3DO7B

X-ray structure of a nf-kb p52/relb/dna complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
293
structure length
293
Chain Sequence
b'GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRDSDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*DCP*DGP*DGP*DGP*DAP*DAP*DTP*DTP*DCP*DCP*DC)-3'
publication title NF-kapppaB p52:RelB heterodimer uses different binding modes to recognize different kappaB DNA
rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 41
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00554 RHD_DNA_bind Rel homology DNA-binding domain
B PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3do7B02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 3do7B01
2HVKB 1NBVH 1ZLSH 2WV3A 2AQ3A 1T21B 3FN0H 5DJ8A 4F7TB 1XF4B 3B9AA 1V3MA 3DGGB 1OTTC 1PQZA 4LCUB 1HQ4A 1X44A 3VRLF 4I0PD 4WJ5B 1KB5A 2IPTL 3O41A 3BZFB 2WWKT 3HPJB 3IFOB 3DYPA 1OB1A 3LY6A 4LSRL 4EKXA 1A22B 25C8H 4PJEF 3ARSA 3OKMB 4OTXL 4K7PH 2DD8L 3SY0B 3STBA 5DRNB 1JGEA 3MLUL 3HZYB 5K59E 3QIWD 4MNGB 5SWSD 3OR7B 1WFTA 5M95B 4TUOA 3RIAK 3LQZB 3Q6FA 4UIKL 4Y5YC 4Y5VA 3VGFA 3RA7H 1S9YA 2F5AH 5FHAL 1J8HA 4KHTH 4P23C 1UGNA 4XP9L 2VXVH 3E2HC 5I73C 1HI6A 4EXPX 3QDGD 4RWYH 1KB5H 1M7XA 4N1HB 4CN4A 1VGEH 2R2BA 4K9EH 5EUKB 4NUJA 4X7SH 1A6WL 2W59A 4GG6F 4XMKH 4FFYH 1A6AA 4BUHA 1RZKH 1JWMA 1GGIH 1DJSA 5BVJB 1MHHA 2YD1A 2VO5A 2YEZA 3NCEB 4JN2A 1DSFL 1QA9A 1CT8A 1Q9OA 5ECJE 2R23A 4F2MA 5JHDA 4WI8A 4LCCA 4WFHE 2DQJH 1T20A 1ZT4B 2E7CA 2BZDA 3QUZD 3SDDB 1XCQB 2Q6WA 4OFDA 1FN4A 3QIBD 4DZBA 1K4CB 4CU7A 5F1OB 1M7DB 5E00A 1KTLA 2KUTA 3G04B 4D3CL 1AQDB 1BECA 3UTSA 5D1XB 1CFTA 3O11A 1DTUA 1BZ9B 3MYJB 2O61A 2X4OB 3P73A 5EC2B 4WNQB 4PJHE 3VXOA 5TH2B 3U36A 1VESA 5HHOE 3P0VH 1F3DH 4ZFFA 4GXVL 4CJ1A 3AM8C 2CGRH 5DTFB 3R06B 4Y1AA 5FA3A 4G42A 4JO1L 3H9SE 1BVLB 1P7QD 1L7TL 2JJWA 1ADQA 4JRWA 4MXVE 5EOCH 1LE9A 4KK9C 3V7MA 1YY9D 5ICXA 1N6UA 3NN8A 4GKNA 1KTDB 2L4OA 4C4KT 3MUHL 3GIVB 4HG4K 2ESVD 1XF1A 4PP1C 5L2KD 4RGNE 5KVGL 4FXLA 4BQ6A 3VFGH 4Z95L 3BUTA 1HXYB 2V5MA 4PREB 2VUYA 3FB8A 3QFJE 1P6AB 1RZ8A 4F7PB 3F58L 2RR3A 1B4JL 2JCCB 2IWGA 3LS4L 3M8OL 4ODUA 4NZDA 4B5EA 4J4PD 1CQKA 2P8PA 1FYTA 5JLZB 3KPSE 1ADQH 2OR8A 3EO0A 3GMLA 1OL0A 5JNYB 4FMKA 3UTOA 4HF5L 3S97C 1E6JH 2Z93A 4JM2B 3KYMB 1MRDH 5I1GH 5IJKC 5E5MA 1U36A 4PJFF 3I6LD 1CFSA 1GPOH 4LNRA 2DS4A 3QCVL 3D6GA 5DR5L 1JN6A 4OB5H 3AAZB 3RWEB 3EYOA 1FO0A 1CF8H 3JWDH 4HCRL 3VCLA 1UURA 2Y5TA 4PRAA 2VLJE 1ZWIA 4EXKA 3HR6A 5FECA 5HXMA 3UJIL 4AMKL 4Z7VA 1AHWC 3I50H 3MMEA 5K93A 1J5OL 4HGWA 1MFBH 2CDFB 5M7QA 1OW0C 5GZOD 3WD5L 4X4XB 1XR9B 1BJ8A 2B1AL 1MH5B 2ZPKH 5GJTL 2NY5L 2HWZH 5K9QI 4KTDH 5BXFA 4R96A 4WEUD 3D39B 1YMMA 3T0WA 2FYYA 3KYAA 3GMOB 2V5SA 3S34H 3RNQA 2OJZL 3O45B 5F70A 1AP2B 3KPQB 5CUSH 4QOKE 2GIYA 4I48A 4I18B 5CJOL 3H7BA 4I9WE 1C16B 2OR9L 3G6AB 3NCJH 4NM8H 4H20L 3QNXB 3B5TA 1SM3L 2AXGB 4PG9B 3SDDD 3BJLA 5IW1B 1SMAA 3D85A 3DGCR 5C70A 1W72L 3MSPA 3I9GL 4DQOL 3C5JB 1ZGLP 5D1XD 4Q6IC 4Y19E 1YNKL 4UBDD 1BOGA 4YDJB 4J3VA 5ITFA 1ZHBA 5DHYA 1MFDL 3RWFA 4HGMA 4KHXH 3EJJX 3FO0L 4UIMB 2CLVB 3V7AG 1F58L 1IAOA 5T1KB 4LSPH 1YQVL 1A1NA 1QRNA 4FFVD 3V4UH 2AK4E 3PXJA 1RZJC 3MV9B 5TDNB 2K9UA 1A9EB 1ZA3B 3SDCB 4PG2C 3BIKB 1KCVL 3WKML 2XZAL 4MJ4A 1CLZH 4Y4HB 4TUJA 5IW6B 4S1DD 4NZTH 1UH3A 3EYVB 3G6JA 3BWUC 4HZLB 1U8IA 2ICEA 4M5ZL 3ZE1E 5LQBH 1WQVT 1MELA 2F74B 3GI8L 4L8SA 1LQSR 3I6GB 5HGDB 1CGXA 4DAGH 1KN4L 2E7BA 2A1WL 4N8VB 1BFOA 3MROA 1RUPL 4PJ9B 5T3ZD 2VN4A 5C0BE 3VW3L 1G7QA 4MQ7B 1AGCB 4LARL 3ZLQC 1OAKL 4JKMA 1DUZB 1MUJB 4ZODA 4XXCC 3HS0A 1DL7L 4MMXC 2RFXA 3TBTB 4AH2A 4FP8H 4MXWH 5FUZH 3O9WA 4M7JL 3K74B 4F57L 4LPYA 3QI9A 3RAJL 4OCMC 4P4RA 1ZVSA 2AV7A 3MRJB 3WS3B 1W0VB 2DI8A 1QTYT 5F9DC 4K94L 4IRSB 3KHOA 4HIHA 4KQ4H 4YXKH 3U0TB 1EHLH 4L3CB 4P3DB 5FO9B 3KPLB 1IFHH 1ULVA 3WNOA 1P4BL 4M7KL 2IH1A 5SWSE 5JXEA 1JV5B 4NSKA 2RCSH 4KVCH 4ZFOA 4X6CF 2GUOA 2XZCH 5IVNA 2FIKA 4M5YL 1IGTA 3QNZB 4XI5C 1FLRH 1A3QA 2HP4A 4JM4L 5DQJB 4OZFH 3D39D 4X80H 3PWJB 4EBQH 3BN3B 1ZT1A 1NJ9A 2R0ZL 1HH9A 2OCFD 4LLMB 1G7MA 2VLRB 1R3KB 3D3VB 2NYYC 5DI8A 3ARFB 1TZIA 3AY4A 5IF0A 4WUKL 4PJCF 4OF7A 5HHQB 4PY8I 3EYUL 1Z9SA 1ZAGA 1G9NC 3RWDB 4APQA 4YDVB 2GJZB 3SGJC 1YC8A 1EEUA 2HJFA 4WIQA 5JW4M 2PKDA 5L88H 5ALCL 5HYJA 4Z6AT 5HVHC 3WSQL 4R6UA 3VXTB 1KLUB 1CDUA 5K9OB 3VMOA 3U0PB 5FYJD 5KZCB 4TPRH 2AEQL 5E94B 4J12A 5T1MA 4MQXC 1MCLA 3R0MA 3NVQA 3BGFC 4DVBA 4ZO7A 4NT6B 2CKBL 2CMRL 5EU3B 5I75C 3RX8A 4AM0B 1IT9H 1PKOA 5T1KD 1BQHG 5BOPA 4KTEL 3QCTL 3KJ4B 3GMRB 2G75A 3F7VA 5C9JB 3S36H 3WHE1 4U1MB 1MCCA 3BDYH 3U0WH 3MV9D 1BVKA 4YAQB 2OQJA 1CFQB 3SDCD 5LGKA 1U8OB 1OY3B 4Y4HD 5DJZA 1NCNA 4K55A 2MHAA 1WTLA 1NFDE 4JDZA 4C56A 3VFUA 1NH6A 1SY6A 2HN7A 4KJWD 1LK3H 4Z18A 3V5KB 3K1KC 1C5DB 5L2KE 2J6EA 5D1ZA 4ZFZB 3K2UH 2FX9H 1M6OB 2XQBH 1U3HB 3S37X 1T2XA 4G9FD 3ZDYE 5IB2B 4PJ9D 4DVRL 2QADC 5D7JA 4G5ZH 5HPMA 3LS5L 2D7MA 4QXTA 1Z2KA 1U3YA 1YEDB 5B3JE 4DZ8A 1IKNA 2BHYA 3S3JA 5BV7B 1JNLH 4RA3A 3VFWB 4L8DB 5BO1H 1YYMH 1T5WA 3C8DA 2J1KA 3SQBA 1XIWB 2PF6A 1BPVA 5DRZB 1SY6H 2NXZD 1G6RB 1H15A 3R8BB 1VA9A 2AABL 2GFBA 