3DO7B

X-ray structure of a nf-kb p52/relb/dna complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
293
structure length
293
Chain Sequence
GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRDSDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*DCP*DGP*DGP*DGP*DAP*DAP*DTP*DTP*DCP*DCP*DC)-3'
publication title NF-kapppaB p52:RelB heterodimer uses different binding modes to recognize different kappaB DNA
rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 41
structure length 293
sequence length 293
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00554 RHD_DNA_bind Rel homology DNA-binding domain
B PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3do7B02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 3do7B01
1AR2A 3VFTB 1ZA3B 1UJ3C 4JQVC 3S4SG 5K9KA 4ORGA 4JM2D 4YHIB 3IDYC 2JK5A 3CFKB 2VXTL 2KPNA 4LARH 2FIKB 1QLRA 5DFTA 1YQVH 4HKZB 5DZLA 3WBDA 3VXUE 4F7TB 4J3XA 1JGLH 3B4NA 3OKDB 3ARED 2Y9RT 2YWZA 5L8KB 2VISB 1T1YA 3TVMD 3EYUH 4KDWA 3ELAT 3GSOB 4PTUA 4FQ2H 5JQHC 4UT6L 5IM7A 5DD6A 3LH2H 3K1KC 3DX7A 3AU1B 4EDXB 3X13A 1N6VA 5C71A 3L3HB 5CP7B 2R23A 4NCC1 5T1LA 5CP3H 1EVTC 5GIRA 4DAGL 1U2CA 1MAJA 1IEAB 3FFDA 5I1GH 4HGMA 5E9DE 1IBGL 3PIQB 4LDOB 4NC0B 1QSZA 5DMGD 1MRFL 1Z3GH 2R9HD 4G7VH 4NHCH 3BE1L 2DI9A 5B39A 3PDOB 3N0PB 3EOTH 4LDEB 5KVEL 2DRUA 3G5XA 4E0RB 1PLGL 5JO5B 4XBGA 2Q86B 5J13B 3ILQD 4POUB 3MLWL 1Q0YL 4ZFFA 5EOTB 2DQCL 1RZKH 1YN7A 1IGIH 4L8DA 3V6FB 4UTAL 3BRGC 3DIFB 1AD9A 2L7UA 1UYWL 1XIWA 4I18B 4W70A 2XFXB 1F02I 1KCUL 3MLUL 3TBSB 1T3FB 3WFHB 5FA4A 3CVIL 4NKMB 3VGAC 4I2XA 3VDAA 1J0HA 3DMMC 3TFKD 1F97A 4WUKL 4MX7A 3QDGE 4PRAA 2YHGA 5DJ2A 4XH2B 2V9QA 2XZAH 4CNIA 4OCNC 3HLAB 1YQ2A 2ATKA 1CFVH 5L88L 2W65B 4WUUD 5BZDA 4LLVA 4XMLH 4Y4KA 1I1YB 4M7ZB 1YDPB 3ZHDA 2N7AA 5MP6H 1RI8A 4PP2B 2VSCA 2R1YB 4PY7B 1DVFB 1CLZL 1MQKH 3HZYA 1N3NA 4IM8A 3RA7H 3U0PA 5ANMA 3QJHB 1QSFD 3RL2B 2JJSA 5D1ZB 4U7MA 3S96B 2XRAH 4MSWB 1EA9C 3BGMB 4KAQL 4NSKB 1FG9C 3O3BB 4I8DA 2OLDA 3L5XL 5FYJD 1JZ4A 1OY3B 4NCC2 4KI1A 4P4KD 4HSQA 1BF8A 1OL0A 4NYLA 4RGND 2BP3A 2XNAA 4QT5A 1UACL 4NN5B 1NFIA 1JJUA 2AV1B 1O5DT 3T0VA 2VLRD 5BRZD 1KG0A 4DGIH 1AGCA 4IMKA 4GRLA 3WUZA 3TNNA 4OLZH 5ESVB 1G6RL 5L0QB 3D18A 4MJIB 3ARYA 3FT3B 3I02B 1QLEH 2ID5A 5I9QB 1CR9H 4CAGA 1H0DB 1Q1JL 4Y5YA 1JTPA 1BLNA 1BWWA 2YD7A 2F54A 2HKHL 1S7RB 1XF4A 1EO7A 1MCWM 3TZVC 5IP4A 1YEIL 4ZDHA 4OCSL 4TTDD 5IB3B 1XT5A 1B6UA 4NBZB 5AZEL 4Y1AA 5FM5O 2J8UA 4QYOB 3NFNA 2Q20A 1P4BH 3WE6B 5I71B 3QCTH 5FYLD 3SCMD 1X5LA 3HNVH 3N9GL 2OTPA 4UNTA 2Y23A 4F58L 4PJGA 4ZS6D 1JPGA 4FQ1H 3GSXA 1WAAA 5JLZA 4QCIB 3GJFK 4P46D 4TSCL 4LKCB 1XF2A 1HILA 2AAVA 1N64L 4IS6B 4BUHA 3GMRA 1MI5B 4RFEB 5B4MC 3T8XB 4HLZH 4PREB 1FO0B 5C2BH 4UBDD 2YEZA 4Z5RB 3BP7B 4HG4K 5J1TC 2DQTL 2VDML 2D2OA 3MREB 2FYYB 2VQ1B 3DV4A 5IIEA 4HH9B 5I66B 4PJIE 1MHEA 4MLIA 2ADIA 1MNUH 5L6YH 2BVOA 2R2BB 5E6IC 1MFCL 1V3LA 1U8MA 2IALA 2XPGA 3UZVB 1W8OA 4Q9RL 4XPHL 3VXRD 5JW4R 2HKFL 3HHRB 3I2CL 3IVKB 1N6QH 1I8IA 2EE2A 4Q74A 4YWGH 4D9RD 1SEBB 3WXWH 3WEXA 1J1PH 3IXTB 2WNGA 4ZFOB 3PV6B 5DLML 2AJZA 3AAZB 2F53D 3HPJA 3SQBA 4QHKJ 2DYPD 3M1BB 5T3ZL 3MMEB 4MAYB 2MCPL 3NN8B 2NW3A 4BFEA 3ZKSD 5BO1L 1YEEL 3EO9H 2E7BA 4YHNB 3HE6B 3ECBA 4NZRH 2IBBA 4LPXA 3G5VA 1I1FA 1X5XA 3WXVL 5ISZD 5KBNC 4XP9H 4TUKL 1RV6X 2ICEA 3E1F1 3P73A 4O2CA 3EKCA 2JCCF 5C92A 5J1AA 3VD5A 4ELKA 4UT9H 4NZTL 2ZKHL 3FOMA 1XF5B 3VXUB 5DEZA 1AGDA 1S7TA 2VNCA 5GRVL 1U3HA 3VGFA 5IMKA 2V2TB 3PP3K 1EFXD 3K3QA 1X5GA 1L6ZA 2D4FA 1KGCE 3CZFB 4DVBB 4R96B 2ILLA 4HMEA 1BREA 2E9BA 4AZ8A 5ABDE 2FX8L 1NMBH 3EJYD 3T3MF 4XPAH 4U1KB 5AG9A 3QPQD 3DVNB 2BK8A 5BV7H 4KRPC 4EKXA 4NKIH 1OSPL 2A73B 3PXHA 2APWA 1MCDA 5LBSH 2MQ0A 4L8BB 1MFBL 1F6AB 3I6KB 3MUGB 3EJZD 3MRMA 5JDSA 3V6BR 2HT2C 1CGSH 1L7IH 4ETQB 1IAIH 2VAAA 3CFJB 4OZHA 3EFDL 3U1SH 3ES6A 4O2EA 5SWZA 4L4TA 1M6OA 3GSNL 4APQA 1GGIH 1HSBB 1MCPL 3HKFA 4Y2DA 2ARJQ 5EBMB 1WC7A 4M8QB 4JB9H 4Y19D 3W0WE 4MJ4A 5C0RH 2B39A 5JQ6L 4HK3J 3V6ZB 3D0VB 3LEXA 5I0ZA 4UI2A 4H20L 4D8PB 2Z9TA 3ZHLA 5KSVA 4JZJC 1CE1L 5D6DA 2C1PA 3LSOA 5D1QD 5CGMA 4R9HA 1NCAL 3E3QC 1RUAH 1BEYL 2VZUA 1NCUA 3FT4B 5DD0L 1CTOA 4PJGE 3JUZA 2DTSA 2VL5B 1NEZG 1VFBB 3BT2H 2FX7L 1P7QD 3W2DL 3ZSTA 1MJ7H 4NPYA 1LD9B 1H15A 2AEQH 3E8UH 1S7WB 4N0UA 1ZAGA 2FBOJ 3QFJD 3K46A 4D9LL 2QADD 4LCCA 1MJUH 4XPBH 4PD4J 4FXKB 4KJPD 5LXGH 1VFUA 2XTJC 4TTGA 2XG5A 4YDJB 5E1AB 4P57B 1CGTA 4HGKC 3ILPA 4MB5A 4P5TA 2W38A 4HJ0C 4L3EE 2YRZA 2K7QA 3GHEL 3OXSA 4ZAKA 3CVHA 3QIUB 3TA3C 4XP6L 3C5JA 3TYFB 4O9HH 4ZUTB 2NY3C 3LKRA 5I1IH 2P8MB 3C5ZD 4MDJA 3SGJA 4G8GD 3VFWA 2J8OA 5EU3B 5EZJA 1PKOA 3ULSB 3QNYA 5F71A 4QHKI 2XY1A 4N90E 5C3TA 2V2XB 2BRRL 1U92B 4JEGB 4RWYH 4ZXBA 1L7TH 4KVNH 3MUJA 2V7NA 2I07A 3C6SA 1G0XA 1BPVA 1R3KA 2DIJA 4RGOL 3TCLB 2ZNWA 2P43B 4X99B 1TZIA 4Z7QE 3O2DL 5D7KD 4V2CB 5CEXA 5ITBH 3ZE0F 2VABB 4XP1H 5K9QG 1AXTH 3UDWA 4GSDH 1H3PL 5EBLA 4AH2A 5AYUH 1MJJA 2QQQA 4CRPA 3VFRA 3O2WL 4NWUL 1OARL 2VUOA 1BVOA 3H3PH 3GUTA 5DVMA 3QQ9C 4ZPVA 2EH8H 5F6IC 4GO6B 3MLRH 4Y8AA 2GJ6A 3E6HA 2VXSL 4FP8H 3WV0A 1S7SB 2CR3A 3U0TA 3SKJL 1KJVB 3FO9B 5J57B 1MELA 