3DOJA

Structure of glyoxylate reductase 1 from arabidopsis (atglyr1)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
292
structure length
292
Chain Sequence
GSHMMEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEVIKKCKYTIAMLSDPCAALSVVFDKGGVLEQICEGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPVSGSKKPAEDGQLIILAAGDKALFEESIPAFDVLGKRSFYLGQVGNGAKMKLIVNMIMGSMMNAFSEGLVLADKSGLSSDTLLDILDLGAMTNPMFKGKGPSMNKSSYPPAFPLKHQQKDMRLALALGDENAVSMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cytosolic NADPH-dependent Glyoxylate Reductase from Arabidopsis: Crystal Structure and Kinetic Characterization of Active Site Mutants
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords Dehydrogenase-like protein
total genus 119
structure length 292
sequence length 292
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3dojA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dojA01
1B14A 5IJZA 2I5PO 4P4GA 3E18A 4LVCA 3KZVA 4AJJA 1YL5A 4XRGA 2XXBA 4WJZA 3NDRA 3LLSA 1A7AA 1LEHA 1IPFA 1FJHA 1JN0A 1NHWA 3X2FA 4E2XA 1M6WA 3ABIA 3HE3A 2C82A 5EPOA 5JBIA 3KYDB 2E4AA 4P8RA 4B4VA 3L0DA 1ONOA 1Y9EA 1A71A 1PJQA 4H16A 4WEQA 3TWOA 1PGQA 1LC0A 4ZRNA 3DMYA 3A1NA 3WQRA 1KY4A 1RJWA 4ROSA 2BHLA 3DFZA 1HDZA 3I1JA 3RFVA 2QW8A 4W9NC 3G49A 3MZ0A 5CPFA 5BSFA 3GEDA 4JROA 2Y67A 4BO4A 3DONA 2NTVA 4XGKA 3IOYA 1KETA 1YOVA 4ZU3A 3SLGA 5T6BA 4J1QA 5GZ1A 3H5NA 4FJ2A 4O6VA 5TT0A 3JYPA 4OSPA 5CDSA 1M66A 1ISIA 3AU9A 2R6JA 4I9HA 2Q3EA 5KNLA 1BXGB 1ARZA 1FK8A 1P44A 1DB3A 1QLHA 2AEJA 1O89A 1X0VA 4B4UA 4M87A 1J5PA 2J5RA 4IBOA 5JLAA 4ALIA 1VKNA 1LLDA 3QVWA 2BFPA 2QYSA 5H83A 3CSDA 1C0IA 1R0LA 5F1KA 3BA1A 1G0NA 1GUFA 1HYHA 4E4YA 1KBZA 1ENZA 5ADHA 2EHDA 4KTVE 4GX0A 2RHRA 4YJHA 3FN4A 1K6IA 4HWKA 3D5TA 3GGPA 4RO0A 3CTMA 1MFPA 4YAEA 1TT7A 1N1EA 5JO0A 3ANLA 1GQ2A 2BKAA 4U6SA 1R15A 3LVFO 3OMLA 4YCAA 4IJVA 2YQ5A 4NBRA 4INAA 1YXMA 1ISFA 2O3UA 4E21A 2E37A 3LF1A 3F47A 2CDAA 3RBXA 2Y1OA 5L95A 2YHUA 3BTSA 1SEPA 1U7TA 2PR2A 1P31A 4UUMA 4TZKA 1YVEI 2DUWA 3TQHA 1Y9AA 3JQGB 2PKQP 1I3NA 2DU8A 3IC5A 5H81A 1H5QA 3NKLA 2WYWA 2VOJA 3DDNA 3KXDA 4B4OA 1U3UA 1Y8QA 4ZICA 5JCJA 4D44A 1DHTA 4TRMA 4Z0HO 2QG4A 3EMKA 1O5IA 2JFHA 1ZK2A 1PJ4A 3VTFA 1UP4A 4MVJE 4RVGA 1QG6A 2CY0A 1EK6A 1TT5A 4YWJA 1XU9A 1KY5A 2JL1A 3DMTA 1VSVA 5A02A 5K6AC 3HN7A 3PZBA 1U3VA 1ORRA 4NNJA 3HDYA 1EFKA 1CQJA 2R00C 1DFGA 3DZKA 5FF9A 5JMPA 1GL3A 2WYVA 4GKBA 5BSEA 4WE3A 1HZJA 4BO6A 4YDRA 3AWDA 1I32A 4RF4A 5CEJA 1PZEA 5FEUA 3GLQA 5U1PA 4E2WA 1JVSA 2GSDA 2RH8A 3OETA 4E5PA 1LSUA 1HF3A 1LRJA 4CM5A 2VWHA 2Q1WA 1RPNA 3DC2A 3WTBA 2VYNA 3AI2A 3ONDA 1PR9A 4WCDA 3LDHA 3ETDA 1Q7CA 4GL4A 4WLOA 4XJTA 2EJWA 1E3IA 1QORA 4MDHA 3BMCA 1EDOA 1EVZA 2HMTA 2VYND 3JQAD 2JJYA 3ZWAA 3VPSA 4OJNA 4L4XA 3DBRB 3AUTA 3OQBA 3JQBC 4AJ2A 4FC6A 4ONEA 2ZIZA 4IQGA 2W8ZA 4RPJA 4GAEA 1QLJA 4R01A 3OECA 2YYYA 5B37A 1UZLA 3RU9A 4DC1A 3JQ6A 1HE2A 2V6MA 4BNZA 2PD6A 1SB9A 1ADBA 3PIIA 4PVDA 4PFJA 1E6UA 4NPCA 1TB4A 5ENVA 5TX7A 4N7RA 5CEEA 2FRDA 1NFRA 3ASUA 3S1LA 2AE2A 2FN7A 1UDBA 2WTBA 3G1TA 1NAHA 4FDAA 4PG5A 1YRLA 1TLTA 1ISGA 3DOCA 3LT0A 1C1DA 5JY6A 1TEHA 2IZ0A 2C20A 1M75A 1LSOA 4PLHA 3Q1LA 1E1MA 4PLGA 3ONEA 1PX0A 2OL4A 1GUZA 2QZ9A 1ZEMA 3GF4A 3OIGA 4CMEC 4LRTB 4UEOA 3H2ZA 4CV3A 3V8BA 3VH4A 2NWQA 2GN9A 3WLEA 1DRUA 4J7CA 4XGIA 4GBJA 1NWCA 1Q7BA 3H3JA 2JCVA 4GGPA 4NFYA 4B8ZA 3M2PA 2QRKA 3SX2A 2VHVA 2VHYA 4PLCA 1SBYA 3EVTA 5DF1A 3ZCXA 3AY6A 1ZH8A 1QYCA 5TGDA 2HRZA 2HUNA 3R3JA 1PWZA 4LSMA 1JKIA 2CDBA 3B1FA 4CODB 4XJSA 4EW6A 4JLWA 3AFMA 4Q3NA 3PDJA 3MJEA 1H93A 1NR1A 4GKVA 2JHFA 4ZGWA 2OUIA 3LT2A 3BHIA 4C4OA 3JYLA 3PHJA 4J1TA 5KJ6A 3U0BA 4NHEA 2GZ3A 3GFGA 1JW9B 4ALLA 4YRBA 1H2HA 2HKIA 2ZYGA 4J91A 3VKVA 3PFWO 3G0OA 2FPIA 4A7PA 1ZMOA 2HRBA 1JDJA 4DYDA 4JJIA 3G79A 2QZZA 3RUEA 1Q0HA 4CM6A 5L4NA 4XQ9A 4BQPA 3GDFA 3KSDO 5CG1A 3NRCA 4D46A 1PSDA 3ASVA 4RF3A 2NSDA 3FRJA 2R2GA 3S55A 2A92A 2WE8A 3V2UA 2NU9A 3RAJA 4EBFA 1YE3A 5KJFA 2BF7A 2BLLA 4J9UE 5G0VA 5B1YA 3C1TA 1H0KA 5DNAA 1B15A 1Y8RB 3G1UA 3I52A 5F5NA 4Q3AA 4JJFA 4Z3KA 4L4RA 3HSKA 5CEFA 4RJTA 4OXYA 1ISJA 2C7VA 3JD0A 3U4CA 1Y5RA 4YB8A 5COBA 2GGSA 3ZI0A 3BXXA 4IIUA 4PN3A 3Q11A 4RVDA 1GUYA 2EKLA 3AUAA 1P9LA 2ZTVA 2NACA 5JYDA 3DO5A 3HB5X 4I1IA 4XR4A 4C7JA 4IDBA 1H6BA 4U5QA 2NUAA 4BNHA 1PJBA 3BZUA 2Y0EA 1L1FA 3IIEA 3NGXA 4I5GA 2VWGA 4CMIA 3H9JA 3O38A 3WFJA 4CM8B 2NLOA 2PH5A 3GVCA 2VZ8A 1LDNA 5JSFA 4GH5A 4IPTA 5BNIA 2W2LD 4MOWA 4OSOA 3EVNA 1P1IA 2R00A 2EIHA 1NQOA 4RPHA 4UAGA 1CYDA 1UDCA 3VZRA 3I23A 2D5AA 1NASA 5L9AA 4NDNE 4LMRA 4BV9A 5BT9A 4CJXA 4XQEA 3H7AA 1P1RA 1NFQA 1I3LA 2J3JA 3UCXA 1GPJA 4JP2A 4DC0A 1PS9A 4N5LA 3WS7A 4U6QA 1B26A 5A9TA 2ZYAA 2GZ2A 5EQDA 3HFSA 3E6AA 2ZTMA 3HB4X 4EUFA 3MWEB 2C59A 3GG9A 4P4LA 2AHRA 2OMEA 3QQPA 3WX0A 3F1KA 3CUKA 3KEOA 4PGFA 3U62A 3O8QB 3G3EA 1MB4A 2TMGA 4WGGA 5I8ZA 2VWQA 1WZEA 3GDGA 1U8FO 1UR5A 4R1SA 4OOFA 3F46A 4PLWA 4DIOA 3TRIA 5GZ3A 3E82A 4W7IA 4JBGA 3W4JA 6LDHA 2O3QA 5AXCA 2OHXA 5DZSA 3U3XA 2YY7A 1FDSA 2JAPA 4YJGA 4ZQHA 1NQAO 3RBZA 1BGVA 3PYXA 3K30A 5A06A 4EJ0A 3AJRA 3O03A 2P5YA 3QA9A 4R69A 4XYBA 4NH4A 1YO6A 3F3SA 3I9LA 4G5HA 4KWHA 3D5QA 2X6TA 