5ADPL 4R97B 1TQBC 3I6LE 1A7OL 2J6EH 5E03A 5EBLB 4DKFH 4PJEA 4M43L 3CC5B 2WZPD 3L3OB 3QG6A 4IRSD 5KSUA 3RKDD 1ZANL 2NZ9D 4O4YL 1CBVL 3SO3B 4KUCD 3WLBB 4JZOA 4HIIB 5CJQL 1F6LL 2IPKA 4UNVA 3TPKA 2G5RA 1XCTB 5TE4L 2UUDK 2VZOA 3V6OE 5I16A 3QG7L 2ENSA 5IVZA 5SWZA 3CUPA 1DVFA 4M62L 1S7WA 4LFHG 3RGVA 4C55A 3GO1L 3IETB 4GG6A 1FFOB 4BK4A 3T8XA 3NAAL 4BFEA 1ROWA 1XGYL 1DLFL 3TVMA 1JUFA 1BQLH 2VLRD 2AJVH 4P57A 3SGDH 4QLRA 4BQ8A 3TA3A 1BEYH 3D3VD 2Q76A 3OTTA 4Y16B 3ARFD 1I3VA 3VWKA 2GTZB 3SKMA 1H3PL 1HSBB 3SDYH 1MCEA 5A16A 4OI7A 3BEVB 3REVB 1NCBL 2OL3A 4UILH 1D9KB 4HUMB 4K3EL 4RGNC 1KCSH 4Z7UA 4KC3B 1RZFL 4QWWD 2RBLA 1K3IA 4P5KA 2R0LL 2IADA 2W9EH 3CVIL 5KZCD 3FMGH 2HMIC 4B53A 3TT3H 3JTSA 3KVQA 2FH6A 2HH0H 2EEBA 1CFVH 5TFSH 5AWNH 3BH9A 3UTQB 1AXSB 1G1YA 3P4NB 3QIUC 3DX6A 1SEBA 4GW4B 1KJ3L 2AGJL 1S78C 3U7YL 3EAKA 3RWJA 2A83B 5IMMB 3PNWA 3KYNA 4X4MA 1IZKA 1AI1L 5HVWA 5FYLH 4LGSB 4JHZA 2W9DH 3V8OA 1C7TA 3UDWA 3D87B 3RVXC 3GB7A 3MRKA 1EIBA 4Z0XB 3WBDA 4CVZB 3UYRL 4NQDB 1I9IH 4ONGH 5L9DH 3ULUD 4PR5A 5F21B 3O3EA 4ISVB 4P59L 3CFEA 3FZUC 2CRYA 2Y9RT 1U8MB 3MOBL 5MERB 1U3HD 3LSOB 5I8KH 1TJHL 1D5IH 3ARRA 3BPOB 5K9JL 4FQHB 4WGWB 2JCCE 1RK1A 1ZV5A 4ZAKA 1J1XL 3HZKA 5DD6B 4ZXBA 1A1MB 5T3ZE 4JB9H 1FC1A 1J7VR 2X4RA 3MODL 4OFPA 1BGXH 3MLSH 5JORB 2DQIL 4MCYB 4CMMA 1XIWD 5HYQB 2ITCB 4N8CL 4PJFA 1MOEA 5IB4A 15C8H 1BZ7B 4K71B 4XC1H 4EZMA 4D8PB 4YHYC 3P9MB 1E4WH 1JPFA 1OQOA 2BSTA 3HNTL 3IDMB 2EO9A 2YK1L 4PFEA 1KXQE 3W9EB 4FQCH 3WFCL 3EFDH 1U8NA 4PGBB 5EO0A 1UWGL 3KPMB 3LPGA 3IKKA 2K3TA 3C5SB 1MHCB 2R2CA 1ZLVH 4WI7A 5T1DL 1U92B 1FBIH 2D4FA 4MJIA 4LVOB 1QP1A 3X12B 5JDJA 2NX5B 3ARXA 4JY4A 3V6ZB 3OG4B 2WP3T 1ORSA 1H0DA 4HKXB 3TT1H 3FQUA 2PXYB 2I25N 1NFIA 1JPGB 3MNZB 4NPYB 4NHUB 1K8IA 2A6KB 3T77A 4Q2ZB 4B41A 4E9LA 1SBSH 4G6KL 4TSCH 4ERSL 1CGUA 3K2MC 1A5FH 3GSUB 1PBYA 1DLHB 3D39E 4RZCA 1A7NH 2VZUA 3ULSA 4Y16D 4WO4B 4NNYB 1ZHLB 3MCKB 3WE6B 4O2FA 1XGQB 4XP6H 5F6HI 4JLRA 4E41B 4RX4D 2D4DA 2X7LB 4R8WH 2PW1B 5FDYA 3QAZB 1UZ8A 3JWOL 1CGYA 2CDEA 3NCMA 1D9KD 4I77L 4PGEA 1JMXA 2B1HH 4WU5A 3FHQA 3ESUF 3VXNB 3DMMA 1L7IL 3KPPB 3FB6A 4EI5B 4A6YA 5ACZA 3G5ZB 3P30L 5GISH 3ZKXB 1DN0B 2IBBA 4KROD 3WN5C 2V2XB 1X5IA 4N5ED 5FYJE 1REIA 3KWWB 1H8OA 4WFGD 1X5GA 1UCTA 1T2JA 3C8KB 1N0LA 4HBCH 5E8EA 4H1LH 5H35B 2CH8A 3NTCL 4CDHA 1CN4A 1ZVHA 2P1YA 4I0PC 4JKLA 2R29H 2CK0L 4LMQI 4OCWL 2ZUQB 4NQEA 1B9ZA 3IYLW 5CS7A 2ZSWA 2C1OB 4A6YH 4XMPL 1W72B 3MV9E 4YPGB 1ACYL 3IJHB 3P11L 5C0CA 4GKSB 3BP7A 4NQDD 2H1PH 3QWOB 1JZ7A 2AXFA 1UQSA 1UVQA 4D0BA 2YZ1A 3IDGA 2EDXA 1H3XA 3C08L 3QIWC 1GGBL 3QNYB 1ND0A 4Y4FA 5DK0A 3HI1A 1N7ML 1NBQA 2IALA 1IQDB 1YNTA 3NZHL 1WEJL 2BSSA 3AS3A 3BXNA 4K8RH 4LEOA 4QHUB 3HRPA 4UDUB 3IF1B 3BSZH 5D2NB 5KSAB 1JWSA 4TSBL 4OAWA 1X3DA 2ZUUA 5J1AB 3OPZH 3BZDA 1A3RL 3MGAA 4QRQB 5E9DA 4HBQA 4DKEH 4NN6C 3SE3A 1U42A 2OM5A 4KU1A 4JQIH 3O3AB 1RZIB 3ZDXF 1NL0H 1U0QA 4OLVL 3ZYOA 2X44D 1KIQB 5GJSL 5C7XH 3QUZC 2DJ4A 1P7KB 2R8SL 3DVFA 3QIBC 1E4JA 4WWKA 3T4YB 3O2DA 1AXTH 3MCLH 1A9BA 4LAQL 4AEHL 1DUYA 4OLZH 3LZFH 4NQXA 2DN7A 2NX5D 3EUUA 4DWHA 5C0IB 3MJ7B 3PGDA 4WRLA 2KPNA 1CI5A 2DQHL 2VAAA 5FUOL 1U58B 2UWEF 5I8EA 3C09C 4X6CA 2IFFH 3LEYH 2PXYD 5ANMA 4O5LL 3NCBB 4PRHA 5DS8B 1YECL 1MAKA 4OUOA 1IGYA 2Q7NA 4HIXH 2IFGA 1KC5L 5BS0B 5C08A 2VQ1B 4WO4D 2ILLA 5TPWH 3Q48A 4CADA 2VLRE 1LD9B 3MO1B 3FOMA 1EK3A 3D3VE 4PJCA 1A7PL 1C1EH 4E41D 3O2DH 4U6VL 4GRWF 1YY9C 5I18L 5F9WC 1SJEB 4OD2B 5DDHA 2DTMH 2XIDA 4MGXA 4D9LH 5AG9A 1UXWB 4WHTB 1UT9A 1CK0L 4XAWL 1R3JA 1S7SA 1LO0H 3CH1B 3TH3T 2WUCH 1RJZA 4EI5D 4Z8FH 4ETQB 1J0YA 1OM3L 2F19H 2MQCA 3U6RB 5IK3A 3CXDL 3UX9B 5I1HL 3WHXB 4J3SA 5GRWA 1F6FB 2I5YL 4CJ0A 1RUKL 4J4PC 2V17L 2XQYG 3U4EB 3EBAA 2XTJB 1A0QH 1PGRB 4GAJH 5ICZB 4HUUB 3EOBA 3ROOB 4JE4B 4RRPA 4ONHA 3FN3A 3FRPG 1EAPA 5TJWK 3T2QA 1MWAH 5GRUH 2OTUA 1T6WA 4OFYA 3X3FL 4JO4H 4ZUUA 4G43A 3QISA 5E6YA 2FJGB 1TZGL 1WIUA 5FDWA 4UU9B 2BVQB 2GT9B 4M6NH 4PGCA 3A6BH 2HT3D 1J9CT 1MHEB 4KI5D 2BK8A 3L5XH 3SKNA 4X6EB 4NUGH 1JZ4A 2HT4D 3KLSA 3EYSL 3NPZB 3BO8B 2YD5A 4YBQD 3SGKA 3ULUE 1UZ6F 2E8ZA 3JV4B 1V7MH 2X1QA 2CKBB 3UMTA 5A2LH 1IGMH 1TCRB 3V6OC 1KUMA 5GZOC 2B20A 1UXSA 3LMJH 4XBPB 1VFBA 1WICA 1T83A 3KPRB 1T66D 4XVJH 1HSAA 5T5NG 3BRDA 5HHMB 1I8KB 1VGKB 3VGEA 4QRTA 4NNXB 3K4DA 5A40E 1GZPB 4I1NB 5KSAD 3MA9L 1KPVA 5IBUG 5E5UB 1NCWL 2GKIA 3MRNA 5E4EB 3DTXB 1LO5A 2E7LC 4GRMA 1J1OL 5HYSA 4JG1L 5CLTA 5FB8A 5FCUL 4HWEH 1Q9WA 4YGVA 5EU4B 2EDTA 3VGAB 1S7RB 3N9GL 1T1ZB 5HYEA 5FEBA 3BE1L 4MCZA 2JLLA 4Q58C 5ILTL 3S5LG 4FQXC 4EDXA 1CDCA 5C0JA 3WEXA 5D1XC 2HVJB 4PJ5A 4GW1A 4LCIL 3TF7C 1U6AH 3PL6B 2XKNB 3UEZA 5CMAB 1Z0MA 2GYSA 4KK8D 4ODSH 5FHBH 2DI9A 3PP4L 1DQDL 5BS0D 3SCMA 1FZMA 4JFDA 4OCSH 1DEDA 2CRZA 1QLFB 2GK0A 3OF6D 4FFVC 4URTB 3ZTJH 4ZD3H 1NLBL 4HMCA 1XGUA 1J86A 3KPNB 5K9KB 3EGSB 2ZUVA 3HG1A 2P7TB 5KTEH 1GOHA 5FO7B 4HS6B 3K46A 4S1DC 1BWMA 1OT2A 3QUKA 1NEUA 4HX1A 2APXA 3MACL 2VDPL 2M1KA 4JFFB 4YO0B 4KZDL 1IEAB 1H3TA 4PJBF 2Z4QA 2J5LB 2WNGA 5MP6H 5KSBB 4M03A 3INUH 4YFEA 3CSYB 4X9GA 3IFNH 4JFYA 5ESVB 3T0XA 3PWLB 4PJXB 4P23A 4PJHF 2XTJD 3QXWA 4QRUA 3W2DL 4BSJA 4WFGE 