2P7TA 4C56A 1I9EA 4J7RA 2VTFA 4JFFB 5IW6A 1U93B 2IAMA 2I26N 2CIKA 3FB5B 5I1EH 4CBPA 4XCFL 5B22A 4M48L 3EOBB 1F42A 1WZ1L 4P2OA 1CG9A 4NGHL 3EFFB 4PJIB 4UU9B 2EIBA 2EXWC 5SWSE 1F3DJ 5ID1B 5DEFB 4XMPH 4FNLL 5ETUA 4X6EB 4ZFZB 5C0DB 4PGCB 2F5AH 5JNYA 3QPXH 1BZ9A 1T1WA 1TETH 4M5ZH 3QXUA 1UA6H 4OQTL 1P4LB 3JZ7A 1JNNL 3TO4C 5DUBB 4HFWB 2FJHA 5DT1H 3EAKA 3OKKA 5CINH 4MD0A 1R5IA 1N2RB 1C08A 5BQ7B 4K94C 5F7UA 4NHUB 4B5EA 5EB9A 4H5SA 4NN7C 5ESAB 1OTTD 5FYKE 1SEQL 2XZCL 1ZWIB 4BSWA 4JJ5B 1I1AC 2VWEE 3NOIA 3C5SB 3ARDB 3H2WA 4U1JA 2ZUVA 1ULVA 3WNOA 3MNZA 1Z6JT 1T80A 1PD6A 5GSRB 4ONHB 1B0WA 2R2HB 3NCMA 5LCVL 3OKEA 1KEGL 4YIQB 5AWNL 1WCBB 4X5LA 5F1OB 3WKML 5HHOE 3DRTA 2VZ3A 5JZ7D 2OJZL 1ZS8B 1DN2A 3ZSSA 5GZOC 3ARBD 4JM4H 3DSFL 1AC0A 3WD5L 3KAAA 4JAMB 1ED3B 5BOZG 3G04A 1F6FB 2UUDK 3KPTA 1KCRL 1CU4H 3AS1A 4F80A 2R2CA 5A16B 3ULVE 4XTRC 2OCFD 4N5ED 4GQ9L 3QWRA 3VRLF 3OBAA 4Q9BA 3EDDA 5E0QA 5E1HB 4N8VA 3DVFA 3P2TA 1CE6B 3VXNA 3U46A 1BZ7A 1MWAA 1X7QB 2EH7H 3QUZA 3HE7B 2CH8A 1ITBB 2C26A 3VMOA 2VZSA 3E6FA 2UY7A 2DOCA 2WP3T 4RRPG 2GJJA 4TUOB 4G9FA 4U4BA 2L4OA 1URLA 4ZUSA 5DJXA 2H2SD 4F7EA 4M6NH 4HC1H 3FB8B 2X4TB 2QSQA 1XR9A 2EDOA 1MIML 5L9DH 4UINL 1RFDH 1ZV5A 3CH8A 4K3EL 4PBXA 3LB6C 2F8OA 2PYEB 3OAZH 1ZSDB 5DJ8B 4ZOBA 2R39A 1VGEH 43C9B 1G7HB 3O8XC 1JGUH 1TJIL 3PGFL 3VXMB 3W0WB 1TNMA 3R8QA 2FH8A 3T1FB 3V7MA 5TDNA 8FABA 4HLZG 1RZGB 4JRXE 2AXGA 5D72H 2AKRA 1LK3L 3FB6A 5J4MA 3RL1B 3BQUA 4JY5L 3GMMB 4HIIA 4IRJD 4PJ9A 5L2KB 5FXCH 3Q0HA 5DD5H 3D25A 1HHHB 2YPKA 2CD0A 1LNUA 1UM5L 4KKCD 4NBYB 4IDJL 5LQBH 1VFMA 4ODSH 5I18H 3GSVA 4KWUA 2DBLH 4X9HA 1V3MA 1D5MA 1R24B 2J5LC 1ZA3A 4LQFL 2EDTA 4XVSH 1Y6NR 1CBVL 4YHIA 5A2IH 5C0GA 3CFKA 4XNYH 4JFZH 2F58H 3OF6D 2NY4D 1GC1H 2B2XH 3DHJA 3LHPL 3PV7A 4Z7UE 5CEZE 2IQAB 1S5HA 3CSYB 4F7TA 3EIFA 2CRIA 3U2SB 1A1OA 1S9WA 4NC1C 5TFSL 3O6KH 5CHNB 2HFFA 4JQXC 3GSOA 4E41A 4MAUL 2AJVH 3MJGX 4YK4B 1A1NB 3GSRB 2IH1A 5CP7A 4F33B 4KKAD 3HZKB 4NM4H 3MGTB 4HIHB 2QSVA 4K94L 5DRZA 4QWWD 2BXYA 3LEVL 3RIAK 3Q3GA 4ZOAA 5E2UL 2NX5D 2BERA 3BP5B 4OF6A 4HIEB 1FDLL 5C86A 3PIQA 4P23C 3VXOB 2PCPB 4Y4FD 1NEZB 1JCKA 3KXFD 5BS0D 2HWZH 4XVJL 2VLMD 3MNWB 2GAZB 5D2NC 1FLRL 1RUQH 3T0EA 12E8H 2Q86A 3IGAA 1LO5B 1U95A 4FTVE 5TH2A 5DJYB 1CVSC 1P2CB 1WLHA 3H9SE 4JG1L 2R2EB 1RUMH 5DR5L 5TF1L 3BPCA 1A3LL 1JWUB 2DLFH 3V6FA 5C0EB 4WHYH 1BFVH 4MNHB 3PQYD 4I18A 1D6VL 4JR9L 1U8JB 5HSFA 1U8HB 4Y5XB 1A6WL 3TBSA 4D0CB 4LBEA 2LU3A 1JZ8A 5GGVL 4NKMA 4PJ8B 4HJGB 3VI4F 1QNZL 4NP4L 1EHNA 7FABH 2R4SH 5E08L 5T3XD 1JHTB 2G2RB 3LDBC 3MRHB 5I1LB 4CN1A 1Y0LB 2NZIA 5CZXD 3ZYOA 3EO1A 1BJ1H 1N0XL 3PWPD 4L3CA 4OD1L 5D7IB 1CGYA 3HLAA 4ZQKB 3RVUC 4NDMB 2X4UB 2W65A 5EUOF 3VXSA 1I1YA 1UM4L 2NW2A 1YDPA 4KK6D 1HZHH 3OQ3B 3DO3A 4PP2A 1JF6A 2BNQE 4PY7A 1NFKA 2YD6A 5IVOA 1T03H 3QG6A 2VLKE 3QJHA 3RL2A 3NIGE 2EZ0C 2VH5L 2L7JA 3BGMA 5AYQA 3O3BA 2RIKA 4PB9H 5IBTH 3VFUA 2NTFB 1FBIL 4J12A 2EDRA 5DMJB 3P4MA 3ZMRA 4K7PY 4PJCE 5DA4A 3BKYH 5DJ0B 5F9WB 2IANE 3O0RL 2AV1A 1REIA 1C5CL 4NRZA 1YUHB 2VE6B 5KG9B 5ESQB 3GIVB 4LASH 5DJDB 3HR6A 4JCMA 4PLOB 1ZKAA 2HTLD 4WY7L 1TVBB 2NR6C 4N0FA 3SJVE 4RCAA 2FJFA 3FT3A 4M7LL 3VA6A 4FABH 2BY2A 3QIBD 1H0DA 4NQDB 3QAZC 1G7MB 3RI5K 3T4AA 3MLZH 4JFDE 1TITA 1DLHB 3QWOB 2MWCA 4LARL 4QYOA 1YQVL 1A14H 4LFHG 4NO2B 4OCMC 1VEOA 4KHTH 3ABZA 3GKWH 2HMIC 2CXGA 5HGBB 3HC4H 1F5WA 2WQ8A 3VXPB 1ZT4A 1MFDH 3EYUL 4MJ2A 3L95B 1JIBA 1DVFD 2KBGA 3QDMB 4RFEA 3T8XA 4HLJA 1FO0A 1I9RL 2CIIB 2AEPL 4NKQB 3WFCH 5IW3A 4E5XB 2XKUA 1T83A 3S35H 5HI5C 4XB7A 1MCLA 5I6XC 2VQ1A 3HCVB 1M71A 4UNUA 5I66A 2ZCLH 5I1GL 5HYJA 2BSSA 4TVPD 5T1KA 3PWJB 1E0OB 1ZANH 4NQEE 2AGJH 4G7VL 1Z3GL 4NHCL 2Z31A 2GEEA 5JIHA 4G6AC 4X6BB 2J6EL 3UTTE 3EOTL 1QR1B 4P3CH 1EXUB 3AB0B 3TIDA 4X6CB 1VHPA 4QRQB 4WFGE 1ADQA 4XBEH 1J8HB 4L9LC 1UXWB 5I16A 3EGSA 1DL7H 3IXTA 4OV5A 2JCCA 2X4QB 4JRXB 3AAZA 4J1UB 1E4JA 2B0SH 3M1BA 1LDSA 2APTA 3MMEA 5I1DA 4LEOB 2K3TA 5I8KH 1HH6A 4MJID 4WENB 1IGIL 3SDDC 1BX2A 4HX1A 5E8EA 4KV5F 2ED8A 3RTQC 3S35X 2YXMA 3G6JF 1OSZB 3DUSA 5DO2C 3GFUA 3LPWA 4Q6IB 1R3HB 1OTUD 1QBBA 4YLQT 1T2QH 3HI5H 3CDGA 4E42B 2R0WH 5DRNB 2XZAL 1QPPA 4HXBH 1CLCA 5JOPE 4KDTC 1E6OH 2IGFL 3CU7A 5E8PB 2QEJA 1CFVL 1XF5A 4Z76B 3DGGA 3DTXB 2P5WE 5MP6L 4OZFB 5J9PA 4RMSA 2V2TA 3REWB 4RX4A 3KLHC 1ZLWK 3QO0B 5JA8B 5JOFB 5FO7B 2XKSA 3RA7L 4R96A 3TPKA 3O4OC 4U6VH 3QJFB 5BV7C 3V4VH 2ZNXA 2XRAL 3C6LC 3LKQA 3H3KA 5GSVB 1BD2B 3DVNA 3WFEH 3D39B 1K8IA 4LLQB 2IH3A 2Q3ZA 2CKBB 3S5LB 1LO3H 4ALAL 4L8BA 3OL2A 2PF6A 4PRDB 2ITDB 3CFCL 4Y5VC 5FV2A 1YPZF 4GBXB 2WBJA 2FEDD 1EGJA 1TJGH 4U2ZA 5C0JA 4ETQA 2FX9H 2YPLE 1AQDB 2X9YA 4DGIL 4KROB 4OLZL 3HE6D 3WS6A 4RAUB 3S98A 5T3ZE 3FN3A 1QQDB 2DM4A 3V6ZA 5HYIA 5B3JF 3B6SB 5IEHB 3DLQR 3N1MC 1EUTA 3ARTA 1JPTH 4K3GA 1A6AB 4Y7MA 2XA8H 1P4BL 4P4KC 1Z9LA 2YBRB 2NTSP 3HNVL 1HXYB 1FNFA 3H9HB 3VXUD 2XZZA 3MRGB 4XWGL 5HHVL 5BVPH 4ZNEE 5CSZB 5IBLC 1KPRA 1OAZH 2H32A 4FQ1L 2WM0A 4L4VE 1NSNH 4JKMA 1PW3A 5DD1H 1YJDH 3B9VA 5IWLA 2VL5A 1CGVA 4JQIH 5C0BA 4U0RC 3S6CA 2Q7YB 1CICC 1LD9A 3C60D 5JMOC 4QEGA 5DA0B 3S3JA 2BNQB 1IQWH 4FXKA 2H8PB 5D96C 1MNUL 4FQXC 1Z9MA 4OZIF 