 3MJ7B 4JO1H 3HNVL 4PYGA 4XT1C 2X5PA 2AXGA 2F54A 4WWKB 4L3CA 3EW3B 5F9WC 3IU3A 1F3RB 3L3HA 5T1DH 1U95A 3GK8L 3H9SB 4NUGL 4POUB 3C6SB 4PUBH 4UIKH 4E41A 1DE4B 3W9DB 1U58A 3PL6D 1ORSB 1LK3L 3SDYL 3F6LA 4FS0A 4JM2D 3IAPA 1VKXA 1HSAA 1M71B 3VFMB 1CZ8H 1MLBB 3V0WH 3ARQA 5CD5C 3LD8C 3LOWA 1NGZB 5EULV 1XEDA 4PLNC 1MPAL 5IVNA 2VQ1B 1NJ9A 1PAMA 4Y5XA 3KNBB 4YHIB 5D1QA 3DVGB 1UGNA 4E5XA 1FFRA 1JTTA 4I13B 5DRNA 5GGQL 4P5TD 4WUUE 2FJFB 4NNPH 5HI5D 5EZIL 5GISL 3C60C 1FL3A 5EBMB 1A7QH 4J3VA 4OF6A 4OZHE 4Y5VA 4KHXH 1RIUH 1HI6A 2DQFA 3QRGL 1BX2A 3T4YA 5KOVC 4HZLA 2A6IA 3BXNB 3ULSB 4MD5A 1VFOA 3V52L 4V2BA 2X4PA 1RUPL 5JW5B 2I24N 3ARGD 5DJDB 3EO0A 4U1LA 5IB2A 3K2UL 4A2LA 4UQ3B 4ONHB 4HIJA 4M7LH 2EKJA 2DQJL 2ZUWA 1NGPH 4Q2ZA 4ACPA 2EYRB 3HAEA 4KUCF 3MO1B 3QPQC 3MROA 2OJEB 1MFCH 2DMKA 5JXEA 4MA1B 1G84A 4MZ3A 1EERB 4JB9H 1AKJB 5D71H 2C4FT 4HS6B 5FEBA 4X5LA 5GPRA 3CFBA 2CMRH 4GG6F 1IL1B 1NC2B 5IHUH 5I1CL 4HJJL 1GHFH 1N8ZB 5ID0B 2A6JB 2YOCA 4WRLA 2Q8BH 3CMOL 4WIQA 1FC1A 3C08H 1IC4L 3RZCC 3QDJE 3TYGH 1AIFB 2R9HD 2OZ4A 2K7QA 3NCYP 5GS0C 3UAJD 1HHGA 2EDWA 1L7IH 2VO5A 3MV8B 1TZIA 4M61B 4ZAKD 1ZV5A 2VZSA 3HZVA 3F7RA 3OAZH 5FF6B 1A1NA 1AFVH 2D7TH 3BKYL 4MLIA 3TN0B 4JJ5B 1ZOXA 4U1HB 2G5BB 4E9LA 1YQVL 1JHLL 3BOVA 3BZ4A 5KVDH 3LCYA 3UXFA 1X7QB 1W72H 1X4YA 4NQUA 4Z7WA 1QPXA 5GSRB 4QHNB 1MCCA 2BY3A 3S3PA 3IFLH 2FX8L 1MAJA 3GNML 1J0IA 2IAND 3BDXA 4XWOC 3T3ME 4HXBL 1INEH 5TE4H 5IP4A 4QY8A 4OZ4B 4CU7A 1I4FB 4WFHE 5JHLL 2Q76B 2XNAB 1V3JA 3WKNA 3N85H 3RQ3A 5IBUG 3QUYA 4MQ7B 4YHIA 5KJRL 1ED3A 2YD4A 1KPRA 3BYTA 3RWEA 2AK4D 4OGAD 4BKLB 5L8LB 1XF4B 2FO4B 4G8GB 1WLHA 5FUOL 4H88H 2XXCB 4JRWA 5DVOA 4K8RL 3GSOA 2BNQD 5D6CB 3C5JA 5F93C 4HIJB 4XWGL 2K1MA 3MOBH 4L4JA 4UNVA 2GJZB 