4YYZA 3QSGA 1HE4A 3CEAA 3ROPA 1H6CA 1Z74A 4TRRA 3VDRA 1CETA 4DPMA 3L77A 2DLDA 1E3JA 5BNTA 4BMSA 3AOEC 4J9VA 3K8ZA 3A14A 5FI3A 3W6ZA 3M1LA 3DBVO 2NTNA 2VWPA 4W9NA 4Y8VA 1E7RA 4MKXA 5L4SA 4ND5A 4BO8A 2I3AA 1IHYA 5AOVA 4W6ZA 4N54A 3EW7A 3JQBA 4FSHA 2P9CA 3NDIA 1E3LA 4Q3BA 5HS6A 4MIEA 4AJ1A 2EW2A 1QYDA 4IXTA 4FGWA 1OFGA 3ZV4A 1DXYA 4YAJA 1J4AA 9LDBA 4CR6A 1Q2XA 5C7OO 4J0EA 1F0YA 2ZQYA 2RAFA 3D3WA 1W6UA 3UVEA 4A2CA 3QVXA 4CUZA 2RCYA 3C7AA 3E9NA 1E0DA 4LCEA 2HMSA 1PTJA 1TVEA 3ETEA 4NIMA 5AXAA 1BTOA 1U3TA 4LRSB 2FPGA 1GZ3A 4C7KA 1T4BA 2H5LA 3FNEA 4N5MA 1HXHA 2PFGA 3QW2A 4UREA 4YT4A 2QHXA 4WEOA 5IZ4A 4CLEA 5JCXA 4IMPA 2B4TO 2Q45A 4U8GA 4F6CA 3C8MA 3H6KA 3GOHA 3W4IA 2CZCA 4MVJG 2P2SA 1AHIA 1PQWA 4L9RA 3PGJA 3IL2A 2A94A 3TZ6A 1VL6A 3PJFA 5I9MA 3VZQA 1BVUA 3GGOA 4GLLA 3W4KA 3D1LA 4OOEA 1N5DA 4JJGA 1EE2A 1UXIA 1Y81A 2BD0A 1HDOA 2J6IA 3WGIA 3DBHB 3WMXA 2LDXA 3HUDA 2AE1A 1PGPA 1UZNA 4BO2A 5A5FA 2DC1A 3GVIA 4BKQA 3SJUA 4P22A 3RD5A 4Q3EA 3KLMX 4RVHA 5TIIA 1E3SA 1UXHA 2C5AA 4I08A 3JQ9A 3OJLA 4G81A 3GZNA 2VRBA 4JIGA 5J23A 4TROA 4F45A 3DFUA 1MG0A 1PJLA 1LI4A 2ZTUA 1LRKA 1ENOA 1MV8A 5HWSA 4R1NA 4OAQA 2WM3A 4XQGA 1LX6A 4EDFA 1XLTA 2XF8A 4QXMA 3QV1A 1GYPA 1WMBA 2DFDA 1LSJA 1NQ5A 3VOSA 4CMCA 1WVGA 4KZPA 4DVJA 2E48A 1VC2A 5L40A 3ZV6A 3JQ7B 2FSSA 2P91A 4CLRB 1PZFA 1PJSA 2PKQO 3LF2A 4FGSA 4YAKA 1DFHA 3RJ9A 3OIDA 1T25A 2EG9A 4UVDA 4IGEA 2V7PA 3V5NA 1GZ4A 5JNLA 4W82A 1UAGA 2JFFA 3K9QO 4HNGA 5T8KA 3PFFA 1B7GO 2OZPA 2HCTA 3RWBA 3GZNB 4FS3A 1FXSA 3JSAA 1K6XA 4L8VA 2EKPA 1BWSA 2C54A 3I9KA 3WG9A 2POQX 1HKUA 3WIEA 2P5UA 4AJPA 1A7KA 3DAGA 3QWFA 4R9SA 3DBHA 1GAEO 2ZCVA 3OH8A 4MJLA 4QO7A 3AI3A 4E3ZA 4F6LA 2VHXA 3FTNA 3KOUA 5TT1A 1SC6A 4ND1A 3VVCA 3KB6A 4IUYA 5DP1A 1OC4A 4A27A 3AM3A 3TOZA 4MVJP 4NBUA 4D3SA 3WGGA 3GDOA 4GWGA 3PJEA 2WJPA 3BHMA 3ITKA 2X9VA 1JAXA 1R37A 1U9JA 2AQKA 4IQ8A 4OXKA 4YJFB 3ROKA 3DXFA 4URFA 1NPYA 3A9WA 1O0SA 2YJZA 4MVJD 4IINA 2VUTA 1GCOA 2DT5A 5KJCA 5T8KC 2O2YA 1IE3A 4CM4B 3RUIA 4JQCA 3IAHA 4R4JA 1MLDA 3VZPA 3I83A 4QTZA 1G6KA 4M1QA 4CLXA 4ND3A 1VE9A 1AN9A 1UUFA 1JLLA 2Y68A 3PYLA 1E7QA 4HFJA 1HDYA 4D0RA 1LU9A 1I2ZA 1KVUA 4ZQGA 2YW9A 3JQFC 4KTTE 3LK7A 2C0CA 3HQ4O 4BNTA 3DB2A 3SLKA 5CP8A 2NVBA 3TF5A 3GVPA 5EMHA 3U5TA 2QX7A 3NTOA 2J3HA 4R54A 5JDIA 3UH1A 3DZGA 4D41A 4MP3A 2DTEA 3K6JA 1SAYA 3BTVA 3HNPA 1A5ZA 4UULA 3NJ4A 3ZWNA 3WGZA 5CDYA 4CR8A 3RKRA 1W73A 4ND2A 1OC2A 3EGOA 2Q2QA 1FDVA 3QIVA 4II2A 3GN2A 1ADGA 4TRNA 1NVMB 2AQIA 1GYQA 6ADHA 2B36A 9LDTA 1HLPA 1O95A 1IHXA 2P4HX 4ESOA 4NZ9A 4BVAA 5B4TA 3PZRA 3WQQA 4DMMA 4FOSA 3PHLA 3V1TC 3T7CA 3ZU4A 2OORA 2VCYA 3ROMA 3VC7A 4AG3A 1Z7EA 3DAPA 4BHTA 1GY8A 1E7MA 3MOIA 2HK9A 1LUAA 5IFLA 4FC7A 4YT2A 4G2NA 2HAEA 4Y9DA 1D1TA 4YJGB 4IJUA 5LCXA 3TZQA 1NFFA 2GF2A 1SEVA 4LGVA 1PJ2A 5JCJD 3LC2O 1GEGA 5IF3A 2NVWA 4YTEA 4JP3A 4J90A 3OICA 1JKFA 4B3HA 5B4VA 7ADHA 1E6EA 3QVOA 4KUEA 5I8WA 1HETA 1K2WA 2Y1FA 3IUPA 3OM9A 5ER9A 4CM1A 1VL8A 1ZSNA 1PJ3A 2LDBA 3DL2A 2BFAA 4XGNA 5HA5A 3L4BA 3BMOA 3GZ4A 3O8QA 4AJOA 2JAHA 4RZIA 2V6FA 3CH6A 3IUSA 4J4BA 4BO3A 2OO5A 5HRUA 2F1KA 3ANMA 1UZMA 3PPIA 4QT0A 5BSHA 4XDYA 4MINA 1F06A 1V9LA 4Y6SA 1U4SA 4D3FA 2I66A 5TJ9A 3I9MA 1B8UA 4R5MA 4ZQBA 1H6DA 4EI2A 1O8CA 5JC8A 3MWDB 5JPIA 3ZNPA 3GG2A 1S7CA 3U49A 2VNSA 3DOOA 3FWNA 3PK0A 1JWAB 4BNGA 2B83A 3OP4A 1PR3A 3BTOA 3UW3A 1UXGA 3D0OA 3ZWXA 2FWMX 4DQUA 4K9DA 2DVMA 4HY3A 5L51A 1SB8A 3DEYX 3GVHA 5A9SB 5I7VA 1RM0A 1YQXA 4EUHA 2GNAA 4UEJA 5GY7A 5KJ1A 1XQ6A 1IY8A 1HEUA 2QRLA 3RUAA 5CDTA 3TL2A 4NI5A 2O3TA 1LQTA 3P2YA 3FR7A 1Z7BA 4CM8A 3I4CA 2AG5A 3H9EO 1GV0A 3H9QA 8ADHA 4DUPA 1Z75A 3DBLB 1WZIA 2GR9A 3GFBA 4MP8A 1ZMTA 2YDXA 3WIDA 4OMUA 2NM0A 1C1XA 3ONFA 3L6EA 3FWZA 3K2BA 3PYMA 2GCGA 2GDZA 5HTOA 4J7XA 2JFGA 3DQPA 1HE5A 3TSCA 1A72A 1OI7A 1ZEJA 4NU6A 3ANNA 1ZK4A 3FTPA 2Z1NA 3WLFA 1OOEA 1C1XB 2DKNA 4CUJA 3B20A 4BNJA 1BXZA 2RBEA 2G5CA 3ZHZA 3DBLA 1MUUA 5MDHA 1WP4A 2CDCA 1B8PA 1BVRA 5H82A 4WCFC 4AVYA 4JCOA 4CM3A 5T64A 1DLIA 3WSVA 2PZKA 4XYEA 1T1SA 3ICPA 3EZLA 1IPEA 2VN8A 4IJWA 2X22A 3MJVA 1CIVA 1NWHA 3JV7A 3ORFA 3RKUA 4FFOA 3HWRA 5A9SA 1H94A 3W1VA 3MOGA 4FFRA 4TSKA 4I5DA 4DLAA 3PGXA 5IXSA 3NYWA 4FQ8A 3ZN2A 1VJ0A 1ZXBA 3VH1A 2X0NA 2E6UX 5B12A 2X5JO 2WEKA 2Z5LA 1CQIA 3V2GA 3R3SA 2Q46A 4P38A 1BG6A 3NV9A 1I33A 1J6UA 1QXSA 2DBQA 3ZH2A 5IG2A 1LDEA 5AYVA 3O9ZA 3ZWBA 4XCVA 1OAAA 4MIOA 4XIYA 2IYPA 2XXJA 1JAYA 3H5RA 3ZDFA 4ALKA 4D0SA 1M6HA 1PS0A 3ZWVA 1HE3A 1WDLA 3BMOB 4BO1A 4D3DA 1P33A 4E5KA 4FW8A 2Q1UA 1P1HA 3QRWA 1LDYA 1NYTA 1PL6A 3PVZA 1KIFA 3DWFA 1PZGA 5DCUA 2PGLA 5A3JA 1PL8A 5G0SA 1U28A 2F00A 1DRWA 4HFNA 1ULUA 4XRRA 4MPDA 2BH9A 4OKNA 1ZW1A 3VZSA 3TNLA 4EEZA 3AM4A 4W7HA 3SBOA 3I5MA 4D43A 2DBRA 4Q3DA 4ZJUA 1BXKA 2J3KA 1W8DA 4A0SA 2A4KA 2H6EA 4NK5A 1MP0A 3D3EA 2X8LA 1ZBQA 1WDMA 4J1NA 1UXJA 5EESA 1EVYA 5IZCC 1U8XX 3TPCA 4J0FA 1CWUA 2OP1A 1MXFA 1HDXA 5L7YA 4D7AA 4BO9A 4GMGA 1A9YA 1WDKA 2IZ1A 5GMOA 4Z0TA 3TFQA 4ALMA 1VL0A 3KEQA 4CL8A 4KUGA 3LLVA 2FP4A 5TQVA 4RQTA 2XAAA 1G0OA 3ADOA 4YRAA 2I99A 4BNMA 1PQUA 3FNHA 3PQEA 1QR6A 1NR7A 4S1VA 3OA0A 5FWNA 4ZHSA 1K6JA 1X7GA 4XDZA 1RM5A 4DBZA 1HDRA 1B16A 1T2FA 4MO2A 5FFFA 