4CVZB 4YDJA 5E1AA 5E9DD 2H3NB 1F11B 4N0RA 4P57A 1GGCH 2VR4A 3SDCD 4XXDA 5K9QI 1NCBL 4AEIL 2GT9A 3KPRD 4YWGL 1D9KB 1AO7E 5FA3A 4FQLH 3WXWL 3GGWB 4C55A 4BQCA 1FIEA 4Z7WF 3WL9A 3TYFA 1XFPA 2A6KA 3T2NH 4ZUTA 4M3KB 4PJCB 1LO2H 2OI9B 2P8MA 2DLIA 1QEWA 3O2VH 4U1HA 4WO4B 3TBVB 3MZTA 4M7KH 4NKDA 2GUOA 1U3JA 4JPIB 4NNYA 4V2BA 3EO9L 3VWKD 2V2XA 4NZRL 3FRPG 3QDJE 1FHGA 2WIIA 3HFMH 2YPVH 4U6XB 3BIKA 5FYKU 5A43C 5HY9B 4NT6B 3B9DA 4K8RC 25C8L 2AQ1A 4XP9L 2VDKH 4N9OB 4IRSA 4X7EC 3TCLA 5DMKB 2QLVB 3QDGD 4NQXB 4P5KA 4UT9L 2VABA 1KOAA 4GKNB 5FDWB 3T3ME 3EYOB 3IU4H 4LLMB 1KN2H 3BRFA 2YUWA 2ESVE 1CXHA 2AXJA 3CSBA 3QFDB 4NZJA 4S1DD 2VERN 5C6TL 1D5XA 1CQYA 5A3ID 1S7SA 2BJMH 5KW9H 3FO9A 4YBQC 4LLYB 1IEHA 4PJ7F 4JFFA 4Z0XA 1NMBL 4XPAL 2MJWA 3JXAA 4IJ3B 5TDPB 5BV7L 4O2FB 1S78D 3C9NA 3QIWC 4NKIL 4ZD3L 4CL7A 1DEEB 4I0PB 3SO3C 5LBSL 5INDB 3JSSA 2NXYB 3QIUD 1BJ8A 5ID1A 5HYSB 2EDEA 4MXVE 3EZJB 4CW1A 1A2YB 4X6EA 4ZFZA 4PGCA 2YWYA 3UTTB 4ZS7L 3W9DB 3RZCD 1KJ2H 1H5BC 3F7VB 1L7IL 4LF3B 3GRWH 3RKDD 1IAIL 3RVXD 3GMLB 1P4LA 2GJZB 4HFWA 1KELH 1GGIL 1N4XH 1L0XA 1UM6H 3DRQB 5ESAA 5C09E 3DURB 4K55A 1X4YA 2VDRH 4CMMA 5C0RL 2OM5A 2DQJH 4CVUA 3ARDA 4WI5A 3KYNB 3IXAB 4YFDB 4FFVD 4OGYH 4X9GA 1D5IH 5GSRA 2R2HA 4WWID 5I1HH 4YIQA 5HGDA 1S3KL 3B5GA 3VFOB 1LO0H 2DKUA 1RUAL 2X89A 4JPWH 2V7HB 1ZS8A 4GFTB 1L0QA 3TBYA 4Z7VB 3SDXB 2H2PD 1BBJA 3LPFA 5FGSA 3WN5B 4GW1B 1NUGA 4RFNC 2DTMH 3SOBH 3RAJH 3BT2L 2OL3L 4P2CG 5J6HA 5EZLA 1V5JA 1IFHH 1E4KC 3TJHC 1MJ7L 1C16B 1X44A 3CFBA 2AEQL 3E8UL 2P5WB 4DKFH 5J3HD 3NCBB 3ORJA 1DDHB 1MJUL 2NCMA 5LXGL 4ACPA 4DW2H 3T3PF 1CE6A 3VXTB 1CFTA 3LKOA 1X7QA 2ADJB 3HE7A 3RVTD 5FYLL 4XNXH 4L9DA 1PBYA 3MACH 1EX0A 2X4TA 5CZVH 4PLKC 1T0PB 1TPXC 5C3LD 5EG6C 5JXED 3UXFA 4JHWH 4Y4HB 2PO6B 3RJDA 1I75A 2NPLX 2AP2A 2YPLB 2PYEA 3IYLW 1ZSDA 5DJ8A 1S9YB 1GGBH 2DMCA 3OMZA 3TO2B 4RWYL 5FGCB 4XAKE 1AXSB 4KVNL 4NCDA 3UX9B 3O9WB 4U7KA 4JPVH 3VXMA 4D0BA 4DZ8B 4LLUA 5KSBE 4QHLB 4KGLA 5FIEA 4AG4H 4K8RL 2NY0C 4JFQB 2J2ZA 4OM0H 2F74B 3PWNB 4U7SA 3GMMA 4BELD 4XP1L 1FZKB 4EIZC 4GSDL 1CXFA 2BHYA 5K9OB 4MGXA 3W39A 3BO8A 3C5ZC 4LCWB 4PV8B 2EH8L 1J18A 3PDDA 3MLRL 3MGAA 5IBUG 4FP8L 3CDYA 3QEQB 3H9ZA 3MRRB 1R24A 4MNQB 5ICXB 4MQXD 3E3QE 3ETBF 1NGYA 3FRUB 1JV5B 5IVXF 2F19H 1CFSB 1CDYA 5E6ZA 3RDTA 1QYGH 1HINH 4LDLB 1T89C 1TVHB 3UO1H 2IQAA 4OT1H 4UUJB 4XMPL 2Q8AH 2PETA 3T0AA 3SGDH 3VG9C 1JPST 3RNKB 4JFEA 5IMOB 2F5AL 3U2SA 1WF5A 3AROA 3QPXL 5FB8B 4M5ZL 5CHNA 1T4KB 1AO7B 2XTJE 4QXWA 2Q8BH 4N8PA 5GS0H 3E2HC 3B5HA 5DT1L 4AJ0A 1QSVA 4XZUA 4KUCD 1OLLA 2QHRH 4JO2H 5CINL 3AFLA 1J05B 3GSRA 2ENSA 3MV8B 5TDOB 3D69B 4F33A 2XXMB 1UADC 3HZKA 1J10A 4N8CH 4XPGH 5E8OA 5MEQA 4S11A 3W0WD 3ZHKA 4X8XA 5JMRA 1MRDH 3BP5A 2AJUH 4EUPH 3QDJB 3VGHA 3BH8A 4M6OH 4OI8A 2PXYC 5IEKB 2AK4A 5I8CB 2F54D 3GJFH 1D6EB 1NEZA 1BM3L 3TH3T 2OJEB 3U7YL 3GSNB 1ZMYA 1JK8A 1K4DB 1JWMA 1U8OB 3IKKA 3RGHA 4KMLB 3CMGA 3A0OA 2CO7B 3L6FA 4MA8L 4XCYB 2IPKB 4WHCA 3T0WA 1X5JA 2X09A 3CFDA 5D2LB 5C0EA 3TZVB 4ORZC 4MNHA 1CU4L 1KPUA 2ESVB 3P9MA 1U8JA 1JHLL 1U8HA 4Y5XA 5E7BA 5FHBL 1IAKB 4C57C 5KVDH 1FV1A 2VKXA 1H9VA 5IROA 1J8KA 4JFXB 2EH7L 5I2IA 1JHTA 3FQNB 5IB2B 3MRHA 5I1LA 3L1OL 3BZ4B 5JZ7C 4R3SB 4L3ED 1FGNL 5D7IA 2PTTB 4ZQKA 1J11A 4M6NL 4NDMA 4HC1L 3ZZ1A 1JBJA 3MLTB 4NWTH 2G5BB 2AERT 3CX5J 1RFDL 1FIGH 1N59B 4X4XA 3BN9D 4ODUA 2MHAA 2O93L 3H7BA 3ZDYE 5B38G 5E6IB 3KLAA 1MHCB 1EHXA 3K8MA 4OCXH 1VGEL 3GM8A 4N90D 4WU7A 4UDTA 2DQFB 5EA0L 1WBYB 1JGUL 5CP3A 1KF9B 3QA3B 5C09B 2RCSH 4NO0A 1WISA 2NTFA 3CH1A 4QOKE 5D72L 4X6FB 2LTQC 3Q6FB 3OKOA 1CIDA 4JFOB 4YXKH 3PP3H 4XCCH 4LRNH 5DD5L 5DJ0A 5L7XL 5CJBA 5KG9A 5ESQA 3GIVA 5LQBL 3HR5A 2DBLL 1YEHH 3V5KA 2BSED 4FQCH 3F7YB 5F96H 2XQYG 4ZTPL 3WIFB 4WTZG 4NQDA 2QHLA 4PJ8D 2IJ0C 3M45A 4KMQA 2FEEI 3RJQB 1PYWB 4Y16A 3VI3F 1ZHNB 1DLHA 4XNYL 4QXTB 3MNVB 4OZ4B 3MLPA 5IVZA 2B2XL 4NO2A 1ERNA 1XGRB 2EO9A 1CL7L 4YHOH 5SWSD 4XT1C 5F7YC 1RJCA 3A67H 4UILL 2K7PA 1EH9A 2XKNA 2VDLH 3VXPA 5CBAB 3O6KL 4YR6B 3C08L 2J7LA 3QDMA 4U1LA 4ISVB 2AJVL 1DP0A 5E00B 3ARSA 3ZKND 2CIIA 4H25B 1SJHA 3CLFH 2EYRB 4NM4L 1RURL 2CUMA 2BY3A 4URTB 3NFSH 5FYKD 4R4FH 3OKNA 4ZOCA 5T1DH 5CIPB 2HWZL 4X6CA 3EYVB 1DQDL 3P4OB 5HHOD 1RUQL 4DOHB 1UXWA 4PJXE 5KSBB 12E8L 1ZHLB 3VWJA 2X4QA 3CX2A 5HDQH 3NA9L 4U6HA 5EBWA 4IOSD 4XI5D 3MRFB 1C1EH 1RUML 1EIBA 3OHXA 1YNLH 4M9OA 4P2QB 1LGVA 1JUFB 5JW4Q 2VL4A 1BFVL 1DBAH 3NZ8B 2GFBB 3TT3H 3T0DA 3AS3A 2V17H 4JZJB 3L7FB 5EUOE 3WS3A 2YN3A 1FNLA 3LN9A 3CMOH 4Q6IA 1FFPA 3PP4H 3ULVD 2Z8RA 3QI9D 1J1OH 4WFEE 1IQDB 2R4SL 4OB5H 5M7QA 5I1JH 3U4EA 3PHQA 4NQCA 1RVFL 4UT7L 2MMXA 1EEQA 4JY6A 3BKCH 4WI6A 4JREC 5ELIA 1BJ1J 5E8PA 1DQQB 3IFOB 5EU4A 3X11A 1RMFH 2UZXB 3RVVD 4Z76A 3DTXA 4JANA 4L5FL 2LE9A 4OZFA 5IJVB 1IM9B 5A2KH 4PJBB 4HUKB 1A3QA 3REWA 3KG5A 2OTUB 2HFTA 4XNMA 2XTJB 4LK4A 3MYJB 3ZTNH 5JOFA 2V9TA 3OGOE 1XF1A 1T03L 3CFIC 3QXTA 2ZUXA 3QJFA 5F1SA 2EDNA 4NC1E 4Z6AT 1OGAA 4BM7A 1BD2A 4PB9L 5IBTL 3SDAA 3MJ7A 3J8F7 4IIQB 5GS3A 3V4UH 4LGRB 4FFYH 4W68A 2GSIA 4YXHH 3L3GB 2F8XC 4QHUA 4JRXD 2ITDA 5DHXB 2JLLA 2QKIB 3ROOA 4G80B 3EUUA 1J88A 1NUFA 3DX6B 4AY0A 2A6DA 2OTWB 