1S3KH 1KCKA 3WHE1 1UKQA 5KVEL 3T0ED 4OLYL 3ZLQC 3JV4B 4PY8J 2GAZB 1F4YH 3S8WA 4I3GA 1QRNA 4L3EE 2BDNL 2AABL 2APFA 4HBQA 3PHSA 1BP3B 4ETYA 4MAYB 3N1GC 4ZXBC 5ESAA 4GS7B 4HV8B 2BFVL 4IIQA 2VZ3A 4JG1L 1VDGA 2O26U 3O6FA 3QWOB 3VGFA 2ADGB 1A14H 1DDHB 3F7VA 4XRCB 5HPMB 2P7TB 1UKTA 3QQ3A 3WFHA 5D70H 3MNZB 5IESL 5IQ9B 3WS6A 5ECJE 3BW9B 1VFAA 4BYHA 1O5DT 5T3XH 3VU2A 3VD5A 1UEMA 1WWWX 2AK4A 1A1OB 4KKCD 2HTLD 4YGVA 1S7VB 4KZDH 5FHBH 4KY1H 4L9LB 1BJ1H 4CBPA 5DJCB 4YHNB 4GW1A 4KRLB 1HEZA 1QVOA 2Y6SD 2PYFB 2CK0L 4WNQB 1QFUL 3HMXH 5C9KA 5DSCB 4MCYA 2QADD 4L9LA 3B4NA 4QHNA 3KXFA 4CUCA 3BT2L 4I9WD 5INDB 1FVCA 3K4ZA 4LCWE 1I3UA 3SDAA 1UWEH 5CILL 2VLRA 5SWQA 1QSEA 2OR7A 4JPWH 1GGCL 2FGWL 3AY4A 5IVXB 3D0LB 5D7JD 2BNQA 5JR1H 4TTDD 2ZUUA 3QJHA 3RWJB 4FQLL 1MIML 3U0TA 5I71C 4YDIL 4X6CA 3EZ8A 2WWKT 3PGCB 4KK8C 3T0EA 1CD1B 4R97B 4A2MA 2YKLL 3TO4B 2A83B 4XPFH 4Z0XA 4X0KA 1YYLH 3M45A 2HN7A 4KRMB 4AYFA 3RWDA 2BY2A 4JFHE 5E03A 5ICZA 3IXTB 1DFBH 4TRPH 3S6CA 2J4WH 2IEPA 4Q6IA 3B9KA 3ILPB 1IQWH 2VERN 4NQCE 1N6QH 5L2JB 1GZPB 2G60L 4X83A 4RNRA 5FO9A 4F57L 4D9LH 3HUJE 4GKZB 4URTB 2OZ4H 3FO1A 1J0ZA 4P2RD 4PB0H 5C0CE 4K3DL 1AC0A 3KJ6L 3PDOB 5SWSB 4H0IA 2VL5B 2PR4L 3QDMB 3G6JE 1IGCL 3VXSB 2M2DA 3IYLW 3VDBA 1I9JL 4JFFA 1IQDB 3IDMA 4UOW1 4PG9A 2DQCH 1OOAA 4JRYA 4NNXB 5HVGB 3U1SL 4DGVH 5FUZL 4Z7VA 3NCEB 1LO0H 4JN2A 1LEIB 1G7IB 3SDAC 4ZPVA 3OKYA 3QXDA 2NY4C 5T1KD 4ODWB 1GC1L 1F58L 3KXFD 3JWOH 1LE9A 1MFAL 3O2WL 2IFGA 5DD5H 1ZVSB 1NFIB 2UVFA 5E8DL 3L7FA 4P2QE 5KVFH 4NO5B 3V4VH 4YHNA 2A9NL 1FVCB 4DCQB 4K2UH 5EUOE 5ADOL 4RX4A 1OARH 5IW3A 4LCYB 3X14B 1UXSB 5JPMA 3S37L 4JAMA 3DXAE 4X4XB 2V5SA 4JLRB 5IHLB 4Z7QE 4AEHH 2VXSH 1DVFA 4D9QE 1VGKA 2X4QA 1FG2A 2HYMA 5GGTL 4Q6YA 