2VYVD 3FPLA 3RROA 5TC4A 3K96A 2O2SA 2IZZA 2VYVA 1NQTA 3ZWOA 2GN4A 2O3JA 2J8ZA 4AJNA 1I8TA 2A35A 5F21A 2ZB8A 5KKAA 1CJCA 4AJ4A 1EBFA 3HZZA 2VQ3A 5LDHA 4GQAA 2ILTA 3UN1A 1I24A 5JAMA 3V1UA 3GC6A 3JQDA 4B8WA 2PZMA 2OFPA 2H1SA 3GY0A 1DEHA 3L07A 4RL6A 4BGIA 4IDDA 3C1AA 3BMCB 3QVSA 1IB6A 5ILOA 2PZJA 4CM4A 5JDCA 3I6QA 3U4IA 3P2OA 3WOHA 3PDUA 4JNKA 4FJ0A 2ZJ0A 4FN4A 4BNUA 4KWIA 2ZYDA 4FFNA 5DBGA 1EE9A 3NGLA 1NVTA 5AQ1A 2YFQA 3Q6IA 4IDCA 1U5AA 3NT4A 2O50A 4YJFA 4E2YA 2DPHA 5C3MA 1PIWA 2W98A 3MJ4A 1J0XO 1FDWA 1LDBA 4CL3A 3QY9A 3RBVA 3BYZA 1N1GA 4BGUA 1U3WA 5KVQA 4BO0A 1YL6A 5DOZA 5DCWA 1P0CA 4OGWA 2WMDA 3GGGA 4XKJA 4QECA 2AXQA 2ZQZA 2O23A 5TLSA 4PVCA 2H9IA 3K92A 3G17A 3CMCO 4DLLA 3STHA 3NAQA 1YS4A 4K1LA 1KOLA 3K5PA 4OQZA 1YB1A 4H3VA 2C2YA 4M86A 1YB4A 1ENYA 2I6TA 4BB5A 2YQ4A 5L45A 2V6BA 2DPGA 3SEFA 1V3UA 4IQ0A 3ZU2A 2O7QA 3ZW9A 1RM3A 2W90A 5JDCC 1Y8QB 2FPPA 2JCYA 3H4VA 5KJEA 4L76A 4Y67A 3NX4A 1VSUA 1M67A 3AOGA 5EINA 2AA3A 3EK2A 1MFZA 5EL0A 3ULKA 2DQ4A 4WNCA 3JQ7A 2GD1O 4CLRA 1ZJZA 4ILKA 1U7HA 2Y99A 4FD3A 1YQDA 1IL0A 1PJCA 3VPGA 1ISMA 4XYGA 2B37A 3GA0A 5IDQA 1E77A 1ULSA 3W8DA 2IXBA 4BIIA 4UUOA 1LNQA 3FF4A 4IY1A 4WLFA 2Y1CA 4PG7A 3RC1A 2BI7A 1IZ9A 4RVUA 3GNQA 4EITA 3GEMA 2O7SA 4I5EA 3RC7A 4IDGA 4IIVA 4NBVA 1EDZA 3W8FA 2GN6A 4YJHB 3PXXA 2Q49A 4RF2A 3TJRA 4B3JA 4J4HA 4IMRA 3H3FA 1YKFA 4YBZA 3RFTA 3WJ7A 1VRWA 4GX5A 5CFZA 1EUDA 1MGOA 2O3RA 4M49A 1LSSA 4II3A 3WQSB 1DIGA 1GYRA 2JCXA 3PQDA 1DIBA 4FOOA 2Q4EA 3VPXA 5DULA 3EDMA 3JYOA 3PEFA 1KVTA 2D4AA 5AXBA 2OOSA 4OKIA 1ONPA 4DGSA 4YPOA 1X0XA 1P1FA 2Q1TA 1YDWA 3FD8A 3BHJA 3KRTA 1KC3A 4MVJM 1XCBA 2EGHA 4JN6B 2EF1A 4CMHA 1H6AA 1PGNA 2X9GA 1ISHA 1MC5A 3TDKA 1EUCA 1YOVB 4LW8A 4CMJA 3H5AA 1D7OA 2BFMA 3DHYA 2D59A 1HDCA 2G17A 2Y0DA 2ZB4A 2VHZA 4AJKA 3ETGA 4OHUA 1P1KA 1EQUA 3UICA 4MKRA 2Y66A 1GPDG 1GEEA 4PCVA 4QX6A 5C7LO 3ITDA 1MXHA 2CSUA 3D3WB 2UV8A 4XYMA 4CUKA 1BHSA 3C7DB 3GPDG 5G4LA 5IDXA 1WAMA 5L53A 1ZK1A 1RM4A 1WW8A 1XSEA 3KYDA 2FHSA 4R3WA 3C7CB 1X14A 3OQ1A 4AICA 2YUTA 1ZIDA 3E48A 3GRPA 4R9RA 3GEGA 4Z9XA 4D45A 5ES3A 3ZZNA 4TKMA 3SXPA 4E31A 4A5OA 1IULA 3U09A 2HMUA 5C7IO 1EK5A 4DIBA 2X86A 1FDTA 3HFGA 4YQZA 3I9OA 4XB2A 3RU7A 4IJKA 3R1IA 3JQ9C 1EBUA 2XPCA 2G0TA 3R0IA 3FPCA 3S2FA 1GV1A 4UVIA 2NTJA 1GDHA 2PV7A 3QP9A 2X4GA 2RHCA 3CKYA 1DAPA 4AL4A 4HFMA 4HP8A 5JXWA 3P7MA 3PHHA 3DZBA 2CVQA 1SOVA 4J4TA 3ZWMA 1AUPA 1KEVA 3QLJA 5LC1A 3AUSA 1E5LA 2QYTA 3CINA 3TL3A 3IP1A 4M8SA 3GK3A 4UVEA 1GADO 1MG5A 4JXKA 4CV2A 3KYBA 4AJIA 4KOAA 4LMPA 2DUUA 1B0AA 3VH2A 3OJFA 3PTZA 1F14A 4LISA 5JAQA 4QUKA 2RH4A 4E32A 2O4UX 1QP8A 3I4FA 4R68A 4CQMB 3JYNA 3PHIA 4DIFA 1XHLA 2HDHA 3OSUA 4FFLA 4TQGA 2PD4A 3EHEA 3GN1A 2IODA 4J2HA 2VRCA 3EYWA 4TWRA 4WOKA 4XD2A 3SC4A 3TOXA 3WXBA 1SMKA 4BKOA 2GZ1A 4KQXA 5TS3A 2NADA 5EIOA 3FNGA 3WNVA 4YT8A 3GHYA 1LXCA 2E49A 4WCFB 4BQRA 3I6IA 4WASA 3DZIA 1GCUA 5L7WA 2X0RA 4XYLA 2BRUA 1GTMA 4EZBA 3DOJA 2DFVA 1Y7TA 3C85A 3MTJA 1PU2A 2EJVA 5GZ6A 1LDMA 3TZKA 2WWRA 3GNSA 4NFHA 2IDZA 1VM6A 3C1OA 3PQFA 4CQLA 2V6GA 1R0SA 1YJQA 4Z9FA 5L7TA 4BO5A 1R4MB 4ZVVA 1LA2A 3WGTA 1C0PA 2UAGA 3Q2KA 4MVJA 4DPKA 4DPLA 4E2ZA 4M54A 2QRJA 3GMDA 4PIVA 2YDYA 3EY4A 4WUVA 2DBVO 2GLXA 4CMKA 1ZNQO 2CF6A 1EMDA 3INRA 2ZJ1A 4R5HA 4Y6RA 4B7UA 4YACA 2FMUA 2E82A 3NT5A 4CMIB 3MJSA 3B6ZA 3HDJA 4Z3DA 4RDIA 1YDEA 5CHEA 3L9WA 3X2EA 1DC5A 4BNKA 1I10A 2VOEA 4E13A 3FBTA 2ZCUA 3A4VA 3GRKA 1R6DA 3U9LA 1F12A 1P1JA 2EV9A 5B4UA 5C5IA 2EEZA 1HLDA 2Q50A 1LDGA 1VJTA 3WGHA 2I67A 4OIMA 3GPIA 2DBZA 2CVOA 3OA2A 1R4NA 2X5KO 1E1KA 3SVTA 2GERA 1YONA 4NMHA 4JK3A 1Y8RA 5A03A 1K89A 1D8AA 2Q1SA 4KDFA 1UAYA 4I8XA 5THKA 2B5WA 2Q2WA 2UYYA 1C14A 5I9NA 4XB1A 3RC2A 2IYOA 2PGJA 3L4SO 2FR1A 4B79A 3JCZA 3IP3A 4R41A 4I5FA 2HK8A 4NBTA 4M55A 4E12A 1DJQA 3WB9A 4BNYA 3NEPX 1Y5MA 4GVXA 4DQXA 3UCEA 4EYEA 4CV0A 3JQEA 2AW5A 3GMSA 4OH1A 4DXHA 1IZ0A 2YZ7A 4DREA 4EGFA 1D4FA 4GI2A 3ENKA 5L3ZA 1HDGO 2JD1A 4OM8A 1T1RA 2I9PA 3HHPA 5F1PA 4N18A 5BR7A 1JQBA 3I9JA 3ZNOA 5DCYA 2HK7A 1N7GA 1EEHA 3OEWA 3OF2A 4ZRMA 5TF4A 1Z73A 1C3VA 2X58A 4XEHA 2P9EA 1ENPA 5DDIP 3QHAA 2G82A 4DBVO 1EUZA 5A05A 2BELA 1XIVA 4ITUA 4YA6A 3RIHA 3E1KA 2O3SA 4PRLA 3BIOA 2X5OA 3LT1A 4H15A 3RASA 1YJ8A 3UHAA 1QV7A 3CZRA 2HJSA 3CTVA 3PI7A 1XG5A 1E3EA 5U4QA 3DHEA 1NNUA 4HUJA 5JAZA 3VVBA 4DL9A 1CF2O 2IRWA 1K5HA 5G0UA 3ROQA 4FB5A 4R1TA 4RZHA 3N7UA 2DTXA 1Q7GA 2ZB3A 5CPBA 1V3TA 1U4OA 4WLEA 5T67A 1NPTO 1WXDA 5ICMA 4KDEA 2IE0A 2EERA 3BTUA 1TA4A 3LZ6A 5A5EA 4PLZA 4YR9A 5JS6A 4G65A 3IKVA 2CFCA 1C1DB 4EUEA 1IOLA 4BL5A 1DC3A 3R6DA 1XU7A 3WR5A 2WE7A 1JA9A 4FR5A 1L7DA 1Y6JA 3GAZA 2P68A 5DN9A 1N9GB 1FDUA 2HJRA 4J3FA 1DLJA 1ADFA 1X1TA 3JD3A 3QWHA 1R66A 4BMVA 1ZVMA 2YHIA 4BGEA 3EC7A 4GSLA 5I7FA 3MEQA 4H7PA 4BO7A 3NT2A 4MKZA 4BNNA 1A4IA 3V1YA 1DJNA 2VT3A 3C3XA 4GWKA 3KVOA 1YL7A 4JX8A 1I01A 4CLOA 5KWEA 4RPLA 1QSGA 1ZK0A 2PGDA 4BNXA 5JDIC 3LYLA 3DBRA 3F6YA 4U7WA 3RC9A 1RWBA 4KP7A 4DMLA 1QYXA 1LTHR 4GSKA 5A1TA 2EKQA 4WKGA 1XA0A 1XQ1A 1CRWG 2ET6A 1HYEA 3WMWA 5T57A 4LVUA 3LU1A 3HJAA 4ALNA 4OO3A 2Z1MA 4AFNA 1B8VA 2EP7A 3AI1A 1TXGA 1KEPA 3OFSA 3RVDA 3JD2A 3WBFA 1AGNA 1RKXA 4UVGA 5ENDA 1HTBA 5ITWA 3RI3A 