2WUCH 2P8PB 4KK9C 1PEZA 1F4YH 1AQDA 5FUOH 35C8H 4LASL 3QH3B 1T22B 4GRWB 5GZND 5CCKH 1X5FA 1C5BH 3UTSE 4HBCH 4HHAB 4JDVB 2COQA 1EEYB 4FABL 5F1NA 1YECH 2GYSA 3C8KB 5FKPB 3MRDB 5AD0B 5EU6B 1QQDA 3MA7B 3SDDA 1T7XA 1CLYH 3FO0H 3B6SA 3LRSB 5DWUH 2VZTA 3I50H 4LAQL 2VXQH 4PRIB 2NY1D 3VRJA 2IBZX 2WK2A 3N1FC 4OLVH 5ECJE 3U79A 3VFSB 3CLEH 1FH5L 4OZIA 4P4RB 4KHTL 5J7CC 3RWCA 3QUYC 3H9HA 5F6IB 4PJDF 2OX5A 4GG6F 4LHUG 1YJDC 3BP4A 1XCTB 4LVNB 4CADB 5KSAA 3WNPA 3RGVA 1U8QA 5FEBA 1EMTH 3MROB 2YSSB 4Z7WA 4PG2A 3ESUF 2YKLH 2Q7YA 1T66D 2AEIT 1OVZA 4HEPG 3WFCL 2NYYC 5IGXH 5IFJB 1CDJA 2B1HL 3S35L 3P0GB 4WEBL 5A2JH 2AABH 3UEZA 3IFNH 2W9DL 1ZANL 1F8TH 2X4PB 4CVZA 5H37H 4ENEC 2AGJL 1WZKA 4MQ7A 4XVUC 4KV5E 4GLRH 1WIOA 2Z8VC 5TPWH 1RQ5A 1U8KA 4OZGE 4P3CL 3G6JE 5F1IA 4W4OC 1DL7L 1NL0L 2YUXA 3LRHA 2YOCA 4KROD 4QOKB 4EI5B 2UUDH 4FXGB 3N06B 2B0SL 1NDMA 4P2RB 4NN7B 4FTVD 3H9SD 3HS0A 1I1AB 3TBVA 1NKOA 3EYSH 4KGJA 4JPIA 2EXYD 4ONGL 3L3OA 3VMNA 1RIUL 2Z8SA 2HG5A 1QFOA 4UV4H 3MRIA 2EDXA 3HMXA 4RQQA 4NT6A 3RWEB 1BJMA 4P59H 2VZOA 3HI5L 5IKCB 3IFPB 2EE6A 4KDVA 3CCHB 5DMKA 4G6JH 5I8EA 1WFNA 1YN6B 1I4FA 2Y5TB 1N5YH 5DD3H 2X41A 3PL6D 5FDWA 5B38B 1MCIA 1XGQB 2P45B 3ET9F 3Q6GH 3KPSE 4LLMA 1IEBB 1P9MC 3K1DA 1M7IA 4RZCA 2UWEE 4EJ1C 1Y6MR 1ORSB 2UYLB 1XF3B 5MENB 5D7JA 1II4E 2FGWL 1YPZE 3QSKB 2BNQD 1Q38A 5LG1A 3IDIB 4Q7DA 5HGAB 4PGZA 2VLKD 2R0ZL 5TDPA 2IC2A 1DEEA 3WNNA 1D9KD 4I0PA 1HQ4B 2BY1A 5DVKA 1DBJH 1LO3L 4HBQA 1G9EA 3FKUS 3WO4C 1JRHL 2V5YA 4D2NA 1A2YA 1JYVA 5B3JE 4R4ND 3MJ8B 1ZVSB 1TJGL 1W0VB 5C0CB 2WLYA 4LF3A 2FX9L 4WO4D 5EOCH 2IAND 4DEPC 4PJXB 3U4AA 2FDBP 3GBML 4PJ9D 4LPTA 3FO2B 3ARFC 3LS5H 5GXBB 2W92A 3DRQA 3SE9H 3SJVD 5CMAA 3DURA 2WMPA 3TN0C 1J5OH 2BVPB 3HMWH 4F9LA 3LKNA 3H6JA 3RHWF 1BQHG 2E27L 4AK1A 3KYNA 2BOBB 4DGYH 4JFDD 4LVOC 1NDGB 4U1MB 3LN4A 1ETZA 5DHVB 3WJJC 1HXMA 2CLRA 3R06B 2ZUUA 3RUGF 2DQDH 4PJEB 2OMBA 3VFGL 2OSLB 3NABH 1IE5A 5C08E 3BJ91 4O51B 1JYXA 1YA5A 3KJ6H 3SDXA 5I73B 3MO1B 4UTBH 1NSNL 4G9DB 3STLB 3WUWG 3O6LH 5DD1L 1M1SA 1TZGH 1YJDL 3IAQA 4LKXB 5DK2B 3QXDA 1RZJH 1MUJB 2DQIL 1FPTH 3E0GA 1DDHA 1IQWL 3WMSA 5BOPA 3KNBB 4FQJH 4HS8H 1FVCB 3ARGC 3RU8L 2NXYD 3W11D 4HWBA 1QOKA 5HDBE 2UVFA 1GGCL 3IDMA 4NQED 4PJAE 3IDXH 4OBRA 3V5HB 3UTTD 4U33A 1FYTE 1AY1L 1NBZB 2EYSB 1S9XB 4WFGD 1G7PB 2P46B 3T2NL 3IAGC 5BMFL 2C3VB 4LPVA 1KBGH 1CXLA 2XYCA 4Y4HA 2PO6A 3VRIA 1YY8A 4CDGC 1KXVC 4PJFF 4M7KL 3B8YA 3PHOB 4P23B 2YR3A 3UBXG 5D7LE 2AV7B 3HFML 3QXVA 3UTSB 1RULH 2YPVL 1AXSA 1QRNE 4YQXH 3O9WA 5D2NB 3GJEB 4QRRA 4TVPL 5DQJB 5D5MF 5IVXA 2VDKL 3SDCC 3V5DA 3FFCB 4QHLA 2B4CH 2A1WH 4C83A 4UNVA 4L8SA 4PJ7E 5ALCH 1X6LA 4OGAC 1IVLA 1QSFE 3V6OC 5JOPD 4HPYH 1FZKA 3QUMA 4HPOH 2JJUA 5K9OA 3IU4L 1KN2L 4OFPA 5DSCA 4LCWA 4PV8A 2P5WD 5CBEA 1AGFA 5ICZA 1CF8L 3EW3B 4ODVH 3QEQA 3RY6A 3VWKC 4MNQA 4WI2A 5ICXA 2BJML 2B1AH 4LOUC 4I3SH 3LDBB 4WWKB 3RWIB 1A7PH 4X7FC 2OMNA 1T04A 5BRZE 1AKJD 1CFSA 5JW5A 5JA9A 1JPFB 2XWJB 3TBWB 1VFAA 2Q1EA 4P9ML 3VFNB 4W6XB 1XGUA 1UJTA 3BXNB 4UQ3B 2CJUH 1YMMB 1YEDB 2QBWA 1CXEA 4GAYB 1IILE 4WNQA 2BHZA 4G6FB 4MJ6B 4EN3A 3RNKA 4MXWH 3AS2A 5F21B 5IMOA 1QO3A 4DVRH 4M9PA 5FB8A 5GS0C 1KJ2L 4OZGB 1MWAH 1T4KA 1MCQA 4WEUD 3GRWL 4S1QH 3RX8A 1JVKA 2YPLD 2OZ4A 1KELL 1Q9OA 3LS4H 3JVGC 3D85D 1N4XL 2R4RH 3QBTB 3MBXH 3MV8A 3UP1A 5IT2L 4MS8C 2D7NA 2VDRL 2HLAA 4UIKH 4G6MH 5T3ZD 4PG9A 5HYQA 3T77B 1OPGH 4CKVX 1A6TB 1K5NB 1DBMH 1D5IL 5GHWH 5I8CA 1EBAA 5IEKA 2IBGA 1M4KA 1UC6A 4KI5C 2AXFA 2OJEA 1AGBB 1LO0L 3VH8B 1AHWC 4JRYE 4JPWL 1K4DA 1UKSA 1OB1A 1FZOB 2H45A 3LKSA 3S36H 2FR4A 1EUUA 2N56A 1U8OA 3FAXA 4ZSOA 4HZLB 1A6UH 3EDEA 4X7TB 3RVXC 2VLJE 1HHIA 2VC2H 4XBPB 1QSEA 4PRPE 5FUCC 3GIZH 4L4VD 4DFHA 4KTEL 3IDNB 3SOBL 3RAJL 3D2UD 1MHHA 1UEYA 4XCYA 2DKSA 5I15H 1IFHL 3DMMD 5D2LA 1QR4A 1LO4H 1OP3K 2YA1A 2VDOH 2UWEB 4DKFL 1E4XH 2W60B 2A83B 4KKNA 4PY8J 5E2WH 5LGJA 1IAKA 3RWFA 1FNHA 4X4YB 4PRBB 4DW2L 4L29B 3HUJF 1W0WA 5IR1B 4JFXA 5DFVC 3LCYA 3R4DA 5IB2A 3QEUA 2R29H 3EDJA 1HWGB 5HYJD 3UTPE 4XNXL 5JHDE 5ENWB 1XR8A 5DQ9A 1WBXB 2H2PC 1AO7D 2PTTA 3S36X 2Z31D 4QF1A 5SX5K 3MACL 2OK0H 3O6FB 5FOBA 4MZ2A 3WDJA 5I6XB 4Z77B 1NGPH 4JHWL 4BH7A 5T33H 3BFOA 4JM2B 1N59A 5EOQH 1J1XH 4JKLA 1PG7W 1B0GA 3BZFB 1GGBL 1MCCA 1VERA 4X98B 3SN6N 3QDJD 1WWWX 4E9LA 1NLDL 3AREB 4HDIA 2IFFH 5LWYH 4JPVL 2VR5A 4K9EH 4AG4L 4X6FA 1JGVL 3Q6FA 4OM0L 1VEPA 4JFOA 4ZYKB 3GSUB 4YNYB 2F5BH 1FFNB 1ZLWH 4LMQI 1MLCB 2ARWA 2AI0L 1LEKB 3GB7B 5HHME 3TZVD 3DUUB 3JTSB 5H37G 2BSRB 2ESVD 1YYMH 3VFMB 4UQ2A 2XN9A 4H1LG 4FG6C 3ZO0A 2DN7A 4YEFA 4NKOA 3AVEA 1HSAB 5TE4H 2GK0A 4TRPH 1XIWC 4WW2F 1ZHNA 5C07E 5DZOA 1HINL 2CDEB 3UO1L 1IGMH 3FONB 4HS6A 1BIIA 1XGRA 4OCLC 2Q8AL 1HHKB 3OJMB 3JV0A 2LABA 4PJAB 2R15A 5CBAA 3DV6A 3QO1B 1MVFA 3ZLQC 5GS0L 1KCSH 4ISVA 5AG8A 1WT5A 1IM3B 4JO2L 2QHRL 5E00A 3C6LB 1QFWM 2XXCB 4Y4KC 3QQ4B 1RK0B 3QNZA 2EYRA 3R1GH 2FECL 3N50A 2ED7A 4X5XA 5C09D 4GMTH 3D3VE 2VDQH 4OGZA 1TQCC 4ODBD 4XRCB 2AJUL 5D7LB 1MFEH 4WUUB 2X1XR 3KWWB 3FQWB 1T1XB 5J0BA 4XPTL 4KKBC 1UZ6F 2AS5M 3EYVA 3P4OA 2Z4QB 1IT9H 2GTWB 2DD8H 5IOPB 1ZHLA 2HFGH 3GMQB 4DUVA 3A6OA 3FB7B 4RGMC 3CSPA 2ZOLB 