3DOJA

Structure of glyoxylate reductase 1 from arabidopsis (atglyr1)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
292
structure length
292
Chain Sequence
GSHMMEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEVIKKCKYTIAMLSDPCAALSVVFDKGGVLEQICEGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPVSGSKKPAEDGQLIILAAGDKALFEESIPAFDVLGKRSFYLGQVGNGAKMKLIVNMIMGSMMNAFSEGLVLADKSGLSSDTLLDILDLGAMTNPMFKGKGPSMNKSSYPPAFPLKHQQKDMRLALALGDENAVSMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrogenase-like protein
publication title Cytosolic NADPH-dependent Glyoxylate Reductase from Arabidopsis: Crystal Structure and Kinetic Characterization of Active Site Mutants
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 119
structure length 292
sequence length 292
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3dojA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dojA01
4IS3A 3ANMA 3U5TA 2DVMA 3AM3A 1S7CA 4G81A 3CTVA 4R51A 3TDKA 1I10A 1DC5A 1IHXA 3NV9A 1JKJA 1Z7BA 3MCVA 4BO5A 3H9QA 4CM3A 2VT3A 2ZB7A 2D0IA 4RORA 3ASUA 1EVIA 1LNQA 2Y1OA 3QV1A 5I7EA 1DIGA 4J3FA 1U5AA 4GKBA 4TRRA 3VZQA 4J0FA 2X22A 4Q9NA 4ZD6A 3PTZA 4J43A 4B7UA 4EDFA 3E1KA 3C7DB 2CF6A 4FOOA 5JAQA 1GYRA 2HSDA 2EP7A 5DCYA 3WWYA 4A7PA 3DZGA 4WKGA 1EE9A 2GN6A 1WDMA 5T5QA 4RQTA 3H6KA 3D64A 1FDWA 3ZHYA 1ZEMA 3E9NA 4FD3A 4QQRA 2WM3A 4FFOA 3OJOA 3GMSA 4CV0A 5L9AA 2VTDA 1RWBA 1NHGA 4OHUA 4ZN6A 2X23A 5DP2A 2Y1FA 4TROA 3OQBA 1K6XA 4ALMA 4IDEA 2HO5A 2V65A 4IJKA 3QVWA 4KUGA 1OMOA 3G3EA 1HXHA 2Z95A 4OXNA 1B0AA 4XRGA 3QQPA 3HDHA 4OJNA 2DPHA 1DFGA 3AI1A 4GBJA 4IPTA 2D3TA 4GSLA 4RO0A 3WGHA 4CMHA 1PL6A 2G82A 4IJWA 4NBUA 4XA8A 2YHUA 3V2UA 3ZNNA 3JV7A 4ALJA 4CV2A 4DXHA 2AE2A 5I7VA 3Q11A 1DPGA 4DUPA 1DC6A 1XDWA 1NTOA 2YDYA 3FR7A 1XG5A 4BNNA 4DYVA 5L53A 3PWSA 4QO7A 1T2AA 3EK2A 1JU9A 1O5IA 3C7CB 4DPKA 4WLNA 3WNVA 2GF2A 1VE9A 5EINA 4NBVA 3OA0A 1BXKA 2HK8A 1TEHA 3ITDA 1E3IA 3RFTA 2CMDA 3IIEA 4YAEA 1PZGA 2ZTVA 3VH1A 3K96A 1ENPA 1K0UA 4R69A 2PR2A 3DOCA 4LN1A 2BRUA 1E3WB 3QY9A 2IZ0A 3GVHA 3E48A 3L4BC 1E3WA 2O23A 4NDNE 2DTXA 2AG5A 4YTEA 3DAPA 4MKRA 2PZMA 3SVTA 3ZWWA 4I5EA 2SCUA 1I32A 4OXKA 5ILGA 5A3VA 2DT5A 3M1AA 5I9MA 4Z9XA 4HBGA 2C5EA 3RBVA 2HK7A 2GPTA 3PHGA 3DO5A 3LF1A 1Z45A 1L1FA 3KYCB 1OZAA 1WMAA 4LRSB 4UVDA 4A5OA 1VPDA 2DTEA 1LDMA 3KYCA 1QLHA 2FZWA 3PWZA 5JBIA 5LC1A 2PK3A 1ZBQA 4UEOA 3E9MA 2ZCUA 1IL0A 4K6FA 2G1UA 1UXGA 3AWDA 3BHJA 4M49A 1IB6A 3K5PA 1PTJA 4B3HA 3I23A 5C3MA 4YJHB 3Q0EA 1VC2A 5L4NA 4B7CA 2WE8A 3ICCA 3ZU4A 4BNYA 3I83A 1NHWA 4IQGA 2BMAA 4ZQHA 1YJQA 1D1TA 1E7MA 2GZ1A 3KRTA 2NU9A 4IDDA 4WGGA 1WW8A 2FR0A 4M89A 5BNFA 2AXQA 2EGGA 1JW9B 4MP3A 1R37A 3BTOA 3TFQA 5HTOA 4ZVVA 3RBXA 1GFSA 1UAYA 4TSKA 3GDOA 3VHRA 1PQUA 1P9LA 2IZ1A 1PWZA 1XQ1A 3UHAA 4B4UA 1SEVA 1I01A 4C7KA 1MC5A 3G1UA 3IAHA 2HU2A 1IE3A 4TMFA 2V6FA 1WMBA 1PEDA 3VTFA 2Q46A 2UAGA 2PZLA 3JQFA 3C1OA 2J5RA 3DB2A 1VLLA 1NWCA 3JD1A 1CIVA 1IYZA 2IEDA 1KEUA 1PGOA 2DUWA 2RHRA 3MJSA 1I3LA 3D5TA 1PR3A 1ZXBA 3VVBA 4HY3A 1PS9A 1PJSA 3ADOA 2X9GA 1P74A 1JWBB 4ZRMA 4FQ8A 4D44A 3NEPX 2O3UA 1Q7BA 2VOJA 1E0DA 3Q2IA 1A7AA 1C3VA 1W73A 5H81A 5L7TA 4D0RA 2W98A 3JQAD 1SBYA 3CUKA 3F4LA 3VC7A 1HKUA 2ZYDA 3GN1A 2O4UX 5TQVA 1X7DA 2O3JA 3H8VA 5EN4A 1M75A 1TB4A 4C4OA 3VDQA 1NPDA 2BHLA 3QE3A 4GMFA 1M76A 1YVEI 2WD7B 5CG2A 3OHSX 2WD7A 3M1LA 3B1KA 3H65A 3JQEA 1LQTA 2CFCA 1DJNA 4GX1A 2PKRA 2YV2A 1IULA 2IXAA 1U2DA 2J5QA 4NU6A 5CPBA 4IXTA 3RKRA 5G2OA 1XQ6A 3RUCA 4R1NA 4LSMA 1JVBA 1HT0A 1P3DA 1GAEO 1OOEA 1YJ8A 2BH9A 3BMCB 2RCYA 3DFUA 3W4KA 3NX4A 3WS7A 4CV1A 1I2ZA 2Z1NA 3BMCA 3EUWA 4BOYA 1UUFA 2GSDA 3V1TC 4LISA 4PG4A 3WJ7A 1PJBA 2FHSA 4JJFA 1Q1NA 3QWHA 5KKAA 3DQPA 2PY6A 1EBUA 4C7JA 1E3LA 5L7YA 4BKUA 5IDXA 4P22A 4AJOA 4BMNA 1ZJZA 3A06A 1ISIA 5ES3A 2BFOA 5CPFA 2AEMA 1H93A 4R5MA 3VKUA 1EVYA 2B5VA 3I3OA 4BNIA 1DC3A 1E1NA 4U0KA 4BVAA 2AA3A 3GGPA 1I33A 3PHIA 3IDSA 4GKVA 4DPMA 2NWQA 4FPXA 1O94A 4JNKA 4PLTA 3LSYA 1ULSA 3UOGA 3HN7A 3PDJA 1OAAA 4RDHA 2GZ2A 3CE6A 3JD4A 4QECA 1PGNA 3OEYA 2P5UA 4R9RA 3P7MA 4YVFA 2WJPA 5A1TA 3ONEA 2OFPA 4TVBA 1LBEA 2H5LA 4UULA 2A94A 4GGPA 1VJ0A 3BTUA 1HDCA 3LF2A 4CLOA 4RL6A 1IHYA 3VTZA 1LLCA 5IFLA 1HETA 1NQOA 1G0NA 4WCFC 3I4FA 3DHYA 5U1PA 5TLSA 1H6BA 3RASA 5A05A 2B69A 4OAQA 4B7XA 2OO5A 4PRKA 2ZTUA 1ISHA 1QSGA 3MJVA 4XJSA 1ADGA 4PLGA 2IODA 5ITWA 1Q2XA 1GZ3A 5JDIA 3W6UA 1EQ2A 2VRBA 3K31A 1EUZA 2Q45A 2EF1A 4IUYA 4N5LA 3WOHA 4IDBA 4GH5A 2BD0A 3KYBA 4G65A 5JLAA 2VWGA 1I2CA 4ND5A 1NAIA 3DZHA 2O3TA 3F6YA 3FTNA 1FDVA 4OXYA 2YFHA 3EC7A 1U9JA 1EQUA 5KTKA 4RLHA 1PGJA 1PS0A 1ONNA 5JCJD 4IBOA 3GFGA 3I52A 5TNXA 1KY5A 3DMTA 3C85A 4FJ0A 1ZXLA 1P31A 1XGKA 1XLTA 2JFFA 4M1QA 2VYVA 3BTSA 3DEYX 3VPFA 4RVFA 3S2GA 5IDQA 3GEGA 1PWXA 3PQDA 3OIDA 3WXBA 4ZA2A 2HDHA 1Y81A 2O2SA 2RBEA 3WGQA 5EQFA 2OZPA 4EEXA 5B4TA 2VRCD 1QP8A 1T4DA 4F6CA 3SC6A 5COAA 1V9LA 2D1YA 1HLDA 4PG8A 4UEKA 4QFDA 5JCXA 4NFYA 3OIGA 3GEDA 1UZMA 3FN4A 3OSUA 3FPCA 4TVOA 3RI3A 4CMEA 1KVTA 4RDIA 4RVDA 2ZIZA 3G49A 4OIMA 4HP8A 4IGEA 2JHGA 3O4RA 2Y1DA 4RF2A 4DRYA 5T8KA 4WLVA 4JBGA 1HWYA 4OKIA 2PGLA 3FBGA 3RU9A 1GCOA 1A9ZA 3CMMA 3INRA 2EGHA 