4QFDA 2BFOA 1EQ2A 4MVJI 3M6IA 3VHRA 2D0IA 4WLNA 4FJ1A 3INGA 1R12A 3HN2A 4W99A 1SPXA 2EXXA 3FSRA 2YV3A 4PLPA 4PG4A 2GPTA 5BQFA 1PJTA 2PNFA 1UH5A 1P3DA 1UXKA 3DTYA 3GUCA 3RUDA 3F9IA 2BI8A 3RUCA 4OQYA 4CPDA 1W0CA 1DIAA 5IN4A 1F17A 3BMNB 4BS9A 4NFSA 1TT5B 1JU9A 4PRKA 2P9GA 4B7CA 3IMFA 2W2LA 1WPQA 3QVTA 1QRRA 4AJEA 2IEDA 1GFSA 1Y1PA 1JKJA 4ZN6A 4FIZA 1SCUA 3CXRA 5HS4A 1FF9A 4CMBA 4CQMD 3Q2IA 4OL9A 1M76A 3FR8A 5TSDA 3S2GA 3IJRA 3UF0A 2PKRA 4DYVA 2PH3A 3T4EA 1C0LA 3JQGA 4BV8A 1E7YA 5AXDA 3D4PA 2X23A 2GN8A 1KVRA 1LRLA 3L4BC 4BNFA 1R16A 1EZ4A 2V65A 3KV3O 4J43A 4PZDA 4NK4A 1X15A 3JD4A 3Q3CA 3OJEA 3QWBA 2EW8A 1X1EA 1E1LA 2AQHA 5BNFA 2DAPA 2IEBA 3N58A 2VZ9A 1I36A 1OMOA 3JYQA 5CDGA 1Q0QA 1HZZA 1U2GA 4XX0A 2X7HA 4ALJA 1N7HA 1ONNA 2WD7A 4DA9A 1LQUA 2FY8A 5KIAA 4BNIA 1SZJG 2A9FA 3GR6A 3KYCA 2NNLD 2DTDA 1LLQA 5DT9A 4HNHA 2WSBA 1BSVA 2GRAA 3B1JA 3Q9NA 4S3MA 2UUOA 4CMEA 1DC4A 1ZJYA 3T4XA 4NQZA 4RDHA 2J5KA 2D5CA 4J16A 1YGYA 4EEXA 3VH3A 2VT2A 3MTGA 2O4CA 2HLPA 5THQA 3RCBA 3ZWCA 2GASA 3OBBA 5IXYA 1RYEA 2NU6A 4R16A 3TN7A 3WNQA 1A4UA 2HSDA 3RJ5A 3ZV5A 3LQFA 3KO8A 3NTQA 4FBGA 4RCVA 2B5VA 1BXGA 4NG5A 3L6DA 1VI2A 3P5SA 4N5NA 3BMQB 2D3TA 1XWFA 4QSMA 1GR0A 3ICCA 2C07A 4JGBA 1NHGA 4LK3A 5EJ2A 1KEUA 2EGGA 4Q39A 4WLUA 2AG8A 5CDUA 1X7HA 4BOYA 4PLTA 1LC3A 5JE8A 4B7XA 3M2TA 3O26A 2EWMA 2OBYA 3WTCA 4IXWA 1KVQA 3PP8A 1T26A 4CLHA 3H65A 3O4RA 4GPD1 4YEDA 3WGQA 3ST7A 3HG7A 3JQ8A 1XKQA 5ITVA 4XZ3A 3ZHBA 1I3KA 1SOWA 4WLVA 1ZK3A 5K0ZA 4RORA 4BGVA 4GLOA 5MGBA 1N8KA 1ZUD1 1T2DA 3JTMA 1SNYA 2HO5A 1E7WA 1VPDA 1QYVA 1B3RA 3A06A 2ZB7A 4U0JA 4BNVA 2WD8A 1DO8A 1E5QA 5G0TA 3JQFA 1V6AA 3Q0EA 4R3NA 1T2AA 3KETA 1P74A 5CAEA 2P4QA 1KYQA 3IKTA 3SC6A 1ZZEA 5C37A 4O5OA 2PA3A 2Y93A 3JQ8B 2HMVA 1I5RA 1G1AA 1NM5A 3PLRA 2Y1GA 4O63O 5DBFA 3KHUA 4B4WA 4CMGA 3AM5A 3F4BA 3AOEA 4TKLA 3HADA 4L4SA 3GHHA 3I3OA 3TZHA 2YV1A 5A3VA 2VUSA 4J2OA 5ILGA 4NJMA 4DWVA 1E3WB 1B3BA 2Y05A 3JQAA 4J49A 4CR7A 4IM7A 2ZK7A 1DIRA 3FHLA 1MX3A 3L9XA 1J49A 1V35A 3BMQA 1PWXA 1ID1A 4YQYA 1A27A 3E5RA 5IZCA 2TMDA 4O59O 1MC4A 4OYRA 3ZGYA 1HT0A 3MCVA 1F8GA 2RIRA 4RLHA 4L0QA 3T7EA 3TFOA 4IS2A 5KVVA 3E9QA 1XELA 3WWYA 3ADPA 1DAOA 1DRVA 1EFLA 4QEDA 4UUNA 3IDSA 4E5YA 5KVSA 1M2WA 2OXIA 1NX6A 4ZQFA 3ZWPA 5TRTA 2CF5A 4D79A 2AMFA 3KSZO 4IS3A 3DZJA 2PY6A 3JD1A 5TJHA 1E6WA 4HX5A 3H9GA 5F1OA 5KKCA 3KYCB 3ZV3A 4BNWA 3Q9UA 4YAIA 1KVSA 2D8AA 3IQDB 4XIJA 3VTZA 2J3IA 4F46A 3WBBA 3S2IA 2WD7B 1DHRA 4R51A 1YQGA 3W8EA 4FFPA 4GGOA 3FNFA 3WFIA 3KLPX 3BAZA 4LSWA 4DLBA 1XGKA 3W6UA 1BMDA 1N92A 4L75A 1U5CA 1YH3A 1H9AA 1OBFO 1I3MA 3JQCA 1B2LA 5I7SA 1EVIA 5IAAA 1DOHA 4EJ6A 3E9MA 1C0KA 3NJ8A 3PJGA 2HQ1A 3GNTA 3D64A 4W4TA 4PLVA 4CLDA 4J1SA 1PL7A 4QFCA 4EJMA 4IGFA 1HWYA 2CUKA 4RQUA 1HSZA 5KOIA 5BSGA 4B3IA 1BW9B 3U4DA 5ER6A 4LN1A 4ND4A 4U0KA 2G1UA 5IDWA 3MJCA 4NJOA 2FR0A 4O0LA 3A28A 3KBOA 3OJOA 2XOXA 4IDAA 3HDQA 1O94A 3CE6A 1Z6ZA 4TVBA 4X54A 3EAGA 2VNAA 3BMNA 1I0ZA 2D1YA 2VTDA 1KC1A 2W2KB 4ZQEA 3RUFA 4BKPA 3DHNA 2C7GA 3WSWA 1D3AA 4BMNA 1HL3A 1OZAA 4GMFA 1AE1A 5AVOA 4BUCA 4YRDA 7MDHA 4NR0A 2VUUA 4YAGA 5DBIA 3TZCA 3OEYA 2GYYA 3QE3A 4Q9NA 5JW6A 3QWAA 3QWIA 2PLAA 2PD3A 4J6FA 3PHGA 5G4KA 1YB5A 5IN5A 4Y98A 4XR9A 1CDOA 1NXQA 4PZEA 5HBRA 4IDFA 5JO9A 4HBGA 3V2HA 2NVUA 1FMCA 1U1IA 3M1AA 5COAA 3DZHA 5I9LA 4E30A 3KSUA 4Q3CA 2BGKA 3UUWA 4PG6A 2NU8A 1GQQA 2NV6A 3WGYA 3RUHA 4FPXA 1Q1NA 1X13A 4MP6A 1ML3A 1UP7A 1JWBB 3GAFA 3OQ6A 3ZNNA 3SJ7A 3B70A 3WJAA 1S6YA 1XR3A 2OBNA 2WDZA 4CLOB 3CPSA 1NTOA 3LC1O 5JY1A 3ZU5A 3UOGA 1JTVA 3KM0A 1HSOA 3WYEA 3AK4A 4FCCA 3IS3A 3IJPA 3K2EA 1PQPA 1QMGA 1UP6A 4E5MA 2CVZA 3UKOA 3S8MA 1ZCJA 1LBEA 1BDBA 2VRCD 4RF5A 2YHIB 4GX1A 3NDJA 2D2IA 4BKUA 1X7DA 1K3TA 5KTKA 1N9GA 4CM7A 4Z6KA 1GU7A 1Z45A 5CG2A 5JFOA 2UUPA 3DTTA 3RFXA 2YFHA 3FBGA 1ZSVA 2GUGA 4UEKA 4RVSA 5A04A 3RQSA 4JBIA 1NVGA 1ADCA 1N2SA 1PGOA 1WNTA 2FSVA 1JVBA 8LDHA 2HU2A 1NPDA 4YXFA 1E92A 4A03A 5FI5A 3GVXA 4CV1A 3ZHXA 1W4ZA 4BNLA 1YBVA 4ZD6A 1T24A 4WOJA 1I2CA 5ICSA 3D4OA 3HDHA 3ZU3A 3EZYA 1T4DA 1ZSYA 4TVOA 4BB6A 2PWZA 1DDOA 3F4LA 3KUXA 4IZHA 3N74A 1V0JA 2B4QA 3FCOA 2PK3A 3H9UA 1BDMA 3MJTA 2FOIA 3LC7O 1I30A 2O48X 1E7SA 2Y1EA 3AU8A 4K6CA 1DFIA 4IZIA 4A10A 3WICA 5A4DA 4DQVA 4RLSA 2NU7A 1AXEA 1AXGA 3VPFA 4AJLA 3L6OO 2Q99A 3INTA 5LDGA 4QO8A 2GO1A 1A9ZA 2C2XA 4L74A 2C29D 4HADA 1NAIA 4YVFA 4J7UA 1MA0A 1XYGA 3DZFA 2JHGA 3B1KA 3K31A 1V8BA 2AQ8A 4MVJF 2VZ0A 3AW9A 3ZWWA 1E1NA 2Z95A 4I9UA 3UCFA 1Q0LA 5A9RA 2VTEA 1O6ZA 4YT5A 5JYEA 1RYDA 2CMDA 3PWSA 4CM9D 1GD1O 1LLCA 5F5LA 4I9NA 4XQCA 4ID9A 4HFRA 2Y1DA 3DMTC 2YV2A 1K0UA 5L4LA 4TZTA 1ZO8A 2FZEA 3NTRA 1Z82A 1XDWA 4CM9A 1L7EA 4Z9YA 2H63A 4XA8A 4GX2A 1H9BA 4WECA 4YJDA 3S2EA 1T2CA 4E6PA 2IXAA 2X0IA 4L73A 3CIFA 3EUWA 3PJDA 3WGOA 4QQRA 2Y0CA 1I2BA 2FR8A 2NQTA 3P19A 4O1MA 3VPHA 4RPGA 2AEMA 5F3RA 3AY7A 1DBVO 3GQVA 2NVUB 4PG8A 2I3GA 2ZATA 2B35A 4DRYA 4E0BA 5G0WA 5HM8A 5KCZA 4IDEA 2X0JA 5KVCA 1V3VA 1XEAA 4R1UA 5G4KB 1R4NB 3OIFA 2PZLA 4E33A 4CMAA 2W4QA 5EERA 3E03A 1QKIA 3PLNA 4K26A 4WPGA 4RGBA 3H2SA 1QYWA 4UUPA 3UAGA 3C24A 5G2OA 3ENNA 3H8VA 4M89A 1YWGO 2I76A 1YBAA 2W2KA 5JAIA 4PLYA 1KS9A 3WYBA 4MVJH 2ZKLA 2QQ5A 