3DOJA

Structure of glyoxylate reductase 1 from arabidopsis (atglyr1)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
292
structure length
292
Chain Sequence
b'GSHMMEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEVIKKCKYTIAMLSDPCAALSVVFDKGGVLEQICEGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPVSGSKKPAEDGQLIILAAGDKALFEESIPAFDVLGKRSFYLGQVGNGAKMKLIVNMIMGSMMNAFSEGLVLADKSGLSSDTLLDILDLGAMTNPMFKGKGPSMNKSSYPPAFPLKHQQKDMRLALALGDENAVSMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrogenase-like protein
publication title Cytosolic NADPH-dependent Glyoxylate Reductase from Arabidopsis: Crystal Structure and Kinetic Characterization of Active Site Mutants
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 119
structure length 292
sequence length 292
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3dojA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dojA01
1H6CA 1QR6A 2PH3A 4XYEA 4Q3EA 5EINA 5KIAA 1JW9B 3FD8A 3OHSX 3WICA 2Q2QA 1HZZA 5CDYA 1EUDA 2VZ9A 3DTYA 1LJ8A 2I67A 3F47A 4HUJA 4IGEA 5IG2A 2Q45A 5I9LA 2PZJA 1YONA 1A4UA 2EWMA 5FWNA 4BNJA 5CDGA 3V2UA 3BHIA 2HRBA 1V6AA 7MDHA 2CUKA 2O4UX 3NTOA 4IUYA 3PQFA 5A9RA 2ZQZA 5L53A 3S55A 5C5IA 4GBJA 3FNEA 1SB8A 3GAZA 4XJTA 1IPFA 3QVSA 2P9CA 1W73A 4HNGA 2HK7A 2B83A 3LF2A 1W0CA 4DRYA 3K73O 5EERA 5U1PA 3X2FA 4DC0A 1B8PA 1N9GA 3PRJA 4JJFA 4WCFB 2EIHA 2Q1UA 3RUDA 3DB2A 2I3GA 1EVIA 1GCOA 4ALMA 3TF5A 3IDSA 4XRRA 4XYMA 4B7XA 1O89A 5HWSA 1YOVB 1ZIDA 2QRKA 1XELA 3FR7A 4DGSA 4N7RA 1U5CA 4C7JA 3GRPA 3RASA 2QQ5A 4BNXA 3C7AA 4PG8A 2QHXA 1R6DA 2IE0A 1DO8A 1CF2O 1NHWA 3SXPA 3H6KA 3F4BA 1A72A 3FPLA 1F14A 4ZQFA 2RHRA 5C7OO 4DPKA 1KEWA 3D4PA 2ZJ0A 4QEDA 3LLSA 4FGWA 3I52A 4R51A 4Y8VA 3WGOA 2I6TA 4ND5A 1DHRA 4YWJA 4D43A 4L0QA 1PSDA 3MWEB 2Z1MA 1U7HA 3OA0A 1OFGA 5COBA 2Q99A 3ONDA 2QW8A 2EEZA 4PZCA 1YS4A 4EEZA 2CY0A 2YUTA 2AE2A 1DRUA 1P0CA 1YDEA 5I7SA 2X23A 4GVLA 4DUPA 1NM5A 2CVZA 5JY1A 5KKCA 1ID1A 4G5HA 5LDHA 1YO6A 4YB8A 3DONA 3PHHA 4FQ8A 1PJSA 4XD2A 2X5JO 1H2HA 4OHUA 4CMIB 5JY6A 1HETA 2X9NA 3SX2A 4JX8A 2AQIA 3PHJA 1IZ0A 1D3AA 3HHPA 1X0VA 4HADA 5CDUA 2PH5A 3D7LA 3HQ4O 4F46A 1PWXA 2ZYGA 3HB5X 4IDDA 4DXHA 4B3HA 3LC1O 4LCJA 4N5NA 3K2EA 3O9ZA 2ZYDA 3GVIA 4CM4B 3JQAA 5COQA 3TWOA 2ILTA 4UVHA 4O59O 3RJ9A 3FSRA 4R1NA 4LGVA 3HFSA 3DMTC 3B6ZA 5L3ZA 3ZU2A 1SO8A 2JCXA 1QP8A 3EZYA 1PJQA 5KVQA 1BVUA 2OORA 1F8GA 1TI7A 5I7VA 2O7SA 3NJ8A 4E2XA 5G0VA 3DBLA 1Y8QA 3JQ7A 3HDHA 5AYVA 3AUSA 4Q3DA 2WM3A 3DZHA 3PEFA 2CFCA 4TMFA 5CG1A 4PG6A 1ISIA 2W4QA 1H6AA 1PR9A 2WE8A 4AJ4A 4A5OA 3B1FA 2W2KB 1JAXA 4OO3A 4J7XA 2BGLA 1A71A 1G6KA 1PJ2A 3ABIA 4E33A 3LLVA 5LC1A 5KJEA 4BNUA 1N9GB 3FTNA 1XQ1A 1U4OA 3TOZA 1SAYA 1VJ1A 2BFAA 1V8BA 3A14A 4R4JA 3VPGA 1IOLA 4IS3A 1YJQA 3DBRA 3R0IA 4BMVA 3OQ6A 2AMFA 5AXBA 1LDEA 2DT5A 4PIVA 1VKNA 5DCYA 3DOJA 4CM8A 3BIOA 3GOHA 2NQTA 4A0SA 4KQXA 4G2NA 3UAGA 4RZIA 1YQDA 3TZKA 2VZ8A 5BT9A 4BNZA 3EW7A 1SPXA 1ENZA 4Q3AA 4RZHA 2YFQA 