2OORA 4E5PA 4N7RA 4LRTB 4Q3DA 2YY7A 1T2FA 4PRLA 1F8FA 1WNTA 1FDSA 3G0OA 2X0JA 1NR1A 4UEJA 1E3JA 1E5LA 3UH1A 4PVDA 3UGKA 5T6BA 1LLUA 2B35A 3BAZA 5LDHA 3E82A 4DTIA 4JIGA 5IAAA 1YL5A 3ETDA 1HTBA 4I08A 3JQ6A 4RV9A 1Z73A 4DIOA 4F6LA 4LSWA 5EMHA 3WQRA 2Y93A 4CLRB 4YACA 4CLRA 1X7GA 3T4EA 4BB5A 4BO1A 4PG5A 4RF4A 3LC2O 5JPIA 2HMVA 3EZYA 2VN8A 1KYQA 2NV6A 3GVCA 4WECA 2D4AA 4PLYA 3MZ0A 3V2GA 3X2FA 2CNBA 3I4CA 4DMMA 4GVXA 2J6IA 3WWZA 2W2LD 3H9GA 4YXFA 5TJ9A 4A26A 5CEFA 2PWZA 4H15A 3U09A 1RYEA 2GUGA 2I6TA 3WTBA 3WFIA 3ZV3A 4BNWA 4L73A 2OL4A 3FNEA 4OSOA 2Q1SA 4JBIA 4PLPA 3C3XA 5B4UA 1XYGA 3B70A 3KB6A 4JLWA 1X7HA 2IEBA 2GN8A 1X0XA 3DWFA 4B79A 4P38A 3U49A 3NAQA 3NT5A 2O50A 2X8LA 5G0VA 2I5PO 4L9RA 3AI2A 3GH3A 4R1SA 1V0JA 4RF5A 3RQSA 3BMOB 2NVWA 3FNFA 4OH1A 4FOSA 3S2IA 3BMOA 5BSEA 1GQ2A 2GASA 1X15A 4YJGB 4BGUA 4EW6A 3AY6A 1M2WA 4YJGA 5CG1A 1NFFA 1F06A 1H2BA 1N7GA 2DC1A 2WMDA 4ZQBA 5B4VA 3Q3CA 3HG7A 1TT5B 3GGOA 2I3AA 1U4OA 3PQFA 3DZKA 4MVJI 1TT5A 2EJWA 1KBZA 2DBQA 4DQUA 5JMPA 2CF5A 3KZVA 1H2HA 4XD2A 4MVJD 2NM0A 2VNSA 1PR9A 3F5QA 1LC0A 1A9YA 5JC1A 4CV3A 4CL8A 4CLDA 4BGVA 4Y6SA 5CAEA 1YQGA 3RU7A 3L9XA 2UYYA 5TRTA 5FFFA 2Y68A 1LXCA 3TZHA 1NASA 2A35A 3JYPA 1Q0QA 3X2EA 4J9VA 5A06A 3CSDA 1XSEA 8LDHA 1V35A 5DT9A 1NFRA 2FR8A 7ADHA 2R6JA 3HUDA 4IM7A 1O9BA 5I9LA 3MJ4A 3PJFA 1Z6ZA 2FWMX 1R4MB 8ADHA 1LX6A 4BO0A 4BL5A 3OETA 1Q7GA 2YW9A 1KVUA 3IJRA 4Q3NA 2E4AA 1PU2A 4XQCA 4WJZA 2FRDA 1UZLA 4BNKA 5CEJA 1LDGA 1TVEA 3IL2A 4K26A 1RM5A 2FP4A 4L4XA 2JFGA 2IE0A 3T7CA 3ZV4A 4UUOA 3WLFA 3V2HA 1U3WA 4M55A 4HNGA 4BMVA 2Z1MA 3JQCA 4CLHA 3TNLA 3WYBA 1BDBA 4O5OA 3OJLA 4GVLA 3T7EA 3EVTA 5C7IO 1NQAO 1JKIA 3C1TA 4HFNA 1I24A 4AJ2A 1MV8A 1T26A 2VZ8A 2FPIA 3DZJA 2Y0DA 4WEQA 2PGDA 1QV6A 2X1HA 1GDHA 1LEHA 2GDZA 1UJMA 1T25A 5JY6A 2J8ZA 2P9GA 3LK7A 3GHHA 3LLVA 4JCOA 5ADHA 1GV1A 3UICA 2B4RO 3WGIA 3OJ0A 3RCBA 1G0OA 1U8XX 4IJUA 2JJYA 4KWHA 5B12A 4YR9A 4D45A 3EZLA 4FSHA 1TA4A 1NPYA 1DLJA 1IZ0A 3UCEA 4WLFA 1S6YA 3IUSA 3LLSA 2D59A 5ER6A 4J0EA 4J91A 4RVGA 3D0OA 1DHTA 4IJVA 1RKXA 3VH4A 1DOHA 2PZKA 2X9NA 1FMCA 3QVOA 3PGXA 3CMCO 3CH6A 1D3AA 2VUSA 2Y0EA 4HFRA 4IXWA 1SNYA 1B8PA 3W4IA 4MVJG 2HRZA 1LLQA 3E03A 1T24A 4HADA 5DBFA 3PQEA 4F3YA 5ER9A 2DFDA 3HQ4O 4R3NA 1FF9A 3ON5A 1DIRA 1CYDA 5EERA 4YRBA 3KHUA 4BIIA 1HDZA 3WBFA 2F00A 1CEQA 1NWHA 2HCTA 1XEAA 3IUPA 5ICMA 5JNLA 3R3JA 4BNUA 1XCBA 3WIDA 1B15A 1TLTA 2PD4A 3K30A 2BF7A 1GUFA 3EW7A 3O26A 3IKTA 4UAGA 5HRUA 5AXBA 4BO8A 1NBOA 4B3IA 3ZWVA 1SB8A 5F21A 4E0BA 5I9NA 4UUNA 2OP0A 3HE3A 3M2TA 4AJJA 4LW8A 5K0ZA 4A27A 1CDOA 4XIJA 4CUKA 2JAHA 4BGIA 3U0BA 3O03A 4NBTA 2D5AA 1ADCA 3EDMA 1KVSA 1Y8RB 2HJRA 3GGGA 1OI7A 1TXGA 2POQX 2YV1A 1Y8RA 4J1SA 5GZ1A 3QVXA 3FWNA 4BO4A 3C8MA 1LSJA 2O7QA 3GN2A 4QT0A 3RFXA 5A5FA 5H83A 3TRIA 2C07A 4BO2A 3UW3A 4TKLA 4CPDA 1GEEA 1E7WA 3JQFC 1KEWA 1P77A 2IRWA 2E37A 4Z0PA 4NI5A 3NDRA 5JAMA 1LSSA 1ARZA 3IJPA 3FF4A 4IQ0A 3HN2A 4XRRA 5C7LO 1GD1O 5IG2A 3BHIA 2OP1A 4NK5A 1UAGA 2VYND 1NFQA 1B8VA 3AU8A 1UDCA 3ZU3A 1ZW1A 3PWKA 4W7IA 4XGKA 4B8ZA 2HRBA 2AHRA 4DIBA 5C37A 4D3FA 1HL3A 1P0FA 4KTVE 2P9CA 4CQLB 3IKVA 1NXQA 4MVJM 2DU8A 4JBHA 1PJTA 1T2DA 5DULA 3WSVA 4J2OA 1PQWA 5CDTA 2EW2A 4I8XA 4LCEA 3GDFA 4M54A 3PHLA 4H3VA 4Q3BA 3ZDFA 3PDUA 3H2SA 4XDZA 4FFMA 3FHLA 3Q1LA 1AHHA 1PGPA 2YYYA 1GADO 2VHYA 4I9HA 4IY1A 3KLPX 3G1TA 4IDAA 1E92A 3PJDA 5HWSA 1YKFA 4TRNA 4URFA 4AJ1A 3D1LA 1RM4A 4GQAA 1XIVA 4CMCA 3DZIA 2AQIA 1EBFA 2A92A 3S8MA 5JYDA 1R15A 1CF2O 1YBVA 1E6WA 4ND2A 2GLXA 3RAJA 4YBZA 1A71A 3QWIA 4O1MA 3GG9A 1BG6A 1EFLA 5TF4A 4UVHA 4BNMA 4CQMD 3U4CA 5HA5A 1J5PA 2LDBA 2EHDA 4YCAA 1PQPA 2AMFA 2C0CA 3IQDB 1V3TA 3ETEA 1QYCA 4Z0HO 3FCOA 2DBZA 1YOVB 3IP1A 5KJEA 3KYDB 4R1UA 4TZTA 1JDJA 1MX3A 1YOVA 1ZSVA 2H6EA 3AM5A 3KYDA 3PP8A 4RPKA 5JW6A 2RHCA 4MIEA 1PJLA 1ZO8A 2CSUA 3MTGA 3R1IA 2AQHA 1N5DA 3VVCA 3CPSA 3RUIA 5EJ2A 3ZU2A 2EV9A 4JROA 2Q3EA 2OMEA 5L4LA 3ANNA 2IXBA 3GRPA 4Z3KA 4NFSA 2CD9A 1XA0A 2E82A 1NVGA 4TRMA 4CM8B 4RPHA 4U5QA 5JMWA 1GTMA 3AY7A 3JQ9A 3KEOA 4YJHA 2VQ3A 1P0CA 4LK3A 4ND1A 3S2EA 2X7HA 1QKIA 5G0UA 5KVSA 1VSUA 1P1HA 3GVXA 1M67A 1IZ9A 3WMWA 3U4HA 3U4DA 2C82A 1U2GA 2EEZA 4MINA 1MLDA 2WYUA 2YQ5A 1X1EA 2Q50A 3RUFA 5JDIC 4NH4A 1CRWG 3KXDA 1SPXA 4YT8A 4EJMA 4BKRA 2A9FA 4W7HA 1XR3A 1I36A 3GOHA 2VUTA 3RUHA 4YQYA 5C7OO 2XXJA 3OEWA 4BO6A 2UVDA 3WLEA 3PRJA 1CWUA 3M2PA 5GMOA 1LTHR 3OICA 3RUAA 3FNGA 1LDYA 3W8FA 5K6AA 1JA9A 3DMTC 2JD1A 3JQAB 3JCZA 4EBFA 4F45A 1SCUA 2Y99A 2IYPA 3JQAA 5IXSA 5A04A 4OSPA 1MC4A 3DDNA 4NQZA 1WPQA 2HMTA 4R4JA 5L4SA 5JC8A 3CXRA 4BNHA 3ENKA 3GVPA 4HNHA 4ONEA 1HE2A 2C54A 2BLLA 3OP4A 1VL6A 3QWFA 3AUSA 4DBVO 1Z74A 5IZ4A 1SOWA 1GR0A 1G6KA 4BS9A 2NADA 4FDAA 4AJ4A 3LT4A 3EYWA 2JL1A 2V6GA 2W90A 5F1PA 3RFVA 2W8ZA 4QX6A 1U3UA 2OXIA 3ZW9A 4CMEC 2BFMA 3OJEA 3TZ6A 4OOEA 3I1JA 3NKLA 3OA2A 4K9DA 1LI4A 5TIIA 2I9PA 2FPPA 4S1VA 1PZFA 2QIOA 5T8KC 2PH5A 5GZ6A 5L45A 1XHLA 1PZEA 3A9WA 2FSSA 3WGOA 1E7SA 4NHEA 4YJFB 2I99A 4FC7A 3ZN2A 3WB9A 4YJFA 2ZTMA 4PCVA 3H3JA 1ZUD1 3KV3O 1HF3A 2P9EA 2VHXA 4U8GA 2A4KA 1FK8A 2O4CA 4FB5A 1DDOA 3DZBA 5CP8A 1YRLA 2H63A 4IZHA 3RJ5A 3WGGA 4KQWA 4A10A 2NNLD 4E5KA 3E8XA 5HS4A 