1SO8A 5DP2A 4AJHA 3CMMA 1WWKA 2JD0A 2G76A 2SCUA 4K28A 3D7LA 3F1LA 3WDSA 1U2DA 1T2EA 4HXYA 3E8XA 3K73O 2B4RO 4A73A 3DR3A 2C5EA 1O9BA 3GT0A 1KEWA 3PRJA 1BW9A 2PTGA 2OGUA 4F3YA 1PZHA 1TI7A 3I9NA 5K6AA 4XWYA 4K6FA 1NBOA 3WWZA 2NQ8A 1R4MA 1HYGA 5I7EA 3E5MA 5JMWA 1P77A 3CZMA 4LCJA 1QV6A 1ZFNA 1CERA 4CQLB 4D42A 4KUHA 4KMSA 2FZWA 1HRDA 1WLYA 2Q2VA 3OJ0A 3D4NA 4DTIA 1GZ6A 2BGMA 4NBWA 4E5NA 4P4NA 1IUKA 3UFXA 2BGLA 3UGKA 3U4HA 1PS8A 2WYUA 2X1HA 5IDYA 4MIYA 2CNBA 1YBMA 3COSA 3WYCA 3AFNA 3VDQA 2VHWA 3RSHA 1BRMA 1AHHA 1NP3A 1UJMA 2AEFA 3AY3A 5T5QA 3OHSX 4WCFA 3PIDA 1EVJA 5COQA 4PZCA 4WNIA 1DIHA 4WK6A 4ZA2A 1H2BA 1WMAA 3PWZA 2B0JA 3LSYA 4Z0PA 3AUUA 3ZNQA 5U9CA 2HMWA 2ZTLA 5EQFA 5EN4A 4KQWA 4A26A 4BKRA 4CQMA 1CEQA 1IYZA 3GH3A 1GQYA 2CD9A 5DOVA 3ZWYA 2JD2A 2JKVA 4RV9A 1DC6A 1UDAA 4FFMA 5JC1A 4JBHA 2EP5A 2UDPA 5TNXA 2Q4BA 3LT4A 2OP0A 4Y6PA 4NU5A 3ZW8A 3PWKA 1KERA 1VLLA 2QIOA 3FI9A 4GVLA 3KTDA 3GUYA 3JQAB 5FYDA 3ZHYA 1E3WA 3F5QA 4NJMB 1R0KA 3ON5A 1D1SA 1DSSG 2BMAA 3DAFA 3VAZA 1LJ8A 1P0FA 1DPGA 4HV4A 1VKOA 1PGJA 3UXYA 1P45A 2B69A 2X9NA 3QJ5A 2I65A 4RVFA 4TMFA 4UVHA 4HKTA 3F5SA 4RPKA 5K9ZA 1F8FA 4OXNA 1VJ1A 3NUGA 2J5QA 1ZKMA 1ZXLA 4PLFA 3VKUA 4TRJA 1LLUA 2UVDA 2DM6A 1PEDA
chains in the Genus database with same CATH superfamily
2FRDC 1AKRA 4RIHA 1F48A 3LZCA 3OG9A 1JEYA 4PF1A 3WWPA 2ZS7A 4WJZA 4NVRA 2FP3A 1CZRA 1IPFA 1HM5A 1Y33E 3D5EA 5E8JA 3PTLA 3X2FA 3ABIA 4H0NA 3BB4A 2UVPA 1NTRA 2GK6A 4IKPA 2F90A 3F7NA 1OTYA 1BD4A 3I6ZA 2HHLA 2E4AA 5DWQA 3R4CA 3CRVA 4HYEA 1PSWA 3A3PA 3L0DA 2GD0A 2J4DA 2YWGA 1PGQA 1LC0A 3QU7A 4KPEC 5KNCD 4O2RA 1RJWA 3PUIA 5IYZA 2YIVX 3WL4A 2H31A 1TCUA 2VP2A 4E11A 1CT9A 1O96B 3G49A 3GRZA 4Q4HA 4UCWA 5CPFA 2JJ1D 1PD1A 4JROA 1J2JA 2Y67A 3DONA 4RTRA 2NTVA 4M0KA 1J9EA 3TNYA 2IHKA 1FCJA 2Z08A 1HOXA 4QGAA 4JVNA 4MQEA 1THTA 2ZWVA 3JYPA 1RYYA 4D74A 1MZPA 5HZHA 3DM9B 1M66A 1IEQA 2IF2A 3AU9A 3N0VA 1ZUWA 4G8JA 1FMFA 1FW6A 3HHEA 3LUHA 1J56A 1HH4A 1QO0A 4GMDA 4I9HA 1N2OA 3KIPA 1IVYA 5CXUA 4QM6A 4R98A 4AECA 1UKCA 2ES4A 4X3CA 4B3DA 4ENQA 3BB3A 3I2HA 1OFUX 1O89A 1LPNA 3HYLA 1VKNA 3QVWA 3KHKA 1M2OB 3BH0A 3D3QA 3N2GB 2A2ZA 2VHUA 3CSDA 4G0UA 3ZDAA 1K08A 2QAIA 4XGQA 4C2AA 4EGAA 5LZ7A 5F1KA 2JLWA 3QF7A 1PBNA 1T0IA 1SQFA 1KBZA 2CLSA 4ESHA 1IWBB 3KDAA 3RANA 5IM4A 4JBXA 1HRKA 3HB9A 3NPMA 4GX0A 5DHFA 4RHEA 4HWKA 3PCRB 3T1YB 3SC3A 4EGSA 1Q3KA 4NC9A 1RBQA 3CTMA 1WETA 2HPVA 4AG5A 5TR9A 1JQ3A 3CKLA 2IZ6A 4MEJA 5H0IA 3T3DA 2G08A 2PUWA 4LKRA 3PL5A 4U6SA 3F8SA 3OQPA 4JR2A 2WQ7A 1TAUA 1KNXA 1K6MA 2I87A 2K4MA 2GKGA 3CH4B 2R6DA 2YVLA 1AIPA 4UNRA 2JFUA 4INAA 4DW8A 2H51A 2I3BA 1XLWA 2WF8A 3FYTA 5I7WA 3EPLA 3UMYA 1C81A 4IUCS 1KPGA 4ZYTA 3GOQA 3TMYA 1KEEA 1SEPA 2CK3A 1U7TA 2PR2A 4LXXA 4Q9LA 1JUDA 1U6KA 4URZR 5CT6A 1UKZA 1XEXA 3ZDEA 2GCEA 5KSWB 3LDUA 1MW8X 3VPAA 2H5JA 3GA5A 3JXEA 3TQHA 3K9CA 2FDRA 2PKQP 1I3NA 1X87A 2DU8A 2PLRA 3LG2A 3MCWA 4I50B 1U8EA 5H81A 1H5QA 2ZJ6A 1E0JA 2PV0A 3WO0A 1DDGA 1PEAA 4B4OA 4ZICA 3RFFA 5JCJA 3BRQA 4DWWA 3VV2A 1MDBA 1Z62A 4V0MA 4Z0HO 3BQMB 2P6RA 1T2VA 4DLPA 3E70C 1WZ2A 3U44B 1YR9A 3EMKA 1IMJA 1JKJB 3REFA 1ZK2A 4LA4A 5HUHA 1MB3A 2IUUA 5B7GA 1UP4A 2OHJA 4MVJE 4RVGA 3BULA 3CF6R 2H3HA 1E99A 2NTEA 1TT5A 1GNTA 4X45A 4ZEMA 1XU9A 1KY5A 1M1YB 4XUDA 3TI7A 1SHTX 5KQSA 1LH0A 3JALB 3HN7A 2QV0A 4HEA1 1E69A 5AIBA 1ZD8A 4GEKA 2F8MA 3UV7A 2YW2A 2UUAB 3HDYA 2H59A 3DZKA 1FOEB 1NURA 3OI7A 3P9YA 3ZVLA 4KI7A 1IEXA 4GKBA 4JB8A 2QL7A 1BN6A 1UODA 3GBSA 2DB3A 3BUSA 3R2JA 3DDCA 3FVWA 3E7WA 4HNAB 1C7ZA 4MW7A 4NAUA 3SZRA 5JRDS 2IOYA 4JV5B 5KQGA 3IP7A 1DT5A 4J3JA 5HR5A 2XCLA 2YKGA 4KPFC 1I5EA 3TOSA 3EEQA 1JVSA 2Q21A 2GSDA 1QO9A 3I6YA 3WVNA 2IP2A 4M88A 4XLZA 3RADC 1LSUA 1K97A 2WZDA 4ND8A 4TL7A 4BRZA 1V3QE 4IIGA 1LRJA 3PKZA 2X3FA 4KQHA 4R31A 3TB6A 5JJKA 2A0UA 4O4HF 1K68A 1RPNA 1WKCA 3WTBA 4IILA 1H0RA 4O2BB 4Z8YA 1ZHHA 1PR9A 5IEBA 3SYLA 4CFYA 1ZVJA 2QUHA 1JFFB 3DMFA 4TKUB 4EHJA 1POWA 3L46A 3REGA 3ADCA 1EDOA 1O95D 1EVZA 3LUPA 2VYND 3GEBA 3IUJA 4OJQA 1YFLA 4OH7A 4MUYA 5JZOA 4TV9B 2JJYA 3C74A 1N2ZA 3EUFA 2AXEA 4Y1FA 5EXDA 3C3KA 3MGCA 2JIPA 4L4XA 4AQYB 1FJ2A 5EYPA 2FXIA 2W8ZA 1CZLA 4FFDA 4GAEA 3PVSA 1QLJA 1JHPA 4R01A 5AESA 3PT9A 1OA0A 1UZLA 2PH7A 3QTBA 3JQ6A 4ECAA 1HE2A 2V6MA 3U4QB 1QS0B 3MELA 1E1QA 1FSPA 3PIIA 1ADBA 1BKDR 3IQIX 1ETUA 1K2VN 4OPMA 3ZHVA 4NPCA 1TAQA 1CRLA 1TB4A 5ENVA 4YHHB 4N4AA 4N7RA 4YCSA 5C7YA 4JR1A 4QGBA 1JG1A 1Z47A 1W4LA 1SXJA 1MOQA 4X7PA 3SX4A 1R8SA 5FBHA 3ZBQA 4C0SA 3GLGB 5G41A 2HREA 3C7TA 4HDNB 2OLEA 4G9GA 1RABA 2D2XA 4BX8A 1PWEA 3BXZA 3PXGA 3IT1A 2ZCJA 5B3AA 2RC6A 1MMFB 1TGYA 1R10A 2G71A 3GGJA 1BOOA 3ROTA 1UMCA 4DEYA 1YRLA 4CEIB 2BCGY 1FP1D 1TLTA 4H3SA 4OJTA 1ISGA 3LT0A 3PNVA 4D4HA 3KKMA 2X2FA 4ICIA 4IXDA 4J1TC 4RS4A 2IZ0A 3DDSA 3ZTWA 4AMUA 9GPBA 5BMVF 1CE8B 1KFKB 3O4HA 5DJ5A 3RS2A 3I09A 3M4JA 2GH1A 2SNIE 3BM5A 3IAXA 4PLGA 3TLZA 2FF5A 3W5UA 3WL5A 5LOVF 5HRUA 3ONEA 4ND7A 1U4NA 1OLXB 4M0CA 1GUZA 4UBMA 1ZEMA 2R7LA 4BEVA 5HEKA 5HCNA 2C4NA 2JI7A 5G1OA 3O9MA 5LZ9A 4M7WA 4DIKA 2OLKA 3VH4A 2BH2A 3D2CA 1V96A 1VQ1A 5FJJA 3WKBA 5JXIA 4NAHA 1NX9A 1USUA 2RH9B 1A04A 1ZN8A 1NWCA 2HC9A 4K2HA 4B3CA 1FMLA 3H3JA 