3DQPA 3WX0A 4CLHA 2I9PA 1E7SA 4CM9A 3N58A 1XYGA 2NQ8A 2X9GA 1QV6A 2Z1NA 1GUFA 3UXYA 4RVDA 1ONPA 3W8DA 4B8WA 3C3XA 1R0SA 2EG9A 2WMDA 1M75A 3K2BA 2DQ4A 3AUTA 3WLFA 5EMHA 1I8TA 4BO7A 4NFYA 1F17A 4J2OA 2OUIA 2IODA 4TRMA 1VSVA 4FIZA 4GH5A 4AICA 1DAPA 1UDBA 1MGOA 3FBGA 2GZ3A 1AHHA 4NJMB 5DP1A 1R0LA 1I3KA 2BF7A 4PVDA 2HJSA 3JSAA 4XDZA 4IIUA 4DIOA 4U5QA 3HDYA 2JFGA 1F8FA 4FJ1A 2RIRA 1LBEA 1Y7TA 3F6YA 3PPIA 4DLLA 4FJ2A 1H6BA 2P91A 1T2FA 1ZZEA 1U5AA 5FEUA 4XYGA 4WLFA 3TN7A 1G0OA 4BHTA 3G1UA 4EUFA 1NQ5A 5JCXA 4AJ1A 3H65A 3KEOA 3UUWA 1YL7A 1ZMTA 5KCZA 1R4NB 4EYEA 3MJSA 3WB9A 4PVCA 4CMCA 4PLFA 3ZV6A 1EDOA 3U49A 4NNJA 3JQ9A 2W2LA 4KDEA 3VTZA 1B3BA 2HSDA 2OGUA 2J5RA 3GAFA 2J3HA 2FZWA 4GMGA 5CHEA 3AM3A 4YAJA 4MJLA 4ZQHA 1T2CA 4QO8A 3RKRA 1LLDA 3HJAA 4BNWA 5C37A 1B14A 1T4BA 4EITA 4YT4A 2VWPA 2DU8A 2EERA 5K9ZA 1LI4A 4OYRA 5G0UA 3ADPA 5GZ3A 3JD2A 4CQLB 3RUHA 5T67A 3K9QO 3DBLB 1Y8QB 3AWDA 2W90A 4NU6A 4UVEA 5AXCA 5L7TA 4YJHB 3DOCA 3DR3A 3OEYA 3PXXA 1YL6A 2DFDA 3EK2A 3D3EA 1E3WA 3QE3A 4I9HA 1BXGB 4Q3NA 5A5EA 4BO1A 5CDTA 3JQBC 1LUAA 5G4LA 2X0NA 4BGIA 5C3MA 3HDJA 2HCTA 1NVMB 1UZNA 2DM6A 4O0LA 3DC2A 4TRNA 5EJ2A 2X0RA 4BKUA 1WDLA 4HP8A 1CYDA 1WDKA 2A94A 2B35A 1O9BA 1SOVA 3LT0A 2IXBA 2E49A 1KS9A 1NPYA 2PKQP 1J0XO 3I9MA 2O3TA 4FFNA 4XZ3A 4M87A 2JJYA 2QZZA 4HNHA 2NU7A 2BFMA 3I9KA 4CM7A 2JCVA 3JYQA 4DQUA 3CMMA 2QZ9A 3VH2A 3SJ7A 2CF6A 4E4YA 1UXHA 2X4GA 2P5YA 3IQDB 4MKZA 3ZH2A 2D0IA 4PRKA 1UZMA 4ZRMA 1SC6A 2QRJA 1PJ4A 5TNXA 2ZB7A 1UUFA 2ZTLA 4B4UA 2DBVO 4B7CA 3ZWBA 4LSMA 4CQMA 3GC6A 3E9NA 1E1MA 4AJJA 3OFSA 2VT2A 4UUPA 4A2CA 4XGNA 4CLOA 4RJTA 3BAZA 3GLQA 3UH1A 1FDSA 2VOJA 4BNGA 4BOYA 3ZW8A 5I7FA 1QRRA 3GGOA 2C5EA 1AHIA 2A4KA 2GDZA 1HT0A 1JWBB 4RO0A 1LSSA 3WBBA 5TSDA 1TXGA 4A26A 3ZHBA 2OZPA 2OP1A 4DWVA 2Y1CA 5AQ1A 2Y0CA 1I2ZA 3VVCA 4FOOA 3AI3A 3ASVA 3IOYA 3OICA 1IE3A 4J16A 3Q1LA 1CWUA 2Q49A 1O0SA 4W7IA 1EZ4A 5KOIA 4IQGA 3UOGA 4LRTB 1U28A 3UVEA 4XIYA 2YDXA 1U3TA 5AXDA 4AJHA 1U3WA 9LDBA 1PJCA 1LQTA 1ULUA 2NSDA 3PI7A 5G0SA 4WKGA 3G0OA 3BMCB 4PG4A 2B0JA 2ZJ1A 3JQ9C 3ROPA 1VI2A 3K5PA 4J1SA 3EHEA 4BNTA 5JMPA 3WBFA 1N5DA 3O03A 3RC9A 3W4KA 1PL8A 4U0JA 1ULSA 2ZTUA 4NJOA 3AOEA 3DXFA 4M86A 5JFOA 4ZQEA 5KJ6A 3ETDA 2H6EA 2RCYA 1E1KA 1RM4A 4I9NA 4M89A 3BMOA 4R1UA 4XEHA 2HKIA 3DZIA 3ZW9A 1BRMA 4Z6KA 2YY7A 2Y0DA 3WGYA 4J6FA 1Z7BA 4J7UA 5L4SA 4D0SA 3L6DA 4EDFA 4CM1A 2WWRA 2Q1TA 2G1UA 3ULKA 1KVTA 4ZHSA 4L4SA 1K5HA 5BQFA 4MO2A 4GX1A 3W8FA 4YRBA 4DYVA 4U6SA 3KSZO 5IDXA 4YPOA 3O8QA 1G1AA 4MIYA 3MJCA 2C0CA 1ZEJA 4IJVA 3PJDA 2B5WA 5KVCA 1L7EA 4RORA 3PJEA 4YA6A 5FYDA 2I3AA 1B7GO 2CDBA 3I4CA 4E5YA 3F5QA 4W6ZA 3TNLA 1K2WA 2H1SA 5B4UA 2BMAA 1DC3A 2J5KA 4R5HA 1HE2A 4HXYA 2OFPA 4MINA 4ESOA 1QYDA 3STHA 2JD1A 4CR6A 2HMTA 2YHUA 5BSEA 3ZWYA 5KTKA 5IAAA 5A1TA 1SB9A 3C1OA 1DBVO 1IPEA 3VKVA 1O95A 2XXBA 4IDBA 4B4WA 3ZNQA 1LC0A 3C8MA 4CLOB 4YEDA 2CZCA 3PK0A 3ITDA 3H9GA 3JQFA 1YDWA 2Q50A 3BHMA 5CPFA 1DLIA 1E3LA 3OJ0A 1AXGA 4KZPA 2R00A 