4PLVA 1NQTA 4OQZA 3GDGA 1RYDA 1YQXA 3E9QA 3ZHZA 2BI7A 2TMDA 3KM0A 3W8EA 3DTYA 4FR5A 3GC6A 4I5DA 1OFGA 3OFSA 4Q3AA 3QA9A 3GF4A 3RD5A 4DWVA 1DC4A 3A14A 4E2YA 3V1UA 3G79A 1ZSYA 4YA6A 4HUJA 1R0SA 4L8VA 2ZATA 2HKIA 1HE3A 3LU1A 1ZEJA 4GI2A 2B4TO 4KUEA 2QG4A 4EUEA 2Q1UA 3JYLA 3SLGA 4MKZA 5A02A 2Y05A 4DL9A 5T67A 5BNTA 2FN7A 4GLOA 2Q2QA 2CDCA 1LLDA 1AN9A 4II3A 3OIFA 2RH4A 4IMPA 5T64A 4XYGA 1P1JA 5ENDA 3WSWA 1XWFA 3MJCA 3ZWMA 3QRWA 3E18A 1ZKMA 4JP3A 1HE5A 3NDJA 1E7QA 1AE1A 1GZ6A 4IIVA 4PLZA 3QWAA 1ZNQO 4MVJE 1UXHA 3PK0A 4B4WA 4WOJA 1VI2A 3PIDA 1PJ2A 2VWHA 4YAGA 5IN4A 4MPDA 2BI8A 2JD0A 3R0IA 1K6IA 4RZHA 4Y8VA 1PJ4A 3HB4X 5ITVA 1GYPA 2AQKA 3GVIA 2VZ9A 4Z0TA 2XPCA 2LDXA 2FSVA 4EUHA 2G76A 5F3RA 4BNFA 2DLDA 2VHWA 3F4BA 5T57A 4MOWA 1LC3A 2CUKA 3QP9A 2AG8A 1RM0A 3R3SA 3JQBA 4RJTA 3K8ZA 1GEGA 4DBZA 4EZBA 4ROSA 4CM9D 2W4QA 1DAOA 4TWRA 2NACA 1QRRA 1C1XB 3AUUA 9LDTA 3UVEA 5DZSA 4AJPA 1K2WA 1C1XA 1VKOA 4CUJA 2Q1WA 4B4OA 4E4YA 1R12A 4W6ZA 2VRCA 3VDRA 4A0SA 4CM4B 3QHAA 3UUWA 1NVTA 1YH3A 4UREA 3VAZA 4CM4A 1ONPA 4CMAA 5COBA 4KDEA 3NTQA 2ZCVA 4PGFA 4AG3A 3WFJA 4DLAA 4FCCA 4E13A 1W8DA 3GEMA 1R66A 4ZU3A 2XOXA 1BSVA 3L07A 1HDOA 4YEDA 2X0RA 2NVUB 2QW8A 1DXYA 1YBAA 1WDLA 3M6IA 1ZVMA 3PVZA 5A3JA 1CJCA 4E2XA 1GUZA 3W4JA 3WG9A 5ENVA 4IZIA 4X54A 5CDYA 1W6UA 2X86A 2B4QA 2I76A 1ZIDA 5FI5A 3BMNB 3BMNA 5CDUA 2P4HX 2GCGA 4BKPA 4XB1A 4Z6KA 4INAA 4Y6RA 4LVCA 5AOVA 1GUYA 1BXGB 3AFNA 4J4BA 1BXGA 4XB2A 1VM6A 5TX7A 3WMXA 1AUPA 4U0JA 4GX5A 4E12A 1U1IA 2P5YA 3I5MA 1KC3A 2YJZA 4OL9A 5CHEA 2ZYAA 3ROKA 4J7UA 5C5IA 2VYVD 3A4VA 2WYVA 1I0ZA 2PD3A 2X5JO 1NYTA 2J5KA 1BHSA 3PYMA 5TGDA 3I9MA 5U4QA 4EGFA 3L9WA 4IINA 4K6CA 4BNJA 4D7AA 1IOLA 2NSDA 2WD8A 3KUXA 4JQCA 3ZW8A 4BNTA 4OYRA 3ZWOA 3IS3A 2YV3A 2W2LA 3BTVA 1OC4A 1K6JA 1SB9A 4D41A 3F1KA 1IPEA 2BFPA 4XIYA 4J4HA 9LDBA 3JYNA 3ONDA 4JJIA 5BSFA 4I1IA 4P4NA 1EUDA 1ZK0A 1HYEA 5AQ1A 3LVFO 3L4SO 3I9JA 4GMGA 3RIHA 4DVJA 3RC1A 5B1YA 3FTPA 4OO3A 3LT2A 1I3MA 4XGIA 1FXSA 1E1KA 4JX8A 1ENOA 2JCXA 2PLAA 3QLJA 3GPDG 1O89A 4DC1A 1E77A 4B4VA 3RC2A 1V6AA 3TN7A 1YBMA 3VZPA 4A03A 5TS3A 1GQQA 2DBRA 3PLNA 3H7AA 3PIIA 4J49A 2I67A 4ALLA 4QO8A 4NBWA 5CDGA 4CLEA 3IP3A 1WP4A 3FPLA 2O3QA 1C0LA 3S2FA 1ZSNA 1B8UA 1R0KA 2VZ0A 3P5SA 3PFWO 1PJCA 1N7HA 4NZ9A 1WWKA 5F1OA 3OJFA 2P68A 1N1GA 4OKNA 4UUMA 1DB3A 4DREA 3AK4A 1GPJA 1SMKA 3DFZA 2YDXA 4J2HA 4RZIA 4E5YA 5A9TA 1UXJA 5F5NA 4MVJA 1HEUA 2PFGA 2O7SA 2WSBA 3Q6IA 4NU5A 4KOAA 3F3SA 4MP6A 3TPCA 4E33A 3VPSA 1F0YA 1BWSA 1F8GA 2PTGA 3ZWNA 1BVRA 3ZWCA 1N8KA 2Y67A 4YRDA 1PZHA 3T4XA 4CM6A 2B36A 3OF2A 1ZH8A 2XF8A 4ID9A 3CKYA 3TOXA 3F9IA 3KOUA 2JKVA 1AXEA 4MVJF 1MG5A 2CVOA 2NVBA 4FBGA 4IDGA 1I3NA 3GZNB 5CDSA 2DFVA 3TQHA 1J49A 1KVRA 3GZNA 1ENZA 5JO9A 2JFHA 1NNUA 4IIUA 4D3SA 1OBFO 4JK3A 1ML3A 1EK5A 3RKUA 5MGBA 4FS3A 1EDZA 3GRKA 3U3XA 1O8CA 4YT5A 3SEFA 5JDCA 3GNTA 2PA3A 5L51A 1JQBA 2HK9A 3INGA 1Y1PA 1ADFA 4GX0A 4CMKA 4YYZA 3DBLB 1R4MA 4GSKA 3AOEA 3GY0A 5DCUA 2H1SA 3DBLA 5DOVA 4DGSA 1UZNA 3PGJA 7MDHA 3FWZA 2WYWA 2NUAA 2EERA 3DTTA 2BKAA 3MOGA 3RJ9A 5THKA 4I5GA 1YDEA 3EGOA 4J90A 1N9GB 1H9AA 4OQYA 3KSDO 1N9GA 2P4QA 1DSSG 1QORA 1PX0A 2EG9A 3Q2KA 4JN6B 4YAKA 3P2OA 1ZK1A 3UAGA 2ZQZA 2X0NA 2J3IA 3PJGA 3JYQA 1CQIA 1X14A 2DKNA 3Q9NA 1ZMTA 4W9NA 2J3KA 3I9KA 5DOZA 4XYMA 4G5HA 4RPGA 3LZ6A 2TMGA 4TQGA 3PLRA 2B83A 3PHHA 3ZWAA 4XDYA 2Q4EA 3C24A 1Y5RA 2PNFA 4DYDA 1UP6A 1D8AA 3SC4A 4MJLA 3ITKA 4XWYA 1GL3A 3PEFA 1SZJG 1GU7A 4AJIA 2Q2VA 1M6WA 3TZCA 1Y9EA 4AJKA 4ITUA 1F17A 2CDAA 4WK6A 1E6UA 3AU9A 1J4AA 1B14A 1ZJYA 4H16A 2X4GA 4FJ1A 1P1IA 3BIOA 4NJMB 5DN9A 4NJMA 1MXFA 5J23A 1D1SA 5KCZA 3ZHBA 5IXYA 4AJLA 3GQVA 4WPGA 4MIOA 2CVZA 1IUKA 1GQYA 4YAIA 2V7PA 5ICSA 5EL0A 4RQUA 2OUIA 3JTMA 3FRJA 3GMDA 1DFIA 1YQDA 3IC5A 3WQQA 2GO1A 3D4OA 4YQZA 3D4PA 2R00A 4N54A 1VJ1A 1BW9B 1BRMA 1U7HA 2GD1O 1BW9A 4NMHA 1DHRA 2HQ1A 5BR7A 1KVQA 4HXYA 1ONOA 2PKQP 3COSA 3EAGA 3S1LA 1LU9A 2E48A 1LSOA 5A9RA 4QSMA 1NM5A 4Z9YA 3SLKA 4HWKA 4BO7A 2GRAA 3STHA 1X13A 1H6AA 2GR9A 1SOVA 3AJRA 3CINA 3WDSA 3WYCA 3E6AA 3B20A 3PPIA 3JQ9C 4D43A 1P44A 2ZB4A 1ORRA 1UP7A 3MWEB 4IDCA 3N7UA 4YDRA 4UVGA 1KOLA 2I66A 4PG6A 3W8DA 4JJGA 3UXYA 5HM8A 1A5ZA 3RC7A 5GZ3A 3TOZA 4BV8A 5AYVA 1L7EA 1LRKA 3L6DA 5JSFA 1U8FO 2Y1CA 4RCVA 3MEQA 4FW8A 1R4NB 4JGBA 2ILTA 1R4NA 4IDFA 3BYZA 3LC1O 2EJVA 4XYLA 2DQ4A 2QYSA 3HFGA 1ZK2A 2G5CA 3HB5X 5FYDA 3WGYA 1ZMOA 2O3SA 3CEAA 2IDZA 2E6UX 5I7FA 2C5AA 3R6DA 4ALKA 2ZYGA 5KJ6A 4R54A 4WASA 4B3JA 2B37A 1KIFA 3ZHXA 2JAPA 1HE4A 2EW8A 4BHTA 5K6AC 3JD2A 3GLQA 2EXXA 4E5NA 4ZRNA 4IGFA 1GYQA 1T1SA 1VJTA 3K2BA 3UF0A 1V3VA 4WLOA 1ID1A 3TSCA 3EVNA 3OM9A 3AM4A 1QYXA 1ZK3A 5JO0A 3WTCA 1AXGA 3VH3A 3UKOA 1VSVA 1FDTA 5COQA 3TZQA 2VHVA 4WNCA 1KEVA 4S3MA 2PV7A 1SAYA 2NQ8A 3FI9A 1EVJA 3W1VA 3TZKA 4BB6A 1E5QA 4CQLA 4Y98A 5I8ZA 3K6JA 5MDHA 3L77A 4Y67A 1E1MA 2GGSA 5JAIA 4FIZA 4EEZA 2F1KA 4PLFA 4BMSA 1KEPA 3HSKA 4D3DA 5KVVA 1TT7A 2C2XA 2QZ9A 3B1FA 4KTTE 1RJWA 1ZCJA 1XKQA 1HDXA 1NP3A 4ZGWA 4EITA 2BELA 4DLLA 5BT9A 4D0SA 4R16A 1KERA 3K92A 2WEKA 5I7SA 2XAAA 4GWGA 4ESOA 5IZCA 4IS2A 1YL6A 3H9UA 2NU8A 2X5OA 4CQMB 1P45A 2RH8A 4H7PA 3U9LA 3RROA 4RVSA 5GY7A 4CQMA 