2NXYC 5HHMB 7FABL 3V0AC 3K74B 4NKMA 4JAMB 5F1IB 4K8RD 5HGDB 5D1XB 3H42L 3DHMA 5IEKB 2IPKB 1NMBH 2VIRA 3QDGE 5DFVC 2B7DT 4C4KO 1UQSA 1YEFH 4I18C 2VAAB 2DLGA 1OAYL 2NY2D 3WO4B 4P2RA 1W0WA 2F5AL 1WGOA 3RKDD 1JFQL 5GS0L 4WTZA 1T5WA 1G0YR 2EDFA 1F3JA 1A64A 3MRFB 5GHWH 5DK0A 3PDOA 3MA9L 1HCFX 2R8SL 3PGFL 1M1SA 4HZLB 4J1UA 3Q2CA 4WEBH 4KWUA 5HD8D 4ORZC 1FL3B 3C5ZD 4AM0A 4RBPH 4PJ7F 1BAFL 1WQVT 5SWZD 2BJMH 5DK0B 4CNIA 5SWSA 2B2XH 5HYJA 2P5EB 1OTUC 5EO0A 1FO0B 2JJWA 5I30L 5E2VL 3SE3A 1X5JA 4WWID 3KPMA 5IBTH 3HFMH 5EIVA 4HXAL 1F5WA 4U1JA 4TSCL 3U79A 3C87A 4PJ5B 3QNYB 4ZUWA 1NDMB 2XZCL 3O0RL 1IGFL 5B21A 4AEIH 1EUTA 3ULVC 1AE6H 1D3CA 2AQ3A 2NX5A 3DTXA 3MX0A 1EFXB 4G8GE 4NO3B 4UNTA 4DCQA 1UYWL 4JHZA 5DEGA 2IANB 4F7TB 1F00I 5D7JB 3VGGA 5I76B 1J9CT 2ICWI 1J1XL 1OGAD 4G9FA 1YA5A 5DQDL 1MH5B 2F15A 3D0VA 3H9SD 2WINB 3C8HA 1K3IA 5CZXC 3AS3A 5DUPH 1JVKA 1KJ2H 4L4TE 1WUNT 1IM3B 3PHOB 1YNKL 1DL7H 2ILLA 4N0RA 1X7QA 3ZE0F 2CXKA 1ZHBB 1Q1JH 4YFLF 3VCLA 1YC7A 2K9UA 1CQYA 5SWSD 2VN4A 1YY8A 4R4BA 5HDQL 1IGIH 1CIUA 4YBHA 3DPBA 3SDYH 4F8TA 2KUTA 2EE2A 4LCWB 2DJSA 4HBCH 1T80A 2A0LD 4R0LA 1CZ8L 1U8KA 3IAQA 2Y07L 1KT2B 4MJIE 5K9JL 2E3VA 1OAQH 3ARRA 4I0CC 4JM4L 1MCWM 3WE6B 1GZQA 5T3ZL 1NBZB 5IQ7H 4Z7VE 4OLXH 4X5WA 1QHOA 1M4KA 3ARWA 5CIPH 4NN6C 3SDCA 3EUUA 2RAMA 1TMCB 4LDLB 2EDKA 2N1KA 1MCWW 3MRCB 1UJTA 2NX5D 1AGEA 1VENA 1CDYA 2VITB 3MV9D 2R1XA 4NWTH 1F6AB 2DOCA 2W92A 5FYKU 5T1LD 3VFPB 4F15C 1LVEA 5GS1C 4WJ5B 5FA3A 5D6CA 1EK3A 3MRMB 4LQFL 3MTRA 1WC7B 4U05A 5FIEA 1Q72H 5BXFB 3RRQA 4G8GA 5DRNB 4HKJA 1CXLA 1WZKA 4EN3B 3OX8A 1B3JA 4LCWD 3LSOA 1IKNC 3BFOA 4CADA 2DWEA 3MJGX 3H3PL 3QEHA 4WO4B 1VESA 5KVMC 1CICB 5AG9A 3QNYA 4PJCF 5TFSH 3QDME 3L3OB 3CFEB 2RGSA 1JYNA 1G7LA 