3BZUA 4RGBA 3V1TC 4K26A 2PGLA 8ADHA 2D3TA 5U4QA 3NEPX 1T25A 2Q2WA 1PIWA 3GMDA 2ZATA 4UVGA 2XF8A 1XSEA 3NKLA 1Z74A 2GCGA 3GZNA 1TA4A 3WYBA 3PTZA 3DBVO 3ETGA 2NTVA 1LEHA 5IF3A 3FI9A 3ZV5A 1EUCA 1OAAA 1K6XA 3TL2A 5JS6A 3U4CA 3QLJA 3ZHYA 1HRDA 1NR7A 4Z3KA 1T4DA 4MVJA 2PFGA 3WQSB 3JQ8A 1ADFA 1HXHA 1NAIA 2WE7A 1X1TA 3QWHA 1ZSYA 1IL0A 1XCBA 3OF2A 1GAEO 4J90A 2AG8A 3K30A 1GL3A 3W1VA 4CLRA 1P0FA 4FN4A 4J3FA 3AM5A 4RQTA 3EYWA 5DP2A 2G76A 1RM3A 3FCOA 3RUFA 2VNAA 1EFLA 1WNTA 3H3JA 4Y9DA 3WWZA 1V35A 1WMAA 5L7YA 4OQYA 2HAEA 3RU9A 3WSVA 3C24A 3ANNA 3HB4X 5T8KA 3GUCA 3RUEA 3AU8A 2WJPA 5IZCA 3OSUA 1NFRA 3JD4A 4R9RA 3AOEC 1UXIA 3OM9A 3WGZA 4E5MA 4INAA 5TC4A 3U0BA 1MLDA 1C1DA 2FR0A 3M1AA 4Y6RA 2G17A 3PZBA 4LCEA 4NBUA 1ZJYA 3KSDO 4PLCA 3UICA 4IMRA 2VWQA 1QXSA 4KWHA 3VZPA 3CZMA 2A92A 3O8QB 5B4VA 3Q0EA 1DOHA 1U1IA 1UDCA 4G65A 1O6ZA 4XJSA 3V8BA 2JCYA 2RAFA 3GG2A 4ALNA 5TGDA 4IDEA 2B4RO 3ANMA 2PZLA 1B16A 4C4OA 2O2SA 2VTDA 3L77A 2IYOA 8LDHA 4RVFA 3QVOA 3VC7A 1QLHA 3I83A 1GV1A 1XU9A 1MC4A 3MZ0A 3JQGB 4I5GA 3E03A 3MJEA 4CLDA 1I24A 4OOFA 3RAJA 1L7DA 3GEMA 4BO6A 3GMSA 3M2TA 4ALIA 1UXGA 4B4VA 1FJHA 4GX2A 2NACA 4J9UE 1LDBA 1EK6A 2VYVD 3ETEA 4OXYA 3WOHA 3QSGA 1HKUA 4IXTA 9LDTA 1NR1A 1R37A 2GRAA 3QVTA 4YT8A 2X0IA 2DUWA 3ICCA 4NFHA 4RVGA 2PY6A 2BRUA 1QV7A 2QX7A 3E9QA 3F3SA 3RQSA 2XOXA 1KEVA 4DVJA 3JYPA 1M76A 3MEQA 5CFZA 4CMKA 3OETA 1C3VA 3NGLA 1P1KA 1MXHA 4II2A 3LT4A 3ENNA 4IZIA 3IMFA 4LW8A 3T7EA 4ZJUA 4JXKA 3EGOA 1PGOA 1EUZA 1E6EA 3UKOA 2D4AA 1LDYA 4IDAA 4CR7A 4YJFA 2ZB3A 4HFNA 3VHRA 4CM5A 1QKIA 1OC2A 3COSA 4J4BA 1S7CA 5IXSA 4R69A 4PCVA 3I9NA 1GQ2A 2O2YA 2OP0A 4WLOA 3WQRA 4F3YA 4R54A 5G2OA 3SEFA 1TB4A 1M67A 3RUCA 3VPFA 2JHGA 1UDAA 3F4LA 3I6IA 5IDYA 5IDQA 1X0XA 3D3WA 2H63A 4EUEA 3ON5A 1KVSA 3KO8A 2R6JA 4EJ6A 5A5FA 4D41A 3WYCA 1YKFA 1GADO 1GCUA 5DBGA 4CLRB 1LXCA 4E2YA 1YB4A 2Q46A 4PLVA 2WYVA 2GZ1A 4PLPA 4J4HA 1QSGA 1R66A 4IXWA 1E5QA 3ZU5A 3NT5A 3ZWMA 3A9WA 4TZKA 4BNKA 3HADA 3VPHA 1MUUA 3H2SA 2EKPA 4NU5A 1ZCJA 3D64A 4BKOA 3RROA 3CH6A 1Z73A 3B1KA 3DO5A 1P1JA 4R01A 3E6AA 3WG9A 1N1GA 3U9LA 3DWFA 1WZEA 1VRWA 1C1DB 5KWEA 4MOWA 1CRWG 2EV9A 2NVBA 2NTNA 3GVXA 1RWBA 4A10A 2E6UX 4IS2A 4YR9A 4OQZA 2J3JA 3HG7A 3AY6A 1LNQA 3RD5A 2W8ZA 3QJ5A 1PTJA 3U3XA 1OMOA 4L4XA 1OBFO 2WEKA 1PGPA 3FNFA 5L95A 1HYGA 5FF9A 4CPDA 2Y1OA 4CMJA 1A9ZA 3KHUA 5HS6A 1BDMA 3E1KA 2FWMX 4FS3A 2Y67A 4GL4A 4LMRA 3NUGA 2YW9A 3KVOA 1DRVA 1KC3A 4BMNA 2OOSA 4AJPA 2JAHA 5BR7A 3OJFA 3HN7A 5JAQA 3ZNOA 4J9VA 4R3WA 4PLYA 2ZIZA 4D7AA 4YAKA 1Z45A 2C82A 1B3RA 4YACA 4CV0A 5JXWA 4TROA 3RCBA 3CPSA 3JD1A 5JBIA 3FR8A 5A02A 4PLWA 1PX0A 3DFUA 1E92A 1VE9A 4A7PA 3JD3A 1GD1O 4UUOA 5DULA 1KVRA 1KC1A 3KM0A 4WPGA 1HDRA 3GN2A 4OIMA 3ZV4A 2GR9A 1Q7GA 2C7VA 3I9OA 1KETA 4IBOA 1IY8A 1JKJA 2OMEA 4BIIA 4LISA 4Z3DA 4TRJA 4EEXA 2CD9A 2FPGA 4HFMA 2XPCA 3ZWOA 1YVEI 3G49A 1U7TA 4HWKA 1UAGA 1V0JA 3RIHA 4URFA 4N5LA 4CMGA 3RUIA 2Q2VA 4ALLA 1ONNA 3D5QA 2V6BA 5JYEA 4OMUA 3RBVA 4JBHA 5EQFA 