3G17A 4L4SA 5AVOA 4OM8A 1MG0A 4Q3EA 4XCVA 1C14A 3D3EA 4YT2A 4U7WA 4FC6A 4MDHA 4QFCA 1IPFA 2PZJA 2I65A 2RIRA 3SJUA 1P1RA 3PFFA 4FGSA 4Z3DA 4CMBA 4KMSA 3S55A 4PZCA 4KZPA 4BUCA 4L74A 2ZQYA 3ANLA 3H9EO 3DR3A 3WGTA 1LRJA 2ZJ1A 3FD8A 1JAXA 1YB4A 4XGNA 4R3WA 3IOYA 5IDWA 4CMJA 2V6MA 4XR9A 1ULUA 4LGVA 1Z7EA 3AUTA 5B37A 3PXXA 1F14A 4YWJA 4XKJA 2C20A 4PN3A 2G17A 6LDHA 3AFMA 1ZZEA 4W82A 1MA0A 3DONA 3H9JA 5TT0A 1O6ZA 3SX2A 4HFJA 3ZNPA 2DAPA 5LDGA 4FN4A 3C7AA 1W0CA 1Z82A 2ZK7A 1IY8A 2FR1A 3VPXA 3JQ8B 4HX5A 3JQ8A 4PLCA 3JD3A 3HDJA 4L76A 2HUNA 3GPIA 3ZU5A 3DXFA 3UFXA 1HDGO 1YGYA 3KSUA 4CM5A 4N5MA 1BTOA 4CM8A 2AW5A 4RPJA 3MTJA 3NRCA 1BGVA 2O48X 3TL3A 3OMLA 2HLPA 2X58A 1UXIA 2JD2A 3D7LA 3E5RA 4II2A 3TL2A 1GZ4A 1QR6A 1D7OA 1JKFA 3ZI0A 5I8WA 3ICPA 4O0LA 5A5EA 1P1FA 2NTVA 1E6EA 2GZ3A 3VH2A 1E3EA 1DRVA 1H5QA 3ULKA 2VTEA 4L4RA 2XXBA 3JQBC 5G4KB 1CQJA 2FMUA 3QVSA 1JWAB 5G4KA 3GNQA 4AJNA 2VOEA 2WE7A 1YDWA 1ISFA 4UVIA 3V5NA 3EMKA 5EPOA 3NGLA 3DHEA 3PJEA 1PGQA 1KY4A 4LMPA 3W6ZA 2CVQA 4M8SA 1A4UA 1C1DB 2Q4BA 4QTZA 1M66A 1C1DA 4YAJA 2C7VA 1MP0A 4AJHA 1I5RA 4ND3A 3B1JA 4FJ2A 1O95A 1NQ5A 1V3UA 4M86A 1XU9A 1J0XO 3O38A 2HMSA 5G4LA 3SXPA 4XJTA 2C7GA 2J3HA 4D42A 3SBOA 2IZZA 1DLIA 5THQA 3H4VA 1PSDA 4BO9A 5DF1A 1QYDA 3V1YA 4M87A 4RGBA 1T2CA 1H9BA 5A9SB 2I3GA 3WX0A 4ALNA 1QYVA 5DP1A 2JHFA 3N58A 5A9SA 3ZGYA 4A2CA 2UDPA 4D46A 1GV0A 1NVMB 1EFKA 2BGMA 5U9CA 1ZFNA 1NX6A 5JYEA 4BNVA 4XZ3A 4DMLA 1JTVA 1EDOA 2FOIA 3D4NA 3LDHA 1FDUA 4FFLA 1QYWA 4R1TA 4YRAA 6ADHA 1LSUA 3DZFA 2QZZA 3H3FA 4MKXA 2CY0A 2X9VA 4ILKA 3RC9A 1MFZA 3ZWXA 3IMFA 3LC7O 4B8WA 2UV8A 1P1KA 4J6FA 3BXXA 1MUUA 1KC1A 2J3JA 1HDYA 4CMIB 2OBYA 4XR4A 4CMIA 1DIAA 3UCXA 1L7DA 3GAFA 4CL3A 3GHYA 3BHMA 3HZZA 1UR5A 1Y8QB 2IYOA 4P4GA 2V6BA 3DOOA 2H9IA 2DPGA 1Y8QA 3O8QB 1C0PA 1NAHA 3ENNA 3O8QA 4RVHA 1N92A 2Q49A 3RSHA 3QJ5A 4YJDA 4E32A 4Q39A 2Y0CA 4BQRA 3AW9A 3I9NA 2PH3A 3ADPA 1SEPA 1J6UA 4XEHA 4WUVA 4IQ8A 1D4FA 3VPGA 3H2ZA 4BKQA 3KLMX 4HFMA 2C59A 2VWPA 1DEHA 1EUCA 1EMDA 2AEFA 1PIWA 4R9SA 4L0QA 5G0WA 2PGJA 3EHEA 2QYTA 2EKPA 4AL4A 1VL0A 1UDBA 2ZJ0A 3OQ6A 2ZKLA 1ADBA 3ST7A 1R0LA 3BMQB 3JYOA 1K5HA 3JSAA 5JS6A 1ZK4A 4Y6PA 4AJEA 5EQDA 3BMQA 5DBIA 3NT4A 3OQ1A 2QX7A 3FR8A 4E21A 1O0SA 1C0IA 1YB5A 2WTBA 3A28A 1EK6A 2QRJA 1U5CA 4NNJA 4E30A 3F47A 1R6DA 3L4BA 4MVJH 4FFRA 2ZB3A 2FY8A 1U3VA 4EJ0A 2VCYA 4E31A 3BZUA 1CERA 3OBBA 4J9UE 1F12A 3OECA 3HWRA 3RUEA 2AE1A 2YZ7A 2YHIB 4EJ6A 2JCVA 1UXKA 3KEQA 4CM9A 2YHIA 4NPCA 3QWBA 1YB1A 1YWGO 3JD0A 2NQTA 1DJQA 2GERA 4NR0A 4XQGA 1LJ8A 4W4TA 3HHPA 2BGLA 3ROPA 5JCJA 4EUFA 3SJ7A 3CTMA 2X0IA 4CLOB 1DO8A 5CEEA 5KNLA 1HZZA 5KOIA 4P4LA 5HS6A 4ZJUA 1LUAA 3NGXA 1VL8A 1LRLA 3TF5A 1HYGA 4R01A 5G0TA 5JFOA 1E7YA 3NJ8A 4J7CA 2GN4A 1ISMA 1FJHA 1MB4A 4KP7A 3UCFA 4CODB 4DIFA 3GZ4A 2HAEA 5L7WA 4NBRA 2FZEA 3GAZA 5JE8A 3AY3A 1PJQA 2GNAA 4E6PA 5A4DA 5IF3A 1AGNA 3LT1A 2QQ5A 4WCDA 1KETA 1OC2A 5F1KA 1YONA 2RAFA 1R16A 1LDEA 1HLPA 4J16A 3ONFA 2BGKA 1YS4A 1K3TA 3U62A 3P19A 3PI7A 4E2WA 1BXZA 3TWOA 5JDCC 2NVUA 5BSHA 4MO2A 1YO6A 1WLYA 4E5MA 4AICA 3ZV6A 2NTJA 4CM7A 4WEOA 3AOEC 4K28A 4GAEA 5JY1A 5L40A 3C1AA 2QRKA 3ROMA 1NPTO 4J7XA 4BNXA 1B7GO 5EESA 5F5LA 4GGOA 3HFSA 4K1LA 3GK3A 1DBVO 5ILOA 4QEDA 4QXMA 2EKLA 5DNAA 1BMDA 3DAFA 4E2ZA 3DBHB 4FGWA 1MGOA 3DBHA 3RBZA 4GL4A 3CZMA 4WNIA 1B3RA 3B6ZA 3INTA 3NYWA 4QUKA 2VNAA 2Y1GA 4W9NC 3CIFA 4ZICA 3NTOA 2PKQO 4WE3A 2VT2A 5L3ZA 4KWIA 1QLJA 2P91A 3WBBA 2C2YA 2AEJA 4BKOA 1YE3A 4XYBA 4O59O 2P2SA 3ZNQA 5G0SA 4JXKA 4CR6A 4XX0A 3K9QO 5HBRA 3JQ7B 4DQVA 1JLLA 3FSRA 4F46A 5K9ZA 3JQ7A 5KJCA 4BNZA 2CZCA 2EIHA 3L0DA 4N5NA 4NIMA 5IDYA 3TJRA 2CDBA 5IJZA 2HMWA 2OBNA 1WVGA 3AI3A 4BNLA 1PL7A 1ENYA 3QSGA 3HADA 3WR5A 1G1AA 4CM1A 2VWQA 3QVTA 2QHXA 3HJAA 1B26A 1MXHA 3JQDA 1U4SA 5JAZA 1WXDA 1JAYA 3H5NA 3NUGA 4GPD1 1GPDG 1Y6JA 1W4ZA 2PD6A 3ABIA 4DC0A 1MFPA 1HDRA 1BVUA 4A73A 1B2LA 4TZKA 2OHXA 4MIYA 3VKVA 5DCWA 1I2BA 1HSOA 3ROQA 1EE2A 2HJSA 3QW2A 1PS8A 2R00C 3NTRA 4J4TA 1QG6A 3GR6A 2Q1TA 2W2KB 1E3SA 1RPNA 3VZSA 1A4IA 2YQ4A 5IN5A 2W2KA 3WQSB 1VKNA 1DRWA 5BNIA 1PL8A 2Y1EA 2OGUA 2B0JA 5AXCA 3I9OA 3DOJA 4PLHA 3I6QA 4Q3CA 4BQPA 1LA2A 1B3BA 1EVZA 1H0KA 5TJHA 3ZZNA 4CR7A 5KJ1A 1WAMA 4ZHSA 1Y7TA 5FWNA 2EWMA 2DBVO 1KS9A 1X1TA 2D2IA 3ZWPA 4N18A 4CMGA 4YT4A 3DBRB 2B5WA 1H6CA 3LYLA 3DBRA 4MP8A 4D79A 1DRUA 3L6OO 4RLSA 3GUCA 1RM3A 2NU7A 4ZQGA 3ASVA 5A03A 1JN0A 3L6EA 1HYHA 1K89A 2VHZA 4LMRA 4NK4A 4WCFB 3WICA 4KQXA 3D3WB 1P33A 1A7KA 3HDQA 4JP2A 4NFHA 4U6QA 1QXSA 4WCFA 4UUPA 3DHNA 3A1NA 3D3WA 1EZ4A 3WJAA 1DAPA 5AXDA 2WDZA 3ZWBA 1SC6A 5H82A 2EKQA 1JVSA 3ZCXA 1DIBA 3GT0A 1C0KA 1T4BA 3I6IA 3NJ4A 4AFNA 1GCUA 4PIVA 2VUUA 4DLBA 1XU7A 3FNHA 4WLUA 3ETGA 2WWRA 3NT2A 4RF3A 1H6DA 1U7TA 1VRWA 4DA9A 4Y9DA 3ZNOA 4ALIA 5DDIP 2OOSA 4FFNA 4KDFA 1A27A 5FEUA 3ORFA 4I5FA 1UH5A 4CUZA 4Z9FA 3WNQA 4WOKA 4DQXA 1ISJA 4PLWA 1U28A 4PFJA 1AHIA 4WLEA 1DIHA 1SO8A 3ZWYA 1LDNA 1WDKA 2ZB8A 4BGEA 3N74A 2AQ8A 4R68A 4PZEA 2FPGA 3DAGA 5TC4A 1I8TA 3F46A 1A72A 4RPLA 4O6VA 1WZEA 4HKTA 4L75A 3ZH2A 3UN1A 5IZCC 3D5QA 1Z75A 3GG2A 5KVQA 4OGWA 2ET6A 2DM6A 3RWBA 2GN9A 2QRLA 2Y66A 3AUAA 3LT0A 5TSDA 1Y5MA 2O2YA 4XQ9A 