4U63A 4V0RA 3ETJA 4NFYA 4B8ZA 4LDQA 3M2PA 3O83A 4X8OA 4YP6A 4C6TA 3DAHA 3SFVA 4PLCA 3DOUA 5KTTA 1I4TD 2JVKA 2A8YA 1Z0AA 1KBOA 2SBTA 2W6JD 3AR3A 3DJFA 1G98A 3EWNA 4FILA 3VSBA 4ZGGA 1RRMA 3L1HA 4OP1A 2HRZA 2Z2JA 1NRIA 2PEYA 3U3OA 5F64A 2J4FA 2PWBA 3C3JA 3B82A 4I9GA 2NQ2C 3A6FA 3SIPA 4CODB 4DGQA 4G0WA 4XJSA 4HRXA 3Q41A 4JR0A 3QOYA 3CGGA 5FXMA 2WUDA 2IYZA 4Q3NA 4FYJA 4W9MC 2WKWA 3MJEA 1WMDA 2OFFA 4EY4A 2DUNA 1E9VA 1Z3CA 3ODPA 4GKVA 3C16C 4ZGWA 1I7PA 2Y9PB 1W7AA 2OUIA 2KHZA 4Q9AA 3HUTA 3IEUA 1DQZA 1TAHA 5U4XA 2QLTA 3ISTA 4KQIA 4ZT3A 3T4UA 4LGMA 5JU6A 2GZ3A 4N39A 2O7VA 3M3DA 3ESYA 4FYMA 1B73A 2VHJA 3KTFA 4JBYA 1HFKA 2WU1A 5ELXA 3VKVA 1J06A 1RQLA 3PFWO 2HHJA 2WJHA 1CHDA 1ZMOA 2HRBA 3STTA 2DETA 3LBAA 2FMKA 1OIXA 4OLHA 2QZZA 3RUEA 4XLTA 1RWVA 4M0UA 4CN8A 1J0BA 1XZMA 1SPBS 2DSNA 4XQ9A 5IJWA 1OWLA 5L4NA 4D46A 1ESDA 4OU5A 4Y6QA 4V1CA 3C2QA 3Q8KA 3FRJA 4QDKA 1VSBA 1JSLA 1MPTA 2R2GA 3OZBA 5K2OA 1RNLA 4CF6A 1H5UA 1HUQA 2WE8A 3RIYA 2XNHA 4FGKA 3V2UA 3MW8A 3IQEA 2BF7A 2FFAA 4NE7A 4D9JA 5DX1A 5IC4A 1OBCA 1YHNA 4FSXA 1DJLA 3MA0A 3R9XB 1IM5A 3PV0A 3QUBA 1AZWA 1B15A 1Y8RB 2GWRA 3I52A 2WIAA 2AL7A 1EDEA 2ZIXA 4H35A 3SC2B 4BN5A 1O6CA 3N0TA 4CF4A 3GBPA 1G21A 1D6MA 4BECA 3WK9A 3JD0A 1L5RA 5DHQA 4JX9A 1SVOA 4RD6A 2SKDA 3ZI0A 4ZTZB 3HUFA 4EY8A 1K4MA 2GYUA 5AVKA 4H1VA 2L18A 2H2HA 4JZKA 3NBZC 4RVDA 4AK9A 4LUCA 5LQCA 1P0MA 3AUAA 3GJYA 2VQFB 2ZTVA 4QTUB 3AH8A 4QJIA 1MB9A 5J2UB 3O31A 1KIAA 3UHJA 4C07A 1SU4A 4C7JA 4AY2A 2HXYA 3R7FA 4IKOA 4BVGA 4KO3S 4ZCRA 4CMIA 1EUYA 2ONYA 2I0FA 3H9JA 4YMWA 5J5AA 1O95C 2FUG6 4CG0A 2ST1A 2NLOA 4HDSA 4W8GA 1FVHA 4E4RA 1M8FA 2B2NA 1RAHA 2BFFB 1NVDA 3TQCA 2W2LD 3L7JA 1YQ9A 4NZPA 2APJA 4QULA 2XWJI 1XXHA 2JFBA 2ZI5A 4NBKA 3OOYA 4R8LA 3H11B 2G8NA 3VR5H 1QIMA 5JJBA 1J5XA 1UDCA 3P9NA 3C15C 3R0JA 4H1HA 4TLAA 3WA7A 5L9AA 4MK4A 4NDNE 4LMRA 4TKVB 1NGSA 2O8CB 4WZZA 2C58A 4LHYA 4CJXA 3B3FA 1SD2A 4XQEA 3ZZUA 3H7AA 1P1RA 2SHKA 2J3JA 2VATA 4UCQA 4RKYA 1ZJJA 4EO9A 4JP2A 3OU2A 3OZUA 4RFLA 4TMXA 1PS9A 1SJ9A 1U9IA 1V5EA 1Z4LA 4U6QA 1FTGA 2GZ2A 2QRVB 4PFQA 1QDLB 1OJ7A 1FFAA 3HFSA 1JHZA 1W2GA 4TMTA 3T1OA 2JW5A 1EGMB 4BX2A 5KYWB 3G2HA 3IQZA 2NYVA 3KSBC 3D3KA 3WX0A 1N4DA 2OMEA 3HWX1 4OREX 2WHXA 2C4TA 3CUKA 5E7MA 3KEOA 1P7ZA 1ZA2A 1SH7A 1L5HA 3A6DA 3WGNA 5EJ8A 3DEFA 2TMGA 2AR9A 4MV9A 2WC1A 4WGGA 5JS7A 2VWQA 4FCTA 3GDGA 4OHRA 4DQLA 1U8FO 3MB5A 5JCZA 1J39A 1JLMA 1JIIA 2FNAA 4UNPA 4EF4A 3CN7A 3IP6A 5C1DA 3EODA 3HXQA 4M4SA 1ZIOA 4TV8A 2E4VA 1E6LA 1K8ZB 2PSSA 3E82A 1PTKA 4QUIA 1FX0B 3TB4A 3ZQUA 6LDHA 5AVSA 2O3QA 2WWVD 5EWLB 2IS1A 5DZSA 3E8MA 4FN5A 4JI0B 5BN4B 4CL2A 1FDSA 1FSSA 4YJGA 2F1RA 2ISQA 2R9VA 3AY0A 2W8BB 3DCYA 3THSA 2XNCA 1NJFA 4R83A 1PE0A 1YFJA 3AB7A 4S1WA 2Q5QA 1BRTA 2F2TA 2QN7A 3RUPA 4F6RA 4Q7LA 3AJRA 4E5VA 2P5YA 3KJIA 3QA9A 3HWSA 2Y1KA 1D9ZA 3X2SA 3I9LA 5BSRA 3K70D 1QGAA 3A6PC 2RKWA 4O5AA 1ESMA 3HXLA 4P82A 3GLHA 2FSVC 3QSGA 1HE4A 1NVEA 1Q2UA 1TVCA 3EWSA 3MJFA 4MI9A 3TZLA 8OHMA 3PU6A 2P8SA 2QVGA 1YVRA 3F6EX 2WFAA 1E3JA 3IDOA 4X65B 1OBOA 2CNWD 3ENZA 3CLVA 3H8JA 4Q7KA 1XZGA 4RNDB 1ZXXA 1E66A 1JPNA 2NZXA 4YV7A 2HWXA 2Z4RA 3CF4A 5CM2Z 5LJIA 3QPUA 4IP0A 4C4XA 4R1OA 1WRBA 2G04A 1MTZA 2ERCA 2YYZA 3WZLA 2JF0A 4ARZB 4MEAA 3K9GA 4BCCA 2WHEA 2OZEA 3AI7A 5AOVA 3ZXUB 1KY2A 3JQBA 1OJLA 1H69A 1YIOA 3DOIA 2UYQA 1E3LA 4WESB 4Q3BA 2OPHA 4AJ1A 3D8TA 3MCAA 4UZSA 4G5OA 3OWXA 1COWD 2I1VB 4NOMA 4IXTA 1OFGA 5IMBA 3RS7A 4WKBA 4FWBA 4FGZA 421PA 4ZYUA 1NV9A 2BEVB 4QIHA 8ABPA 3ELWA 1DTWA 4K5QA 1YZ3A 4OK5A 4URUR 5ALSA 1SVSA 4ESEA 5C7OO 4PZPA 4QARA 1GILA 2IHUA 1P5RA 5AICA 3FB4A 1TCCA 3QVXA 2EFEB 4CUZA 2IU4A 5BN5B 1RDFA 1BVHA 2AUTA 1E0DA 4S05A 1E4OA 1L7OA 1TVEA 3ETEA 4NIMA 4NL4H 5BQ5A 3RHSA 1HNXB 2FPGA 2KPOA 4V0SA 1CDZA 4X95A 2H5LA 5DWDA 5TMEA 4UREA 1HXHA 2FEPA 3QW2A 2R2AA 4MW1A 4EVIA 2QHXA 1C4KA 2PLNA 5IZ4A 1Y5IA 1WBDA 4F0JA 1PV2A 1BA3A 3MT7A 4P3YA 3CLTD 3Q5DA 3JAWB 1CR6A 1W88A 3C8MA 1KL7A 1A95A 2X76A 1P3JA 3OO0A 3PNBA 4CKCB 4C43A 2P2SA 3PPYA 3TW4A 2F3PA 1G9XA 3VO9A 4B7AA 2RGCA 1GNSA 2GUWA 3GJ0A 4IWNA 3WGLA 5J63A 3BBPA 3ACBA 3TZ6A 4QEKA 3OZDA 4QEZA 5DH9A 2FK8A 5KUTA 1IXYA 1WKBA 1Z6GA 2XJ9A 2XW6A 4IH1A 4WINA 1BVUA 3GGOA 4GLLA 5JSQA 4KNWA 5E1MA 3U37A 5I7HA 4LYGA 3W4KA 3D1LA 2CXRA 3LWBA 1YS7A 3KAKA 1GPWB 2QZ4A 2R4QA 4YO8A 1GKYA 1DKOA 1UXIA 2IYEA 5JSYA 4HNVA 1N5JA 1WCYA 1Y81A 2QEQA 1HDOA 2J6IA 5DI3B 4PE5B 3DBHB 2VBFA 2LDXA 3D0QA 3BK2A 5FIUA 5EZSA 2AE1A 1ISRA 1PGPA 1JTFA 1AS0A 2ZYTX 2XVAA 2ZYUX 2VJPA 2A9QA 3GVIA 1YBHA 4U00A 4BKQA 4M98A 3LUFA 1A5TA 5EP3A 4INZA 3K1JA 2WIBA 2GFHA 4MUXA 3VMFA 3L6BA 4JIGA 3TINA 3ZD9A 2XUKA 5J23A 1YDMA 1A9XB 1TW2A 2YZMA 2EDAA 2RG1A 3MLEA 1ZNZA 1LI4A 1OWPA 4WN9B 1ENOA 1NC3A 1XL1A 4UHCA 1YRHA 4R1NA 1TU3A 2OD9A 4OAQA 1H2YA 1QOPB 4R84A 4WTOA 4XASA 3NBKA 1O1YA 1JHDA 3Q7SA 1FFBA 3MQ4A 2V3VA 4OLJA 2QAGC 4FZRA 1D07A 3PFBA 5FRDA 1JBKA 5ALKA 4EG7A 3LVRE 1VGQA 3HYNA 3HVRA 1M72A 4WNAB 1GYPA 1LSJA 1GPMA 1NQ5A 4CMCA 3R75A 2IHNA 2DWCA 2ID8A 3HU2A 1VC2A 4KRYA 3TIGA 1LQ2A 2GYVA 4Q1VA 1GPH1 1QGDA 2D74A 3A7DA 3ZV6A 1A9TA 2FSSA 5TVKA 4CLRB 3TX6A 4UQLA 2TECE 2E4UA 4L7VA 4FGSA 1W47A 4HNSA 2BCEA 4XFKA 1WMSA 5ALRA 1UKYA 