3F1LA 3F46A 1MG5A 3PYMA 5CDSA 1O8CA 2FPIA 5ILOA 5T6BA 4KTVE 1BG6A 3GHHA 3OH8A 1PL6A 4I5EA 1HEUA 4GKBA 3F1KA 3WTBA 2VRCA 5HS4A 5EL0A 4XQ9A 4MVJG 4ZQGA 2EP7A 2BI8A 4NMHA 1YQXA 4D42A 4RPHA 1WVGA 1T2AA 1DIGA 2DTEA 1T24A 4E13A 2HRZA 1C1XA 3CINA 3DBHB 3BTVA 2B36A 3PQDA 1VJTA 2ZB4A 4RVUA 3DTTA 5G0WA 5G4KA 4BNHA 4XB2A 1FF9A 4O63O 5JYDA 1P31A 3IUSA 2D8AA 4E32A 3OIDA 1K89A 2C07A 4K9DA 1JKIA 2WD8A 4UVIA 2IRWA 3W8EA 2PD3A 3T4EA 3EZLA 2C7GA 3G79A 4ITUA 4KQWA 4ONEA 4YVFA 5L4NA 5JCJD 3GY0A 4AG3A 1RM5A 5JAMA 1VM6A 3IC5A 4QFDA 1BW9A 3PIIA 3Q6IA 3BTOA 4W9NA 3INRA 5IFLA 1JVBA 3GEGA 2EF1A 3JQBA 1E3JA 3WGIA 4ZU3A 3PQEA 1H5QA 4GQAA 1NNUA 4JJGA 4CUZA 4YCAA 3P19A 1TVEA 1Y81A 3E5RA 3ZWVA 2W98A 1ADCA 2P5UA 1X1EA 4TQGA 3VH1A 5DF1A 1KVQA 2P2SA 3FHLA 1QLJA 3MOIA 3QV1A 4RVHA 4TKMA 5DZSA 2FZEA 4BV8A 1X7GA 3A06A 4IY1A 4F6CA 5HBRA 1XG5A 2UAGA 1DFIA 5B37A 1GYQA 1PU2A 3L9XA 5AXAA 4KUGA 1NPTO 1SZJG 4E12A 1LA2A 4IJKA 2ZKLA 5JC8A 4XRGA 1ZKMA 1UR5A 1E77A 1OOEA 1P44A 1P3DA 2VWHA 1FMCA 4NBRA 5TIIA 2GPTA 4JLWA 2C2XA 1TEHA 1N7HA 1A7AA 1ZUD1 1XGKA 4HFJA 3PP8A 3VVBA 2V6GA 4YAEA 2D59A 4IDFA 2VYNA 1LC3A 3KYBA 1VPDA 2J3IA 1D1TA 3UFXA 3EVNA 3WIDA 3PGXA 4Q3CA 3EMKA 4GSKA 2DAPA 1WWKA 1AGNA 1BTOA 3TFOA 1W8DA 1Q0HA 5KVVA 1NWCA 3H4VA 4J1TA 1YQGA 1FDVA 3S2IA 4M55A 3GDFA 3WMXA 3HZZA 3KV3O 3EVTA 4FW8A 4MVJD 2G82A 3INGA 3VH4A 4BKQA 1CIVA 1PZGA 3BXXA 5DN9A 1YB5A 3ZWCA 5KJFA 1Z7EA 4NBWA 1F0YA 5CPBA 2J6IA 5B4TA 2E37A 4XWYA 2O48X 2PGJA 1I33A 4S3MA 1R16A 1PS0A 2HLPA 3WTCA 2ZTMA 4QTZA 1X14A 4GAEA 2VCYA 3DZKA 1I36A 1K6IA 4IINA 4ILKA 4AJOA 4J91A 5G4KB 4PN3A 4ID9A 4BMSA 2AE1A 4WLVA 4BQPA 1WP4A 4R68A 4E6PA 4E31A 2NNLD 3JQAB 1WW8A 3H9EO 2RH4A 3CTMA 3DOOA 3PFWO 1DDOA 1AN9A 3OA2A 2XAAA 5AOVA 3V2HA 3MJVA 4CMEA 2NTJA 1CEQA 3PJGA 3GQVA 2NVWA 4FFRA 4WNIA 4K6CA 3KYCA 3RWBA 2ZCVA 1SCUA 2DC1A 1CJCA 1XIVA 2EHDA 4GKVA 3JQ7B 5T57A 6ADHA 2VRBA 2QRLA 1EMDA 2VHWA 1U8XX 3Q3CA 4A73A 2DLDA 2FSSA 3EY4A 4IM7A 4J43A 4W9NC 4QUKA 2BFPA 4H7PA 1NTOA 4BUCA 1I2CA 1DIAA 1P33A 2GN6A 3H5RA 5A06A 1RPNA 1PZEA 4EI2A 1M66A 2B37A 2HMWA 5G0TA 3ZWWA 4CV3A 4BNYA 1NYTA 5AVOA 5ER9A 4D3DA 1HYEA 2BELA 2EKLA 2RBEA 5DBFA 3DBRB 1F06A 2PA3A 4BNNA 1A4IA 1EVJA 1XLTA 5F3RA 2V65A 4CM8B 2HK9A 4GLOA 1DB3A 3F9IA 1H9BA 4YBZA 3TZQA 3O38A 2YHIA 3CZRA 5BSFA 4FFLA 4N18A 1NHGA 2FSVA 1I0ZA 3GNSA 2BD0A 1IHYA 3L4SO 1HTBA 3ZGYA 4NH4A 1IULA 5JE8A 3WFIA 3INTA 2GNAA 3E48A 2ZCUA 3ZWXA 4MVJF 4P4NA 3I6QA 3IJPA 4YRDA 4WLEA 3V2GA 1NFFA 4P4GA 2DBRA 1DC6A 4IJWA 2FRDA 1EK5A 1HSZA 1EDZA 2QG4A 1EQ2A 1FDTA 1N8KA 3GFGA 2UUOA 4FCCA 5F1PA 5BNFA 3V1UA 5IZCC 3VOSA 2GSDA 1VL0A 1VLLA 1KERA 3LQFA 2NV6A 4J1QA 4NQZA 4U6QA 3LDHA 3ZNNA 1PQUA 5L7WA 4TSKA 4M1QA 1EBFA 4P22A 5JO0A 4NIMA 1HL3A 4L4RA 2C20A 1PZHA 1YE3A 3E82A 3PYXA 5L51A 3AFNA 3DL2A 3BMNA 2G0TA 3GR6A 1ZSVA 2BGKA 3JQCA 1PJTA 3QW2A 4DMMA 2XXJA 3C85A 5IDWA 1P77A 3ASUA 4RF5A 1GQQA 4NPCA 4TWRA 1HLDA 3A28A 3OQ1A 5ITVA 4Q39A 1C14A 5K6AC 3H8VA 4DYDA 3FWZA 4Q3BA 5H83A 