5HDQL 2B4CC 4X98A 3S7GA 2ZUSA 3VFVB 1CS6A 1RZGB 1ZSDB 1OAXH 1JNNH 4X6FA 4JM2C 5MENA 3CFBB 4NO5A 1NGZA 4XCNA 1F11B 3MA7B 3OKNA 4GSDL 3RUGB 1HHKB 3DLQR 1KCLA 4JPKH 4JO2H 4YHPB 4YHOL 5DHVB 1U41A 3MFFA 3H0TB 2EKSB 1BLNA 4TVPH 3BKCH 5EORH 5DJDA 5FM5M 4RIRB 2OTWA 4HJJL 4G8FB 5FYKL 1EUTA 2VDNH 3SN6N 3U7AA 1MI5D 4NQDE 5DVKA 4TTGA 3OKEB 1HYRC 3N1FC 3Q1SL 1R3HB 4HWBL 3MC0A 1LEKA 2QLVB 5GGRB 5T5FH 5I1AA 3UBXB 4AENA 5CINH 4HDIB 3G5VB 4EVNA 3TPUA 3KPRD 2ATPA 4LHJB 1F8TL 4OFIA 1ZT7A 3L3GB 1FL5A 3G9VA 4POZD 4M6OL 4OUUB 3ZT5A 3HPLA 4LIQL 3C6SB 4G6MH 2FLRT 4JJHA 3HZMB 3T1FB 3AM8A 5E8DL 4ODBD 1QFUL 2VDRL 3ARTA 2R56L 4I4WB 1NUFA 3HC3L 1QACA 2ED9A 4U1GC 1MHPH 1H9VA 4I18C 2PW2A 2CDGA 4TNWK 5EO9A 3SGEI 2MNUA 4AQ1B 4KGLA 3D2UA 1J87A 5ALBH 1RY7B 2YBRA 3S37L 5CHNB 4OF5A 2WIIA 3TV3L 3CCHB 1YEFH 2D9QB 2I07B 5AZ2L 4PJ7B 2HA1A 5JOEA 1CLOL 4UDTA 4JANB 3H3KA 4TNVF 2NX5E 4XNQA 2DICA 5BZWB 3QEUB 3PL6D 3BRFA 4LPCA 3EOAB 5INCB 2CJUH 5CSGA 5EWIH 5CKAA 1FSKB 2P5WB 3W82A 3TCLA 3IGAB 43C9B 3KS0H 4HK3J 1S7UB 2WWMD 1KPRA 4F33B 5TE7L 4JRXA 2JB6A 2FBOJ 5ICYA 5EIQA 2L0DA 3ARPA 2P8LA 3G08B 5CBEA 4KMTL 1BWWA 2AJYH 2VR9A 1Q1JL 4NKDB 3SDCC 5B39A 4QHKJ 4DEPB 4Y4HC 2GTWA 4LLUA 4XBGA 1P9MC 3EJZD 1YUHA 2BY2A 4GAYB 5IVXE 5GZND 4XNXL 4P9MH 1MQKL 4PJGB 1QZ1A 3RHWF 4JFFD 4U6HB 1I4FA 4FZ8H 3OKKA 1AHWA 1VPOL 5A2JH 3V0WL 3VU2A 2VIRB 1DQMH 3EFFA 5J9PB 4ODTH 3UO1L 3V5HA 4AK1A 1LNUB 4J7RA 2PCPB 4PJ9C 4QHLA 1X5JA 5DQ9A 1IM9B 2W60B 4JHAL 4QTHB 5DQDH 1EXUA 4AEEA 4MB5A 3KLDA 4XCFH 2FD6H 1ZLWH 1I3RB 5IESL 4ZNEE 3IU3B 5L2JB 4JVPA 1I1RA 2OI9B 1MQ8A 1VEOA 2E9IA 1E6OL 5HDBF 1PDKA 1I1AB 3VXPB 4LRIA 4JRYE 1HXMA 2OZ4A 3X14A 5JW3L 1FGVH 3FN9A 4IRSC 5GRJL 3RKDC 2NZ9C 3QXTA 1KF9B 4KI5E 2Y7QA 1X5YA 4FFWD 1S5HA 5D96B 1YNLL 4BZ1L 4ODVH 4XZUA 4Q9QL 1FPTH 3QUMH 4EDWL 4XNMB 5C0EA 2IQ9H 2W65A 4X5WB 1GXEA 3H9HB 1MCHA 4WTZA 1J11A 2EIEA 1UKQA 4U1SA 4S1SH 2QEJA 1X5XA 1A7QH 2DKSA 1WVZA 4PB9H 4GUPA 2OZ4H 3P9WB 5D2NE 2F58L 3ARFC 1F3JB 5GGUB 4LQ1A 3U2SB 4JKWA 3LRHA 5B8CA 3AXLA 1U9KA 4FNLL 4C59B 4ACPA 5C07A 1B0WA 3MREB 4PPTA 1TMCB 5ENWA 1MJJB 3BH8A 3RL2B 3T65A 1HILA 1JI1A 4BJLA 4U6TA 3DV6A 1Z3GL 2XI9A 3MLPA 4QXUL 1HOCA 1U95A 5F3BA 5DJYB 4QYOB 5JMOC 3CVHA 2QJDA 1NEZB 1LDPH 3KNBB 3BWAA 4G8IA 4G7YL 3BZEB 2IANA 3MJGX 3PGCB 3R8QA 2P5WD 1H8SA 4EI6A 1T0MB 1RZJH 4XPFH 3UJTL 3ALXA 3CD4A 5I8CA 4WFEE 4O51B 1DBMH 2EE3A 4OCXL 2FB4L 3KJ4C 3WNPA 1KSRA 2XACC 2ADIB 1AD0B 5IG7A 3LKOA 3GNMH 3VJ6A 4Z7WE 3BP4B 3T0EB 1NGWB 1UC6A 3BZ4A 3MLXL 4QRPB 2X1XR 4R2GB 4NRZB 3ZT7A 3CVHH 4UT9H 3O3DA 1W8OA 5I15H 2R1WA 1X4YA 1MJ7L 4TTDC 3H3BC 4NQSB 3H3PH 4PY7B 3WIHA 3ULUC 4MA7H 5L8LB 2B5IB 5IFJB 4Q9RH 5A2FA 1U3HC 5IMLA 1NMBL 2BVOB 2VLKA 3IU4H 1QNZH 1LE5A 1INDH 5DMKB 4AYFA 4GRWH 4PD4K 1Q94B 4M8QB 3TWCH 1I1YA 5BV7C 1EJOH 3GKWH 3HE6A 5E2VH 1A6WH 3GSNL 3VGHA 2IC2A 2D03L 5EBMB 1XIWC 4QRSA 4OZIF 1T03H 4KAQL 4LSTH 3WIHH 5HHXL 2PTVA 4OKVB 4R97C 5JMRA 1UWXH 4HLZG 4K23L 1I1AD 4UUJB 4KKCC 2EIZB 4DGIH 5TDOB 4H26A 1BBDH 3SO3C 2EICA 3O4LB 3CDFA 4EN3B 1VSCA 1RMFH 1MFAH 3T3PE 1KBGL 3MBXL 4BKLB 3NFSH 4D3CH 1G9ML 2DQDL 3RVWD 1P4LB 2GCYA 3OZ9H 4P4KB 4WY7L 3CSBA 2X41A 2VJXA 1HIML 4LSVL 3W0WA 2P5EB 3BX7C 4XX1E 2ZNXA 3WFEL 2HYMA 5HHME 3U82B 1JPSL 2C3HA 2MFNA 1I9JL 1ZHNA 1C5BH 3J8F7 2O5YL 1G9NH 4Y16C 2MWCA 2KZ1B 4CVXA 5DFTA 3X3GL 1XF2A 4M6ML 4E0RA 1IQWH 1J0KA 4D0DB 1DBAH 3N85H 2OK0L 1OGAB 1ACZA 3RNKB 4KKNA 1BFVL 1IM3B 5FKAA 4QF1B 1D9KC 1MPAH 2BMKA 2FATH 2MSPA 5KG9B 1TIUA 4FABH 2BY3A 1X4XA 2CD0A 1TZHA 2LV4A 5E2UL 5DJCB 5H37G 1CGSL 3ZE2F 4N5EC 3DVNB 5MEOA 3MLRL 4AG4L 2PTUA 3E8UH 3HAEA 4YLQT 5EU5B 1MCIA 5FIEA 5EIIA 1YN7B 1CG9A 5I2IB 3D25A 3MGTA 5FA4B 1IKFH 1F2XK 5C9KA 1QKZH 4P2OA 3MV8B 5EPMA 4ONOA 3FOLA 5F1KC 3IDIB 1YEGH 3BP6B 3UJJH 2I9LA 4ZUWA 2XY2A 1ZGLM 1JRHL 5KBNC 3T0ED 5D2LB 4QRPD 1GSMA 3FQNB 4R2GD 5DFWH 4O58H 5C0RL 3TM6A 1WBYB 3P4OA 5D4QA 5CSBA 3V4PH 5GSVB 1T2QL 3QH3B 3HAEH 4Z7NE 1P2CB 4LSUL 1S7XA 1NAKH 1RQ5A 2BFVH 3MR9B 1BQSA 1RK0B 3BN9D 5GS2H 4RBPK 4IRZH 3QUYA 5JPNA 2AQ2A 2EDDA 1OAUH 5F9JB 1INEL 3BPOC 5ERWA 3RPIB 1FJ1B 3LVEA 4PJHA 5D6CA 5GGVY 1T3FB 2A6DA 5HHOA 5CBAA 4PJXE 4L29A 4HIEB 2MKWA 3WXWL 2QL1A 4MB4A 2ZCKL 4U1LB 2KQMA 3SDXB 3CX2A 4D9RD 5HHPB 3HUJF 3L1OH 5FGBA 2QQKH 1KLGB 3VDAA 4ZDHA 1ZLSL 3FN0L 4K71C 1JWUB 3G5XA 3GJEB 4PY8J 3MFGB 1G7IB 2BY1A 4WW2B 1PKQB 5CJOH 2MPAH 4PS4H 3MRMB 5I0DA 2FR4A 1SM3H 2VE6B 4D0CA 4N90D 1JK8A 3O4LD 4EN3D 5L8JB 4NO0B 2MKLC 4LVOC 25C8L 1NAMH 1ED3B 2VABB 4P4KD 3QFJA 4ODHH 4K7PL 4M6AA 1MCQA 3VFRA 1Q9LA 1PYWB 2PXYC 5DJXB 1D5XB 3KPSA 5DZOA 4XBEH 2P5ED 1PY4A 3QQ3A 3RA7L 1FL6A 1IAKB 2F5AL 3QIUA 4KHTL 2VXVL 5C0FB 1MCPH 3BEWA 3TBWB 5ACMA 4WO4C 4RWYL 1KB5L 3EO1B 1VGEL 3JV0A 3L7FA 2AJ3B 4JM2F 1QSEB 4K9EL 4X7SL 4YGAB 2CIKA 4XMKL 4FFYL 2WBWB 1OGAD 1RZKL 5HD8D 3QXAA 1GGIL 3P77A 3QAZC 5LWYH 2VLJA 1NDMB 5D70H 4RRPG 4MHHI 4R26L 1BMGA 4JFQB 4EI5C 3PWVA 4DW2L 2DQJL 3ZKXC 1HDMB 2VL5A 2ITDA 3ZDZF 2LQRA 4PV8A 5IOPB 4UV4H 4PJ7E 1VFAA 2NXYD 4OGAD 2ZCLH 4HQQL 5FOJA 3RY6C 5FOBA 4ODXA 1J12A 3PIQA 2XWTA 1CTNA 2EYSB 4D2NA 3IDXH 5DGRA 4JFXB 1VADB 3MV8D 3MLYH 2VXQH 4UTAH 3PWPB 1NDGA 