5ABPA 1GZ4A 1UAGA 3C3EA 3CLRC 1KJNA 1SXPA 2B9EA 1SK9A 1YR6A 2OZPA 3RWBA 3WJ1A 1YIDA 5KOJA 3LIIA 3E4DA 3JX9A 2C4WA 2P40A 4FS3A 4GXQA 4QD3A 1JEOA 8MHTA 2XWPA 4H1WA 4W5HA 1YULA 3C8UA 1USWA 1BWSA 1IZ7A 3GIWA 1QRUA 3T3OA 1QZTA 1SBTA 1RAIA 3EDQA 4BVLA 5LXTA 3RABA 1N3IA 4O08A 2VQEB 3NVMB 2ZCVA 2Q3BA 3OH8A 2CBGA 3R74A 5DEOA 3HKBA 4RIFA 4E3ZA 1TLFA 3FTNA 4O2AB 5T6MA 3MFQA 4ND1A 3UBMA 2I4OA 2XLCA 4OYLA 5DIZA 4IUYA 4A27A 4PNZA 4PV7A 1XZIA 4NBUA 2QE7A 1V2GA 2JAQA 1JDSA 4L57A 1N5IA 3H1AA 2VAPA 3H9CA 4B71A 2WJPA 3ITKA 4E7PA 3QFHA 5K8UA 1JAXA 1R37A 5CLIA 3B5IA 4IQ8A 5H9WA 2WMYA 1OROA 3WNBA 4JODA 3WMEA 2HR1A 1M83A 4JOBA 2FLWA 2NX2A 1NPYA 1ISSA 1O0SA 2CXPA 1GG9A 2YJZA 3V4RA 4JD5A 4ZU6X 1BFDA 2OHIA 3EISA 1REQB 5T8KC 3V7NA 2O2YA 2AG0A 3AHGA 5DFAA 4Q4CA 5IWCA 4LFBB 4PQGA 2JGFA 1X92A 2CMGA 2HNAA 2C2OA 5M7EA 1L4NA 3MT0A 4JQCA 3IAHA 4R4JA 1MLDA 4PINA 3CRRA 1HNZB 2B6NA 1CR4A 2PZBA 8GPBA 4LJ9A 2BI4A 2J30A 2VHEA 1RJDA 1G64A 1QIKA 2VXCA 3RSSA 3WWEA 6ABPA 1AN9A 1R6AA 3LECA 2GF9A 1C3OB 4ZC8A 3KELA 3UFBA 1TGVA 1Z0JA 3E3OA 3PYLA 2Y68A 1E7QA 3ICOA 1HDYA 1NVBA 3U3ZA 1LU9A 5GADl 4HQFA 3M0EA 3FHTA 2ORED 3FOZA 2B8EA 3LK7A 2VNJA 3Q8WA 5BQPA 1PFQA 3VR2D 4HR7A 3RK1A 4O29A 1XFAA 3LCCA 1HR0B 1GNQA 2NVBA 1URPA 4QE3A 1E6CA 3HMQA 1XYYA 2IXTA 4B75A 3U5TA 2FPKA 3NTOA 1CZOA 5JDIA 2BEUA 3GBVA 1OLUA 1WXWA 2VDOB 2DX7A 1GRQA 1J7KA 1YRYE 4JSTA 4MH0R 2G70A 1RXYA 4KYTA 4EY7A 4U7HA 5HRAA 3BTVA 3KUDA 3HNPA 1LBHA 1A5ZA 1AA9A 2FSIA 3FUVA 3NJ4A 4UULA 5A0TA 2KB0A 5D5HA 5AKXA 3AVVA 1CIJA 3C6BA 1W0KA 4DBLE 1OC2A 4HATA 4Z4HA 5KX5A 5CIYA 3BWYA 1GGFA 1K5PA 4D8WA 3QIVA 4D9HA 3KU1A 1EM8A 1ADGA 2CLKB 2F3RA 4G0YA 4KVAA 3A9SA 4F4DA 1AKMA 1I6MA 1Q5PA 3FVTA 3L40A 4H0FA 4UE3S 2D0OB 2P2YA 4NZ9A 2O5VA 2VAVA 3OPNA 5C51B 3RIEA 3WQQA 3GLIA 4DFDA 4FOSA 4W6QA 4EPWA 4AG3A 4LGYA 4V2UA 3T7CA 3VC7A 1AK9A 2ENWA 3AFGA 4BHTA 1Z7EA 1GY8A 1H3FA 1N0VC 3LV8A 1FS5A 1LUAA 4FC7A 2CL5A 3D02A 3ZI4A 1LJUA 2FW0A 1CY7A 4WW0A 4DZRA 4YT2A 1V5IA 2Q9CA 1XCJA 2QG9A 3IPAA 1SEVA 3QVMA 1E0SA 4DV4B 1GEGA 2X1VA 1H8ED 4BNDB 1TUEA 2FGJA 1V26A 2JGKA 2NVWA 3MTEA 5ULLA 4YTEA 5JEEA 3JU3A 1UWLA 4YUZA 3H17A 5A5DA 1CVLA 1K88A 4MV6A 2XAUA 4XTCS 5TEVA 4BP1A 5B4VA 4WWHA 3SSMA 3B5JA 1SXQA 3QVOA 2OV8A 4G0VA 4KUEA 1QE3A 1HETA 2VT6A 5I8WA 5ER9A 4CM1A 1H42A 1VL8A 3DL2A 4XGNA 2XNSA 5HA5A 3QMMA 5KNBA 3FFAA 3O5AA 5IT4A 3I76A 3Q98A 5HG0A 3T7KA 4AX8A 2AJCA 3IIIA 2JLRA 2FZ4A 2XTNA 4BO3A 4Q48A 5IWAB 1QCCA 1U7WA 2QVBA 4KQGA 2C00A 3W5SA 3U4GA 2E21A 3ANMA 1SUPA 3JQPA 4UDXX 1UZMA 4RA6B 3C48A 4D9CA 1Y6GA 4XDYA 3GCGA 1V9LA 1U4SA 2I66A 4QU8A 3G1WA 3CO5A 4R5MA 3QKSA 1H6DA 1WOYA 2AS0A 3B1ZA 1TJ4A 3MWDB 2B1JA 3ZNPA 1HOTA 2H1HA 1JU3A 1S7CA 4EEKA 5DRYA 2VNSA 4GPTA 4X44A 4CGYA 3DOOA 3F3YA 4LJRA 3TUIC 3S1SA 4Z4IA 4GL2A 1SOAA 3OP4A 3UW3A 1OKKA 3KR0A 3B48A 3L8GA 4DMCA 2FWMX 2ZIAA 2QNIA 2M1ZA 2CLOB 4PAGA 1SB8A 3EG9A 2FE1A 1FRZA 4MUNA 5F2OA 3Q8XB 4JJ4A 3ZGNA 2ZBEA 3KAJA 2B4AA 5CT5A 1HEUA 4ZVRA 1EWYA 3R5XA 4DUGA 2O3TA 4O4LA 1CUHA 1JXAA 1Z7BA 3FAKA 5TMBA 1G5PA 3I4CA 5YASA 2AG5A 4CM8A 3KWFA 1X7YA 2ZRJA 4JUIA 2Q3HA 4DCSA 2C8VA 2ISCA 3PHCA 5JROA 2PX6A 1RI2A 1I0LA 3GFBA 4EPRA 3WIDA 1CJUC 1ZC3A 2F9FA 4OMUA 1C1XA 2NUAB 4MGHA 5FTWA 3TQFA 2VJNA 2X6RA 3K2BA 8ATCA 1G19A 3BGVA 3LYUA 4TYYA 1QJ4A 4RKWA 4DIDA 1EG2A 3P32A 3PQ4A 3DQPA 3TSCA 2D0PB 2LR0A 4NU6A 1NLMA 3U56A 2ZRGA 4A8JC 2RGWA 1ZK4A 3NV7A 2Z6QA 2R96A 3WLFA 2HWYA 3OWHA 4O4IB 4YAOA 1C1XB 2DKNA 2KSQA 1WUTA 2LCIA 2WAOA 1UC8A 5I4CA 3N75A 3ZHZA 3W2FA 4DY4A 2FTKE 1RTTA 4H18A 2ZRCA 3L0OA 1RIIA 4QDZA 4ZFNA 1J70A 1SCAA 4UXJA 5T64A 3E0XA 4XYEA 3LPDA 3T3PB 5EIXA 4PPNA 2OFOA 1BVYF 2WPNA 3DEKA 1FU8A 2X22A 3MJVA 1CIVA 3JV7A 3RKUA 1L4MA 2LCQA 5BUZA 1H94A 4CG3A 5KDOA 3IERA 2BEWB 3PGXA 2XOEA 4KQ2A 5DTRA 5ECWA 1BJKA 1XZHA 2Q6OA 2J0UA 3CG0A 2W2VA 3EXIB 1RQXA 1FYDA 4FQ8A 1VJ0A 2Q5CA 4LECA 2EWWA 2OAGA 2E6UX 3K15A 2VDQB 4HGPA 3UJHA 4DDTA 5B12A 2WEKA 5EUQB 3CC8A 3NTXA 1WW3A 1W4BA 3T6KA 3MBKA 4OJMX 4G5RA 1BG6A 1I33A 3RYIB 1SFRA 2HFJA 1AM4D 1YKGA 3QKSB 4QG3A 2VXYA 1VXOA 2ARKA 2RGEA 3CPEA 4C04A 3CH5A 4RA6A 3WDMA 5A4IS 4DLYA 4RZ2A 1LDEA 2VDLB 4A6XA 3F6RA 4CG1A 1ZINA 1JR6A 1VYTA 4AZ3B 2CHQA 1S2MA 3RVRA 1AKUA 4XIYA 3TE7A 3ZDFA 1RACA 1ST3A 2Q2OA 4D0SA 1PS0A 2R1TA 4MARA 4D3DA 1QZ3A 3T12A 2HCFA 4JDPA 1SBQA 3G0GA 3PVZA 1SCKA 2WYIA 1PZGA 1XL0A 3NBUA 1PL8A 1EDDA 4NCIA 1I13A 3U48A 3W9SA 1DRWA 4U9IS 1YC5A 4LSGA 4P4SB 2IX9A 3GFPA 1VPWA 4LE1A 3V8NA 4IX1A 2JIZD 2XDWA 3RC8A 4ZYYA 3VZSA 3TNLA 3BE8A 1DOZA 4F9TA 3AM4A 1C9NA 1NVUQ 4FDMA 4XIIA 4AMVA 2CHEA 2BSXA 3EF3A 1XVLA 3KZCA 3UMCA 1ZCAA 2ID9A 3G8AA 3I5MA 4Q3DA 4OHZA 4D43A 1KTIA 1A8PA 1SGWA 2A4KA 1XZQA 4NK5A 2WG0A 3ADDA 5F77A 2E4XA 1ONBA 3IEVA 4NYJR 2XA1A 5CBPB 4ZV4A 3CNBA 1WDMA 3VYRB 4J1NA 1UXJA 1J25A 5IZCC 1T9GS 3GLIB 2QL6A 3QFFA 4YRJA 1GTJ1 5ESWA 3AC0A 3VR1A 1HDXA 4D7AA 3AGPA 3MTAA 4EKEA 3X3HA 3OIUA 3KB2A 4C7OA 1F7VA 4ALMA 3IDAA 3R3XA 3M7IA 3KEQA 1UKVY 1DL5A 3LLVA 4J0GA 3D0RA 1G0OA 5AHRA 2VRNA 2ZLBA 5E3JA 3T1VA 4BNMA 4BMYA 3DE1X 4FZ5A 1NR7A 1JI0A 1VBNA 1WA5A 5CGZA 4ADSG 2FFBA 4DBZA 1THMA 4RMGA 4IEIA 2OM6A 2SKCA 4AZ0B 4PYJA 3RROA 5CDHA 2C1ZA 1US8A 4EQ6B 5HYVA 2EBFX 