3I9JA 1DFHA 2A9FA 3GUYA 3QY9A 4AL4A 5DDIP 1ISMA 1GQYA 3GDOA 2LDBA 1RYDA 5ILGA 4I08A 1PGQA 4ND3A 2JHFA 4MPDA 3M2PA 3JYNA 4BL5A 1HDXA 3GG9A 2X8LA 5GZ1A 5JC1A 2CVOA 1LRLA 3K31A 2X5KO 3R1IA 3QWFA 4CMEC 4GMFA 4XYBA 3ANLA 3ZWNA 5KVSA 1HF3A 5LCXA 1Q2XA 3GNQA 1E3WB 4TVBA 3H9UA 1NQTA 1AE1A 4WOKA 1A27A 4HY3A 4LK3A 2D5AA 5JO9A 1PS9A 5JPIA 2ZTVA 1LDGA 3AY7A 3L9WA 5ITWA 1DLJA 1BGVA 5FI3A 4JN6B 4G81A 1H6DA 4J49A 1ZMOA 2VUUA 1C0LA 2Y66A 4JROA 3GN1A 1LTHR 3R3JA 1PQWA 4JK3A 1J6UA 3P2YA 5IZ4A 2Y0EA 1VSUA 5GZ6A 4LMPA 3M6IA 4RV9A 3WXBA 1S6YA 1GFSA 3WYEA 4YQZA 2CVQA 3D0OA 1Y5RA 3U62A 2JL1A 3FN4A 3A4VA 1MC5A 3G1TA 3IP1A 3LF1A 2YHIB 3MCVA 3OP4A 4Z9FA 1ADGA 3DAPA 3LSYA 2PKRA 2YFHA 4GGPA 1KY5A 4ZD6A 3SVTA 3DZGA 1U3VA 3T7CA 2IZ1A 3C7CB 5DNAA 1EVZA 3D5TA 3HDQA 1JN0A 5B1YA 3G17A 1E7RA 1ZVMA 2F00A 2O3JA 3P7MA 4CQMB 2SCUA 4JCOA 3H9QA 1DJQA 3T4XA 1UP6A 4PZEA 1YH3A 2GF2A 3P2OA 1E3SA 3R3SA 4MKRA 1KY4A 4MIOA 4YT2A 2PNFA 4TVOA 5HRUA 3JYLA 3ZCXA 3O4RA 2O7QA 3NDJA 4FFPA 1LU9A 3HSKA 1ZK3A 3V1YA 5EN4A 2NM0A 5EQDA 2C2YA 3GVPA 4W82A 2OXIA 4R1SA 1ZEMA 2VHVA 1P1RA 3VKUA 3OJEA 4DMLA 3UW3A 5DOZA 4AJLA 3VZQA 3WNVA 4IDGA 3AOGA 2P4QA 1XEAA 2H9IA 2DPHA 7ADHA 1N92A 4AJIA 5THQA 3GRKA 1D1SA 4IPTA 3BMQA 1SBYA 1B0AA 2VRCD 1E0DA 4O6VA 2C5AA 1LDMA 1ISGA 4KOAA 4M54A 5KJCA 1HZJA 3HN2A 2AHRA 3AUUA 5I8WA 2VTEA 4KWIA 3KYDA 4WECA 5DBIA 1XR3A 1LRKA 2GZ2A 1GEEA 3NTQA 3PDJA 2FN7A 2HK8A 4JIGA 4QQRA 4LVUA 3JYOA 4XB1A 4Y67A 5FI5A 3VPSA 1OC4A 2FOIA 4S1VA 4E0BA 2Y1EA 3ONFA 3AUAA 3JQAD 3VH3A 2O3RA 4CLXA 4AJNA 2QYTA 4YDRA 2AQHA 2FP4A 3QHAA 5ER6A 4WLNA 4MP6A 1XDWA 1ZXBA 1BXZA 4GX5A 3QWAA 4ZRNA 3CMCO 3E5MA 5A03A 3QP9A 5F1OA 3RC1A 3BMOB 4XR4A 3OBBA 3SLGA 3GDGA 3AI1A 4CMBA 2E48A 4NI5A 1AUPA 2YDYA 3OQBA 2Q4BA 2X58A 2BI7A 2DBQA 2OL4A 1GR0A 2X5OA 4YJGA 4FGSA 4R5MA 4MVJP 5TT0A 3GZ4A 2YQ5A 4QSMA 4Z0PA 1RJWA 1ZK2A 1NVTA 1PZFA 5MGBA 3DZFA 4KTTE 3ENKA 5TLSA 2IEBA 2UYYA 1X7HA 1LSUA 1DC5A 3M1LA 4PRLA 3DAFA 3I3OA 1PJBA 1FDUA 1PQPA 4WE3A 1I32A 1K3TA 1Z75A 2QYSA 4D46A 1U2GA 1I3NA 2HO5A 4L9RA 4YRAA 2CF5A 1I2BA 4UREA 5KNLA 1VKOA 3WR5A 1YJ8A 4BO3A 1ZW1A 3I4FA 4XIJA 3UF0A 1ZO8A 1O5IA 3PFFA 4CM9D 2Y05A 5CP8A 3GH3A 4OAQA 2NLOA 2VYND 4J7CA 5A9TA 4ROSA 1JDJA 3RBXA 4CODB 3HUDA 5I7EA 2YV2A 3WS7A 1NVGA 2YZ7A 2VHZA 3TJRA 1ZJZA 1DRWA 1V3UA 1MX3A 4NHEA 4ALJA 2PZKA 2NU8A 3LZ6A 2P68A 1FK8A 3DHYA 4MKXA 4DIBA 1JA9A 3IL2A 3MTGA 4OOEA 3I1JA 3JD0A 4L73A 2JD0A 2Z5LA 1IHXA 3AW9A 5HM8A 4BGUA 5JAZA 5L9AA 3ZHXA 1UXJA 4J2HA 4FFOA 1Y5MA 2O4CA 4P8RA 1ADBA 2PKQO 3EAGA 4WCFA 4B3IA 5JSFA 3GVCA 4N5MA 3GZNB 1GUYA 2FPPA 1B15A 3PLRA 1HSOA 4W7HA 5FFFA 1CERA 1HDOA 3WLEA 1E5LA 4ZQBA 4E5PA 2X86A 3CXRA 3ZU3A 4WGGA 3NGXA 1IUKA 1UXKA 2V6MA 3KYDB 1BSVA 4DL9A 5THKA 3AJRA 3JQ8B 3KBOA 1AXEA 3SC4A 3W4JA 2DVMA 4EUHA 2TMGA 1PJLA 1Y8RA 2UV8A 3FPCA 3GFBA 2HDHA 4NG5A 4BO4A 1LLUA 2EXXA 2GLXA 2W2LD 3LC2O 3VPXA 4TRRA 4B4OA 2Q1WA 3IUPA 3B1JA 1KEPA 3A1NA 5I9NA 4AJ2A 3W4IA 2X7HA 1GZ3A 3BYZA 3FTPA 4JP3A 2EGGA 