1MJUH 4GUPA 1OGAA 4O2EA 3QCVH 2C5DC 1YC8A 3QIBB 1EFXA 4IIQB 3BP4B 1LO3H 3UJJL 5DTFA 3GKWH 1N64L 2H41A 2VZVA 2NW2B 4K3JL 3W2DH 3AB0C 1GHFL 1XF5B 4H8WH 5I0DA 1RU9L 1NGYA 3CMOH 5KSBB 4NRXB 1WTGT 3BIKA 4KVNH 4XMLL 2AEPH 2W9DH 4LSDA 3GHEL 5DJYA 4KKLC 1OWWA 5T1LA 4QRQA 3LEXB 4LIQL 2VLRE 4AZ8A 1IAKA 1U2CA 1E6JH 3OKMA 1XZ0A 4MNGB 4QT5B 5IM7A 1XAUA 1PZUB 4NN7C 5GJSH 1A1OA 2OMNA 2VDLH 1IGML 5DWUL 1KYOK 3LKRB 3D18A 5IB1A 4OUUA 5T33H 4LSPL 3SDDB 4JPIA 5B3JE 1S9VB 3WUWB 4U1HA 4JCLA 2GUOB 4F58L 5A43C 1KEGL 5JQ6H 4JPIB 5E2TL 1OTSD 4XC3L 2OJZH 1LD9A 1A3RH 4NKOB 1F4WL 3AGVA 3N85L 4IRJB 4WFGD 2IG2H 4ZD3L 1G7QA 4WI2A 4PJ7E 5MENE 3BN9D 1HWGB 1TZHB 1MAKA 5KJRH 5C0ND 4HUVB 4ZXBD 3MLUH 3LN4B 1MFBH 4NZTH 5ANMA 1SQ2N 1OAKL 3D85A 3S34H 4P2QA 4CDGC 1CF8H 4OCYL 12E8L 1TTGA 1XGQB 4EZMA 3DX6A 2ADJB 4GFTB 4OD1L 4HKBB 5J11C 3ZYJA 5KVEH 1U36A 1JMZA 5GGTA 3H9YA 3FOLA 1MJJB 1ND0A 4KGLA 1URLA 3T8XA 5HXMA 4OZFG 1R3HB 2BDNH 5GJTH 2B4CC 4DKAA 2ADJA 2FO1A 1RFDL 3RIFF 2AEWA 43C9B 4PRAA 3S7GA 1F4XL 5AD0A 1G9MH 5ANME 5I66A 1G6RA 3PQYB 4ODVL 3BEWA 1LK2B 1YMMA 3PWUA 3GHBH 4ODHL 3I85A 4XCFH 3QDMA 1RULH 4JFDB 4XP9H 1A14L 6FABL 3DRQA 4XCNA 2J1KA 5D96C 3VXNA 4Z7VB 5JPNB 3HZMA 4LGRB 3QG7H 4LSUL 3DXAB 3UYRH 5F71A 4PJ5E 4DW2L 3G6AB 3CFKB 3K7UA 5F7LB 3AAZA 1TQCC 2DMCA 3DRQB 4XCNB 1EJ6A 4X6BB 2HFGH 3KS0H 1EO8H 2DJ4A 2HKFH 4NFBA 4OZHA 4QHLB 4Z8FL 3Q6FA 1G6VK 4I4WB 3OB0H 3HMXL 1CFVL 3CUPB 4G3YL 2FIRT 3SOBL 4NO5A 4X4XA 1YPZF 2HKHL 2BSRB 4UQ2A 1S7RB 3MBXL 5CP3H 3TVMB 3IT8D 2BNUA 3T2NH 4JO4H 1A4JA 1GGCH 5FYJU 1IC7H 1KJMB 1OAXH 3RIAF 5HVHC 4LOUD 1LO4H 3BQUA 3VWJA 4N5UA 2QKIB 1D5MB 1A7BA 4N1CA 2YKLH 1I8KA 2NY6B 4LKXA 1IARB 3BEVA 5IK3A 3V4UH 1UCBL 1JF1A 2VLKE 3D9AL 3KYMB 4M8VA 3V79C 2FEEL 