1G7HB 2PTTA 2J8UF 3ECBA 1YN6B 3P0VL 2ZUQC 4QOKA 4ZO8A 3TFKD 3DUHA 5F6IB 4TN9A 2CGRL 2V7NB 1OSPH 1GC1C 4Z77A 2ZNWA 4M61B 1IZJA 4U6XB 2HT3C 4KI5C 5EOCL 2XQYK 2HT4C 2YUWA 4HKJB 4PJGE 3HLAB 2GJ6A 4PBXA 4M4PA 4UINH 4EUPA 1E27B 4Y19A 2V7HA 2B0SH 1N5YH 1T66C 3VFGL 4P0DA 1RAMA 2X70A 1U8LA 2C4FU 1HH6B 3ZKNC 2UZYB 4ONFL 2QR0A 5D2NC 5JW4N 5KSAC 3EO9H 3WFZA 4LPTA 3VFSB 1ADQL 3GGWA 2ICWB 3RDTD 4X8JA 5CWSA 5JW5A 2AK4A 5CD5C 1W8NA 3ARWA 4JGMA 5AZEH 1E6JL 3SJVB 3EYUH 4EUPH 4MA1B 1MRDL 5I1GL 3OHXB 1N59A 2AXHA 1GPOL 5J89A 4O2CB 3LHPL 1BJ1J 3U9PH 3SKOA 4NO0D 4OB5L 5DYOA 1CF8L 3JWDL 4WTWA 2YUVA 3LOWA 5EZLB 4I2XA 1BZQK 5F3HA 2I9TA 5D7KD 2DOCA 3MRHB 1F13A 4M02A 4IOIB 3LAFA 3I50L 4LOUD 3F6LA 1E4XH 1BIIB 5C0BA 1MFBL 3LEXA 1EEZA 1RIUH 4HG4J 3HCVA 2ZPKL 3QXDA 2HWZL 4MJ5B 4KTDL 3VE0A 2ZOKA 1QSED 3B43A 2PETA 5DD0H 2M26A 1NC4A 3GI9H 1UUSA 2HJKA 4Q9BA 1JNHB 3TIDB 2NMSA 2GAZB 3S34L 4K7FB 1FZKB 4RFNB 5LCVL 1NKOA 4HIJB 5CUSL 3GZKA 1MREH 1K4DB 4WHDA 3NCJL 1S8DA 4NM8L 4WU7B 5EDXA 3V5DA 2QTEA 3FO1A 1YPZB 3MXWH 3VRJB 4BQ9A 3WNLA 3R0NA 3RL1A 1T89C 3QIWA 3ORJA 1A2YA 1NGYB 3FFCB 3C2AH 3AREB 1SQ2N 3AGVA 2AEPH 3PP3H 5K33A 1LP9F 2RAMA 2XTJC 2W0KA 3AROA 5ABDE 3DVIA 1UJ3A 4LP4A 2HTLC 3P4MA 3P3YA 3PV6A 4MVBD 3EHBD 3PWPD 4WUUB 3FT2A 5HTSA 5EU6B 5C0DA 4KHXL 1Z5LA 4F9PC 1BQHB 4HFWA 1BX2A 2AABH 3WFHB 4UMGA 3D0VB 1A6UH 2EECA 3QR2A 4LSPL 3BMWA 3WS6C 1EFQA 3T0EE 1JIBA 4QRPE 3V4UL 1ONQA 3DYOA 3IJSB 2C4XA 4I0KA 5GIRB 5F7YC 1KN2H 2A73A 1CLZL 4XXDA 5C09D 1YJDC 2VSCA 4NZTL 4U1JA 1UH2A 1JPST 3L3JB 3ILPB 2C1PB 3QQ4B 1HEZA 4AIOA 3ZKMD 5LQBL 4L4VA 4F7MA 3VFMB 4PJDF 1SJHB 1ITCA 4PJ8B 4POZC 4DAGL 5K9QG 4ZUVB 3VMPA 1JRHI 3STLB 2DLIA 3TC9A 3NAAH 3CDGA 2X4PA 4JKKA 1DLFH 1JGDA 3QYCA 5E4EC 4OZIA 2YSSA 4FQQB 1TFHA 5GS1B 2NLJB 4NHCH 5DFVD 1JJUA 2L7UA 5J12B 4MA3A 3SHSA 3VGAC 4L8BB 4MDJA 2X1OA 5TDPB 4FP8L 4MXWL 5FUZL 3CDCA 4OT1H 4NO2A 3SOBL 1WC7A 4HK0A 4N90E 3O4LE 5L2KA 3NIFF 1NBZA 1A6ZB 3NZ8B 1YDPB 4HXBH 5AUMA 5F7MC 5EULV 1P1ZA 4KQ4L 4YXKL 1EHLL 4KKLD 2HJLA 3MBEA 1XGPA 3PL6C 1ZA6A 3U9UB 1PAMA 1IFHL 5LKNA 3LKRA 2FL5A 4MX7B 4J4PA 1R5IA 1INQA 2P5EE 2RCSL 2QHLA 2WWMC 4KVCL 1JGLH 2YD6A 1P5UA 2XZCL 3DGGA 5F1NB 4WCYH 5GGSY 1E28B 1FLRL 1MFNA 1YEJH 3SDAD 3ZHLA 2CUMA 4X80L 4EBQL 3LKNA 1B90A 4I8DA 3BZFA 2WMPA 3HPJA 2LAGB 3O6FB 1J0IA 1OGAE 2Z35A 2IH3B 5HHVH 5F7FA 3EJZC 5MEPB 2PN5A 2JIXB 5GZNC 1C08B 35C8H 3QP3A 2EC8A 1F42A 1FFRA 5F1IB 1UCBH 2Z91B 5FO8A 1R6VA 4QHNA 3SY0A 4JPIB 4P2CG 5DRNA 2O93L 2J5LC 1H3WM 2BC4B 3OR7A 5CKGA 3FFCD 3AVEA 3VGGA 3ARED 4XRCA 3V6OA 1DR9A 1UWEH 5F96H 5E2WH 5IQ9B 1ZS8A 2ZSVA 1MRCH 2SEBA 3DYMA 2Z8VC 3N1QC 1FL3A 1T22A 5EUKA 4TPRL 3BJ91 1FIGH 4WUUD 3PQYB 5EU6D 3WIIH 4X7FC 3S88H 3ZYIA 2XY1A 2UY7A 3OAYH 3KLAB 3C5ZB 2FO4A 2O5ZH 4JZJB 5LXGH 3GJFA 1XGRB 2FJHA 3LKPB 3RWGA 3W39A 1IT9L 4IMLB 3TO4B 4PJIE 4F58H 2BRRH 4CKVX 3BKJH 2F53E 5D2LE 3OJ2C 3RKPA 3S36L 2G2RA 3BDYL 3U0WL 1N64H 1JHTB 3FJTA 3EOTH 4KKAD 1Q9KA 4XP4H 5IWLA 5GRYA 4YHNB 1AGEB 3V79C 4J3TA 4FFWC 4FQXA 1R5WA 4YE4H 3G04A 2XKUA 2WBJC 3VXSB 2W07A 5C3LD 1LK3L 2CIIB 5DUBB 3FT3A 4HW6A 4U6YB 3KYKH 2AJSH 1WWBX 2AP2A 2ZUWA 3GJFH 3PABB 1C8PA 3K2UL 4PJ8D 1AIFA 2FX9L 3DX7A 5TH2A 2XQBL 4OF8A 1FH5H 3NIGE 3CFDB 5F7NC 3C6LA 3SDXE 1X7QB 4G5ZL 1LDSA 5DTFA 3R06A 1MY7A 1JNLL 2EDRA 5DK2B 4Z7OF 5BO1L 1YYML 3PHOB 4LLVB 4N68A 3UAJD 2AKRB 4C58B 5JHLH 1PKQE 1SY6L 3KHQA 1KIPA 3L3IB 1U93B 3GIVA 1VACB 2ADJB 4R7DA 4LVHB 4W4NA 2F54B 2J6EL 3FQRB 3GSOB 4DKFL 1VB9A 3SKJH 3M1BA 2VH5H 3UTPD 4P5TA 2J3SA 2BX5A 3VXME 5D7KE 3TN0A 3TZVD 1QFHA 3WJLC 2JCCA 2QQLH 1FSKC 3RZCB 5EO1B 3C2SA 5EUOE 4LFHD 4GBXD 2DI7A 1BREA 1F6AB 1SYVA 2G9HB 5ID1A 5DEGB 4JM2A 1NUDA 3KYMA 3QUXB 2R4SH 1IGFH 2HFGH 4IM8A 5DUMH 5HI3C 1QSEE 3VFPB 5I66A 1BQLL 2AJVL 4R3SA 3O6FD 4DEPC 5KVFH 3RWIA 1BEYL 2E9WA 2WW8A 2NY2B 4X7DC 3AAZA 4MJ2A 2WLZA 1AC6A 2JIXD 1FG2A 1MSPA 4HJGA 3K4AA 4G7VH 3SDYL 2PYEE 2AVGA 5DJ8B 4AIZB 5T3ZH 4MNQD 2Y4SA 1PQZB 2EYRB 4UILL 5JIKA 4KV5F 1HQ4B 3T4AA 1KCSL 1S7VB 2CDFA 5LAXA 4IIQB 1S7TA 4W4OC 5JIPA 4X4XA 1VCAA 1M4KA 1MH5A 1HKLH 1MCJA 1I7ZB 3O41B 1FORH 4KXZH 4TUKH 2P49B 2W9EL 1N6QH 3ZL4H 1PLGH 1OB1B 3FMGL 4LEXH 3TT3L 1OSZA 2HH0L 3PQYD 1CFVL 2DLHA 5EBWA 5TFSL 5AWNL 5GS0D 3PWPE 3C5ZD 1JGEB 4GH7B 2OI9C 3O45A 4IDLA 3V7AE 3TO4D 4TUOB 1I1AC 3Q6FB 4Y5VB 2V9TA 4CUCA 5JW4Q 1S9YB 2EIBA 1J8HB 4X6DF 5FYLL 1HI6B 5IVXF 3FB5A 2R2BB 3MUZ1 2W9DL 4NUJB 5D96C 1IAIH 1M7IB 1JWMB 3AMLA 2GEEA 3MV7A 3VXSD 3B8YA 1I9IL 4ONGL 5L9DL 5E56A 4NJ9H 5I1DA 1B0RB 1QA9B 1CT8B 1Q9OB 1UKSA 1SVZA 3MZTA 5CD3A 2R23B 3DWTA 2W0FA 1I8IB 2X9YA 5I8KL 1YMHA 4LCCB 3GMPA 3GRWL 1D5IL 3IT8D 1JBJA 3PG2A 5IB5A 2Q6WB 1LK2A 2CLVA 1FN4B 1OAQH 4DZBB 2XNAA 3OL2A 4JB9L 5E00B 1KTLB 1BGXL 3UTSB 3DO3A 1XH3A 3MLSL 4CDGC 1CFTB 3O11B 2F8VA 2O61B 1SHMA 3P73B 3SDCA 3SJVE 2N4IA 5ITBH 5FYJH 1U3JA 4XH2B 4XC1L 3VXOB 3U36B 1E4WL 1A14H 3EYVA 4NOFA 4FQCL 3EFDL 4ZFFB 1MLBA 3UPAA 4O02H 5FA3B 1NLDH 4G42B 1OM3H 4F7CA 3I6GA 3AFLA 4Q9CA 5J11B 1FBIL 3EZ8A 4N8VA 1M71A 5E8NA 4NFBA 3DX9B 1G6VK 5ICXB 3RZCD 3BD3A 5A1AA 1LEIB 4LCWE 4QTIH 2FRGP 2JF1A 4L5FH 4MQ7A 3TT1L 1AGCA 2APWA 3LIZH 5SWQB 