4MVJE 4XKJA 3ROQA 3PYLA 5DT9A 2VZ0A 3WGHA 1LRJA 1QMGA 2DTXA 1H93A 5T64A 3TL3A 2Y93A 3U4HA 1B2LA 4ZICA 1DC4A 2HU2A 3KUXA 4PZDA 5TS3A 4XQEA 4GX0A 4IMPA 4FB5A 4BV9A 3HWRA 3CTVA 2YQ4A 2VWGA 1NASA 3U5TA 4GLLA 1Z82A 1CQJA 2IDZA 3KRTA 3N7UA 3U09A 4WJZA 1E7WA 3LYLA 1EE9A 5ICSA 1HYHA 4CMIA 1YL5A 4OL9A 3NT4A 4E5NA 1JWAB 1QYXA 2HMUA 1QORA 3UCEA 2Y68A 2UVDA 4PLTA 3KOUA 1ZFNA 3L4BC 1BHSA 4FC7A 5J23A 1JVSA 4RVSA 1DEHA 1NAHA 4GSLA 2OO5A 4UULA 3W6UA 4WEOA 1ORRA 3PVZA 3KZVA 3KSUA 1UAYA 4X54A 3VTFA 4PG7A 5BSGA 1KYQA 4YYZA 3TDKA 1CDOA 1PS8A 5T5QA 2E4AA 4J0EA 4DBZA 3CIFA 2Q4EA 3H5NA 3U4IA 3E18A 4CQMD 2B5VA 2EW2A 1KBZA 1Y1PA 3RFVA 2NWQA 5JAIA 2YV1A 3S2EA 4DPMA 3S8MA 3L07A 3PZRA 4CM3A 1Z6ZA 3IIEA 2P9EA 4WLUA 3NX4A 4L74A 4MDHA 1PJ3A 4XGIA 2W2KA 3Q2IA 3RFTA 2NU6A 3ROKA 3TSCA 2BGMA 4I1IA 1QG6A 1U9JA 1DIBA 3K8ZA 2O3SA 3GHYA 1ZK4A 4YJFB 1DIHA 3MJTA 1HE4A 4GI2A 3RC2A 4R41A 3UHAA 1N7GA 2EW8A 4UEOA 4WCFC 1PL7A 3KTDA 1KEUA 4IIVA 1GPJA 5I9MA 3VZSA 2C54A 3LT1A 3ROMA 3WSWA 4BNIA 1NX6A 2VUSA 2WSBA 2BFOA 1CETA 4JNKA 4Y6PA 1P1IA 3MWDB 2OHXA 2PD6A 3D3WB 4OJNA 5BSHA 4ZVVA 5TQVA 3GVHA 4Y6SA 1LX6A 1QYVA 1PR3A 1Y8RB 4XQCA 3TQHA 2IZZA 1M2WA 3PLNA 4D3FA 3PWSA 4M49A 4D79A 3MOGA 1YWGO 2IZ0A 2VT3A 4ND2A 1PWZA 4JBIA 3TZ6A 4EGFA 2P9GA 1SOWA 4WUVA 1U2DA 1WMBA 1L1FA 5H81A 3VDRA 3WJAA 4BNMA 1K0UA 4MP8A 1WLYA 3TFQA 2P4HX 1ENYA 4NBVA 4A03A 1T2EA 4FOSA 1JAYA 3CUKA 4E30A 1KVUA 3PHIA 3RBZA 3Q9NA 1I3LA 1U4SA 2VHYA 5IN5A 2VUTA 3FNHA 3JQ6A 2DUUA 4NJMA 5EIOA 3OECA 2C59A 1C0PA 3ZN2A 4DBVO 1P74A 1SEPA 4L8VA 4KUEA 1GDHA 1RM0A 3H2ZA 4RPKA 1MV8A 4IJUA 3LC7O 4IGFA 3WJ7A 4UVDA 5TX7A 3ST7A 1ARZA 4JP2A 1GUZA 2VN8A 4OKNA 4HX5A 5EESA 4CM6A 1WAMA 5U9CA 3U4DA 3R6DA 4E5KA 3GK3A 4H16A 4CMHA 1XHLA 1J5PA 5ENVA 2GN8A 2OBNA 2EP5A 4N54A 4NBTA 3QRWA 3HFGA 1R4NA 4MVJH 4PLGA 4P38A 4TKLA 2O3QA 3NV9A 2JKVA 1MA0A 2Y99A 3GGPA 4FBGA 4RDHA 5GMOA 3OIGA 2FHSA 1M6WA 4GPD1 2JFHA 4ZA2A 2JFFA 1YBAA 2EKQA 1I5RA 1ZBQA 3TRIA 4OH1A 3D4OA 4BO9A 4DA9A 1MFPA 2AA3A 3RI3A 2J8ZA 3C7DB 3DHEA 3JQDA 4YTEA 4BO2A 4CQLA 2Y1FA 3KXDA 4BB6A 2RH8A 4UEJA 3QVXA 1BMDA 1NFQA 2PR2A 3RVDA 4BO0A 4WEQA 4YAGA 4YJHA 3WFJA 2C29D 3E8XA 1R15A 4KUHA 3I9LA 1A7KA 1BXGA 3BA1A 3VAZA 4R9SA 2BLLA 2YJZA 2D1YA 4FD3A 5JW6A 1H9AA 4D44A 3I23A 3AI2A 5BNTA 3UGKA 1MP0A 4WCDA 3RU7A 4LN1A 3ADOA 4Z9YA 5LDGA 4OM8A 1PEDA 5F5LA 1NPDA 4MVJM 4JQCA 1YBVA 4HFRA 1BVRA 3DEYX 4GGOA 3ZDFA 2X22A 1MG0A 1TT5A 3BHJA 4Q9NA 3BTUA 3DDNA 1DFGA 2ZB8A 4W4TA 1FXSA 4O5OA 4UUMA 2VYVA 4RCVA 1YXMA 3RKUA 4FSHA 2NADA 4FDAA 3K96A 5I8ZA 1BXKA 4A27A 4RLSA 4U0KA 4XCVA 1I10A 2YV3A 4LSWA 2POQX 4RF4A 3DZBA 3JCZA 3TZCA 4F6LA 2X0JA 4DC1A 4EW6A 1XQ6A 5K6AA 4OGWA 1C1XB 2TMDA 3Q9UA 1GY8A 3NT2A 1DIRA 2HUNA 2EJVA 1DJNA 4YQYA 4BS9A 1EVYA 1J4AA 4OXKA 1C0KA 3GGGA 4I5DA 4C7KA 4CJXA 1B26A 3OMLA 1B8VA 2GERA 4DQVA 6LDHA 3NJ4A 5KJ1A 2A35A 3H9JA 4EBFA 5B12A 1UJMA 4BNFA 3CKYA 1BW9B 4Z0TA 4PG5A 1E3IA 4NR0A 1YGYA 4RPJA 4RF2A 2B4TO 3ITKA 3S2FA 2O50A 3TPCA 2D2IA 