3MRFA 1QSFB 4HG4J 1NAKH 1WEJL 2NY6C 3WHE0 4YHYB 3CPLB 5SWQB 3RFZC 4P2QA 4XCNB 1JUFA 1FORH 3NZ8A 3WHE1 2GFBA 4IMKC 4GRLC 2VXVH 2VLLB 3FCTA 5HJ3B 1BMGA 5KZCD 3F6IA 3IJHB 5C0BD 4P4KB 3L7FA 1C7TA 1A8JH 4UOW0 5KVDL 3QHFH 2PW1B 4RGNB 4UOW1 4Y5YC 4XP5H 4C4KO 2VLRB 3MYZA 5BRZB 2OL3B 4HKBA 1GGTA 4W6WB 5F7EH 4GMSL 1FSKB 1NMCC 3CX5K 4DUXA 1K4CA 3V2AR 1C8PA 1EFQA 3F5WB 1MCBA 4U0RB 2VMFA 2BSTB 3IFOA 1FZJB 1QLFB 4NWTL 1BOYA 1PX3A 5IJVA 3MBEA 1FIGL 4JFHE 4PJBA 4KRPD 5EU7C 3WJLA 5IHZB 5D96B 2JIXB 3QCVH 1MVUA 3MYJA 1PGRB 4WU5A 2Y6SC 3HAEB 5C0AA 2VO5A 4MNGA 3SCMB 1B0RA 1NGZA 1FO0H 4NQVB 4XAKD 2DWEA 1OWRM 3HG1A 2EE3A 4P46B 4R97B 1G1YA 4ZUWA 1GCFA 4HWNA 4IIQA 3BPLC 3L3IA 3L3GA 3VE0B 5HHQB 3L5WB 1X4ZA 1A0QH 4JGMA 3FOLB 4YXKL 1NBQA 5LGKA 4G80A 4DKEH 3MLSH 4LRNL 2AJ3B 2OTWA 2DF3A 2E7CA 4X6DF 2AJYH 3UTZB 4JRYB 3UTQB 2P42B 4MQTB 3QH3A 1T22A 4ELMB 3BEWB 5FCSH 1ADQH 4HCRA 5K9JH 2OXGA 2VLJB 1YEHL 4FQCL 5E5MB 2X4RA 4PRPB 5F96L 4HHAA 4Q97A 4JDVA 2AJSH 4R7NA 3PNWB 3VXRB 4P3WA 2OP4H 2EEDA 3NTCH 2XN9E 1KTLA 3MRDA 3RWHB 3B8SA 1JP5A 5GQBA 3OGCB 1PSKL 4ODWB 3LRSA 5IFHH 1WBZB 4I0KA 2F53B 5CEYB 4BUGA 4BH8B 2R69H 2DYPB 4J4PA 4P4RA 4YHOL 1FZMA 1JWSA 2X70A 4M7LT 3V0VB 4EEEA 2UZIH 1U8IA 3BW9A 2JTDA 3T4YB 3UAJC 5FK9A 4B53A 4CADA 1IM9D 1F4HA 2MOVA 3C2SA 5I17A 1SYVB 3V7AG 2YSSA 2XTJD 5HHXL 1MH5A 4I5BB 3TIEA 1RJZB 3OZ9H 4MWFA 5F44A 2C4XA 5ISZB 1A7OL 4JZNB 3OJDB 1U3HC 3LKPB 5F72S 3CLFL 3LEYH 3QIWB 4HJ0D 3VW3H 4QRSB 4GUPB 1GHFL 3T2OA 4BK5A 3NFSL 4OFKA 2NXZC 4R4FL 3P77B 4OUUB 3TA3D 3NCYS 2CXKA 4FQHB 2D0GA 1M7DA 2X4PA 2NY3D 3MV11 5DYOB 1T6WA 3NZHH 2A77H 5T1DL 5DC9B 1VPOL 1I9IH 5D1XA 1H5BB 3MQIA 1OAKH 4V1DA 3LZFL 5GGRY 1KTDB 2NY7H 1EFXB 5IFAH 5ACLA 3QP3A 4EI5A 1VKXB 4ONOA 4BQ9A 5HDQL 3U6RB 2J8UF 5E8NB 3V52H 5DS8B 4P2RA 4H26B 1NMAH 5GGVY 1C1EL 1YY9D 1YNLL 3RVWC 1A6ZB 1OAQH 2DL9A 1EZVX 1DBAL 4S1RL 2DQGH 1EGJH 1EEZA 2V17L 3OJ2C 4PR5B 1CD9B 4APQC 2Q76B 3PP4L 2D0FA 4Y2DC 1J1OL 1YNKH 3RWEA 1RUKL 5BZWB 5IKCA 4OB5L 3IDGB 4F9PA 5ITFB 1PG7H 1IC4H 5I1JL 3BD4A 3GK8L 4ONFL 4KMTL 1YN6A 3BP6B 5DK0B 5C07B 1JNLH 3BKCL 2VQUA 4CGTA 5D6DC 4RFOH 5DI8B 2YD8A 5B38A 3RNQB 1FL6A 1BVKA 3H42H 1IEBA 3GMNB 1EAPA 1B3JA 1ORSA 2X5PA 2UYLA 5I76B 1XF3A 1BGXH 5MENA 3MR9B 1NFDF 1JF1B 2H32H 3MFGB 4G8FB 5KVGH 2BOCA 5F7LB 2I9LB 2EXWD 5B8CA 1FNEB 3IDIA 4XCEB 5HGAA 5HHPB 2Q6WB 1CDIA 4LP4A 4LCCC 5E2TH 5EC1B 1DCLA 1HQ4A 5JUEL 2AK1H 3TO4D 3V4UL 3D3VB 4FFYL 4YXHL 1PG7X 2Z8WC 5CILL 3VFPB 3BZDA 2NQCA 3T0XA 1CGUA 4QOKD 1P7QB 1TPXB 4UOJA 1DFBL 4H1LB 4P5TC 1ZVSA 4AM0A 1KXQE 3RVVC 3RUGA 2WUCL 5AAWA 3GDBA 5C0CA 4PRHE 1J0IA 3QFJB 2LQRA 4Z95H 4ZAKC 1F4YL 1A47A 1EAJA 1CDHA 35C8L 5LVEA 5CCKL 1C5BL 4X80H 3ZT5A 3QULB 3FO2A 4HBCL 4PJDE 4P3DA 4GG6E 4QRPE 3NACL 3SGJC 1RIVH 2VZVA 2CLZB 4OD2B 4I3RH 2CDFA 2BVPA 5KS9B 1T7WA 2NY0B 1H3GA 1CLYL 5E94A 3FO0L 5AAMA 5DWUL 3I50L 5IMLA 2VXQL 3DI3B 4LGPB 2XQBH 1LEIB 2E7LA 3B9KA 4ZXBC 1NDGA 4OLVL 4Q2ZB 4I77H 5E03A 5D8JH 4U1MA 3CLEL 5EN2A 2GCYA 3C5ZB 1BFSA 4LLWB 3R06A 2WSKA 4G8GB 4PJ5E 4PJEA 1G7IA 4O51A 1EVUA 3TGXA 2GQHA 4OJFH 2NX5E 5IW1B 4G9DA 3STLA 1ONQB 1RZJC 1KYOK 4OSUH 4F7CA 4PUBL 2YN5A 3UDWC 3VFVB 1NC4B 1XH3B 4CUCA 3UBXI 2YKLL 2LU7A 1MUJA 2X1QA 4N1EA 4U1GC 5IGXL 2RFXB 1GIGL 3QQ3B 5FHAH 2UVEA 3CUPB 1JZ3A 2A6JB 2VJXA 2FO1A 5CD5C 1IAOB 3IFNL 1KPVA 1FVCA 4YBLB 1B6DA 3VG9B 1F8TL 1N6UA 4KVCH 1I8KB 1INQB 5C0FB 3LV3A 4U3HA 2IAMC 5TPWL 3DXAE 5ACZA 4EI6B 1BECA 3BSZH 3OB0H 5D5MA 1NCCH 5BW7A 1NBZA 4P2OC 3LB6D 2HJFB 1S9XA 2FHCA 1CFNB 2W0PA 3RY4A 4V1DE 3O81A 1G7PA 4X9IA 1U8PA 5EFIB 3O8XD 2C3VA 2QQLH 1EHLH 2FZ3A 2P24B 4Z18A 1T66C 5GGSA 4YHKH 4LLDB 3U9UA 3IFLH 1TNNA 2FWOA 5T5FH 2E6PA 1HCFX 2FB4H 1CLOL 2AV7A 1OW0A 1AC6A 1SM3H 5HYFA 4UV4L 2Z35B 4U1NA 4QNPF 3CK0H 2YC1A 2EDJA 2B4CC 4IEFB 5FYKL 3GJEA 4LCUB 5DQJA 4DZBB 3IF1B 4WFED 5IJKA 1CDCA 4G6JL 2CO6B 2X7LB 3KPPA 1ZA6B 4MMXC 3L3JA 1N5YL 5DD3L 1JI1A 5FUZH 5TF0A 3Q6GL 5CGTA 4ZO6A 2I60L 2HTKC 5HYEA 5K59F 2D3VA 1UWXK 2X44D 3RKPA 4R8WH 3G5ZA 1OWWA 4F3FA 3QDHA 1RJYA 2WBWB 4MA1C 2Z93B 5D9SB 1NCWH 4QY8A 4WWKA 1HIMH 3RWIA 3LAFA 1A7NH 4HIXL 4KY1H 1UQSB 4UDUB 4DN3H 1BBDH 3TBWA 3ARBB 3U36B 1C7SA 1INDH 1MHPL 5DJ6B 5LAXB 3BXNA 1I7TA 1T5WB 2AJXL 1DBJL 1YMMA 1L9NA 3MUZ1 3TNMA 2IPTH 4GAYA 2Q3AA 4M5YH 2UY6A 2EKSA 3QUZC 4MJ6A 3FQTB 6FABL 2CRMA 4FRWA 2OR8A 2H26A 4NJ9H 5ADOH 5GRYA 5EOCL 1DSFL 5EOCJ 5IB4A 2ICWB 4P23D 3LS5L 3CVHL 4UAOC 1FYHB 2MFNA 2D7QA 3KYOA 3UTSD 1OF2B 2WWKO 4LRIA 3BIBX 3MZGB 5DRWB 2HJLB 2BNRA 1J5OL 3HMWL 1IRAY 4AL8H 5HVHB 4JY4B 4LHUA 3KPOA 4GKZB 4DGYL 3D0LB 4OF7A 1A6TA 4M00A 3QUXA 5B21A 1JNHB 2VYRE 2DQDL 3NABL 3VH8A 3ZE1F 2KZ1B 3BVNB 1FZOA 1IKFH 2D7TL 2YUZA 1SJVA 5HGHB 2NLJB 2Y7QA 3KJ6L 1LEGB 4PPTA 4HZLA 1R0AH 1GPOH 1NC2B 3QWQB 4X7TA 4TVPE 3CC5B 2YD4A 1MAML 3O6LL 4LMQE 1MFAL 1SBSH 3BQUC 3AUVA 4PJ9C 2K1MA 3JWOH 4YO0B 1RZJL 3F12A 5JXAH 2XZQH 5DEGB 4AMKL 1T1ZB 1YEGH 3IETA 1FPTL 1SHMA 3IS0X 5TQ2H 4CVXA 2A83A 3ZKXB 2G9HB 3NIDF 4LSDA 2HP4A 2XQYK 1DQTA 3VD7A 2E9JA 4FQJL 4FQQB 4HS8L 3RVUD 4PRBA 4X4YA 4KQ4H 4L29A 4LSTH 4PJFE 4NQTA 2C4FU 1AIFB 3DI2B 1JI2A 4BJLA 3ZDXE 4AIZB 3FQUB 3SE8H 3OKYA 2Z92B 