1RHFA 1MUJA 1SBSL 3QUXD 4TSCL 1O0VA 1A5FL 4UOW1 1ZGLA 1A7NL 3FB8B 3T0EC 4KJQD 5C86A 4R2GC 2NY2D 3GMQA 1FDLH 4ODUB 4XP6L 3WS3A 2P8PB 1FYTB 4YNYA 1W0VA 5HGBA 2BDNH 3GMLB 1X5AA 4R8WL 4KRPB 3NOIA 4ZTOH 2B5IC 3BN9C 1YPZE 2Z93B 4JFZH 2B1HL 3FCTA 4M9PA 2HFTA 1JV5A 5E5MB 1K6QH 1CFSB 3I02A 3CXHK 1FFNB 3BGAA 4YDIH 4LNRB 5GISL 2KDGA 3ARZA 4O9HH 3EYOB 1FO0B 1CL7H 2Y5TB 4IJ3B 3T2PA 3IDYB 3PWJA 1T7WA 3A67H 1ZWIB 1WZKA 5FECB 1YEEL 4WUUE 1BM3H 5EU6E 5HGHA 1L6XA 4Z7VB 1CDHA 2LVEA 4HBCL 2VWEE 3D18B 3MMEB 1DBKH 3BD4A 2BOCB 4HGWB 4HUNB 4QRRB 5DSCB 5JPMA 4Z7WF 5HHQA 3P0YH 3RVTD 4OD1H 5CEZD 2R29L 1J8HD 2H45A 4IS6A 4JFHD 2JTDA 2DYPA 2D7TH 4YDVA 5BXFB 1T0PB 1XF3A 4PJAB 4A6YL 4R96B 1UM6H 4I3GA 1YMMB 2FX8H 2FYYB 1KLUA 1XR8A 4NZUH 1EEQA 3HNSH 2H1PL 4P4KC 5K9OA 1GIGH 3RNQB 1F5WA 3PE9A 2ZUTA 4KFZC 2FWOA 3MV11 5C0ND 2YPVH 4PJDA 3EDKA 3H7BB 4KDVA 1JPTL 5E2TH 3IDJA 1A7BA 2UZXB 2AEWA 4KZEH 4NQCB 5KANI 4AM0A 5CIPB 4K8RL 3D85B 5B38G 4M00A 5IBUB 4BH8A 4HKBA 3GMRA 2DJUA 1L9NA 5C9JA 3UTSD 2E7HA 2EH7H 3BSZL 4PLKD 5HD8C 1RJLA 3VWJB 3OPZL 2EO1A 3F5WA 1BOGB 4DKEL 1ZHBB 5DHYB 3RWFB 4JQIL 5IHBA 3Q5YA 5KS9F 1QR4A 1YA5A 1NL0L 1S9WA 4BA8A 4BFIA 5CGYD 2VDPH 1RUQH 2EDOA 4P99A 3S5LB 5C7XL 4Y1AD 1IAOB 1NSNH 4XP1H 4ZFZA 2WSKA 4K2UL 1A1NB 4KJYB 3D0LB 1QRNB 4OGAC 4QCIB 3UTPE 4CN1A 1AXTL 3MCLL 4J23A 2XFXB 1SEQH 4OLZL 3LZFL 2B7DT 4WEBH 5IB2A 1Q8MA 1NBYA 5DVMA 5CJBA 4ZS6D 3L3KB 5J1SC 1CD8A 2C9AA 2HAZA 2IFFL 3LEYL 1AGDA 1KIRA 1N26A 3VFWA 2CO6B 5SX5K 2F8XC 3GHBH 3HR5A 3G6JB 2R9HD 2OJEA 4EUPG 4HIXL 1U8IB 1XIWA 2ICEB 2PO6A 3TFKC 1G6RA 3ULUH 4L8SB 3BHBB 4LLAA 5TPWL 3BIAX 3MROB 3H42H 3QDJE 1C1EL 1FYTD 1RVFH 3CC5A 3O2DL 4G9DA 3N06B 3HN3A 1BFSA 4KRPD 5FYKH 3UP1A 2DTML 3BI9X 4D9LL 2VISA 1T1XA 3RTQC 1LO0L 5BV7H 2WUCL 3HS0B 1XCTA 4FTVA 4U0QB 3ULVD 2VR5A 3GBLA 4Z8FL 2RFXB 1WAAE 5D7LA 4AH2B 2BSED 3O9WB 4L1DA 2F19L 3QI9B 1G6RH 1DQQA 2AV7B 2MQ3A 3SGDI 3ROLA 1C7SA 4HIHB 4GAJL 3PQYE 1A0QL 5E8DH 3CK0H 3D5OF 2OP4H 2VDQH 1H5BB 4P46A 5KVDH 3GSQB 2R69H 2RGSA 4QRRD 1MWAL 2GK2A 4WW2C 5GRUL 2IH1B 2IAMB 1A6VH 4HT1H 4NSKB 3WV0A 2EDWA 3V2AR 5FM8A 1GHFH 4ZFOB 4JO4L 3BESR 2FIKB 1IGTB 4YFDB 5INDA 1D9KA 5LVEA 4YBHA 1D7FA 1I1FA 1EGJA 3TV3H 1RHHA 1YMMD 4OCRH 5LJYH 4XPBH 4M6NL 1NJ9B 1HH9B 3A6BL 3WLWD 1G7MB 1NKRA 3L5XL 3QDME 1ORQA 3OKYA 4NUGL 1B0GA 5DI8B 4DTGH 1KPUA 2UZIH 3WHE0 4LOUC 3VA2C 1L0QA 1V7ML 2LU3A 1IGML 3UTQA 1XMWA 3BYYA 1TETL 4RGOH 3LMJL 4APQB 1T1WB 2R0WH 3DBXA 4NQCD 4XVJL 1RD6A 5I0ZA 3EOYG 1IJ9A 3I84A 4F7EA 1I8MA 1IGJA 3D85D 1P84K 2A83A 3H7LA 1JHKH 1EGJH 3U48A 4H0IA 3VWJD 5DWUH 1Q1JH 4BZYA 1P7HL 2AJZA 1VEPA 5T1MB 5ESQA 1WGOA 1VHPA 4M9OA 4Z0XA 3TYFA 4CVZA 3OR6B 2FBJH 4HWEL 4DVBB 4WI6A 2BVTA 4ISVA 2F54E 3SBWA 2X09A 3IXAA 1U8MA 1F02I 5MERA 1QRND 2G75B 3F7VB 5I71B 5FGCB 1BVKB 2OQJB 4FQHA 3SO5A 4X9BA 4YFLF 3MUY1 1R5VA 1OP3H 1U6AL 2MCPH 4MVBC 5F8QC 2VQTA 3EHBC 4JDZB 4C56B 4Q74A 1IEBB 3VFUB 4I3RH 5JUEH 2HN7B 4RSVA 4MCYA 1QQDA 2D0HA 2YOCA 4ODSL 5DD5H 5FHBL 3QXUA 5F6IC 3MCG1 4EOWH 5GXBB 3GFUA 5D1ZB 3F8UB 4U1NA 4D8PA 5FKPA 1E6OH 3MRPB 4OCSL 4JKPH 1JFQH 3ARDB 2EC9T 4R7NB 3KPMA 4JDVA 5HPMB 1G7PB 4ZD3L 4JHWH 5IM7A 1LO2H 5KTEL 5HY9A 2IQAA 3X12A 1T5WB 3VG9B 4ZSOE 2VMFA 5C3TA 4LQFH 4OGYH 1LMKA 1H15B 2Z8WC 3ZKMC 3SE9H 2GFBB 3O9WD 3J7HA 5J6HB 2YWZA 2WBKA 5MP6L 4NHUA 3QI9D 5TQ0H 2Q8BH 3QEGH 4ZUTA 3INUL 4PJEB 5DLMH 3S35X 3IFNL 3I3BA 5KSUB 1RJCA 3MRDA 3TBSA 4O2EA 1FZOA 2DM3A 2JE8A 3QZWG 1KXTB 5F8RC 4QEGA 4JZOB 4NNYA 4GMSH 4XNYH 2HRLA 4AJ0A 3ARGA 3MCKA 2ZG3A 4MZ3A 4PRBA 4TYUA 2IPKB 1OAXL 3VXUB 1JNNL 3DECA 2IAMD 1BD2E 5JXED 4MA1C 2X7LA 2A6IB 4PRNA 3QA3B 2VDMH 5I16B 5CEZE 1TPXB 3D9AH 5IVXA 2IBZX 3CUPB 3L9RA 5I1CH 1DVFB 1J8HE 1S7WB 5B21A 3RGVB 3N1GC 1ZKAA 4GG6B 3VXNA 2DF3A 1EDQA 1FFPB 3T8XB 2XZQH 4TVPL 2NNAA 4Y5XB 3BKCL 5EORL 3AC0A 3KYOB 3TVMB 3IXTB 5DK3A 5F7WC 1PX4A 2Q76B 1F4XH 2VDNL 2O26U 3VWKB 1CGWA 3C60B 2V2XA 2VDLH 1RUAH 2VZSA 2YRPA 3TBYA 3RY6A 3SKMB 3KWWA 5T5FL 4HXAH 3ESVF 5IR1B 3VD4A 4JY5H 5A16B 4APQD 4PRIE 4RQQA 2OL3B 5CINL 1I7TA 3NH7H 4PBWD 1MY5A 1NPUA 4ZNEA 4LSDA 3IVKA 3TH4T 5BRZE 1JZ8A 5DMGD 1BJ1H 4P5KB 2IADB 2DQEH 4G6ML 2V6HA 2BOBA 2C1OA 3UTSE 3JTSB 4JRYA 5CJXC 2E7MA 4RFNC 3IJHA 5J8OA 2LAAA 1MHPL 5DVOA 1UEYA 4Y2DA 3BH9B 2VUOA 1K3ZA 4NWTH 1L4IA 3DX6B 4JFPB 1FNEA 1SEBB 2YHGA 3WXVH 3VXQA 3MRIA 3AREC 3KYNB 1I7RB 1IQDA 4RAUB 1YEFL 1PG7X 1FVDB 4EJ1C 1CLYH 4MAYA 1KTRL 3JTTA 5FGSA 4AT6A 3GB7B 1KB9K 3MRKB 1GC1H 4C56D 4UDUA 3IF1A 5D2NA 5JQHC 1RFDL 5EOTA 5J1AA 2CJUL 2D03H 2VWEC 4YDKH 4PR5B 3DXAA 5EWIL 3O3EB 2R0KH 1KG0B 5IEHA 5D1ZD 4B50A 4UB0H 1U2HA 3UTZA 4HUKB 1OTUD 3ARDD 5BW7A 1UACH 4G8GE 2IBZY 2EXWC 4MWFB 1KIQA 1WT5A 5D7JD 4S0SD 4KKAC 3DURA 2AJYL 3HZKB 2NY0B 2X4RB 4OF0A 3V95A 1GYAA 4IDJH 4P9ML 4CMMB 1BAFH 3CX5K 4PJFB 1U58A 5IB4B 5HVGB 4GXUM 3V52H 4FZ8L 1U3ZA 4OGXH 3ULVE 4JAMB 1JPFB 2E6PA 3S3PA 2BSTB 1DQML 5DS8A 4JFOA 4PJ8C 2F8OA 4ZS7H 3WUWA 4ODTL 1U8NB 5D7IF 1Z9MA 3E6HA 5EO0B 2WUBH 3CLEH 1H3GA 3RJDA 2O5YH 3BGMA 1T6VN 2FJFA 3GSXB 5GS1C 1LD9A 5DQDL 4MJIB 4Z7VE 3VXUD 4L4TA 4Z7WA 4XCFL 1FYHB 4JY4B 2FD6L 4V1DA 5CP3A 5FK9B 3UAJC 1ORSB 3BT2H 1H0DB 3FL7A 