1E1LA 3FBTA 3JTMA 4J1NA 2HMVA 4EZBA 2G5CA 5TT1A 3RC7A 2CDAA 2PLAA 5EPOA 3WQQA 4EJ0A 4BGVA 4CL3A 3EUWA 4H3VA 1QYCA 4FR5A 4RF3A 4BGEA 4U7WA 3EDMA 3WGQA 3K6JA 3BMCA 4RPLA 2BKAA 1WZIA 4CUJA 4AJKA 3FRJA 3PIDA 4IQ0A 3P5SA 4AFNA 4EJMA 5CG2A 1GZ4A 5L4LA 3RUAA 3FNGA 5ES3A 1IYZA 2BH9A 2WD7A 1NWHA 3RJ5A 1IB6A 3S1LA 1JKFA 3NRCA 5IN4A 2VHXA 3NTRA 3SLKA 3DAGA 4XDYA 3KETA 4RPGA 1Q1NA 2J5QA 1ZK1A 5JNLA 3B70A 2GGSA 2OBYA 3W6ZA 3QWBA 3S2GA 1ENPA 2RHCA 2PGDA 1P45A 4GWKA 2GN9A 4CMAA 4D45A 4DLBA 1A5ZA 1Q0QA 4WK6A 1PGNA 1U8FO 5DCUA 5A3VA 2VQ3A 2X9VA 3CSDA 4BNLA 4ND4A 3ZWAA 3GA0A 4OKIA 1G0NA 4NDNE 2HMSA 3OJOA 4QT0A 4JJIA 1TT5B 1V3VA 2ZQYA 3GNTA 3LVFO 2B69A 3ZI0A 3CEAA 5CEJA 3OJLA 1WPQA 1Q7CA 2CSUA 3DZJA 1SNYA 4I9UA 5JMWA 1N1EA 2J3KA 4ND1A 1ISHA 5DOVA 3Q11A 5JDCA 1LDNA 1GEGA 2GN4A 1GV0A 4YT5A 3SJUA 1NQOA 4ZN6A 4FJ0A 4W99A 4AVYA 2NU9A 3HNPA 4UAGA 4BO5A 1DSSG 3ZV3A 3OIFA 4NFSA 4J0FA 1E1NA 5GY7A 1H0KA 2E82A 4MVJI 1GU7A 2H5LA 4KDFA 5TJ9A 3DFZA 1R4MA 4KP7A 1ENOA 1P1FA 5CAEA 4BO8A 2Y1DA 3IKTA 3H7AA 2ZYAA 2CDCA 3GEDA 3ORFA 4UEKA 2I76A 1X13A 5DCWA 3IKVA 4DLAA 3WIEA 5A9SA 3O26A 2AG5A 4L76A 4R3NA 1GYPA 3KYCB 4PLZA 3ZHZA 1HDYA 1EQUA 3HE3A 1I3MA 4R16A 2WYUA 5IXYA 3PGJA 4U8GA 1Y9EA 3KLPX 4AJEA 3L6EA 2YYYA 1UZLA 2X6TA 5TF4A 2GUGA 4NK5A 1Y6JA 3GPDG 3QIVA 3GPIA 5CEFA 3QQPA 4Z9XA 1EEHA 3ICPA 5ADHA 2HQ1A 4II3A 4B79A 5BNIA 5L45A 2I5PO 1B8UA 1ONOA 2NVUA 3ONEA 1IZ9A 3QA9A 4D3SA 2PTGA 2IYPA 1WXDA 2PWZA 4XR9A 4BB5A 2WYWA 3PJFA 4NZ9A 1ZNQO 4F45A 1MXFA 2WD7B 3WGTA 4K6FA 1P1HA 3PHGA 4E21A 1JQBA 2ET6A 2GASA 2WTBA 1X15A 4E2WA 2JD2A 2GYYA 1V9LA 2D5CA 4RQUA 1W6UA 2DTDA 4K1LA 1JLLA 1NXQA 3PHLA 4QFCA 1R0KA 5JCJA 5HA5A 2I65A 3WWYA 2HJRA 2FMUA 1YBMA 4WNCA 1C0IA 2DFVA 4QO7A 5TRTA 4PGFA 2I99A 3C1AA 1ZSNA 1P9LA 1ISFA 1SMKA 2GD1O 3GF4A 3RSHA 1HE5A 3KB6A 3GT0A 1U3UA 1JTVA 3MTJA 4BKRA 2AQKA 2AW5A 3K92A 1RYEA 1DAOA 3CE6A 4OXNA 4KMSA 5A05A 1N2SA 2BHLA 4MP3A 3FF4A 5JDIA 2EJWA 3VZRA 1E6UA 5COAA 1E7YA 2Z95A 1T2DA 3JQGA 1JU9A 1X7DA 3JQEA 4RL6A 3SC6A 4CL8A 4YJDA 4YAIA 4Z0HO 1PGJA 4I8XA 1LQUA 3AK4A 4P4LA 2FY8A 3WMWA 1RKXA 1VL8A 1HDGO 2AEFA 2V7PA 2ZK7A 5JDCC 5JLAA 4XA8A 4O1MA 5A3JA 4CR8A 4B3JA 2F1KA 3ZNPA 3IAHA 3BMNB 4IZHA 5L40A 3AU9A 3EC7A 2IXAA 4DIFA 2FR1A 2AQ8A 1YB1A 1R4MB 3RFXA 1A9YA 3PDUA 3BTSA 2Y1GA 3MJ4A 1E7QA 5KKAA 1I01A 4XYLA 1I30A 3Q2KA 2CNBA 1DPGA 3VDQA 1VJ0A 1J49A 4PFJA 1NQAO 3N74A 4TZTA 4GVXA 1XKQA 5A9SB 1K6JA 1QYWA 3FWNA 1ML3A 2FR8A 3DMYA 5IJZA 4FFMA 3I5MA 5H82A 3UN1A 5HTOA 3KLMX 1HLPA 1SEVA 1XU7A 4NK4A 3IP3A 1E3EA 4XQGA 1HDCA 4ALKA 1ZH8A 4OSPA 3SBOA 3L0DA 2AXQA 2Q3EA 3L6OO 2UUPA 1OI7A 1KOLA 4K28A 5MDHA 5K0ZA 5F1KA 2NVUB 5C7LO 1DXYA 3D1LA 3PWKA 3WDSA 4YXFA 1UH5A 3LK7A 4M8SA 3F5SA 3TZHA 1H2BA 3NDRA 1OZAA 4XGKA 3IS3A 4IDCA 3KEQA 1XA0A 4CV1A 4DQXA 3L4BA 5ICMA 2AEJA 1MFZA 1UP7A 3UCFA 1R12A 4DTIA 2O3UA 1D4FA 1Q0LA 1TT7A 3JV7A 4Y98A 1GTMA 1WDMA 1HDZA 1VC2A 3ZWPA 4BNVA 4HKTA 2CMDA 4DPLA 3WGGA 4ZGWA 3LT2A 3H5AA 2X1HA 4QX6A 4OSOA 4L75A 