5MEPB 4ODHH 1KUMA 5IQ7H 3I9GH 4WIQA 4WVRA 1UKTA 2A6IA 1S7XB 2MPAH 3K2UL 3O6FA 2EZ0D 1KBGL 4GLRI 1N0LA 4YC2B 4Z77A 5B3NA 1RZ8B 4JM2A 1TDQA 3L7EB 5F8QC 2EIDA 4YHLH 1IGJB 5F3BA 1JZ2A 3BPNC 4AT6B 1X5IA 2B5IB 1NGWB 3BPOB 1RULL 4B41A 4QRPB 1LP9B 3MV7A 4YQXL 3AREA 4YDIH 2PR4H 4K9EC 3MV9A 3S7GA 2ZJSH 3TVMA 1U8NB 4Y8DC 2B4CL 4WW2A 5SX4H 2A1WL 3MRCB 4DGVH 1HNGA 5C9KA 2NR6D 4ZYKA 5J89A 4QHMB 3NGBB 3GSUA 4HPYL 4HWZA 1K2DB 4HQQH 3P40A 4PJ5B 5KN5B 1MLCA 1A1MB 1Q72H 3GB7A 1DLFL 3KPSD 3BHBA 3T0EC 4Z7OF 2X9WA 1AQKL 1NBVH 3JTSA 5J13C 3IKCB 4NFDA 5D71H 4O4YH 3RI5F 2NX5B 2VR9A 2VIRB 4AEEA 4ODVL 1UUSA 4L4JA 1Q9WB 1BQLH 3O11B 2B1AL 2WINB 4Y4FB 4G6KH 3AGVA 1HSAA 3MX0A 4I3SL 2HMID 1A7PL 4KKLC 4I18C 2HN7B 2I9TB 4R7DA 1TJHL 1GOGA 5JORA 1U0QA 5DTFB 2IMMA 5ID0A 2IG2H 2VRAA 4BFGA 4P9HH 1BQSA 2CDEA 1FJ1A 2CJUL 2P47B 3BYTA 4NFBA 3OR7B 1R5VA 4I48A 1HHKA 1G7JB 2E6QA 3DHMA 3SDAD 4MXWL 3PQYB 1UB5B 5HI5D 2PTUA 4DVRL 3DXAB 1T0NA 4JN1H 1MWAL 1LE5A 1QBLH 4S1QL 3TBTA 1Z5LA 1AGEB 4S2SB 1BQHA 3SKOB 4GT7A 1SMOA 2ZUSA 3LS4L 3MXWH 1IL1B 1FG2B 2R4RL 3MBXL 3QYCA 1HYRC 1W72B 3QQ4A 4G6AD 4X4MA 4G43B 1I7ZA 43CAA 4QRUA 4UIKL 3PWPB 4G6ML 3BD3A 4YDVA 4MYWB 3O3AA 1OPGL 3OJVC 3WUWA 2YS4A 1DBML 4WUUA 5D1ZC 5GHWL 5EWIH 4ZUUB 3FQWA 4R6UA 4QHNA 2YK1H 3SDDD 2ATPB 3PWUA 4M02A 3MRJA 4WCYH 1MCFA 2GTWA 3RTQD 1A6UL 4LSVL 5C08D 2FBJH 5GRUH 3HUJE 3QHTC 3HZMB 3NIFE 3FB7A 5DO2D 5CWSB 4DQOH 1K9TA 4NN5C 3QRGH 1LO4L 3KPRE 4I0CC 3PJSA 2VDOL 1KIRB 1I7UB 1FC2D 2VLLA 3V6OE 3IJHA 5E2WL 5L0QC 2BDNL 3DBXA 3HZVA 1ZTXH 3O4LA 3P9LB 3QUYB 4HUXB 5I9QC 3DX8A 4PJHB 1GGUA 4O00A 4U1IB 3P4LA 1E28B 4OKVB 2C4FT 2R29L 2VLRA 5FM8A 2FIRT 4GRMB 1MCWW 3WFDH 3KLHD 1XGPA 2IEPA 3F5WA 3FHQA 5I71C 1FYTD 1G7QB 2ITCB 1HH9A 2OK0L 1FVEA 3UBXA 3SBWA 3QIBB 3NBNA 1A7RH 3I75A 3C6LD 4NRXB 1NGPL 3P4NB 5T33L 3TT1L 5EOQL 3BD5A 3ZDZE 4P48A 4X6DA 2LAGB 3LOWA 1J1XL 5EO1B 3N85H 3DWTA 1CWVA 1HI6B 4HKJB 2J12B 3BAEL 3SCMA 1PQZB 4KQ3H 5D7LD 1FL3B 1CN4A 1T83C 4A6YB 5DUPL 5BXFA 4NQVA 3EOAA 5BVJA 2IFFL 5LWYL 1AP2A 1QRND 4P46A 2H6PA 4ZO9A 3WFZA 3MSPA 4K9EL 3REVA 4XHJC 5F9JB 5HHQA 2BHUA 3L5WA 2JB6A 4Z7NE 3S88H 3WNMA 3FOLA 2Z31C 2AJ3A 3U30B 2F5BL 2W9LA 1JMZA 3QZWB 3MRPB 3OAUH 4GKOA 4ELMA 3BEWA 4NNPH 1D5BA 4YEEA 4KI5E 3ZYZA 1WQVT 2DS4A 4PBVC 3PNWA 1DN0A 1RY7B 3VXRA 5IG7A 1RU9H 3IDJB 4TRPL 1VGKB 2C9AA 5IBLD 5C8JA 1MCHA 3G6AB 5FUCE 4ODWA 2XACC 3PUCA 1KACB 2F53A 5CEYA 3WSQL 1SJEB 3K80A 3X12B 1IGML 4MA7H 2DYPA 1I7RB 4QXGH 3NPSB 1CICD 2P49B 4LCYB 4JGUA 3VJ6B 1A7BA 3HI1B 4M61B 4Q9QH 1CK0L 1YEKL 3HRZB 2JIXD 4FQXD 1KCSL 4O58H 4LIQH 4IBLT 5ISZA 4JZNA 3OJDA 5D6CB 1UXSB 4KFZC 1A02N 3LKPA 5CEZH 3M17B 3SKMB 2RHEA 2D7OA 4D0DA 4XNZB 4XPFH 4GUPA 1LHZA 2P8LB 4GMTL 5H94B 4OZFH 1WFTA 2FJGA 3WO4B 1FP5A 3P77A 4OUUA 4FQHA 2BVYA 4MCZB 2BVQA 1KJ2B 1MFEL 5JHLL 4AENB 2G5RA 3U7WH 5EIIB 1XCQA 2FD6L 3IJYB 3MLXH 3CZJA 1PKQA 4JRYD 2DD8L 1MREH 3ARFB 1VKXA 2DQUH 4IRZH 5E8NA 2VLJD 3F62A 2CLVA 3INUH 1T20B 2WBJC 4PRPD 4JO1H 3FQXA 4K8RD 1FORL 4KU1A 4LSQH 3TH4T 4FZ8L 1IJ9A 4S0TD 3THMH 4JHAH 2J4WH 4LVOB 1DE4A 2QTEA 4WI7A 1NFDA 1M05A 3UMTA 3WS6C 3QHFL 3B2VL 1VCAA 5BZWA 4XP5L 3S3SA 3HC0B 3S3PA 5IB1B 1E4XI 3H0TB 5F7EL 1JZ7A 4P99A 3BP6A 4LCIH 4UZGA 3BN3B 4BSVB 3OAYK 3UTPD 5JHDD 4TSAH 5DI8A 3RNQA 4YBQD 4F37K 3MTRA 4LPWA 3SE3A 4WFHE 4U3CA 4Y19A 3GMNA 4OUOA 4M62H 1YYLH 1OD9A 2C1OA 1I85A 5I75C 3DUHA 1NJ9B 3QIWD 4I2XE 1A22B 3SKNB 1QVOB 4G8FA 5IWLC 2YRPA 1BOGA 1FNEA 5D1QA 4XCEA 4X6DE 1BP3B 2VITA 1MIEH 3G5YA 1FO0L 2P5EA 5D93C 2Q6WA 2R1WB 1OQXA 5EC1A 3MRQA 1F4XH 3O3DB 1E4WH 3QEGH 4YHPB 1A0QL 4N9GB 1P7QA 5ERWA 1GYAA 1X5ZA 4H1LA 4DKEL 3C60B 4FFZH 3MLSL 1RZIB 2ZCHH 4PGEB 4NUJB 1NCTA 2PW2B 3FTGA 3QFJA 5HTSA 5ANME 5HHMD 5I8OL 1ADQL 3CU1A 5K9JL 3PWVB 1H3VA 2JF1A 1NUDA 1AR1C 5E9DB 1DBKH 2OP4L 3SDCB 2H9GB 5GGTA 3U0WL 3KPRB 5KS9A 1IMHC 1CD1B 5TGBB 1TLKA 4TVSa 4NQSA 4HUWB 1LEIA 5C07D 2R69L 5FF6A 3VU2A 4HWUA 4LLWA 1WFUA 3TJHD 4G8GA 3MA9L 2AW2A 2WWMC 3HMXH 1AFVH 4GW5A 4EBQH 4IRSC 3BZEB 5DMIL 3VWKB 1NAMA 1ONQA 2DQCH 5EPMA 2W07A 4NJAH 4GQPH 4UTAH 1SYSB 2F54E 3OZ9L 3SGEH 3ALXA 5KOMC 1KCUH 2RFXA 1KB9K 1P84K 3LEYL 3VW3L 1X9QA 4Y1AE 4KXZH 3QQ3A 2J8UE 2ORBH 2P44B 2X4OB 3QDGB 2A6JA 4R0LA 4CN6A 1P4IL 3TJEH 1IAOA 3PE9A 4KZDH 1ZHKB 3D3VD 5HPMB 5C0FA 1WAAE 1WGOA 4PLKD 2DQEH 4HUNB 2CMRH 2A77L 3NZHL 4QXUH 5EU7E 1I9IL 3SEPA 4RIRB 4EI6A 2VN4A 3EO0B 2NY7L 3IRZA 4W6YB 5HXMA 2HJFA 5IFAL 1VADA 3B3IB 1OP3H 4Z8FH 4OQ1A 5EFIA 4GG8A 4F7MA 1NMAL 5C0NC 1ES0A 1CLZH 5FKAA 1OAQL 4TYUA 4LLDA 2DQGL 3V0WL 1JZ6A 3HNTH 1EGJL 3GJFB 3GMOB 2VZ1A 2NY0D 5DVOA 2HT3C 3EYQC 1J0JA 3OKMB 4RDQG 3OXRB 2BRQA 1YNKL 2BFVH 4LCUA 1UH4A 2DWDA 3RZCB 1PG7L 1IC4L 2O61B 3IF1A 5DQDL 5SX5H 3ARDC 1OP5H 2XWBB 3TH2T 2HVKB 2X7LA 1DTUA 5E24E 1JNLL 3VXQB 4K7FA 3S97C 4RFOL 1Q9LB 3MOAL 1Q9KB 3QDAA 1NC4D 1YZZA 1Q94B 4M43H 1YY9C 3PGDA 3MRLB 2EDDA 2A74A 3C2AH 1BGXL 3PWLA 4MDIB 4BK4A 1WCQA 3SPVA 5IESH 3JWNC 3MOBH 3FT2B 3KYMB 5AUMB 4JFHD 1IGTB 3FQRA 3ULUH 2PYFA 4LNRA 4LP5A 2Z93A 4LPYA 2HKHH 15C8L 5K9KB 1YEIH 2JK5B 3CXHK 1UQSA 2YMXL 1A6VH 3ARBA 2FO4A 5E2TL 1CXKA 2AK1L 1FLTX 2C7UB 4JVUA 2M26A 3B2UC 4M93C 4YE4H 