1U8QA 3KWWB 1OGAE 3ARYA 3C6LD 5ALCL 5D1XA 5TDPB 1S7TA 4C83A 2V2WA 4PRPD 3RY5A 5DVLA 1IQWL 2AJYL 4YDLC 3FT2B 4LSVH 3QIUA 2X4NA 1RZ7L 5BW7A 5IB5B 5AAWA 2BVOB 4P4KD 2BK8A 2Y36L 3V5HA 4W6XB 1X5XA 4OGYL 4PRPB 4PB0L 3KPNB 5EA0H 2C4FU 3OQ3B 4PB9H 2AGJL 3ILPA 4JN1H 4P3CL 1NQBA 4EOWH 1GGUA 3FONB 1IC5L 5FYLL 5E6IC 5I1JL 1I9JH 1CK0L 1ZHLB 4Y16C 4U6VL 5E99L 4L5FL 3EO9H 1EDQA 1G9MC 2JIXA 2PTUA 2BZDA 1YMMB 3NIFE 1PVHA 2DQCL 2VWEE 5I1EH 3MODH 5KSAC 5JTWA 4EN3D 4ELKA 4WW1A 4Y1AE 3WFHB 2P48B 3MV9E 1EVTC 1M7IB 2FHCA 1I8IA 2JCCE 4PLKC 4HWEL 1AP2A 2HTKD 4OLZL 3A6CH 2LE9A 2X41A 1INQB 3SDCC 4BZ1L 3Q1SH 3KPSA 4HJGA 1B4JL 5LCVH 1JPTH 2P1YA 1T0NA 2OR8A 2DM3A 3EYFA 3W11C 4DKEL 2XWJA 5C0FA 1RZIB 3O4LA 5A2KH 5GRVK 5IFJB 15C8L 32C2B 1A4KA 2ZUQC 3GM8A 3BQUD 1IEAA 3LRGA 1REIA 2EDQA 2JJSA 5EBLB 3IVKA 2ZWLT 3S37H 1PKOA 4QF1B 1W8OA 3LQAL 4GXVL 1U8NA 3ZDZE 2ITDA 5E9DA 3HE6D 5F9DC 1Y0LA 1I3GH 3L9RB 3M17B 1SBSL 1CYGA 2ICCA 1GAFL 4XC1L 5F1NA 1DQJB 2J7LA 1IILE 2ZSWA 3D69B 3G5YA 3LKOA 4XPHH 2VR5A 3MCLH 3MRPA 1NDGB 2GKIA 3B9KD 1ORSA 4WI7A 2V9TA 1LDPL 3QUXB 2E6JA 4HK0B 5EU7E 4HIHA 1R5WA 5D7SH 2F5AH 3RUGE 4JJHA 3VXOB 4ZUUA 4XXDA 1JPFB 5B38A 1BFTA 1A3LH 3PWNB 3LRSB 5GHWL 1N3NA 3RVVD 5JLZA 5I1KH 4HGWB 4WV1B 5JA9A 2VIRB 4PJDB 1BLNA 2PYED 5DC0A 1II4E 3PGFH 4NWUL 1EVUA 3RVUC 3THML 4HGMA 4ZUUB 4JKPH 4MX7B 4WEBL 3PWNA 1UADC 3BHBB 3QUKB 4LRIA 5CEZH 1JGLL 3VI3E 3F7PC 2Q87A 3ES6A 5C07A 4H20L 1CLYH 1YEHH 4W4OA 1UENA 4AL8L 3FONA 5DMKB 2XZQL 1OSZB 5E2VH 1MCHA 4PFEA 3CFEA 2GSGB 2X4PB 1J5OL 4L8BB 4HEPG 2BHZA 3SE9H 5L6YH 4TSCH 5TQ0L 4ONGH 2P5ED 4J4PC 3GMNA 4JFXB 2MCPH 1IT9L 1SJEA 1DBMH 5HHVH 3P3YA 1ZS8B 2XZCH 3O0RH 4IJ3B 2R0WH 2KQNA 1NGQL 3TJEL 5JIHA 1CXFA 1UXWA 3PXHA 5J3HD 1K6QH 