4TRJA 2YUTA 4XYEA 3P2YA 3H5AA 1TI7A 4W99A 3MOIA 2UUPA 1I3KA 4J1TA 1HZJA 1HSZA 3U4IA 4OMUA 4CJXA 2BFAA 3PYXA 5BQFA 3K2EA 1ISGA 1LQUA 3GUYA 2YFQA 1UDAA 3K73O 2R2GA 4RVUA 1T2EA 3PZRA 1E7RA 1U3TA 2JCYA 2X6TA 4I9NA 1YXMA 2Z5LA 4ND4A 1HRDA 1CETA 3KBOA 5CFZA 3MJTA 4YPOA 3RUDA 1N1EA 4TKMA 4KUHA 1PJ3A 4O63O 1NR7A 1Y9AA 5DBGA 3HDYA 2E49A 1B16A 1YL7A 3AOGA 2G0TA 3PZBA 2X5KO 4R41A 4GX2A 5FF9A 3E5MA 3NDIA 2EP5A 3TFOA 1Q0HA 4ZQFA 1N2SA 5KIAA 3QIVA 5KKCA 4PVCA 4EI2A 1QMGA 1XELA 1Q0LA 3DL2A 3DC2A 3PYLA 5L95A 3O9ZA 1V8BA 5KVCA 4LCJA 1T1RA 3CZRA 1UP4A 3RVDA 3BA1A 3V8BA 5FI3A 5BSGA 1DFHA 4AVYA 3LQFA 3KVOA 5AXAA 2O3RA 3DMYA 1I30A 3GNSA 4E3ZA 2D5CA 3H5RA 4FFPA 2UUOA 4LVUA 3VZRA 1M6HA 3HNPA 1WZIA 5KJFA 4BV9A 2NLOA 2Q99A 3VOSA 3FBTA 1LDBA 3GFBA 3KSZO 1BDMA 3PHJA 1QV7A 4P8RA 1EEHA 4CR8A 1X0VA 3I9LA 4EYEA 3Q9UA 4MVJP 3WIEA 4G2NA 3DBVO 1GY8A 3MJEA 4PZDA 2Q2WA 3OH8A 2ZTLA 4YB8A 5JXWA 2GYYA 3JQGB 2NTNA 4I9UA 3KTDA 2HMUA 3JQGA 4PG7A 4CLXA 3MWDB 2D8AA 5TT1A 4ZQEA 4UVEA 4NG5A 5KWEA 2VYNA 4BNGA 4J1NA 1H94A 3KO8A 4OOFA 4NJOA 4R5HA 1Q7CA 4IMRA 1E1LA 4J1QA 5LCXA 4BO3A 4DPLA 5EIOA 4XQEA 3WYEA 3KETA 3WGZA 2DTDA 2NU6A 3VPHA 2C29D 3F1LA 2DUUA 4HV4A 3EY4A 4U6SA 3GA0A 4GLLA 4GWKA 3F5SA 3ZV5A
chains in the Genus database with same CATH superfamily
2P62A 2V7QD 3KZOA 3ANMA 4X97A 3U5TA 7GPBA 5AP9A 4YRIA 3N0RA 3KZKA 1U0FA 1JV2B 4J94A 1EHIA 4G81A 4MYUA 3BC1A 4RPCA 1IHXA 5ED0A 1D07A 1HURA 1R27A 2QTRA 3PVCA 1JKJA 3NVAA 1B41A 1U0GA 4GEGA 1TD9A 1E6KA 1N9ZA 3KXKA 2Y1OA 3LA8A 3QV1A 2FPOA 4G86A 3RQIA 1K98A 5TB5A 4N6NA 3U7QA 4DIDA 1XMJA 2B1QA 2YH2A 1NRJB 5JVDF 5K8VA 1OI2A 1OR8A 2R8EA 3L5OA 4ZD6A 4J43A 4B6GA 5LNK6 3E1KA 3C7DB 2HNKA 2CF6A 1RIFA 5DCYA 1FOEB 2HSDA 1NLFA 3WWYA 4UAVA 1N2ZA 1SXQA 1NQUA 3HU1A 1GPMA 4WKGA 2J3QA 2XQVA 3S2YA 3DTVA 2QW0X 4U2BA 5EJ9A 1F2UA 1XCJA 3S28A 1EK1A 4ZYTA 4JYAB 1WXGA 2NAFA 5TGTA 1M1YE 3K70B 3B6IA 1XKXA 3OC6A 4K81B 4LKOA 5J47A 4YP7A 4JX9A 4BEWA 3L4JA 1XEWY 1PHRA 4RJKA 1QYRA 3G2QA 3GMSA 3EXIA 3HKDA 4YR7A 4CV0A 2IHYA 3VJLA 2VTDA 3MNFA 4YYEA 3D7NA 4ED9A 4D9FA 1JBKA 4FHFA 5DP2A 5ELLA 4L4UA 2Y1FA 3OQBA 4BMYA 4K9NA 1RXIA 2HREA 3LCCA 2AFIB 4IH9A 2JASA 4IDEA 4QE3A 4EY5A 4EY4A 3QVWA 4W1PA 3NI2A 1OMOA 4Q6WA 3PCRB 3G3EA 1HXHA 2Z95A 2RGAA 2JH8A 1M54A 3P9PA 4PRYA 4XRGA 1J5XA 1POWA 1DFGA 3AI1A 3T9AA 2Q6VA 3OZWA 4RO0A 3OF5A 1U7XA 1L4BA 1V37A 1YU9A 2E21A 2O07A 1ORWA 5FO0A 4CMHA 5BV7A 4PGHA 3OQMA 1XHEA 5LM3A 3FDZB 1TYAE 4XA8A 4A36A 1BN7A 1UBHS 5FLEX 3QLEA 3AEKB 1E5DA 2IU0A 4ESVA 2G9QA 4J75A 4L8LA 4ZC1A 4CV2A 1XZ8A 3Q11A 4MJ7A 4CU2A 1DPGA 3AJEA 2HBQA 3U3JA 3FR7A 4NZYA 4BNNA 5L53A 1PR2A 2IBTA 2FFAA 2XXAA 1C3OB 1O5IA 2C8JA 4KH1A 1XPJA 2G36A 3TLGB 1E9AA 4DCTA 1XDSA 4WLNA 2P2YA 3V48A 3WNVA 2GF2A 2FLVA 2RKWA 5EINA 1M3SA 2JCSA 3OA0A 3OQNA 2HK8A 3ITDA 1WUYA 3ZDRA 2XSZD 4YAEA 2H17A 4Z4QA 1EZZA 2FOXA 1ENPA 4BPRA 1OHHD 3IEUA 2PR2A 4LRWA 4A0FA 2FRVA 3BE5A 2R8XA 2YWRA 1KHTA 2ZSDA 4HB2A 1FUUA 2GBLA 4TV9B 3G9XA 4BDSA 3QY9A 1CB7A 2IZ0A 8ABPA 3DKKA 3E48A 4NDNE 2PGIA 4OTZA 4AROA 4G36A 3VC3A 2HLNA 2WT8A 4DNFA 3DAPA 5IKEA 1VPLA 4P92A 4FOPA 4F2WA 3USES 2X9LA 2SCUA 4WK4B 2IEGA 1E1YA 1I32A 2P9ZA 3AFGA 3MINA 3Q3EA 4Z9XA 3A6PC 1Z2AA 5K8TA 4HBGA 4M9ZA 1Q1AA 2GLTA 1UFKA 3UC5A 2HK7A 2GPTA 1W5TA 1CSEE 1JYEA 1NUHA 3L1IA 3PHGA 5DLEA 2PL1A 1SCKA 1Z45A 2BCGY 3NEJA 4OAOA 4RKRA 3RTAA 3CWQA 1DG9A 1LDMA 1NRXA 2D4HA 2LXNA 3IBFA 4EA7A 5JBIA 4OLFA 1DKQA 2VSNA 4YNBA 2GZAA 3WOVA 3P4YA 2JIOA 1M5TA 1KK2A 2PK3A 1VCIA 1IL0A 1OXUA 4K6FA 3TYXA 2G1UA 1URPA 1X7ZB 1YJAA 1RJEA 2BFDB 3BHJA 3IEXA 1IB6A 3Q40A 5JECA 1FLAA 2FVXA 3I23A 4N9WA 2Q3MA 2PMBA 5C3MA 2NZ2A 4BNYA 1QFYA 1NHWA 3CV3A 3IQXA 2VP5A 4MQUA 4DSZA 3KX2A 1FMJA 1RE1A 2NU9A 3TGPA 1JEYB 2AXQA 4TQAA 2C4HA 3CW2A 4I4TB 5I7UA 3IAM1 1JW9B 1UWCA 5JS1A 4O2AA 1W88A 3TFQA 5D1NA 5HTOA 4GL2A 1BDJA 1O5OA 4G6ZA 4ZVVA 1UAYA 1BFKA 3CZCA 5FHQA 4DHWA 3GDOA 4ZOBA 2ZANA 3RAGA 1P9LA 2P8SA 2IZ1A 1PWZA 2P0AA 3O4GA 3UUEA 4ZYUA 4FYVA 3OEED 1MC5A 1CC1S 2AMLA 2ZETA 3G1UA 3UANA 3ZCTA 5IT9A 2QUKA 1Z3CA 1IE3A 3MJHA 1E6LA 3PRHA 3WIUA 1N2CA 2CWDA 2G77B 2X8JA 4XDGA 2CMGA 3OFKA 3C1OA 4AXXA 3HEAA 1NWCA 4O2AF 1CIVA 3UV6A 5DFAA 4OV6B 2JLXA 4IQFA 1KEUA 4F4FA 1V5WA 1T35A 3CUVA 3TD6A 4YRQA 3CW9A 1YTUA 3HJGA 3TAUA 3PFKA 4MKFA 3UB4A 4DUZB 1ZXBA 4D56A 4B6PA 4ZRMA 4C2BA 2C4KA 1TQ4A 3HPRA 4BE4A 1RI4A 4MUXA 1Q7BA 3Q5GA 3P2IA 3COYA 2QRHA 3FOAA 3SDSA 2W98A 4AZ3A 4C9BA 4TYWA 5DTEA 3VC7A 5KNBA 2GB4A 2VJAA 3PDIA 4EF6A 3AF4A 4EHLA 5ECYA 2O4UX 5TQVA 1X7DA 3LFHA 3SM3A 2REOA 2ZCJA 4MI9A 1VQ1A 3BICA 4DNXA 2HHJA 4AKIA 4UBOA 2KS6A 1GG5A 4GMFA 4GMXA 1M76A 1YVEI 2WD7B 3STTA 4QAJA 5CG2A 3OHSX 1Z4QA 2AI2A 3ZTYA 2OKCA 1RKBA 1ZIOA 4V24A 3H65A 2YMPA 1KO4A 1SKUA 1DJNA 2V54A 4BB0A 2J45A 4Z4CA 4Y6QA 5EJAA 5A4KA 2ZWPA 1IULA 2WWXA 4FDMA 1JQEA 5HCNA 1G7TA 2OD7A 3BG5A 5DHFA 1KXZA 2XJ9A 2DR2A 2O1EA 1KA9H 1W4CA 1MAAA 2XD4A 1S2MA 2A5YB 4HJRA 2JC3A 4MA4A 3OU7A 3RKRA 1YDMA 3MS2A 2PJRA 4D3XA 3HNOA 1LNSA 3N2KB 1CUYA 3V97A 1OOEA 2IHBA 3VNVA 2RCYA 3DFUA 1JH8A 3JAWA 1HFJA 3M8KA 4KEAA 3FTQA 3HU5A 3NM4A 1UUFA 4P84A 4D82A 4GZ6A 4MYTA 4J2TA 3LLMA 3DTNA 1PJBA 1U2EA 1K5PA 2BFNA 1SVWA 5DBEX 3C98A 