4QRRE 5I76A 5IIEB 1SJEA 5H94A 1UXWA 3FQUB 3WDIA 1DVFD 4BELD 1NFIB 1IC5H 4XVTH 4ZNCD 3RGVD 3LD8B 4DUVA 1K8IB 1JNJA 3T77B 3RPKA 1G0XA 5D1QA 2IMMA 1QO3A 4PJAE 4S11A 4ETQA 1QFWH 3TVMD 4N9GA 4RZCB 1YMME 1FGVL 3ULSB 3FONB 2FZ3B 2VRAA 3VWKD 3C60D 3H9YA 4P9HH 2ZUYA 3M45A 4JLRB 4ODVL 1K85A 2A0LD 3W81A 1FPTL 3QUML 1UZ8B 2CDEB 2IQ9L 1WCQA 4GS7B 1KLFA 4PGEB 2ADGA 1KCRH 4WU5B 1N2RA 5FYLD 1AQKH 1F4AA 3DMMB 4NQCE 4S1SL 4YZFE 4PLJC 1A7QL 2EEDA 3U46A 4FN0A 4A6YB 5ACZB 1X6LA 4PB9L 5JIIA 1A6TA 3O6FC 5TF1H 2X4SB 5C2UB 2BVQA 3Q5TA 4RWHA 5KS9A 4DCQB 2OMBA 5ELIA 1GOFA 2JJTA 4NYLB 2BCKA 5J13B 3B2UD 4BH7B 4PTUA 3JV4A 1UWXK 1TCRA 4HKZB 2LABA 1RZ7H 4NQEB 3CDYA 3VD3A 2R1YA 1TVHA 4Q97A 1EFXA 1X5LA 5AD0B 2KH2B 4OZHF 3IFPB 5C0CB 1FLTX 4ZPTA 2IBGA 1LDPL 1OQXA 3BP7B 5GS0C 4DK3A 2AXFB 1UQSB 3C5ZC 5D7SH 4D0BB 4JZJC 4UQ2B 1QHOA 3IDGB 3P4LA 3G6JE 1RZJL 4XPFL 3TO4C 4KKBC 4WEMB 1RJYA 3HI1B 4G8EA 2IALB 1DBML 1YNTB 3NA9H 1YJDH 3F12A 1NGQH 5DD1H 3GNML 2BSSB 4ZAKD 1G7JA 2NY0D 4ZXBD 4HS3A 3OKDA 3CVHL 4FS0A 4UT9L 1JWSB 5IB3A 4OAWB 2Z0BA 4LCYB 5EH1A 5I15L 5J0BA 3LB6D 4OD3H 8FABA 3H3PL 3WJJC 3LDBB 4MA7L 5JOPD 3PL6A 5HJ3A 4Q9RL 3DUSA 4F80A 4M7ZB 1PG7W 1NFAA 3QHZH 3IU4L 1QNZL 3N50A 4RA0C 1INDL 1MCWW 4R90H 3X11A 4WWKB 2Y25A 2E27H 1A9BB 1N5AA 5E1HB 4MJID 3TWCL 1QLFA 1EJOL 3GKWL 5E2VL 4PJIF 2O5XH 2VAAB 1WITA 4ZMAT 3EGSA 5I8EB 5C0GA 1T03L 4X6CB 4LSTL 2P7TA 3WIHL 5ANMB 3RBSA 4YIQB 5FO7A 4HS6A 2H6PA 4PRHB 5F97E 5DC9B 1NUGA 4LVHC 4WHCA 1IGYB 4DFHA 2FSEA 4B0MM 1QYGH 2JELH 4R26H 4JHBA 4DGIL 1BBDL 1KXVC 3KXFE 4OLWH 1IEAA 1FNFA 4DW2H 2QKIA 2DQTH 1T04B 4PV9A 4CADB 2BSRA 5JA8B 3RI5F 1CXEA 3FOMB 3PWUA 4GAFB 4Z7UF 3FFDA 4PJCB 3ZKQD 1RMFL 1MFAL 1WZ1H 5ESVA 4HQQH 1JZ5A 5GSRB 3NFSL 3RZCC 1HCVA 5DDHB 1DQLH 3OZ9L 4ZFGH 3CSGA 3WCYA 3UC0H 1QFPA 1OLZA 3BKYH 1R3JB 1S7SB 1I3GH 4G3YH 3DMMD 5F1SA 1RJZB 3QUXC 3MA7A 5CLWA 4OCYH 1C5BL 4YHPA 4KJQC 4UT6H 3MNVB 1G9NL 1F4WH 2NY2C 3BIBX 4XCEB 5IVOA 4DGYH 4PD4J 2EKSA 4RAVA 3GMMB 1IQWL 1YEIH 1JYNA 1DBAL 3AS0A 3N85L 4J6RH 3W5MA 2LTQB 5CEXB 3RP1A 1R24A 3BPNB 4PIRF 1EAPB 4J8RA 5DVNA 5BMFH 5I30H 1MPAL 4NN5B 4MJ6B 3BAEH 2OTUB 1NGPH 4IIQC 3UBXA 4ZO6A 2WBJA 2FATL 4NQED 4G43B 4K8RD 4FABL 2ZJSH 5L6YH 4K9EC 1CICA 5FGCE 5FDWB 5EUOF 5C0CD 5DHVH 4PGCB 4ONFH 3GSWB 1B3JA 3E8UL 4CN6A 1OHQA 1QLEH 2ED7A 5L7XH 1QSFE 1IKFL 1QKZL 3K8LA 3RVTC 5E7BA 4Y5VC 1IE5A 3O3UN 3A6OA 1UXSB 1YEGL 2YS4A 2YPLA 1VFBB 4W6WB 3UJJL 1HSAB 5DJ6A 1X4ZA 4G6AD 3NBNA 4QRTB 3DUUA 3LHPH 3CFIC 4O58L 4H88H 5LBSH 3V4PL 2DQGH 1KPVB 1KENH 4UV7H 3OXSB 2DKMA 3MRNB 3VRLE 6CGTA 1LO5B 3HB3D 4JANA 3VI4F 1J0JA 1KT2A 1NAKL 5C0NC 2BFVL 4B7IA 3MRRB 5FB8B 4IRZL 2V5YA 3EOAA 4HHAA 3K1DA 5INCA 5B4MC 1Q9WB 1OAUL 5AEAA 4LCCC 3IGAA 1J8KA 4U7MA 4YEFA 1S7UA 4PJEE 4RMUA 3D48R 4MCZB 1Q0XH 1M05A 4WWKD 4U7SA 4EDXB 1JI2A 3SEPA 3MNWA 5C0JB 5DJ2B 3G08A 2FHCA 4PLKC 4GW1B 1S7QB 3L1OL 3VXUE 4DKAA 4J2XA 2QQKL 4NKDA 3KPOB 4PRHD 5CEYA 5LCVH 5MEQA 4BSWB 1I9EA 2H9GA 4LVNB 4PJGA 2MPAL 4LK4A 4PS4L 5CGYC 3S96B 4GG6E 2VAJA 4KK5D 3SCMB 1IC7H 4KK6D 3ALWA 4JFDB 5HPOA 5J11C 2GK0B 4IRJC 2Q3AA 2W91A 3JUZA 4W4OA 4TNVK 1NAML 1IM9A 2W60A 3CAFA 4XMLH 4ZS6C 3UPRA 2YRZA 3I3EA 4ODHL 4QTHA 3I85A 1GJIA 1KNOB 3FAXA 3QUKB 4XBEL 1QPPA 2R9HC 4X9HA 2XG4A 5L2JA 3EKCA 2Z4QB 3BMVA 2DQCH 1MCPL 3JWDC 2Q1EA 2BXYA 2XOTA 3HNVH 3E2HB 2JB5H 4KRPC 5J6GA 2YZ8A 4PP2A 4WVRA 3RHWK 1Y6KR 5LWYL 1OD9A 5I1IH 4X6FB 5D70L 5MENB 4NO5B 1NGZB 2R1XA 4OFYD 3O8XA 2AI0H 4NCDA 3V6FB 3ULVC 4H5SB 3W11D 4X4ME 4RMQA 3H9HA 1JVKA 3DRTA 3OKOA 7FABH 5GHWH 3L95A 3MFFB 4UV4L 2VXTH 1BLNB 4IJ3C 3KDMA 3IDYC 5CZVH 2ARJA 2ZCLL 3G6DH 4H8WH 5DJDB 4G9FB 4I0CC 2FDBP 4XPHH 2OTWB 4YHZH 3HRZA 3E6FA 1N0XH 4RISH 3IDXL 1F3JA 3ARBA 5DJ0A 5DJAA 4FQPA 5GGUA 1LEKB 3MLYL 3PJSB 2VXQL 5I1AB 2BXZA 3SPVA 4UTAL 4AENB 5CCKH 4NNPH 3BPLB 4RNRB 5FYJU 2K7QA 1ZT7B 3MX0A 1A4JB 2NXZB 1FL5B 2FHFA 1OSPL 4LDEB 4YXLH 1MJJA 4OZFA 2IG2H 1D6VH 3C9NA 3HPLB 3SOBH 1OCWL 3WLWC 1TDQA 5DJYA 5T3XD 2FHBA 2YA0A 3REWB 5FM4A 4PJFE 1DP0A 4UINL 3BZEA 5JOPE 5EO9B 5D7IA 3BW9A 2B0SL 1N5YL 4OQTA 1J05A 5F9AC 3SKUD 4NBXB 4O51A 1MF2H 1A8JH 4P3CH 1ZTXH 5BQ7A 1KCKA 2H2SD 3QDGE 1O7VA 3EO9L 1U8KA 3PP3K 3VWJC 1FRGH 1J1PH 4HAFA 4UDTB 4XNQB 1CDYA 1FNAA 3T2NH 4QRPA 3BP5A 4HUXB 4NRZA 4Q0XH 3WNKA 2NY1B 1D6EB 4NQSA 5AZEL 3TCLB 5F7DA 4DN4H 4N0UA 2CLRA 1KPRB 4MHHG 3SCMD 5IFJA 4JRXB 4JFDD 2JB6B 4OQTH 5ICYB 4LAJH 3U9PL 4XC3H 5CBEB 3G5YA 2BVOA 3LH2H 2VERN 2R39A 2GTWB 4LLUB 4XBGB 1XZ0A 2BJMH 2CXKA 1E4XL 1CXIA 4N8PA 1RIUL 5EBMA 3DVGA 5C6TH 1I4FB 3OKKB 1F90H 4OJFH 4L8SC 1MCKA 4TVPD 3EFFB 3TCXA 3V5HB 5FXCH 4F37F 2WQ8A 5IROA 4P2RA 4Z78A 4QHLB 1GGTA 4P23D 5EZJA 5DD0L 3BISA 3GI9L 1CWVA 1DDHA 4WFFD 4UQ3A 5D72H 1CZ8H 2NZIA 3O4LA 5JIHA 2XA8H 3OJDB 2Y72A 5MEND 1J10A 1MREL 5ISZB 5J3HC 2MCG1 3KJ6H 5F7HA 4QXGH 3CSPA 3TESA 3W9DA 2ESVE 3MXWL 1RURH 3O9WC 3IKCA 4NQEE 3TNMA 4CL7A 1P6FA 5KAQF 3QI9C 3C2AL 4R9HA 4OZHA 2WANA 3X14B 2AEPL 5C0CE 1I7UA 3CJJA 3FB7A 4LLYB 3GHEH 2IMNA 1MFEH 1G7LA 1S5HB 1H5BC 4U1IA 2FNBA 1CR9H 3BFOA 4XZUB 4MYWB 1IC1A 2IAMC 2H8PA 1NCTA 1OGAA 4X6BA 5F7LB 1PX3A 5C0EB 2XTLA 2G5BA 2W65B 3NFNA 5JW4R 