4G6AD 2Y9RT 5IFJA 3EOAB 5E8NA 5ICYA 3U48A 1J1XH 2HT2C 4Z7VF 3RNQA 5IJVA 3I75A 3QZWA 3WFBH 4FQXA 4M62L 3FAWA 1RHHA 5DDHB 1QFOA 4IJ3C 3F12A 2R2CA 4OFYD 5DUPL 1AI1L 1IGJB 4K71B 3BVNA 3B2VH 4Y4KC 1YNKH 5HYSA 2H26A 3VH8G 5FDWA 4G8EA 2H2SD 5EZOL 3WD5L 1T21B 4HW6A 3S98A 3FHQA 3GMLA 3L3JB 1MFNA 1H8NA 4LCCB 5AG8A 3NCYS 1JZ2A 5C0BB 1X5KA 3PQYE 1WEJL 1CFQB 4R97C 2PYEA 4P9HL 2X7LB 1AGDB 2BVQB 3ARDB 3I50L 4JZNB 1I1CA 3MRFA 4EBQH 1RUAH 1U8PB 5M94B 4I9WE 4IOIA 1Q0XH 2FR4A 2PYEB 3QIUC 1ZTXL 4Y5YA 3RZWA 1D7FA 3WE6A 4FP8L 2AEQL 4U0RB 5JUEL 3QDGB 1NEZG 1NCTA 2N7AA 2Z91A 4QXWA 3OKOB 2Q6WB 4LCCC 4DAGL 4PJEA 5EO1A 2VLJA 3MRLB 1Q72L 1DSFL 3KPOB 4L8SC 3IDIA 4ODXB 5MEQA 3GJEB 5I75B 1I9RH 2X4UB 2XKSA 2GJJA 3RWHB 3SKNA 5B8CC 2VZTA 3QQ4B 4FXGA 4ZS7L 1DQLH 1MHCA 5HYJB 5FUCE 1V7NH 5E0QA 1HXMA 1JZ5A 1A5FH 4WDIB 5T1MB 1Q94B 5BMFL 4NDMA 5DR5L 3QR2A 1GPOH 1BOGA 1FGNL 3DO3A 4JFXA 1WCBA 1A7RH 3EYSL 3W0WE 5DVKA 1J05B 1R5IA 4FQPA 3RU8L 2CKBH 5DJAB 5DFTA 5C0CD 4PLJC 1ZAGA 2FX9L 3LRHA 4N0CD 4I18B 2OBGA 3QCTH 2VR9A 4IRJD 3P0YH 4GG8B 2CIKA 5FOBB 4TNWK 1AD0A 3MNZA 4G43B 5IQ9A 1RJCA 3MOQA 5ENWB 2A73B 3KYNA 3C8KA 1ZE3C 2XY2A 2R9HC 4PP1C 1XR9B 1AD9A 2DL2A 2V5TA 1T3FA 2I9TA 1U58B 3EYOA 2FB4H 3P77B 4LSPH 1A02N 5HYQA 1VKXB 2DTMH 1S8DB 3ZKQD 1XIWC 5LG1A 2NTSP 2B20A 4WI8A 3L3HB 1EEYA 4GLRI 3SQBA 4PRNA 3NTCH 2WQRA 4X7DC 1BQHB 4M7ZC 1AGDA 2BVQA 4JZNA 5CD5D 4X5WB 4ORGA 5DZLA 3OXRA 3VMOA 3TIDA 1NSNH 3U36A 1KEGH 2FH8A 3C6LB 3T08A 2DQUH 3BKJL 1ZLWK 3FTGB 4D2NA 2BSRA 3P73A 2IG2L 4ZD3H 1BVKB 3DWTA 3U36B 1G7PA 4I0PD 2P4AB 3E2HB 3NAAL 4TVPH 4LVEA 4KUZH 2WBKA 5DD6A 1KTRL 3O41A 3ARVA 4M1CC 5IVXE 2Z35A 1PG7L 1CF8L 2LAGB 4W4OC 4OF7A 5ISZA 5IEHA 3W0WD 1XGTB 1FZOA 2DBLH 1A7NL 4OZIF 1I85A 1Z9SA 