1D2CA 4JJFA 2H7VA 4WY5A 1CE8A 1R6VA 2IY7A 3LUKA 1EBUA 3L7IA 1IHOA 1E3LA 4C7JA 5L7YA 4BKUA 1DOZA 5G40A 5IDXA 1YB2A 1L5OA 4R2KA 4X95A 4YO7A 1G64A 5ESXA 1BEEA 1ZJZA 2OSVA 3A06A 3O1HB 3O8NA 3QNUA 2XYGA 4Z7NB 1NGSA 2QPOA 2AEMA 2C2GA 2HY7A 1J9EA 3EH2A 1EVYA 3FLEA 3AF0A 4FD2A 1Q12A 2P9YA 4BNIA 4U0KA 3HHEA 3IDSA 4AXBA 2NWQA 2WFLA 3SSNA 3ED1A 4JQSA 3ORSA 4KR7A 2J46A 3UOGA 1EYZA 3KT8A 1I4EB 3C5VA 3CG0A 3VKFA 3HABA 4Z4EA 5CVTA 2FN8A 1OAAA 1RWVA 4IWNA 3CE6A 4QECA 1RMQA 2CHVA 1PGNA 4OY3A 5AKXA 2SNIE 1BS9A 1FXUA 2XW6A 4R9RA 4FYKA 4D3YA 3DVLA 2CE7A 2WJPA 5EMMA 3D9QX 3ELYA 1LBEA 3E9RA 3JU3A 1O97D 1XZAA 1KMHB 4FT2A 1VJ0A 4MPJA 3BTUA 4UBMA 4A8JB 5IU6A 3HRKA 1HDCA 1THGA 2TS1A 4CLOA 4AN4A 2D62A 5ITSA 1RBMA 4G9GA 4RL6A 1IHYA 3UC9A 4C4AA 1K63A 1Y4DE 3P4UA 2G70A 4EHNA 3DEZA 4WI1A 3T4UA 1RZ3A 5DGHA 4WK2B 1ULAA 5A05A 2QTZA 2A1TR 2B69A 4OAQA 5I9IA 1HORA 3Q98A 5FUQA 3RBAA 5BN5A 2C4WA 4QLBA 3LRPA 3TZLA 2IODA 2WG2A 2ACKA 1H1LB 1EQ2A 1ZOSA 1BE8A 4N5LA 1Y4UA 4E4TA 4R1PA 4HDQB 4NBSA 2EJBA 3KQKA 5JLAA 4B6RA 4FZ5A 2MYUA 2QTVB 2GH1A 4EUSA 3MQFA 2VRNA 4FYWA 2QN6A 1C1YA 3SDZA 1FDVA 3GW8A 3KTOA 4OXYA 4D02A 4CIYA 2X6RA 4RANA 1PG2A 1U1GA 1PGJA 3DD5A 4MK4A 4N8EA 3LVBA 1KI6A 4RLHA 1E89A 4XVUA 5ICGA 1NDUA 3BHNA 3GFGA 3I52A 5TNXA 3SMVA 5IXJA 4FJ0A 4CKBA 2Z8ZA 2A0YA 1SBZA 1YZGA 4CFYA 4CN8A 5HKAA 4NBLA 3NVDA 3SE0A 3CVYA 4ETNA 3T1HB 4QJIA 5BYJA 3RFFA 4Q1EA 2CDRA 3S2GA 4F4JA 3IPLA 3OURA 1EJ6A 1VTKA 1U0LA 3TIGA 1T9KA 2RBEA 4GBED 4R98A 2XUQA 3USZA 3WGQA 4EEXA 3AG6A 3SYRA 1N1DA 3A6DA 4IIEA 3OZCA 2PT9A 2OGTA 4X8HA 5KYGA 5COAA 1V9LA 5JCXA 1HLDA 4GBMA 4V0OA 4JXJA 4NFYA 3OIGA 1RZRA 4JLMA 1Z6GA 4CF4A 4EK9A 2TMYA 3NKVA 4LZNA 3FN4A 3IKMB 3U1VA 3U7JA 3JWHA 3SZMA 3M4YA 4BVKA 4TVOA 5EHQA 3RI3A 4CMEA 2AOVA 1DI0A 1SVIA 4A4DA 1WNFA 1GTG1 1YASA 2ZIZA 2IYAA 3G49A 3N8KA 3EZXA 3G8BA 4I1OA 4NZPA 4V0SA 4BBAA 1L8LA 4DRYA 1AUVA 2FZVA 3E3AA 4JBGA 4QUAA 4WLVA 1HWYA 4H1HA 4MZDA 1BOFA 1GPLA 1TZBA 4JP5A 2JLWA 4R8KA 1H3FA 2DMRA 4Z0NA 4ZZIA 1G5RA 3ZXSA 4Q3DA 4PRLA 1J06A 2EFDB 1O7JA 1BRTA 2X0JA 4KXVA 2QU7A 3UH1A 3ZIAD 3RRNA 3OZAA 1DS6A 4XFJA 4GP9A 2B35A 3AI7A 2LIVA 1CNFA 4JIGA 5FOSA 3T3EA 2OV6A 5A1JA 3ETDA 5BOVA 2YJGA 5IAAA 2Z0MA 4L8YA 2M98A 4M1OA 4RNCA 4RV9A 3N87A 4JUCA 4DG9A 1KPGA 1W2WB 1K7XB 4E70A 2NTYC 3L6CA 1XAJA 4LSWA 2R0QC 1EFPB 1QVWA 2IYFA 4BFWA 3AXTA 3ND8A 10MHA 4C6RA 1DJPA 4CLRB 2OT3B 3AQIA 4AZWA 4BRSA 1XJ0A 3MM4A 1MPXA 2J7KA 2PL9A 2QN9A 3PIRA 5JZVA 1Y42X 4XVCA 3PFIA 2CNKA 2D0PB 1BU5A 4GM0A 2VXBA 1RWNA 4P5EA 3DM5A 5T4HA 4UQPA 2M6KA 1Y33E 4I8IA 1KO7A 2M6RA 4H7FA 2JFWA 2K6GA 2PYZA 4PLYA 1THTA 3S6JA 3TW4A 3V2GA 1EDDA 2CNWD 4K9LA 1YFKA 2ZIWB 4GVXA 2J6IA 4PTLA 1WBJB 3H9GA 3P96A 4BAZA 4A26A 2Y92A 4QAQA 1FFWA 4QNRA 2AZTA 2GUGA 5EPEA 1WXIA 1WDTA 1DQSA 1DCMA 2Q1SA 4RIHA 4MZXA 2VKQA 1V5GA 5KTSA 1ZD5A 4N49A 1E9SA 3C3XA 5JIBA 4FNOA 2IEBA 2QD5A 5LMZA 4GRAA 1PP4A 3MMPA 4B79A 2I34A 3MPUA 3QUQA 3Q12A 2CYBA 5BUQA 5DXFA 1Z88A 2G5GX 3LHDA 2O50A 3QG5A 3KOYA 2UZ4A 2D2FA 1G8HA 2AL7A 3AP3A 4L9RA 1U3CA 3EFOB 4MRAA 3UAYA 5D5PA 3UT0A 4YRRA 3EGIA 1NVVQ 2WLSA 4KO1S 5DX1A 3CLUC 3DXYA 2P9TA 5EFOA 1M5UA 1PD1A 1CB0A 1FUYB 2ZAGA 5MFZA 4OH1A 5JCOC 3BK7A 3JAMA 2CJPA 4PYIA 5HKOA 1RCFA 2WTXA 1GQ2A 3IA7A 2GASA 4C0JA 4IIJB 3AGQA 1T1JA 3O1JC 4YJGA 4EFLA 4ZTZB 1NFFA 1B6RA 2VH5R 5FI0B 1F06A 2DC1A 3KG2A 4RKYA 1ESDA 4IOJA 4ZQBA 5ARBA 2E7ZA 4B48A 5B4VA 4JEHA 1TT5B 3COWA 4FMPA 4EG1A 3GRUA 3STVA 1JIIA 1TM5E 2EJWA 3IKJA 3I09A 4X7MA 1ST3A 3R7FA 1L4MA 4DQUA 1YB6A 3EUAA 3ESXA 4BWGA 2VRWA 2YIMA 3QXGA 1T4CA 4MVJD 2UZ3A 3SOZA 1G55A 1TCVA 1PV2A 3HGMA 2GJAA 4O4HA 1OFHA 1A9YA 2Z5GA 5JC1A 2XITA 4IHJA 5MN5A 2I2DA 1CS0B 2P67A 4Y6SA 1F7UA 4LHEA 3BGOS 4YH1A 5JD4A 3JYPA 3AJ8A 3JSXA 1E0KA 1S2OA 4J9VA 4BLRA 2CXSA 4HXGA 3B60A 1CJMA 2OV4A 1HTWA 3PGKA 1GXSB 4NABA 4E14A 4EHDA 2E2WA 4G0MA 3TMKA 3EBOA 1DMRA 2PL3A 2J33A 3NHFA 3HCCA 2ZRNA 4KQHA 4E5DA 5FLKA 1OB5A 5CLQA 4HQ0A 4YCCA 1HT1E 2PX5A 4M8NE 4O4HF 4PSCA 3B7PA 4F5ZA 3L02A 5LLDA 3U61B 1GAWA 2XBMA 2IS2A 4IHJF 3DF7A 1KP3A 4PGMA 3W9BA 5IAOA 4C14A 3E2MA 4HWGA 4QQKA 4LFAB 5JQWA 2XGGA 3O3CA 4GYKA 1VHJA 1I6LA 4X41A 2C5LA 3CX3A 4WJZA 5C46F 2HT1A 1UZLA 2R96A 3DCYA 3X43A 1W48A 4AYWA 1WU7A 1KJ9A 4BNKA 2CJXA 4HX9A 4L4XA 4YRNA 2JK0A 1SA0B 5EMLA 2BSQA 4CTKA 1CLEA 2IE0A 4HYEA 4UUOA 3OZBA 2BFBB 4KVGA 4F4HA 3UT6A 2GEVA 3T4PA 4BMVA 1ZD8A 3JQCA 3TNLA 3WYBA 1DAGA 2IP2A 2O2HA 2PRKA 3PPYA 4HDAA 4DARA 3EVTA 3OCXA 4YI3A 5F98A 1I24A 1JYFA 1GSAA 2QTGA 2WHPA 3HY3A 5IK2A 3DZJA 4RTQA 1NJGA 1RYMA 3HXOA 5HJ5A 1C7IA 1GDHA 2ZDGA 2FEPA 4IZOA 4JUIA 1DQZA 1U7PA 2J8ZA 2P9GA 2F4NA 1Z39A 2BC9A 3BGIA 3T1NA 3LLVA 3DO6A 1S3SA 2C0QA 2ZI4A 2ZRFA 3DEHA 4C29A 1OT3A 1F5NA 4M0EA 3SICE 1T6ZA 2HJHA 2VP6A 3OJ0A 3NMUF 4RQBA 3QLUA 3RVRA 1G0OA 4IJUA 1PN3A 4QXPA 5B12A 4YR9A 4D45A 1P9RA 1CT9A 1SUPA 2FEXA 1NPYA 4RFSB 3U7HB 5EXDA 3R8XA 5AVKA 3I2IA 2CBXA 4M3NA 3LGXA 3PNPA 1NW8A 4WLFA 4WY8A 1GZUA 2D59A 4J91A 4JA2A 1R10A 1KFBB 1NMEA 2C2ZA 3QFTA 4CKYA 1DHTA 4HZGA 4HATA 4PHTA 3IB3A 1MO5A 2C3YA 3VH4A 1S4QA 1D4ZA 2GBLC 3BFJA 4S04A 2PZKA 1F7VA 3QVOA 2ZRGA 2RI1A 3HP7A 2WHQA 4JL5A 4ZQIA 3WP1B 5CB4A 1NN5A 2XADA 4M46A 