2EDKA 2VDOH 5CGMA 2ZKHH 4KY1H 4U1SB 3CFKA 5E5RB 4CMHB 1F4YH 3PHQA 1A6UL 4OI8A 4RAHA 2OR7A 2QV2A 3EDJA 4GUPB 5E1AA 1LGVA 4BFGA 2J8HA 1Z9LA 5EIVA 4UAOB 1VFOA 1J0ZA 1KN2L 1WAAF 5B8CB 2R2EB 3DIFA 3AB0B 4KK9D 1U8HA 3LKQB 1UJTA 4MNGE 3PDOA 5I2IA 5FA4A 1ZK9A 2DMCA 5ENWB 3GUTA 3T65B 2DLFH 1KEMH 3BP6A 5DMGC 1HZHH 1HOCB 1U95B 1OD7A 4XVUD 4PJIA 5F3BB 1K2DB 2NW2A 1RUMH 5DA0B 2UWEB 2F53A 4K07A 4U1HA 1WBYA 1I85C 3BWAB 2NY1D 2MJWA 4G8IB 4X6CE 4NHCL 5EU7E 4LKXA 4PRHE 2UVFA 3GBNH 2BHZA 5FYKU 5IGXL 5GGVH 2AQ1A 2HT2D 2YD4A 5D5MF 3BKMH 1WBXB 4JRXD 1IVLA 3IFLH 2WIMA 4FXKB 4R4BA 4JQXC 5BCAA 5LGJB 3RTQA 3HE7A 4NCC2 2N56A 4OT1L 5I71C 2V5TA 1BFTA 1EV2E 1QBAA 5IG7B 3LKOB 1HHIA 2IGFH 4GRWB 2W0LA 4JJ5B 4HXBL 1FJ1A 5F89B 1T3FA 2E6QA 3QEQB 3BZ4B 1JP5A 4G6JH 1A4KA 4KROB 4HIEA 3O3DB 2KZWA 3FTGA 1I75A 2R1WB 5J4MA 1P5VA 5HHPA 3VRIB 1DBBH 2J4WH 1GZQA 2BVPA 1WUNT 1JGLL 4JFEA 5D1ZC 3GJEA 4WCYL 2BP3A 3GJFK 5EN2A 3MZGB 1OTUC 1PKQA 3E1F1 3ARDC 5IMLB 1MCDA 4OKDA 1YEJL 3GRWA 4NRXA 3EDFA 3WUWG 4GG8A 1N3NA 2KQNA 4L9DA 3VDCA 3EW3B 2VE6A 1TCMA 1I1YB 4GO6B 3HE6B 5HHVL 3HI5H 2ZCHH 1OWRM 3VG9C 5ISZD 4J3UA 5HSFA 35C8L 4TQEH 1S5IH 3VXMA 1U8QA 4QRSB 1UCBL 4XWGH 4X99A 1PYWA 1CGTA 4NKIH 1Y0LA 1BBJA 5EUOA 4H26B 4DGVH 5D71H 1QSVA 1IAKA 1UWEL 1F97A 2A9MH 5F96L 5E2WL 3GRWH 4LU5H 1MRCL 2WLYA 1CD1B 2AJ3A 1EO8H 1QSEA 2YMXH 4M7LH 1FIGL 2K1MA 3WIIL 3S88L 1F4HA 3O4OB 1TPXC 2O5ZL 4MD5A 4NKMA 4XPTH 5LXGL 1XGTA 1DVFC 4OIIH 3RGVC 1N4XH 3W0WB 3TEUA 2I26N 4F58L 2BRRL 2PYEA 4JPVH 3BKJL 3UTTB 2XWJB 5F71A 1WFNA 2DLEA 1BF2A 4X8XA 4JFQA 1A1OB 2OTPA 4Y5XC 3IS0X 3TVMC 2D31A 1PSKH 1N64L 3EOTL 4FQ2H 4XP4L 4IMKC 5IOPA 3VWKC 3C60C 5GQBA 1XF2B 5ESAB 1DBJH 4HC1H 2H32B 1ZEAH 4XNUH 5LG1A 3FQWA 5T3XE 5FF6A 4YE4L 1C12A 5C07D 2EYSA 5FKAB 4FZEH 4TULH 3T04D 3KYKL 4MSWA 1UH4A 2AJSL 5J57B 2BMKB 32C2B 1G7HA 1NC2A 1TJGH 3DPBA 1FH5L 1TZHB 3CIQA 4FXGA 1DCLA 3BQUA 2CKNA 2VZ3A 1AGFA 2P44B 2FIRT 2Q87A 2E9JA 4XVSH 2X4NB 3MJ9A 5E4IA 1SJXA 5IMKA 2P48B 5EIIB 1CG9B 1HKFA 1PZ5B 3MGTB 4H1LA 4HKJA 5JHLL 1HHHA 3B2UC 3HLAA 4P2OB 5EPMB 3QJHA 3NIDE 3FOLB 3QWQB 3WDHA 1E27A 2DAVA 4KVNH 3O2WH 5I6XB 2I9LB 4HMEA 4ZUWB 2Z31A 5CAYB 4GW5A 1G1CA 1JTPA 2R2HA 3SKJL 3QEQD 4F15B 2VH5L 1AFVH 2HKHH 3F6IA 1KGCD 3RWCB 3T09A 4OLYH 1FVEB 3MJ9H 3V0VA 2QQLL 4H25A 4RGMB 1IEHA 1OP9A 5DRWB 1YEEH 5DVLA 2ICWA 4PJBB 2DBJA 3F7YB 4GFTB 3QUYB 1A66A 1WV7T 3SJVA 3HC4H 2VLKD 2R4SL 1IGFL 2HFGL 5DUML 4PJHB 5D6CB 4M1CD 4NQVB 2VR4A 4W70A 3OHXA 2A6DB 2NY0C 4YWGH 5CBAB 4HUWB 4L29B 4O2CA 2V2WB 5KVFL 4QT5A 3SE4C 4YR6B 5HBBA 3HE6D 4WFFE 2XN9B 3WIFA 4L3EB 5BZDA 3LB6C 2RQ8A 3WFBH 4ZDHB 1H3VA 4G7VL 5MENE 2YA2A 4HZAA 1E4XI 5T3ZL 3G5XB 2DWEA 5H8DA 2I60H 4LCWA 3T3ME 3NPSB 1KELH 5C8JB 1JPTH 1HKLL 1FORL 4TUKL 4D0CB 1JK8B 4G9FE 4MZ2A 1N6QL 3ZL4L 1PLGL 4LEXL 5IV2A 4KUZH 5I8OH 1WWAX 2LVCA 1B6UA 3QFJB 2X4UA 1JNHA 1U8JB 2EKJA 1K8DA 1Q9LB 3LD8C 3W0WD 2C5DC 4HIJA 5I1LA 3QWRA 3JBG7 4R0LA 2OXGA 3DI2B 1K4DA 3UTTD 1MIEH 4NZJA 1FL6B 1QPXA 1HCFX 4WU7A 3BEWB 5FV1L 3ZHDA 3GSVA 4K2UH 2CIKB 3AREA 1QSZA 4IHOA 1D5BA 4Z7QE 1IAIL 5HI5D 3ULVF 3QXAB 4TRPH 43CAB 4L8CB 3P77B 3BPCA 3RY5A 4GS7C 2Y23A 4NJ9L 5IFAH 1MIMH 2VITA 3HMWH 4WUUA 4GRLB 3DMMC 3VD5A 3P9LA 3MRQA 4NRYA 1BQHA 3LQAC 3FO2A 3UZVB 2NTFA 5B38B 2ITDB 2NY7H 4PV8B 2VN7A 4GLRH 3PWNB 1YEHH 4ELMF 2FEDD 1IMHC 1OAQL 1VFAB 4C54A 2APVA 4S0TD 2JKXA 5FOBB 1JHLH 4ODXB 1T0NA 1WIOA 2XWTB 4X7TB 1PZUB 3QBTB 5GS2D 4CNIA 2WM0A 5GIRA 4PJAF 5J13C 4P2OD 1MWAA 5ITBL 5FYJL 4IOFD 2PTTB 3QULA 1AGBA 1A14L 4QOKB 3L3JA 3R1GH 4QY8B 2W0PA 3ILPA 2Y07H 3QQ4A 2Q20A 2XXMB 4O02L 1UA6H 2I27N 2NCMA 4Z77B 3VFMA 1NLDL 2X4QA 5L0QB 4WFHD 2DMKA 3CMGA 4NKOB 5EFIB 4ZUVA 1OT1A 5F7EH 4XTRD 5GGSA 2GJ6B 4FQQA 2HLAA 4QTIL 3QPXH 3VD7A 4L5FL 3S9DB 2EE2A 3QUYD 4EUPB 3LIZL 4Y19B 2N7AA 1CYGA 4U3XA 3TJHD 4L8BA 4PGZA 5KSVA 4HLJA 2X70B 1U8LB 5CJ5A 3L3DA 4G6AC 2QR0B 2XN9D 1TTUA 1FDLL 5HYIA 1JGUH 3NZ8A 4L3ED 1HWGB 1YDPA 1TTGA 2BDNL 5ISZE 3LDBC 3SE3C 4X8JB 4KJPD 4ZTOL 5JW5B 1MI5B 4FQIH 1WIPA 4JFZL 4X4YB 2D0GA 2OS7A 4M93B 4LBEA 4M7ZC 1TETH 1K6QL 2OBGA 1I9RH 4YDIL 1D3CA 2VXSH 4RGND 1TQCB 4WWKC 4Y0GA 3M17A 4LDLB 3RWHA 1I1CA 5DYOB 3SKOB 4O9HL 1GCFA 3DOSA 3Q2CA 1CL7L 1IBGH 1QLRA 4I2XB 3P0GB 5F3HB 2I9TB 3A67L 3QFJD 2PUQT 1BM3L 2WINA 5EU7C 5F44A 1V5JA 3QDJA 1DBKL 4P2QA 5C0BB 1WWWX 1AJ7H 1C08A 3P0YL 4OD1L 3GBMH 3OKLB 3QXDB 1QBBA 4JPIA 2HG5A 4KK5C 4KWUA 4Z5RB 2D7TL 3B6SA 4YBLB 2GQHA 4KK6C 3VE0B 2ZOKB 5ETUA 3SDDC 2X89A 2E3VA 1ERNA 1WAAA 1UM6L 2FX8L 1NC4B 1LO3H 2OSLA 5K59F 2HJKB 4NZUL 3HNSL 3ZDXE 1GIGL 2HFFB 1XAUA 4HV8A 4KH2A 4UBDC 3L7EA 2YPVL 4GRLD 1WFOA 2ZG2A 2MMXA 2PNDA 1MFCH 1S8DB 5DXWA 2YRLA 3V5DB 4UI2A 5E2TL 4JZJA 1PVHA 2YC1B 2BNRA 1GH7A 1MLCA 4OF6A 3RL1B 3FT4A 4BQCA 4KZEL 3CXHJ 1T1YA 1I3UA 4U7KA 2UWEE 1DQJA 2VZVA 4L1HA 2EH7L 3WL9A 2JK5A 4ZQKA 4LSQH 3IDNA 1UJ3B 2C3XA 3OGCA 2LTQC 4PTTA 3BPNC 5D5MA 5TQ2H 3PV6B 2ENYA 3DRQA 4NN5C 3QDMA 3FT2B 5F72S 1Z5LB 4QNPE 4QOKD 3W11C 1RUQL 2VLMD 4U6YA 4ZYKB 5GS0H 4HFWB 2QSQA 3GM8A 1BX2B 1NSNL 3PABA 4HPYH 4XP1L 3QJFA 1K5NA 5KW9H 4LASH 4G6FB 3QEQE 2QSCH 1IL1A 1RU9H 4OZFG 4Y5YA 1SEQL 4WEBL 4LPUA 