2G9HA 3G5ZA 4M8QA 4FNLL 1AO7A 1AGFB 2ZZUT 1J0JA 5FM5M 5IB2B 3CZJA 1JPSL 3FO0H 1TVBA 4DVRH 8FABB 1D5BA 2NW3B 4FG6C 3GBMH 2BOCB 3H9HA 4Q74A 5F72S 5AYUL 3AS1A 2AQ2A 4POZC 4AIOA 4ODVH 3JV4A 5SX5K 2V2XB 2XV6B 4YPGB 1TTFA 3SO3C 3SO5A 3GHBL 4ODHH 4U6XB 3UTPD 5DHYB 5FK9A 4ERSL 4MYWB 4ZOAA 5I15H 1KEMH 2IH1A 2MKWA 2XWTB 2BOCA 5DS8A 1I3VA 1HHGB 3SBWC 3MJ8B 3VXUD 4YXLH 4OF3A 2Z0BA 4DW2H 3LZFL 3PWLA 5IROC 4GRLC 5F7EH 5DHYA 4EJ1C 2AI0L 4R7NA 2C3WA 2JE8A 5IF0A 1FV1B 5FM8A 5B4MC 25C8L 2MHAB 5DD3L 3TV3H 2XI9A 2DJUA 4G42B 4MNQA 5C0JB 2UWEE 4IDJH 4FZEH 4ZUSA 5KW9L 1KELH 3GIVA 1XR9A 3U0PB 3HLAA 1S9XB 2G75A 4YO0A 5DJ6A 5JQHC 2Y6SC 3VWKA 1OAZH 4PY7A 2R56H 3MBXH 1DUZB 3U30C 3ARUA 4N1EA 5M7QA 1IMHC 2G5RA 4WNQA 4L8DB 1TZHA 3D2UA 3QDJA 3IGAB 3PL6B 3S37X 4XBPB 4FQIL 1U6AL 1H8OA 3ARFB 1CFBA 1NDGA 1I1AC 3RVWC 4KDVA 4P9MH 5E6ID 5BV7L 4JY5L 4U1GC 4L8DA 2AAVA 4LCUA 3PABB 1OF2B 3MXVL 5ALCH 3TH4T 1W0VA 1NUDA 3M8OL 3QJHB 2WP3O 2VDOH 2DQHH 1FAIH 4HF5L 2AJYH 4KPHH 4LSVL 4JG0H 5H8DA 5HPOA 1WZ1H 5FYJD 1NANI 3MGTA 4GS7C 4JREB 1W0WB 4MDJB 4WEMB 5EN2B 4M9PA 3MOAL 3QCUH 1EFQA 5F96L 3BHBA 3BGMB 1ZGLP 1WBXB 1S5IH 2YHGA 4X9FA 5K93A 1DN0A 3T2PA 3V7MA 2BRQA 5IGXL 5MEPA 1T03L 5AD0B 3F7YB 4U6VH 1CT8B 1SM3L 1X5ZA 1S78C 4I3RL 1IEBB 4LMQE 4LLQA 4LLYB 3FFCA 3PWLB 1OM3H 3MODL 3ARGB 5L2KA 4KVCL 3T09A 3ZO0A 4OM1L 4K9EC 2DQEH 4L8BA 4M6AA 3NZHH 1K2DA 5DJ8B 5DJZA 2VXTL 3TFKC 5DRZA 3ZKXC 4LKCB 4IMLB 3INUL 5FYLD 1BECA 1DVFD 2YEZA 1DLFL 1P6AB 1FNAA 3QDGD 2VQTA 3MJ9A 4OCSL 3GIZH 1RV6X 4A6YB 4KTDH 4ZSOB 2ENYA 2QHRH 1QR1A 2EE3A 5DEGB 3IU4H 2BSTB 3QFJE 4HS3A 1YEDB 5I1DB 3IJYB 3CUPA 1I3RB 4G6MH 4XCYB 2CDGA 1RHHB 3X3FL 1CU4H 5IG7B 3JUZA 3RFZC 3MLVH 2VR4A 2EDYA 2ATPA 2IPTL 2R29L 4Y4HA 4CW1A 1CG9A