4W4NA 1SMAA 2EIEA 3BEVA 5I74B 3HE7C 3FQTA 4RWHA 1F3JA 4HWBH 4PTUB 4JDZA 4Z95L 1ZLVH 1U58A 3DX7B 5ACMA 5J11B 2Y06H 1FL5A 4NO5A 1LMKA 2ICWA 2APVA 1G84A 5DJCB 2A0LC 1RUPL 2PXYD 4GKSB 2VDMH 3FL7A 1NEUA 1OF2A 3O41A 5HVFB 2HJLA 1EJ6A 3B9AA 4NUGL 1S5IH 2XN9D 3RWJB 1MFCH 3GNMH 4Q9RH 3OG4B 2VQTA 4HW6A 1AXIB 1EK3A 2HKFH 2XQBL 1Y18A 5B39B 3I2CH 5ICYA 4I77L 4FN0A 3N1QC 3ZTJH 1A6PA 4OZHE 4F15C 4XBGB 4R90H 5SWZE 4L4TE 5HGHA 2NLJA 1QBMH 5T3ZH 4ZFFB 1TZHA 4UIMB 1GOHA 3JWOC 5FGBA 9CGTA 4PJIF 4OSUL 4L8DB 1P6FA 1AD9B 4U6YA 5BO1H 4YO0A 1YEEH 1XIWB 4PLJC 5JIKA 4OGXL 3QUMH 4HV8B 2EDYA 5FHAL 2DI7A 2E7MA 2EYTB 3MV01 1K6QH 4HMDA 4HK0B 4PTTA 4IRJA 4MX7B 5CLWA 5DJ2B 3U7AA 2ZOKB 4H0GA 2WP3O 3SKUD 3KPQB 3IS1X 5GS1A 4NZTH 3RDTC 4I3GA 2OXHA 1NCCL 2ATKB 4QNPE 4Y0GA 2CDGB 2MSPA 1O7SA 5CJ5A 3OR6A 4Y4KB 4N0UE 2QQLL 1EHLL 1IGCH 3KJ4B 4XWOC 4FHBD 5CJXA 2RR3A 2HT4C 2ZSWA 1RZ8A 4YHKL 5HPOA 1N3NB 3L7EA 2X4SB 3IFLL 1IGJA 5T5FL 3TPUB 3U0PB 1P7HL 5LKNA 2FB4L 3OF6A 1LDPH 3LMJH 4L8CA 3KLSA 1SM3L 1X5KA 2EC9U 2FX8H 1GZPB 1NGWA 2X2YA 2ZG2A 4NZUH 2OZ4H 1B4RA 1LP9A 3X3GL 4XGZA 3MLVH 1A3RH 2H41A 1IZJA 3MRCA 4ZMAT 1D5ZA 1NC2D 4PV9A 1FC1A 2NY6B 4EQ2A 5FUZL 2XNAB 4ZPTA 1NFIB 5ADPL 3K81A 3GM0A 4DKAA 1F45A 4F2MA 1AGCB 1E6JH 4OZFG 3TNNB 3GSNH 3KPLA 4R8WL 3IKCA 3D18B 1TTUA 1Q9WA 4Y5YB 4C54A 1DEDA 1BLNB 4Y4FA 2F54B 3WNKA 1NCWL 1XF4B 3G6DH 4ZUVB 3KXFA 4BFBD 4XAWH 5BS0A 1HIML 4JN2A 4M7JL 1A7NL 1FRGL 4P9HC 2I9TA 4H20H 4KY1L 4GAFB 1DUZA 4DN3L 1BBDL 4Y1AB 4Y5XC 3S5LG 4WV1B 1CE1H 3MFFA 5ILTH 1INDL 4OFYD 2GY5A 5I30H 2IPTL 4U31A 1BEYH 4PJGB 5IROC 4M5YL 1JPGB 5DD0H 1G7JA 3GSXB 4NNXA 1RIHH 3PQYA 1ZLUK 1HILB 2GJ6E 3VFTA 5JPMB 3BGFC 4NJ9L 3RQ3A 5ADOL 1HK6A 3GMRB 4PRHD 4C56E 3EDFA 3W2DH 2BVTA 1AGEA 2YEZB 2FIKA 2CPCA 3ZE1E 4HKZA 1IL1A 1W72A 3DV4B 5T5NG 5IIEB 4QRPD 4PS4L 3OKDA 1MHEB 1ZEAH 2ADIB 4M4PA 2VISA 4AL8L 3WO3B 4L3EB 1K85A 5EULV 2W0FB 2APFA 3AU1A 4EDXA 5KJRH 3GHEH 3L3HA 3WEXB 2ZUQB 2ATPA 3NIDE 4PJ5D 1IKFL 3V7AE 2AJZB 3KLDA 1R0AL 1GPOL 1I3UA 1IEAA 3BWUC 1SBSL 5CWSA 1YMHB 2NW3B 3JWOL 5F9WC 2YZ8A 1BZQK 2XZQL 4AQ1B 1YEGL 3PDOA 1HKFA 2Y36H 4NM8H 5TQ2L 1I7UA 4M6MH 4XC3H 4RMVA 4BA8A 3SE4A 4E0RA 5JO5A 1I1FB 1RZKC 1S9KC 4HUXA 4JCLA 4EZMA 4LSTL 4PJHA 4XXCA 5EOTA 1OOAA 5CAYB 4K3HA 4WEMB 4U1IA 4Y16C 4ELKB 1NGQH 1Z9SA 3DIFA 4OCWH 2XFXA 3DXAD 3P0YH 3U9PH 1JTOA 3S8WA 1J7VR 1ITCA 2HFEB 1H3PH 1G7QA 5IQ7L 3I9GL 1T3FA 1S7TB 3WFHA 4HUVB 3O2WH 3W5MA 1QA9B 1MOEA 1RHHB 1CZ8L 1U3HB 3QIBA 4V1DD 5F89B 5IMKB 1ZE3C 4NRXA 1CFQB 1DANU 5F9OH 3Q2CA 1EHAA 5EO1A 5GJSL 3SKJH 1I3VA 4OLUL 1MPAH 4Z7QF 4XH2A 2CK2A 1HI6A 4HKJA 4LSRL 5FO8B 1PQZA 1SQ2N 4K3DL 4Z7OE 1FL3A 4XCFH 5SWSB 5F8RC 4A6YA 4YDIL 3RPIB 4G9FE 2Y25A 4KK9D 4EVNB 2EDLA 2ZJSL 4M03A 3O3UN 3RX7A 5AZ2H 4HS3B 4GAGL 3D87B 2R1YA 2HYMA 1DVFA 5F9JA 2WUBH 4FNLH 3MRMB 4RDQF 5JDSB 4KJQC 3I3EA 2EC8A 2C3WA 1P6AB 3AB0C 5D1ZA 4HQQL 3S96A 4MSWA 1JNNH 4OZHB 2V5RA 3ES6B 4NSKA 1Q72L 3MRPA 3ARPA 3VG0L 1NBVL 3AXLB 3VWJC 4O4YL 4HXAH 5D7IF 2JJWA 4HULB 5CSGA 4Y2DB 1BQLL 3IDJA 4M1CD 2C3GA 3QUYD 1VGKA 3LEXB 5IVNA 4PGJA 4NOFA 5HHOB 2HLFC 2IG2L 2DIAA 2C1PB 4P9HL 4LVHC 1SJEA 1KEGH 1AE6H 5ESVA 5F6HJ 4Q6IC 5HYSG 2V2WB 2ZUWA 3WKMH 3T65B 1KB5B 3C09C 4MJIA 2OJZH 2EE9A 3GZKA 2NYYD 3I02A 1U3ZA 3BMWA 4LCYA 1CI5A 3HI1A 1S7RA 4YFLF 4M61A 1QBLL 5IB3A 3HRZA 2LU4A 1NLBH 4ENED 3MXWL 1KCRH 3QI9B 4N0UB 3WE6A 4XVUD 5D6CA 1UXSA 1A66A 4J3TA 4JO4H 3SKMA 4YDKH 4LCCB 1JGLL 1A64A 4CJ0A 4GQ9H 2D7MA 4S1SH 4OTXH 4R26H 4QCIA 4LKCA 1F58H 1I8LA 4IS6A 4FQ2L 3ILPB 4UV7H 4P5TB 3LH2L 1MI5A 5EWIL 3QRFM 4PREA 2YK1L 1G0DA 5EIIA 4Z5RA 3BP7A 2BVEA 4E41E 3SDAC 3CVHB 3MREA 3C5JB 2FYYA 4WCYL 4QLRA 2H1PH 2F8VA 3B9KD 1G9NH 4HH9A 5KVMC 2FBJL 5GRUL 4X83A 4K71C 5F3HB 3VFWB 3LIZH 2R2BA 4TNWF 5EZJB 5JW3H 3QRGL 4LLAA 4DFIA 3IVKA 3HB3C 3LRGA 2OBGA 3G9AB 1SEBA 2IF7A 4ZXBB 4ZFOA 2MKLC 3PV6A 4LU5H 3OKLB 2MQCA 4GRWH 1TJIH 2I07B 3C6SB 1ZTXL 5F7DB 1F13A 4HCRH 4G5ZH 3T0EE 1RZKL 1R3KB 2DLEA 3HC0A 4MAYA 1RZFH 2KKQA 3NN8A 3R8BB 5J12B 4YZFF 3H0TA 5CEXB 3SDYH 4BSVA 1FFQA 4YHNA 3HE6A 5IV2B 4WTXA 5CGYC 3VFRB 1VESA 1RSFA 1X5AA 3OTTA 1PFCA 2VKWA 3MCKB 4X6CF 2GJ6B 3SY0B 1DANT 1NJ9A 1WFOA 3U0TB 5KSAC 3RGVC 1NGXB 3SKNA 1QVOA 3ZYJA 4C56B 2NY1B 3ZTJG 4PG2C 3N1GC 3X17A 3A6CH 4KQ3L 2IAMB 1CBVH 2CIKB 4Z7UB 4WRLA 3VXUA 2R1WA 4XMLL 1CG9B 2IPUG 5A40E 3LHPH 1MQKL 3VXSE 3GHBH 3O3DA 4YHPA 3ARFD 3CZFA 3S88L 1UWXH 4DVBA 2BX5A 4LSSH 3MJ9A 1T1WB 3C60A 5CZKA 5TQ0H 3TN0D 4U1KA 2WZPD 1MCRA 1HWHB 1CGWA 3OAUL 5SX4I 3OKKB 3CXDH 4MD0B 3P0VH 4HFUH 4RMRA 2A73A 4NNPL 3PWVA 4R2GD 2JJTA 2OI9C 4H5SB 3SGKA 5CKGA 1ZLSH 4BSWB 1F6AA 3I6KA 1N5AB 3MUGA 4U1JB 1VSCA 3Q1SH 1CD1A 4LGSB 3RIFF 3L5HA 4OLYH 4B0MM 3CNKA 3CFJA 1KCVH 4HUWA 4XVJH 4X0KB 4FTVB 4QXGL 2FLRT 1HSBA 3UPCA 3H9SB 1UZ8B 1QLEL 5EBMA 1WTGT 1CR9L 4M8QA 4MD4B 2QQKH 3BZEA 3B9EA 4IMLB 5F6HI 4JG1H 3D0VA 4Q9QL 1KLUB 1A3LH 1WUNT 3G04B 4D8PA 3ARGD 4OF0A 3WLBB 3NFPB 3QCTL 1B88A 1QRKA 1FGVH 5D7JC 4XPFL 5GGVH 3FT4A 3P3YA 4N8VB 1O7VA 1XZ0B 3I6LE 3PL6B 3VXNB 1BZ7B 5DUMH 3F58H 1VFBA 4AIXA 3E6FB 1F00I 3QCUH 3U7WL 5C2BL 2NY2C 3OPZH 4OD1H 1YC8A 1DUYB 3MLXL 5T5NF 4G9FB 4LHUD 