5JV5A 1DMRA 5BVHB 5HX7A 2O2SA 1GG8A 2XDQB 3CM0A 2IS6A 4MXDA 1NQTA 3ZWOA 4G1UC 2IW1A 3NDBB 3T5AA 2A35A 3UT5A 3GJSA 3DMNA 4B7ZA 3CURA 5D1NA 4ZZ3A 5JG7A 5TXGA 1LWNA 2AX4A 1NYLA 2VQ3A 2YYSA 1CHNA 3FZNA 3HZZA 3BJRA 1FTQA 4GQAA 4Q6WA 5FFMA 4Q24A 2IA5A 2ZUFA 4M8KA 4ZARA 3QQ5A 2EBUA 2OWEA 2WIJA 5LD2B 1XKXA 3FKSD 1C3OA 4EFMA 5D3MA 1I0IA 4IFEA 1QGED 3V33A 5DGXA 3MWGA 5EUBA 3V8PA 3L07A 2FMIA 2JI8A 3W9UA 2CWWA 4KK3A 3OQOA 3OAAA 3RSGA 1IB6A 2GCNA 3QLVC 2PZJA 3T9AA 3TMKA 3U4IA 3SSNA 4GKAA 1E2IA 1BKYA 1K7SN 4YR7A 1QPZA 2BKUA 3MJRA 3Q0TA 5DBGA 5CJ2A 3HM9A 3NGLA 1NVTA 2QR3A 4MB6A 3U39A 4CTKA 4IDCA 1U5AA 5AK0A 3GX1A 1RWXA 3PXDA 3Q3IA 4ZKEA 2PSDA 4EGCB 3K3PA 1ZDMA 1Z2DA 4N5HX 4ZHQB 1QLWA 2CCJA 3BEDA 3UUGA 1RTKA 3RT7A 3MS2A 4FBLA 2VRWA 3SD7A 3FCCA 4BBAA 2IY7A 4BO0A 2WV9A 1O6BA 1YL6A 4X8LA 1AGYA 5DOZA 2CJWB 1P0CA 5DNEA 1U63A 1G2IA 3ET4A 4XKJA 4BUJA 1GLVA 4MPTA 2AXQA 1PLLA 2ZQZA 4OBXA 1YB6A 3AF1A 1CQJB 4KDCA 4F2GA 5BV1A 5CCEA 3SZGA 3G17A 1T9ZA 4J16C 4G4SP 1ZPDA 1GGHA 4NCHA 3FAZA 3NAQA 1KOLA 4IHJF 2H57A 2ZRPA 1M6VB 2VC2B 3DMHA 1RVV1 5A7GA 5L3SA 2I6TA 1VYUA 2JI4A 2O6LA 3OLWA 4FFBB 3NHYA 4DV7B 5JWOA 5L45A 1AGRA 5FR2A 2D1QA 5IYZF 4A0FA 1XDGA 2DPGA 2EF0A 2RDMA 4IQ0A 3ZJUA 2G36A 2XVXA 2MR5A 5EE0A 4XIFA 3BCUA 1L5GB 1E2EA 1CY0A 2XOKA 3H4VA 3PE4A 3DPUA 3K8YA 4PHFA 4RV4A 1MEJA 1UBRS 5D87A 4IMIB 1M67A 3AOGA 5EINA 4PANA 1CP3A 3EK2A 3WKEA 1MFZA 5T41A 4CLRA 2GD1O 1E9DA 2VDPB 5E0KB 3CZQA 4ILKA 3OURA 4EO7A 2QV7A 2R8XA 4FD3A 4DJTA 4B3GA 3ND7A 2AMVA 5C5CA 4D9KA 2B98A 2O8EB 1WHTA 1NJSA 1U3DA 3GA0A 1ULSA 5CYPA 4CIYA 1HL7A 2DHQA 4MZXA 4UUOA 4E30A 1LNQA 1U0GA 2HF7A 2ICAA 4JI2B 2Q6KA 2NW6A 2ZAGA 3PG5A 4PX2A 5AI8A 2QLMA 5T4EA 1Z34A 4OF4A 4BASA 1T35A 3MT9A 2YCLA 4TYMA 2R79A 4FMCB 3RC1A 1GTL1 4QPDA 3GNQA 4MUBA 2PJRA 1XZJA 3HBMA 3A2MA 1HT3A 4N8SA 1N57A 3S1AA 1PUIA 5C32A 1WP9A 3IEKA 4B4DA 3TTXA 2EQBA 3ZX4A 2DJIA 3NP9A 5JS1A 4MUKA 5JANA 4M0LA 3H3FA 4IVNA 3TLMA 1R0CA 3RFTA 5GWXA 3HL4A 3NBMA 1GVNB 1ZN2A 3HXMA 2DH6A 4BLVA 4UW9A 4JP1A 1MGOA 3ZUPA 1LSSA 2XADA 2M32A 4II3A 5DYIA 5SYMA 5CB4A 2JCXA 3PQDA 1YUNA 1DIBA 4WFQA 1JAZA 3VPXA 1QB8A 5I4KA 2PL1A 2MINB 1RIFA 2P0YA 3EDMA 1EZZA 5IULC 1S2GA 1XRQA 4E14A 1AQNA 3PEFA 4ZVLA 2R68A 2VCHA 1HMPA 1WW2A 4K9QA 5AXBA 2GAJA 1N34B 1T3HA 5KYKA 5E0OA 2ZJ8A 2JLAA 4DGSA 4WKCA 1L8QA 4DXDA 2HQBA 3MPOA 5K8VA 3IILA 3SX0A 1ZC4A 4JEUA 3EY9A 3PD1A 1Z4NA 3OTWA 4MVJM 3VUEA 3HCNA 4B33A 4CMHA 5LOVB 1AQLA 1KK2A 3JAWA 4RL4A 3FHCB 4B82A 1T6NA 4GPEA 1MC5A 1OZHA 1NZJA 4OB7A 5AVTA 4HH4A 1ZUIA 4LDPA 1H2ZA 4XSVA 3RVKA 1I6LA 1RWWA 2BFMA 4PXSA 1OR8A 3LFTA 1H4VB 2FPGB 2D59A 4ZCPA 4F71A 3QJGA 2ZB4A 4I55B 2W4IA 4IR7A 4P2GA 1CEEA 1IOVA 1XEFA 3UQZA 1P1KA 1EQUA 4MKRA 5J4HA 1GGMA 1GEEA 1ZRMA 4ZCIA 3TR0A 4DMHA 4F8YA 2CSUA 3NAZA 2FG5A 1WG8A 2YVUA 2PS9A 1Y1RA 1M8PA 1QRDA 3R5JA 1RM4A 3EA4A 3KYDA 1IXRC 4M1EA 4R3WA 5CFOA 5KWVA 1X14A 3D6HA 2VTBB 2TS1A 3E48A 3GRPA 3QPBA 3N6XA 2CD7A 1SHZA 5ES3A 2I29A 4AQ7A 2HI0A 4TKMA 1K9SA 1M6NA 1V16B 3CLTC 3VUFA 2HMUA 1NQUA 2IEYA 3T3NA 4DIBA 1FDTA 2YNMD 1Y6ZA 3FPSA 2IH2A 4KX5A 4Q05A 2A9KA 1XZNA 4XWAA 5AKJA 4R0VA 4ASUA 5CB8A 1RLUA 3S2FA 1NBAA 1QHYA 1T5BA 4UVIA 1ESCA 2ZAMA 5ALGA 3TAXA 4A3SA 1NOKA 1CYEA 3OIWA 2PJDA 3ACCA 4ZDWA 2GJAA 4M9CA 4Q12A 5J4YA 3HZOA 5HW0A 2OHOA 4HRYA 3DZBA 4TN5A 5L8VA 4O4HB 3V55A 1GL9B 3TQRA 1AUPA 3C1UA 4CNQA 4RK7A 1YK1A 1ZI6A 5CU7A 5BSMA 3OQIA 2AUMA 3CNLA 3ISJA 4R1PA 1MEEA 2FSUA 3GYGA 1E2FA 1M2VA 2G25A 3IP1A 2DPXA 4M8SA 1FIUA 1GADO 2BJWA 4R2IA 2B4YA 3NHAA 4ZXPA 4B8YA 2BEJA 2WSIA 4KOAA 4PONA 4C05A 5KYUB 4DB2A 1JQ5A 2P9YA 4US1R 3WAKA 2W8BA 4QUHA 4ZT6A 5JAQA 4QUKA 3CCCA 3WRXC 2O4UX 1QP8A 1ZIXA 3BIFA 4JBLA 3B9BA 2O0JA 1N7IA 4CCYA 1AKYA 4EFNA 1PQ4A 3GN1A 3EHEA 1MZVA 3WL8A 3DUWA 1IVNA 4ZVNA 4FMDF 5JJIA 2O14A 2VRCA 4M7OA 4WOKA 4XD2A 1VTKA 4BFCA 4QYTA 3AIKA 2QN9A 4AAYA 1NDUA 2Y1XA 2NADA 5B55A 3Q72A 1T91A 1XAGA 5PGMA 3EQZA 1EFPA 1LXCA 3TLKA 5LD2C 4WCFB 4BQRA 3HVHA 1K4KA 3I6IA 4WASA 3DZIA 4RQBA 2XQIA 5HPYB 2WVAA 2C03A 4WXPA 3VSAA 2QD5A 4JDUA 4F2DA 5AVUA 4AKIA 3E35A 2LXNA 1T8YA 4EZBA 2AF4C 3X1XA 3R7SA 4AS2A 2A5JA 1T8WA 1Y7TA 2BMFA 2VNIA 4ROTA 5JR3A 1KYTA 1UJ5A 2FR8C 1BEEA 3C85A 4RZ3A 1XP5A 3MD0A 2IUSA 4R2MA 3NU1A 2EJVA 1QHGA 5KYWA 1YZHA 4UUAA 6REQA 1LDMA 5LZ4A 2QRVA 1S3FA 3AR7A 1X70A 1MBZA 3C1OA 3PQFA 3VBCA 1GPYA 4P4TA 3AYZB 5L7TA 2JDID 1E2KA 1JTEA 1PYGA 2HA2A 3RC3A 1LA2A 3WGTA 3AIIA 3VDNB 2IQ5A 3Q2KA 1YTUA 4DPLA 1HY3A 4E2ZA 1QNLA 4M54A 3GMDA 3TR6A 4UD6A 4ZMSA 3KU4A 3RU3A 2C9OA 3NH6A 2DBVO 2PLWA 1O3YA 3MMXA 4D80A 2VH1A 3MRSA 4U4AA 1BYUA 2CW5A 2WF5A 3PC8A 4ZOLF 3INRA 4B3XA 2ZIGA 1NRWA 3FDXA 1UEXC 2XQGA 5KTMA 4HDSB 4B7UA 4RTOA 4HOYA 3SYMA 1NKSA 2Q3DA 1T6XA 3P8ZA 2WZQA 3IKMB 3NRBA 4CMIB 3HDJA 3LGXA 3M9LA 1YDEA 1ZM4A 4PRZA 4RDIA 5CHEA 3X2EA 3ML1A 1V7CA 2RAVA 1I10A 5CNMA 4KDRA 3EXHB 2EQAA 5E1DA 2NZ2A 4GP7A 1M2EA 1U1GA 3R7WA 1R6DA 2IKSA 4DANA 5BWMA 2ZQ5A 4I8DA 3D6FA 5JSKA 4C30A 1P1JA 1GGVA 2GZRA 5C5IA 2O1SA 3UBTA 1UFKA 3WGHA 3DLAA 1LDGA 1XTPA 1UC5B 3GU3A 4TXNA 4JLNA 2YIMA 4Z3OA 2AVNA 3QEKA 3S28A 5LLTA 1NXTA 3MLAA 4E6EA 3RQIA 2ORVA 4DCOA 2YOGA 2NUTA 3C4VA 3EUAA 2G9NA 3VNRA 2X5KO 1G21B 3W8NA