3DO9A

Crystal structure of protein ba1542 from bacillus anthracis str.ames
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
179
structure length
179
Chain Sequence
b'PVSVNEKKDFVKWFLNNYQLKQRECVWILNYLMSHDQLMHKVHFVEHAKYCPRGLVMSANCVKDTPFHFFKQNVMTTDAEKSFHDIRLNRDEDIYIQLNFKSSFQNANYVAVLEENPYLPKHIEVNEKDRLLAERFLEESVFSFRRERLLKQIDEALDKQDKEAFHRLTAELKMLEGHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0302 protein BA_1542/GBAA1542/BAS1430
publication title Crystal Structure of Protein Ba1542 from Bacillus Anthracis Str.Ames.
rcsb
source organism Bacillus anthracis
molecule tags Structural genomics, unknown function
total genus 57
structure length 179
sequence length 179
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08858 IDEAL IDEAL domain
A PF08864 UPF0302 UPF0302 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.290 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3do9A01
3DO9A
chains in the Genus database with same CATH superfamily
3L0IA 3LJ1A 4JCVE 2K19A 2MJFB 2XTQA 5LNK1 2F66B 3FNBA 4NV2A 3DA4A 2FU2A 3SDJA 2ZRRA 2XTRA 2YFAA 2BL7A 4Z7HA 3IAS1 2A2DA 1U5KA 4I1TA 2QGMA 1JQOA 3UITA 2V1CC 4YZCA 2RLDA 2QSBA 2FEFA 4YZ9A 4G76A 2P22B 4U6RA 4PL5A 4HFVA 4G75A 5HGIA 4PL3A 2JB3A 3FBVA 3KP9A 3LJ0A 2JBWA 2ETDA 1TDPA 2RIOA 3IAM1 2YFBA 2CAZB 3B55A 4Q9VA 3Q8DA 2JAEA 4NV5A 3P23A 4GXTA 4O1OA 2A2CA 2E8GA 4HEA1 1SJ8A 2JB2A 2GSCA 2HGKA 2RADA 4OAUC 4O1PA 4AS2A 3LJ2A 4AS3A 2FUG1 2JB1A 3AJFA 2IP6A 3I9V1 1W3SA 3DO9A 2BL8A 2QZGA 3DA3A 3FVVA 4OAVB 2KKMA 4PL4A 2F6MB 3VA9A 4YZDA 1YO7A 3F4MA 3JSBA 2XMXA 4Z7GA 2ZW3A 4DWLA 2L1LB 2V6EA
chains in the Genus database with same CATH topology
3L0IA 3LJ1A 4JCVE 2K19A 2MJFB 2XTQA 5LNK1 2F66B 4NV2A 3DA4A 3SDJA 2ZRRA 2XTRA 2YFAA 4Z7HA 3IAS1 2A2DA 1U5KA 4I1TA 3UITA 2V1CC 4YZCA 4YZ9A 4G76A 2P22B 4U6RA 4PL5A 4HFVA 4G75A 5HGIA 4PL3A 2JB3A 3FBVA 3KP9A 3LJ0A 2RIOA 3IAM1 2YFBA 2CAZB 4Q9VA 3Q8DA 2JAEA 4NV5A 3P23A 4GXTA 4O1OA 2A2CA 2E8GA 4HEA1 1SJ8A 2JB2A 4OAUC 4O1PA 4AS2A 3LJ2A 4AS3A 2FUG1 2JB1A 3AJFA 2IP6A 3I9V1 1W3SA 3DO9A 3DA3A 4OAVB 2KKMA 4PL4A 2F6MB 3VA9A 4YZDA 1YO7A 3F4MA 3JSBA 2XMXA 4Z7GA 4DWLA 2L1LB 2V6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DO9 A; 
#chains in the Genus database with same CATH topology
 3L0I A;  3LJ1 A;  4JCV E;  2K19 A;  2MJF B;  2XTQ A;  5LNK 1;  2F66 B;  3FNB A;  4NV2 A;  3DA4 A;  2FU2 A;  3SDJ A;  2ZRR A;  2XTR A;  2YFA A;  2BL7 A;  4Z7H A;  3IAS 1;  2A2D A;  1U5K A;  4I1T A;  2QGM A;  1JQO A;  3UIT A;  2V1C C;  4YZC A;  2RLD A;  2QSB A;  2FEF A;  4YZ9 A;  4G76 A;  2P22 B;  4U6R A;  4PL5 A;  4HFV A;  4G75 A;  5HGI A;  4PL3 A;  2JB3 A;  3FBV A;  3KP9 A;  3LJ0 A;  2JBW A;  2ETD A;  1TDP A;  2RIO A;  3IAM 1;  2YFB A;  2CAZ B;  3B55 A;  4Q9V A;  3Q8D A;  2JAE A;  4NV5 A;  3P23 A;  4GXT A;  4O1O A;  2A2C A;  2E8G A;  4HEA 1;  1SJ8 A;  2JB2 A;  2GSC A;  2HGK A;  2RAD A;  4OAU C;  4O1P A;  4AS2 A;  3LJ2 A;  4AS3 A;  2FUG 1;  2JB1 A;  3AJF A;  2IP6 A;  3I9V 1;  1W3S A;  3DO9 A;  2BL8 A;  2QZG A;  3DA3 A;  3FVV A;  4OAV B;  2KKM A;  4PL4 A;  2F6M B;  3VA9 A;  4YZD A;  1YO7 A;  3F4M A;  3JSB A;  2XMX A;  4Z7G A;  2ZW3 A;  4DWL A;  2L1L B;  2V6E A; 
#chains in the Genus database with same CATH homology
 3L0I A;  3LJ1 A;  4JCV E;  2K19 A;  2MJF B;  2XTQ A;  5LNK 1;  2F66 B;  4NV2 A;  3DA4 A;  3SDJ A;  2ZRR A;  2XTR A;  2YFA A;  4Z7H A;  3IAS 1;  2A2D A;  1U5K A;  4I1T A;  3UIT A;  2V1C C;  4YZC A;  4YZ9 A;  4G76 A;  2P22 B;  4U6R A;  4PL5 A;  4HFV A;  4G75 A;  5HGI A;  4PL3 A;  2JB3 A;  3FBV A;  3KP9 A;  3LJ0 A;  2RIO A;  3IAM 1;  2YFB A;  2CAZ B;  4Q9V A;  3Q8D A;  2JAE A;  4NV5 A;  3P23 A;  4GXT A;  4O1O A;  2A2C A;  2E8G A;  4HEA 1;  1SJ8 A;  2JB2 A;  4OAU C;  4O1P A;  4AS2 A;  3LJ2 A;  4AS3 A;  2FUG 1;  2JB1 A;  3AJF A;  2IP6 A;  3I9V 1;  1W3S A;  3DO9 A;  3DA3 A;  4OAV B;  2KKM A;  4PL4 A;  2F6M B;  3VA9 A;  4YZD A;  1YO7 A;  3F4M A;  3JSB A;  2XMX A;  4Z7G A;  4DWL A;  2L1L B;  2V6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...