1KGCE 3CGTA 3ES6A 2DWDA 4HEME 4I13B 4POUB 1FV1B 1LILA 5GPRA 3UZQA 1OLLA 2A73B 2GJ6D 4YQXH 4JG0H 3SGKC 1FHGA 4XXDB 4UT7H 4Y19D 5CP7A 4U1JB 5E8PA 3GHBL 2XRAH 1A3LH 1D5ZB 4MD4B 4L4VB 4F7MB 4LHUA 1MAMH 3ULUL 4MXVF 1OAYH 5J7CC 2F54A 1KYOK 3H42L 3CDGB 2X4PB 3TJEH 1RVFL 1JGDB 4OZIB 2YSSB 4LF3A 4NO3A 2AK4D 4Q7DA 1Y6MR 4WGVB 4M1DH 4CW1A 5BV7L 4MA3B 4MDJB 4OFKA 1F6AA 3GIZH 4GMTH 4I5BA 5C6PB 2G9HA 2Y06H 4NO2B 1WC7B 3AUVA 1G6RL 5KANG 3LN9A 1NBZB 2H2SC 2H3NA 3QZWB 4HH9A 4ORGB 1UZ6E 1TLKA 5JR1H 2X9XA 5AUMB 3M07A 3RVUD 1P1ZB 5B22A 3CK0L 2HJLB 2OP4L 3QQ9D 3B9EA 1XGPB 3CFJA 3MBEB 1OP3K 4HUVB 4C83A 2VDQL 3LKRB 2FL5B 5KVDL 5C0BD 1URLA 2R69L 4LVNC 1R5IB 1INQB 3W0WE 1A6VL 4HT1L 2YPKA 4JY6B 1GHFL 3UTTE 4AIZA 2V5RA 3Q5OA 5BVPH 4KPHH 3SCMC 2C3VA 2EYRA 1T5XA 5CILH 4ZSOA 3O81A 3VH8A 1S7VA 5D8JH 4YHMH 4IIQA 3MXVH 4KXZI 1WTGT 4OCRL 4IEFB 4XPBL 1NC4D 3LKNB 2A6JB 3V8CA 1I7ZA 5GGRY 1BP3B 2EDLA 1WISA 2Z35B 5EBGA 1A6PA 1DE4A 4DTGL 4QHKI 4E42A 4XGZA 5C0AB 2UZIL 1CDBA 4ODWA 2D7QA 5JZ7D 1RFDH 5FO8B 3CPLA 4QHNB 3K8KA 1UB6A 5JDSA 4RGOL 3FQTA 4J1UA 2R0WL 1HHJB 1BD2A 2C26A 4XCYA 2Q86A 4GXUN 4XRCB 3DROA 3G9AB 4DOHB 2AJXH 1JHKL 1EGJL 1ZS8B 2ZSVB 2SEBB 3D69A 4QGTA 5IJKA 5DWUL 1FL3B 2CLZA 1IAII 1B2WH 1T22B 3MJ8B 4MD0A 4E41E 3U7WH 3ZTNH 3PV7A 2DTSA 1M7IA 2FBJL 2FO4B 3T0BA 4KDTC 3NABH 4KJWC 3GJFB 3VFNA 1A7RH 3DO7A 1ITBB 1CFNB 3QHFH 2FJHB 3RWGB 3W39B 1B0RA 4RBPH 1ZMYA 1VERA 3Q3GA 5IB1B 4PRIA 4G6FD 5TE6H 3PGFH 1I8IA 1Z6JT 3O3BB 4MLIA 4WHYH 1OW0A 3GKZA 2G2RB 5CEZH 1Q9KB 1JCKA 1HHGB 5BRZA 3LV3A 2Q8AH 3TNNA 4FQXB 4UZGA 1EEYA 2MCPL 1R5WB 4PJBE 3QUMA 4I3RL 5JUEL 2BNQB 3FT3B 2BERA 5DD5L 3BPLC 4L4VD 3F62A 4EOWL 2YXMA 4NIKB 2NXZC 4OV5A 4F8TA 3L6FA 4XH2A 1AIFB 3DX7B 3B3IA 5IEKA 2DBLL 4JKPL 1JFQL 4CGTA 3HUJB 1P84J 3C6LB 4U0RB 3OAZH 2XN9E 4JHWL 3DJ9A 4L3EE 1LO2L 4IRJA 5DEFA 1UKTA 3FRUB 3ZE1F 4HH8A 3DX9A 4UNUA 4WW1A 4LLQA 3ARYA 1LEIA 2P24A 1V3KA 4LQFL 4OGYL 3QDAA 4Q6IA 1KIPB 3SE9L 2NY3B 1RULH 4R7DB 5SWQA 4ALAH 4BZ2H 4MA8H 5TQ0L 2Q8BL 3QEGL 4QO1A 5DLML 3QPQD 2EH8H 1S3KL 4XVUC 3M1BB 2OX5A 4P5TB 1HN1A 3P40A 1VEMA 3TN0B 4G8GA 3MBED 3QFDA 4GMSL 4XNYL 2EYTA 4TOYH 5DRXA 2NY1C 1N8ZB 2ZOLA 2VDML 4KGJA 2HT2C 1D5MB 1SYVB 3D9AL 4PG2A 4YHIA 5I1CL 1S9KC 2DJSA 5ID1B 2AK1H 3MRCB 5ID0A 4N0FB 1MJ8H 4FQ1H 1AO7B 4QWWC 2APFA 2XZQL 5I66B 2ARJQ 1OP5H 2A2QT 1T80A 4NBZB 1FFNA 4R3SB 1CL7I 3RWIB 1F4XL 4E5XA 5D9SA 5C0AD 1FG2B 2VDLL 1RUAL 4HJGB 5C6WH 3I2CH 2H26A 2QQNH 4HXAL 4JY5L 3FRPA 4HS8H 2DDQH 3NH7L 3D18A 3TO2A 3T4AB 4ELMA 5DSCA 2BOCA 5LAXB 4QRRA 1S7TB 5BS0E 3HZVB 4CRPA 5I9QB 3CNKA 2F9BT 4MDIB 4XXCA 2GSGA 2DQEL 3ULVH 3MUGA 4PJAA 4CBPA 4OLEA 1OSZB 3OX8A 4KQ3H 4X0KB 1GVIA 1FNGA 5EBWB 5EZIH 1ES0B 1F45A 1FO0H 2J8UB 4EIGB 4NWTL 4XPGH 5JOFA 2VYRE 4U1GB 4X5XA 1UFUA 2P45B 1VFUA 4ZO9A 3WXVL 2VLME 3KS0J 4LRIC 4S1QH 3I75A 5HHNA 3FB5B 1CLYL 4NQCA 5CIPA 5F7KC 3JV5A 4FQXD 1IAIM 1T4KA 5H2BA 2DM2A 2GJ6E 2XTJE 4NFCA 5DZNA 1GC1L 3MV7B 2BNQD 4NC0B 3VWJA 2HFEA 4YDKL 1J18A 5I1DB 2EDNA 1A47A 1PW3A 2R0KL 1WCBB 4UOJA 1JTTA 4LMQE 5CD3B 4LPVA 4HWZA 3TP4A 4UB0L 4CMHC 2MQ0A 2W0FB 2GW5A 4ELKA 1YMHB 4NP4H 1UACL 4YDLB 5IFHH 3GMPB 3L5WA 3C6LD 5IB5B 1LK2B 3S5LA 2C3GA 1NFDF 4UAOC 2XNAB 1T7ZA 5KOMC 3SGJA 2DQFB 4AEIH 4QHMA 1MNUH 4KJYA 1O5DT 3D0LA 5CIPH 4QCIA 5B8CC 2XFXA 4UOW0 1XH3B 4LLWA 3AU1B 3AB0C 3TLRA 2JJUA 1MI5E 4JDTH 5BJTA 4IDJL 5HDBE 4YX2H 1BAFL 3DV4B 1KTKE 3FHAA 1NCCH 3L3KA 3ZDYF 4H1LG 3V52L 2NY3D 4OGXL 1U8PB 1U91A 3KPRE 2X1WL 3L5HA 4ZS7L 3ARQA 4ORZC 1MLBB 1R3LA 3OAUH 1DN2A 3VFTB 3C8HA 5B3JF 2WUBL 4JZNA 3CLEL 4P5TD 4F7CB 4RCAA 4I2XE 3V9FA 4GJTB 1CE6A 3TN0D 3BHBA 1C5CH 4WI3A 3LRSB 1M71B 1SMOA 5E8NB 4CAGA 4CU8A 1KB9J 1W0YT 1Q72H 4XCCH 2XT1B 1NFKA 3DX8B 5C2BH 3BT2L 3VI3E 3V0AC 2BVUA 5GGQH 4NJAH 5I17B 2W38A 1IC5L 4XVTL 4JM2D 3CLFH 2HRPH 1AO7D 5AYQA 1ZGLB 1QFWL 3A6CH 2NW3A 2ZZUT 3GMQB 4KROC 5E0QA 4P9HL 3THMH 1AD9B 2NXYB 4YNYB 2PR4H 1MEXH 5HGBB 5EC1A 3AS1A 3H9ZA 1YEKH 1FZJA 4U05A 5JQ6H 2YD2A 3CX5J 5IJVA 1H5BA 3GSQA 1KCRL 1KJ2A 3FCTB 2BNUB 5CSZB 1AQKL 2IAMA 1MVUA 3LKSA 5M94B 5AAWA 3I02B 1LP9B 3K3QA 5EA0H 2A38A 4M1CC 4MQTB 4ZPVA 4H0HB 4RFOH 2EE9A 5TF1L 3HE6C 3KXFA 3HFMH 1FC2D 1OAZH 1UYWH 5TGBA 5HGHB 3I6KA 1EUUA 1OGTA 1NGXB 2GITA 5JPMB 4FFZH 4JFFE 4N0RA 1FVCA 1V7NH 2QBWA 4YHLH 1LEGA 1KJ2H 4IS6B 2IF7A 1RZ7L 5KSBE 2DYPB 1AE6H 1T1WA 1IGIH 5IMOA 4JVWA 2YXFA 1XF3B 3TIEA 4I3SH 3MLTB 2CO7B 1NAMA 4PGDA 5C1MB 3MV7D 1XR8B 3GK8H 5IHZA 3QO1B 1MCSA 3O4OC 5D7SL 3GMNA 1CFBA 3H9SA 2FWOB 3RDTB 4PJDB 1ETZB 2EXYD 1AR1D 1I85A 4L4VE 3RUGE 2X4TA 3OR6A 3NA9L 1YJDL 2VSDA 5I1EH 3IDJB 1NGQL 2F5BH 5DD1L 1QEWB 4KMLB 4L9LB 2VC2H 4JQXA 5DMIH 4EQ2A 4OZIE 4BH8B 4HKBB 1EMTH 4LKCA 3GSRA 4FRWA 5HI5C 4LP5A 1RJLB 4BM7A 1KJMA 3BVNA 4OD3L 1Y18B 3F5WB 3OJVC 1NCAH 5E8OA 4DN3H 1IEBA 2JCCF 1S9WB 4BFIB 1QSFA 5J56B 3QHZL 3ZE0E 1DFBH 2FEDC 2VDKH 4R90L 3O6MH 1UM5H 2E27L 1VDGA 3MRPA 4ZUSA 3ARDA 1J0HA 4GKOA 1NBYB 4R7NA 1G7PA 2O5XL 4GQ9H 2FGWH 2Z92A 4QGYA 4ENED 4P2OC 4ZTPH 4OM0H 4OZ4B 1AGDB 1KIRB 4IOFC 3HR5B 2EC9U 4U1KA 2OJEB 2NY5C 4WDIA 4WI2A 5LGHH 5I6XC 3HC0B 4NC1E 1QYGL 2JELL 2PO6B 1KCUH 2X2YA 3U1SH 3CFCH 1R0A