5AW6A 4UZSA 5BXQC 2P2DA 4MA5A 5CIQA 4R8MA 1N2IA 2NW6A 1SNYA 2GMWA 1AQJA 4RMGA 3P94A 2OYRA 2QVYX 2YZ2A 1T24A 2JGEA 1ONSA 2CLCX 1U9IA 3H2HA 4UUAA 5DLPA 5DBFA 2ZSFA 4UXHA 3W06A 4F3YA 2FMIA 4MS3A 1UWKA 4MR8A 4RTOA 3HQ4O 3R41A 4PCAA 3QU2A 4Y6LA 3I3SR 3T5DA 1LY1A 1RU3A 3GA5A 3H84A 3TH5A 1CYDA 1U8ZA 4HLQB 4DDUA 4YRBA 2EDCA 1GPWB 4BNZA 5I3CA 4MAMA 4DR2B 2EFEB 3NCHA 1Y3IA 1HDZA 3F6SA 1GG8A 2GN2A 4N6GA 4MHSA 4BIIA 2VPZA 2PBZA 4QQ8A 2ZU6A 2O2EA 5CB4F 1XEAA 3KQQA 3O0TA 1I9GA 2WQ7A 1CZRA 3R3JA 3HXMA 3RPEA 4QUBA 1XCBA 3UMYA 3TBFA 4NTZA 1TLTA 1GUFA 3NOQA 4OVKA 4ENRA 5LYJA 3EIOA 2ZAIA 3F3MA 3GJ6A 3VR2D 3IKTA 1PBNA 4BO8A 2ASVA 3LZCA 4B3IA 2P7HA 3ZWVA 4LJKA 3SBDA 1JQ5A 2ES4A 4NENA 3SCZA 2O57A 3CCCA 4X8OA 3X44A 1FJGB 4XIJA 1MRSA 3QHPA 4BGIA 4GC5A 3EE6A 3RREA 3U0BA 2PX3A 4FX5A 3ADDA 2DH6A 2V7BA 2G9NA 1NXTA 5JNRA 1WUKS 2CLMB 1R4ZA 2HJRA 3GGGA 4LRQA 5CX4A 1TXGA 3CUUA 2YV1A 1Y8RA 1Z8HA 1BX3A 2X2PA 3FWNA 5MFPA 3F97A 4ADSG 4QFBA 1CY1A 5LYJF 2JI6A 2O05A 2W8BB 4M9CA 4ZO8A 1FP1D 1XYVA 2HWXA 4HN9A 4XW2A 3MWFA 4TKLA 3UW3A 1QZTA 4ZO4A 2I6FA 3BBPA 4UBNA 1JB9A 3ESZA 1EDEA 3NDRA 3IJPA 3CT4A 3FF4A 4BP3A 1WCXA 1GNTA 2O20A 4DR3B 1P4AA 2I91A 4NK5A 1VYTA 4YGXB 4DDHA 3AU8A 1WEHA 4EJFA 3NFRA 3CVVA 3EG9A 5AFSA 2CLSA 4JBNA 3ROXA 5IMSA 5KYTA 4MGHA 2HHLA 3JZMA 5C37A 3L1VA 2N1MA 1G3MA 1Z37A 4ARAA 3RT7A 2EX1A 1L7NA 2P9CA 3DLIA 4KTVE 3TEMA 3X1YA 4UTPA 5TEWA 2BJVA 3QMPA 3RSSA 1PR4A 1YR9A 3LHKA 2IH5A 1KY3A 3B89A 4V0NA 3KVVA 5DULA 3EXAA 2XMSA 1SHUX 1PQWA 1NATA 5E6RB 2O8VA 2BV3A 1V7ZA 4M54A 1UKEA 4JENA 3ACCA 3PHLA 3RHZA 4IDOA 5LBUA 1FP4B 3RE1A 2YWEA 1V47A 4FFMA 3WHPA 1GQRA 4L51A 3DLBA 5HFJA 4ZMSA 2ECPA 2LE0A 5ALHA 2MMCA 1PGPA 3OF3A 1D2EA 3O1IC 1JEQA 2VHYA 4PWZA 4QOIA 1R2QA 4ESEA 3CSSA 4LF8B 4IY1A 4NJEA 4GOXA 1BX0A 1NXXA 4IDAA 5IVKA 3C45A 3NNSA 1BVHA 1GRVA 4ERNA 3LJKA 1CY4A 2I1QA 3ILVA 4DIKA 2QX4A 1DCFA 1K4KA 1V2HE 2ZRLA 4C76A 1JNXX 5ILQA 2A92A 4M0MA 1CXZA 1QOZA 2VJYA 1CUDA 1IU9A 1SQGA 4LWPA 3C5WP 3UW1A 1E6WA 4BASA 4ND2A 2GLXA 5CGQB 2ZRHA 5EUQB 1GLVA 2YIDA 4PIPA 4YQFA 1HFKA 4O1MA 5J63A 3SYMA 3K72B 5TF4A 1R4AA 1ZUHA 2DJIA 4NYJR 4C07A 2NMVA 3ZDCA 3FPAA 3TQTA 1M8GA 1XL0A 4BNMA 3SVLA 3U4CA 4GI7A 4AS3A 2C5SA 1J5PA 1JT9A 1N7IA 3WLTA 4ZVQA 1IONA 4CKXA 3B6EA 4CN9A 1K06A 5HYVA 1PQPA 4DUGD 2WMNB 1X7YB 3IQDB 3UV3A 4UOQA 5KJEA 2DBZA 1DU4A 5JWOA 3TSYA 2PXAA 4TZTA 2NZYA 1JDJA 3E7DA 1MX3A 3EF1A 1QO7A 5LBTA 4IV0A 2O2ZA 5KU7A 2RGWA 3DFFA 1KOJA 3KQOA 1ZO8A 2CSUA 2ST1A 1PT5A 3R1IA 2QAJA 1IEVA 2CLEB 4MV7A 1J1UA 1QIMA 2YN0A 2DKFA 3NNDA 3SZRA 4DT1A 3B1VA 2BDUA 3RK0A 3R5TA 4Q15A 4DLXA 4C88A 1NQXA 2EV9A 4MULA 4AIRA 5HP4A 1K8YB 4D3ZA 3GRPA 1HFEL 4XTRA 1TF7A 3DEKA 4NZNA 1TW3A 4J3JA 4RBNA 4CNQA 1CV2A 1CDZA 1Y3FE 2E82A 4IKPA 5B64A 1D0VA 3U44B 5ADVA 3Q8KA 1HNNA 2POCA 5SYNA 1RKVA 4CM8B 3ZE1B 1G3IA 4RPHA 3L6RA 5J40A 3KKPA 1HK7A 5CLGA 1VRCA 1PFYA 4ZVNA 2BFEA 1SBCA 1P6XA 1P0CA 1TMKA 2VQ3A 4LRXA 5HILA 1QKIA 3I6YA 3SEZA 4DMHA 4RTPA 1U8UA 1YVRA 1XEXA 4OD0A 5C0OE 3GVXA 4EM6A 5EOVA 4NYMQ 1KDVA 4DJJA 1FEZA 2Q3FA 1A9RA 4H17A 1XROA 2C82A 2W58A 3ETHA 3L4KA 1AQUA 1JDPA 2ZTSA 3OTHA 2F62A 3KT0A 4AMBA 4TN5A 2WSLA 4NH4A 4KGXA 3YASA 1SPXA 4E6EA 6REQA 3IV7A 4IUYA 1QHXA 3CNLA 1NJ8A 3GRCA 2OCKA 2QLLA 3H5LA 3GPBA 1VP9A 1PDOA 3PNBA 4I50F 1VJ5A 4JUFA 2CMHA 4L7QA 4DBLE 5SZKB 4E3WA 1JR4A 1PD0A 4RY8A 2UVDA 2COKA 2FG5A 1DWQA 1FP6A 1XI2A 5IVDA 2H51A 5IM5A 2B3TA 1CWUA 1MT3A 2OFXA 1WB4A 3N86A 4JELA 4WCVA 5CFRA 3GXBA 3FNGA 2PQ6A 3I64A 4FMBB 5JMOA 2IZ5A 4WKOA 5K6AA 3PFCA 2PUGA 5U4XA 4A0GA 4JT2A 3RC3A 4B4DA 3EPJA 3JCZA 3ZCRA 2FUCA 2V5UA 3D02A 1P2SA 4R7TA 4F45A 3WV4A 2JIZD 2VHQA 1JHAA 2XH8A 4GM1A 1UBLS 4NQZA 3HRHA 1TFRA 1GITA 3RM3A 4CU5A 2X76A 1F2DA 1SIBE 3CLTC 3JQPA 3KBBA 1ECPA 2EQBA 1EA5A 3LXUX 3CRQA 5HXAA 5JROA 4MR7B 1P0QA 3VSBA 1PFQA 1UFQA 3KLNA 4HNUA 1MPTA 1SOWA 4DXAA 4HDNB 2IYSA 2CLHB 2R8BA 1M2VB 4KPGA 1P8JA 2V6GA 5F1PA 3IQZA 1DBSA 2DFLA 2AJTA 3FKQA 3V9PA 4CMEC 2BFMA 3OJEA 2A9QA 4F5WA 1ZVVA 1FLVA 2PN1A 4Q9JA 4QDKA 5AW7A 2WJ6A 2VDRB 1LI4A 2I9PA 5GONA 3A3OA 1KYWA 4I4IA 2F43B 2QDXA 3HC7A 4EVSA 1CRLA 1C8LA 2G08A 5IYZB 5LQCA 4ZOLB 3I01M 2Q27A 3OOEA 2ZBRA 1TCAA 3GP5A 3U0VA 4J0GA 2IA5A 3B7GA 5FUWA 3WGOA 1E7SA 4YJFB 4NDZA 4X6UA 4ZAVA 5IVPA 5AR1A 3ZN2A 1W36C 1U3FA 4H7KA 3VO2A 1DAIA 3WL8A 3KV3O 2QRVB 5BWOA 4UU0A 4HQKA 4R8SA 1FK8A 3J80A 2IE8A 1F38A 5T7BA 4NWIA 1R0YA 1Y9DA 4NPAA 3DZBA 1GNPA 4QWMA 1GRCA 4IXDA 4A10A 2NNLD 4FEAA 4PYMA 4HTAA 4PLVA 5GONF 1PK7A 3Q4GA 4KGZA 4QYWA 2WWYA 2IBSA 3UWPA 1RYDA 3E9QA 1E9FA 2BI7A 2TMDA 2IHUA 3DTYA 4FR5A 1OIXA 3U60B 3KJZA 3OFSA 2QVZX 4ODIA 2PKEA 4QKQA 3QA9A 5M2QA 4FWIB 1VKHA 1TK2A 1EZ1A 1G20B 1JLKA 1DC4A 1YC5A 5CR9A 3RSFA 3X2SA 4DWVA 4DY6A 2R48A 3W5CA 2QKYA 4IVRA 1D09A 4KXQA 1WUIS 1A9TA 2ZUVA 1Q7RA 4PAWA 1AB6A 5K3AA 3QVLA 5BSWA 3GUHA 4IO1A 1TECE 4CXMA 2ZJYA 3ZVNA 4GI2A 2PEZA 4KUEA 2NVOA 2QG4A 1SKYE 4MPRA 4EUEA 1F8YA 5DBHX 1WL8A 3SLGA 1KYXA 1YFZA 3KCNA 2F8SA 1X39A 3HM2A 2C7BA 4BLPA 1K0FA 1HTTA 2BM8A 3O93A 4LOAA 4C4YA 3KHSA 1AURA 1F8XA 3O2JA 1B6SA 4M60A 3TEJA 3V1KA 1OH7A 3OOWA 1MIOB 5EZ5A 4II3A 3P2MA 4JUAA 5T64A 3TQSA 5EE0A 1TGYA 2YXDA 4INJA 5ENDA 3WL6A 1GZSA 