1S7WA 3EO0A 2ICES 1MI5E 4I0PC 4F7EB 4BQ6A 1CQKA 2IMNA 5F7FA 5KTEH 1MREL 5I1CH 4HAFA 2DQUL 1XR9B 4IRZL 3VD4A 5L6YL 3DECA 1ZT7B 3INUL 4JO1L 1QHPA 3NPZB 3HA0A 4JO3H 4OIIH 2VLKB 4KK8C 4JJHA 4LSQL 5HYJE 1MY5A 1Z0MA 1N6QL 3THML 4DTGH 4JHAL 3GMOA 2J4WL 1KCLA 1J1PL 4YFLI 2VH5H 3OKMA 1G6VK 4OGAD 3QIUA 3PHSA 3DO7B 3OXRA 3VD3A 3X3FH 2APBA 2Y1VA 1FBIH 8FABB 3RZCA 2JCCE 4F9LC 2AXGB 3W5NA 2AKRB 5EU3A 3UJIH 2IANB 3FB6B 3ARWA 2XWBA 3ULSA 3HC3H 2HVKA 3BQUB 4HIIB 4PJ9B 3VXQA 1KT2B 1T21B 3EDKA 1DZBA 3EYFB 4TSAL 3D25B 2YPKB 3O0RH 1Q9KA 5E4EB 4LOUD 3IU3B 1U92A 4G8IB 1Q94A 3SJVB 1T7ZA 4M62L 1J12A 3MRLA 5DHVH 3WIIH 1YYLL 3ULUC 2EDFA 4WY7H 1GSMA 3FT2A 3UYOD 1IGTA 4X99A 5IHBA 4JFDB 3TV3H 2GITB 2YA2A 4PJCF 1MCOH 1I9JH 4J3UA 4NIKB 5GRXG 1MIEL 2OR7A 4FQPA 4YBHA 3RY5A 5C0GB 5GS0D 1EO8H 3L9RB 1S5HB 1F4XL 2C7UA 1E4WL 3MV7D 3QEGL 1PAMA 3BYYA 1NCDH 3DPBA 1KJVA 3MV9D 1A1OB 1S9WB 4FOMA 4FFZL 4MS8D 2ZCHL 3TC9A 1FE8H 1EO5A 2HFFB 4POYA 1U93A 4E41B 3FB5A 3BMVA 1Q0XH 3BPNB 3T1WA 3EOBA 1I9RH 2IH1B 2AEPH 5L2JB 5DJCA 4PJIA 3EFFA 4UU9A 4GKSA 2DI8A 1DBKL 4Y4HC 5DEFA 4KI5D 2PO6C 4NQEB 5DRZB 1SBBA 5C0DA 2GKIA 3Q3GB 3T08A 5EIQA 3RWJA 1CGSL 4YGAB 3WIHA 4UB0H 5DUBA 3U1SL 1KIUA 2J6EH 2HVJB 1HKLH 4XMKH 4OLWH 3O9WC 3IDUA 1N2RA 4BSJA 5JXEA 1XGYH 5BQ7A 4JHBA 3T0EB 4NHUA 3HMXL 4K23H 1AFVL 1KSRA 1BIHA 3IGAB 4JB9L 4EBQL 1U95B 5TH2B 1ZWIA 4JJ5A 4B7IA 4L8SC 4UIMA 3C5SA 3BPCB 4NJAL 3V8OA 1F4AA 5EH1A 4WGWB 4JVWA 1BHGA 4ONHA 1IAMA 1C5DB 5DFVD 1WCBA 3DX9B 4YDLC 4HV8A 4I4WB 1G6RB 4LBEB 2ORBL 2EYTA 4BZ1H 1ZK9A 3RY6C 3TJEL 4HK0A 1LWRA 4KZDL 4DCQB 3OB8A 3MRNB 1QP1A 1EEUA 4PGDB 4JAMA 1KJ3H 2BC4B 5I0DA 1ED3A 1NBYB 2DQEL 2CMRL 4QXUL 1UJ3B 2ZOKA 3EO1B 4L3CB 3KPQA 4RMWA 3IDYB 2DJUA 2IGFH 4JKWA 3V8CA 2NY5H 5C0BE 1IAIM 4KPHH 4KTYA 2FHFA 1KJMB 2CDGA 5E95B 5A16A 1AD0B 3VGBA 4OM1H 2AQ3A 4XPBL 4Z8FL 3VXSB 1GRWA 2MQ3A 1U42A 2NW2B 4EN3C 5T1LD 1AJ7H 5J6GB 4OBSA 1AKJB 5FM4A 2X4SA 3HNTL 3IRPX 4Z7VF 3SDXF 3ULUF 3TPUA 3QG6B 4TUOA 1CXIA 1GZPA 1MLBB 3FB8A 3NCEB 4O9HL 1HE7A 2BFVL 3VFUB 5I1IL 2HAZA 3J7HA 1B2WH 1XAUA 4ALAH 1UCTA 1PVHA 2X4NB 4O02H 3P4MB 3ZE0E 3CFCH 3O4LD 3JBG7 4FG6D 5DHYB 3D85B 4NRZB 1BFOB 1G7HA 43C9A 1L7TL 1IC5H 1XIWD 4M43L 4ERSH 4X7DC 4WFHD 3W0WA 3C2AL 4YUEH 5IESL 3T1FA 3MOBL 4N0FB 4S10A 2IBZY 1RZGA 2FJFB 3ULUL 1ND0B 5HVWA 5EUKB 5ITBL 5F7MC 3RL1A 2DQHH 4J3WA 4ZUVA 3ARXA 3T4AB 6CGTA 5L2KA 1AXTL 1EV2E 2QJDA 1X4XA 5AYUL 2E5EA 1HHHA 1A6VL 3H3PL 4KK5C 4WV1A 1MCKA 2FEEL 4CVWA 3AY4A 1CD8A 1UFUA 2R0KH 4JRWA 3V95A 4L4VB 3VGAB 2XICA 2DAVA 3D2UB 1WJ3A 4YE4L 4XWGH 5HHVH 2BMKB 3DMMB 4Y4KD 1ZT4B 1KV3A 5JPMA 4HWBL 5I1EL 5E99H 2ARJB 1GC1C 2Y06L 1VFOA 4JFFE 3JTTB 1P5UA 4XC1H 2WIMA 4MQSB 3JV4B 3B83A 4BFIB 3CSYA 4WI8A 1ACYH 4KKBD 1M71B 2NZ9C 2X42A 5HYJB 2BSSB 3ESVF 5T1KB 1TETL 1S5IL 2QL1A 4L3EA 1UA6L 1DQJB 4NQUA 3GNML 2Z31B 5SV3A 4H88H 2W0FA 1NCBH 1A1NA 2NY6D 4AEIH 3TIDB 2LVCA 1S7VB 3TP4A 5I16B 3EGSB 1RAMA 4R90L 1P7KB 4OV5B 2JCCB 5KANG 4GRLD 3MGTA 4HIHA 3GI9H 1QBML 1P1ZB 4IHOB 1CTNA 5I1DB 4YHMH 1HH6B 1KLGB 1BX2B 1YMHA 1K8DB 4HIEA 4HX1B 5HBBA 3BI9X 3VXOA 5E8EB 2PCPA 1OGTB 1WVZA 3QUML 3ZYIA 4LHQB 3HI6H 3MNWA 4QTHB 2GAZA 2FSEB 3DUSB 3I84A 3VRLE 1K6QL 4Y1AD 5JR1H 4L1DA 4GXUM 4JM4L 2RJMA 1LO5A 4Z9KB 25C8H 5DJYA 3SGEI 3CDGB 1P2CA 3OB0K 2B20A 2R2EA 1JWUA 4KXZI 1GAFH 5DVNA 1RZ7H 2HFEA 2Y6SD 5GRJH 5DFWH 4D0CA 4HUVA 2ADGB 1QA9A 1RHHA 3DGGB 5HI3C 1IGCL 5F89A 5J9PB 4PJ8A 4HJGA 4L1HA 1CFQA 5C6TH 3UJTH 2G2RA 1NANI 1Y0LA 5DK3A 1OD7A 1LDPL 1WT5C 3LMJL 4Q58C 5FO8A 2YA0A 3LKQB 4NZUL 2OZ4L 5SWSA 2X4UA 1CDUA 1XGTB 3UYPA 5D2LF 1K8IB 4ZD3H 1JE6A 4EOWH 3RPIA 2IH3B 3MLVL 3OAYH 4EVNA 1A3RL 5L9DL 5F7NC 1A5FH 4HS3A 3LY6A 2CSPA 2WBJB 4JKPH 4PIRF 4ZS7H 5C0JB 5CS7A 3S4SB 1R3LB 1E6JL 2PYEE 3WKNA 4YXLH 2YD1A 5DJAB 3AXLA 5EU5B 5H8DA 5C0IB 3QB7C 3ROLB 3VXME 4MXVF 3G6DL 4XAWL 3AM8A 3X14B 2WLZA 1FAKT 5HHOA 3UAJD 1T5XB 1YUHA 2VE6A 5ILTL 5L2KE 5DJDA 3RBSA 4ODSL 5FYJH 5I18L 1S3KH 2V2WA 3T65A 3RBGA 1KB5A 5I30L 1WSST 1TVBA 5DC4B 2P5ED 1IC7H 1YEJH 1KPRB 1G0YR 2H32B 1U3HD 3KHOA 5I75B 1RIHL 4JDTH 3RPKA 4MXQC 3PGCB 4XVSL 2AEWA 1G7MA 32C2B 5KZCB 2OL3H 5C0BB 2NXZD 3QWOA 4JFZL 1GJIA 2F58L 3C8HA 3QI9A 1GC1L 4PP1C 5D93B 3VCLB 3MBEC 3WJLC 5HGBA 1ZEAL 4O5LH 5FO9B 2HJKB 3L95A 4JFEE 4HJJH 3AMLA 4XXDB 2MKWA 3HAEH 4BZYA 3MJ6A 2GT9B 5FA3B 5FYLH 3RVWD 5KJRL 3NAAH 1G9NC 4E5XA 5MEOB 4KRPB 4IIQC 4GAJH 3WL9B 4RISH 5A1AA 2A6KB 3HCVA 5SWZD 1L9MA 4L4TD 4APQD 5F3HA 1QEWB 2LVEA 3PWJA 4Y2DD 4U1HB 2AXHA 4NKDB 2GUOB 4NNYB 5EZOH 4X6BA 5TE7H 2Y36L 1QR1A 1IKNA 1EXUA 1T2XA 4NM8L 2WIIB 4M6ML 4XC3L 4QRQA 3BH9B 5C7XH 1J8HA 2AK4E 3BDXA 3BIKB 5DMYA 3OKLA 4JRXA 4J1UA 5F7DA 3VI4E 1ZVHA 4LEOA 4IRSB 5JW4M 5MI0C 4K8RH 2DLFL 3NVQA 4P5KB 1NGQL 4OCWL 4X4ZA 5CJ8A 3P0YL 3U9PL 1EPFA 1L0YA 1ROWA 2YD2A 4EXPX 1MRCH 1T7YA 4OFDA 5IV2A 1N26A 1OSZA 4J4PC 2XI9A 1R3HA 4POZC 3MCKA 4N68A 3SY0A 7FABL 4LVNC 1D5XB 5F9OL 4E42A 1WZMA 1ZHBB 5KSBF 1NGXA 1HN1A 1MPAL 5DRNA 1ORQB 1CS6A 4Z0XB 2K9UA 3U4BH 4Z7UA 1I3RB 4P5TD 3C9NB 4KRMB 5D7IE 4QRTB 4ZAKD 1HZHL 5AZ2L 4CW1B 2WUBL 3QO0A 2HA1A 4G8EB 4KRNA 1QFUH 4TQEH 5FO7A 3BWAB 3DYOA 4EIGB 5D1XC 2VOTA