1W5AA 1E2QA 1XWFA 1WIWA 2GXUA 1GTRA 3HI6A 1TIKA 1ZKMA 5IJXA 4JP3A 1G6Q1 1HE5A 3KJXA 2P40A 4HO1X 4RHXA 1E7QA 1AE1A 1ZPDA 3DSRA 1HH4A 4PHHA 3WL5A 1TAGA 5C32A 1JR3A 4PSUA 2OQRA 2BUCA 3KKOA 2E1PA 2C9DA 4ETMA 1DEXA 1RAGA 1X7WB 4XWTA 2A9PA 2XE8A 1VI2A 4LTDA 2IYEA 1QIEA 3K4PA 1YKGA 4NSNA 2RHOA 3OQVA 2CFIA 3DE6X 5IN4A 4A6PA 4R8VA 5ITVA 1MJNA 1U9CA 3HB4X 1RJDA 3HVIA 4XCXA 1VPWA 3E53A 1OFCX 1OBCA 1V7CA 2A7QA 2RB5A 2XPCA 3BDIA 2FSVA 2OQVA 4QU9A 4BAGA 2E4VA 4Z7OB 3QPVA 3I1IA 3QP9A 3F9CA 1GFIA 4AZSA 1GPBA 3LOQA 1QGUA 3P2JA 3RSQA 3R3SA 3THXA 4X91A 4FHGA 4DBZA 2BONA 3GJRA 4ROSA 2WZBA 3R2JA 5F2OA 5K5EA 2FWPA 1QRTA 1QRRA 1W44A 1IWOA 5DZSA 2C8VA 3SC3A 1J25A 4AJPA 4EB8A 3N2GA 1C1XA 1VKOA 3TLBA 4CUJA 2Q1WA 3AL0C 1JF8A 4E4YA 3GZTB 3NCTA 4YN3A 1G3UA 1E58A 2VRCA 4P3PA 3VDRA 4A0SA 3SHQA 1YOBA 1NVTA 3LQYA 1EM8A 2XRMA 3PPWA 3FPJA 2VL7A 1V95A 2NYRA 3CNQS 1IOZA 3EQ2A 2JGMA 1OXVA 5COBA 3WDMA 4OHCA 1JG6A 4K46A 4PGFA 4OH7A 4Q7QA 1CYEA 4TTIA 3HACA 2B5OA 3GEMA 5DASA 2BZGA 1BSVA 1CQWA 1FSFA 5E1MA 4YEDA 2X0RA 4JB8A 2WPDD 3UM9A 2OFWA 1OYVA 3CF0A 3ZGNA 3M6IA 2KPOA 3EAFA 1QHEA 1G21E 2PV0A 5A3JA 3R7DA 2H2IA 4E2XA 1GUZA 5I48A 1JG2A 1EXMA 4Z1MD 5C81A 4DR7B 3GRVA 1W6UA 2X86A 1Z5ZA 2RHGB 5FI5A 2VLBA 1KK1A 1CUWA 1K66A 2QN7A 2XA2A 4HDOB 4ZVUA 1NVVR 3OWOA 2P4HX 4MW1A 2VS1A 3FYSA 4QUGA 4Z6KA 2N47A 4BWYA 4ZVSA 4LVCA 1WF6A 5AOVA 1GUYA 3I5UA 1ZL0A 3OWXA 2CWWA 1AKEA 2PZEA 2YL2A 3OBIA 4FXPA 4PSKA 4Q21A 1XTKA 3AFNA 4O2BB 4GRDA 1BXGA 2R1TB 3NHLA 4QEKA 1VM6A 5SY6A 4GX5A 2IGBA 2QTHA 2P5YA 3ZDAA 4R9NA 1TCBA 4DKXA 3WL7A 1Z4PX 3TPFA 3GRFA 5KNDA 1QIJA 3VPCA 2ODNA 5C5IA 2RGCA 1UBEA 2FCAA 4IWXA 4L15A 1AUXA 5CCXA 1NYTA 1KKMA 3VNRA 3D4LA 5U4QA 3ACBA 3TMYA 1R0RE 3GJYA 4CF3A 5L3QB 2VR1A 3L9WA 5I5GA 4BNJA 5H3LA 2NSDA 1NXSA 1D1PA 2O2CA 3KUXA 3QLUC 3TSOA 2ZYIA 1E94E 3G59A 1Q1GA 2W2LA 2YRXA 2YV3A 1OC4A 3IS3A 3JS5A 5CRIA 1XNQB 4HG2A 2BFPA 2PBLA 1Z0AA 3BRCA 4HDRB 2WFMA 4NMMA 1Y1SA 3E0QA 3UXEA 3VSAA 3VYRB 5BSFA 9LDBA 3FG9A 3RVQA 1DQPA 4P4NA 2AD5A 2K4MA 3D0KA 2LP4Y 1C7QA 2BM1A 5LZ7A 3BWDD 2PM8A 4GMGA 1NW6A 5JBNA 3FTPA 3P71T 3QEOA 4OO3A 3LT2A 3AV3A 4FYHA 3QOWA 3A04A 2GTPA 3EF3A 4EVIA 1ZJWA 1Z5OA 1WPXA 2UZIR 1EB9A 3MBIA 4DV6B 2O8BA 1VP3A 2FE1A 2Q9AA 1KSFX 3UFBA 4KAFA 1P7YA 2H31A 3ML1A 4B4VA 1V6AA 2BMDA 5H59A 3TN7A 1U9IC 3AESB 1G2PA 1TUIA 2W0SA 3OQIA 4Q12A 5UKDA 2DBRA 2XZLA 3H7AA 1N2XA 3PIIA 1QMPA 1QGED 4RXTA 4COOA 4DA7A 3F73A 2DWUA 2R87A 4HGQA 4ALLA 3N2NA 2B2CA 2PZFA 2DECA 1JDSA 3JZAA 1V39A 4KPUB 2ZP1A 4LNUA 4PU0A 4F5EA 5CDGA 1P2UA 5I01A 2F67A 4G63A 5JI3E 4L5BA 3PFNA 5BYKA 4E1AA 1B8UA 1R0KA 2IW3A 4OATA 1LBHA 4G0ZA 2ZUFA 1N7HA 4ROTA 2FPRA 1WWKA 5AJVB 5GPBA 2IS1A 4Q7MB 4W9MC 3VR3A 3M6LA 1ODJA 1N1GA 2QUIA 3O4VA 4S1WA 5ALOA 4ZVTA 5A71A 1HM5A 3S29A 1P2GA 1U2RA 3WNQA 4DREA 1YTLA 4CEHB 3L8DA 3MS4A 2YDXA 4REOA 1UK9A 4AO7A 4E5YA 3E7PA 3OCYA 2ODTX 4Q4AA 1XCMA 3EWIA 5KO2A 3QYPA 1P0PA 4EB6B 2PFGA 2HQOA 2B61A 3PU6A 2WWGA 2JIQA 4NU5A 4Q1CA 2LIPA 4B45A 1GUAA 2ZWAA 4DIMA 3VPSA 1JJVA 1F0YA 2H1LA 4YLYA 4AQDA 3ZWNA 5GIPE 2ZAMA 2HEGA 5DE3A 3ZDQA 2W43A 2ZRAA 1GKIA 1SPBS 1Z2CA 2HO4A 2XMQA 3BF7A 3I12A 2PUWA 4RV5A 5CK5A 4YPFA 1XTTA 4QO8A 1GA4A 3O4JA 1KAQA 1SD1A 4LY0A 5ALRA 2QGFA 1KIMA 3TOXA 1YK1A 3BORA 2XV1A 3F9IA 2WF8A 4BX0A 1GDTA 4QYIA 3DMRA 2NVBA 4G1FA 4L2IB 4JT4A 1U1EA 1FA9A 2ZJ6A 3A25A 1MN6A 3GZNA 1X9HA 2B34A 3AL3A 4BV2A 3QY0A 1NNUA 1Z0UA 3FPHA 3UAOA 4TOIA 1Q3KA 2GZHA 3PNVA 2NQ2C 4QGBA 2VYQA 3RKUA 3WZ2A 5K8UA 4EL5A 3SZUA 1BH6A 1F2VA 4FS3A 3U3XA 4B3DA 3FOEC 2XTMA 4JKOA 4LG1A 4YT5A 5JDCA 3NHUA 2WILA 5L51A 1LF5A 2HK9A 2WD9A 3D3QA 3EEBA 3T7RA 3C3YA 3ZDXB 3UJNA 4M1TA 5G1OA 2OKGA 4FUTA 5FUVA 1ZHHA 4YYZA 1YVPA 4CKEB 1QH8A 1R4MA 2ZLBA 2R5NA 3K5IA 4QUEA 3UHPA 2IU3A 4HTFA 2H1SA 2QG6A 3DBLA 4UZFA 5DOVA 5LLSA 1J5EB 1UZNA 5BWNA 4JR1A 3MMNA 1DO0A 4MWCA 4RAQA 2Q6TA 1V7PC 2EERA 2XUGA 4KG7A 4RM3A 5DTIA 3DTTA 3MOGA 1FQKA 2BKAA 3IR5A 1G19A 1YDEA 3EGOA 4HNAB 1N9GB 1H9AA 3D2CA 4XCQA 2GCNA 3T7SA 5BR1A 1KDRA 4N0QA 2Z9BA 1U80A 2VTBB 4JN6B 4YAKA 3CZQA 4Y2HA 1FX1A 1YFLA 1SUBA 1ZWKA 4JC5A 5CUQA 5A0TA 4I6EA 3DOUA 1OH5A 3JYQA 1DGQA 1X14A 1KYIA 3VYVA 3TM5A 3RYIA 2I6QA 3NHRA 1XZBA 1ZMTA 3NGMA 4W9NA 4NYMR 3ZHUA 1H3EA 1CZOA 3CGWA 2ACEA 1RI1A 4K6HA 4RPGA 5JT1A 3DVRX 1F51E 2IDMA 2P5SA 3BXZA 1JQKA 1IXYA 4IFIA 3IPRA 3ZWAA 3LTEA 2Q4EA 4DW8A 2NZWA 1VKRA 4TQ9A 1Z5GA 4TS9A 3TBKA 1KZHA 3VDMA 1H8HD 3V33A 3SC4A 1XL1A 2WZDA 2AOUB 1GL3A 3PEFA 1SZJG 1EWRA 1E4EA 2H2FA 3Q15C 2Q2VA 3H6HA 2QE7D 1OPXA 5IJ0B 1S9HA 1RVDA 1NUUA 1Y9EA 1CVRA 2FPMA 4AJKA 5JAPA 3HVRA 1JWLA 4G4SP 1F17A 1F0PA 2BGNA 4KJXA 4KR0A 4OFZA 1XVUA 1GKLA 4RJIA 1E6UA 4HNRA 3R44A 4US0R 1B14A 3IP9A 1EUQA 2X4GA 2IU4A 1J8YF 2DWOA 4GQBA 1CJUC 4ES6A 3RVLA 4JOBA 3LWBA 4Q9KA 1DX9A 1TZJA 2VJDA 2B2NA 3IX7A 2XGSA 3HR8A 5EIFA 1VOTA 3R7WB 1IUKA 2WAMA 4ZCQA 2FQWA 1XPUA 5EL0A 3C6ZA 3JTMA 3L8GA 4EKEA 3C0KA 1G291 3EASA 2FDCA 1W0KD 3D4OA 5AD1A 1NXWA 2PU5A 3ZHOA 2ZROA 4QLAA 3D4PA 4C0QC 2R00A 4N54A 4RWEA 4C4ZA 3EYAA 1G41A 5E4JA 2ONJA 5ALPA 1Y63A 2XRYA 4PNHA 3QUAA 4LGMA 5DYYA 1UANA 5HIMA 2EJCA 3UOAB 5L3SA 1HMYA 1OX5A 2E4UA 2I4LA 5BR7A 1KVQA 3ZLJA 1JIUA 1F0NA 1UPFA 1Z26A