2GO1A 4QXMA 1CQIA 1Q7BA 2QIOA 1F12A 4PLHA 3QWIA 4B7UA 1T1RA 3X2EA 1EE2A 4D0RA 1T1SA 1W4ZA 5C7IO 1D8AA 3TOXA 4I5FA 2AEMA 4CUKA 4B8ZA 2PZMA 1T26A 5A4DA 2LDXA 2VOEA 4JBGA 2UDPA 5TJHA 5JDIC 3V5NA 4HV4A 1DHTA 2I66A 2B4QA 2VNSA 3D4NA 2V6FA 3BMQB 2PD4A 4GWGA 1GZ6A 1LSJA 3B20A 1ISJA 3DHNA 1Y9AA 1E7MA 3ZU4A 1YOVA 1LSOA 5A04A 3UCXA 4HBGA 3JQFC 1FDWA 2O23A 1GYRA 4FC6A 4RLHA 1EBUA 1M6HA 1HWYA 2R00C 1VL6A 2DPGA 1UP4A 1BDBA 3ZZNA 4DREA 3G3EA 1D7OA 2Q1SA 3NAQA 3E9MA 2EGHA 1H94A 3QVWA 3AY3A 4QECA 1ZXLA 4LRSB 2PV7A 5CEEA 5F5NA 1TLTA 4BKPA 4E2ZA 2DBZA 5F21A 4XX0A 4H15A 2NUAA 4JGBA 1NBOA 2WDZA 4J4TA 4E3ZA 4IQ8A 1YRLA 1ZK0A 1MB4A 4WASA 4BQRA 1NP3A 1HE3A 2R2GA 3NYWA 4YJGB 1E6WA 2PK3A 4RDIA 1V3TA 1BWSA 2DKNA 1GPDG 3C1TA 1LLQA 2IEDA 3LU1A 3NDIA 4BVAA 2JAPA 1LLCA 3H3FA 3AM4A 3IJRA 4MIEA 4CLEA 4R1TA 3DBHA 4CV2A 4FPXA 3WNQA 1KIFA 1O94A 4WOJA 4LVCA 3OEWA 5ENDA 5T8KC 3AFMA 1EFKA 3DMTA 1XWFA 4CM4A 4UUNA 3PWZA
chains in the Genus database with same CATH superfamily
1H6CA 2PH3A 3ZHZA 4EKIA 4F21A 1S2MA 5AW4A 3OHSX 2Q2QA 1M1XB 3A25A 1EJ0A 4RK0A 5EEGA 5EKUA 4C0QC 2HZBA 3LOPA 2X6QA 1EUDA 2H8GA 2ZDHA 2VZ9A 2QLTA 1M9NA 2CLLB 1Z88A 3F47A 4IGEA 1EBBA 3I04A 3VFDA 4D25A 2AJBA 2ORED 5I9LA 1VCNA 1YONA 4QAJA 4LYGA 4V3BA 1XX6A 1GNSA 1IH8A 3Q15C 3BHIA 4N7BA 2Z43A 1U2RA 1PG5A 4RJLA 1RJEA 3V2UA 3DC7A 1U7DA 3VR1A 3PIRA 2FI1A 2CV0A 1V6AA 2ZANA 2CUKA 2V96A 1ORIA 1MMFB 3QX8A 2O4UX 3BRWA 4O8CA 4O1HA 4KKXB 2NU8B 1Z0AA 3MA0A 3GLFE 4YUYA 3B36A 1ECCA 4ZO9A 4XOUA 3GAZA 3H9CA 1GO2A 3P32A 3JXEA 2JAOA 1W73A 4P98A 2WQ6A 1DOZA 1RZUA 2HK7A 5FJIA 5C8DA 3MSCA 2GBIA 5TQJA 3EODA 3KJHA 4IIBA 4TV9F 2GZHA 2ZBVA 2ZYTX 4KXWA 2VK1A 2X40A 1CRLA 2Q8PA 3X2FA 4JJFA 4BUZA 4DC0A 5B6JA 5FH9A 2EIHA 3FHJA 3ZWQA 3OQOA 1PEYA 4M9RA 4CKEA 5KTMA 1UXOA 2FPPB 2I3GA 1E1RD 2IS6A 1DWOA 5HKKD 1VHWA 3ZY5A 2X8JA 4DMFA 4TSFD 3K0CC 3T54A 3BB1A 3TTTA 1N7JA 1CR1A 1VLMA 1OFHA 4HAVA 3GP5A 4L7QA 2X7JA 5REQB 4DGSA 3KOZA 3FDXA 1QANA 3GRPA 4BNXA 4YUWA 3C7AA 3HCFA 4PG8A 2QHXA 4A8TA 4C29A 3DHWC 3IA7A 2J5XA 3HR4A 3WKCA 4ZQFA 2RHRA 5C1OA 2JVIA 5LQCA 1CY0A 1T35A 3IALA 3G02A 4QU8A 2QD5A 2Y2VA 1DHRA 2I8AA 4BJ5A 1QBKC 2BLNA 5JI3E 4QE3A 1DG1G 1X19A 2ZETA 1T5LA 2YWRA 4EGCB 3OA0A 4B84A 4I2VA 2RK3A 3CWCA 1BXRA 1YK1A 4F92B 2MSKA 2CXQA 3G5UA 2C77A 4X6UA 1F0PA 3ONDA 3PC8C 4MDYA 2QW8A 5F51A 1TK2A 2EEZA 3ZTTA 4BTVA 4EEZA 1NVUQ 1GNTA 1NTRA 2PMBA 2JIMA 4S04A 1DRUA 4L8YA 5E4JA 2A5YB 3WK4A 5B6PA 3K09C 1NKSA 2HRQA 3DVAB 4IRUB 4XLLA 4GYKA 4DUPA 3LTNC 4A36A 5JY1A 4CTNA 1D2AA 5LDHA 4YB8A 4K3VA 1MIOA 3DONA 3HEAA 4FQ8A 1TIBA 3KSRA 3MGAA 4Q9LA 4XD2A 4ZI5A 4OHUA 3RVQA 4UASA 3EPKA 3L7LA 1HETA 2XGJA 2AQIA 2GCOA 3BUSA 1NY6A 2O2JA 3TCXB 3O1HB 4UHBA 3U17A 1D3AA 1HOXA 1PW5A 3C8DA 3HB5X 3BXEA 4I55A 2H4HA 2CE2X 1WPXA 1DBSA 4GU5A 4B3HA 3T95A 2EL7A 2A0KA 3MRSA 2REQB 4KVFA 3EEBA 1GQOA 3GVIA 4RC9A 4CM4B 4DMUB 5C53B 4FZ3A 5COQA 1O6FA 1OT5A 3RJ9A 1A88A 1SA0A 4R1NA 4DZRA 4J0QA 3DMTC 2MU1A 4J6EA 2CJWA 2L19A 3LLCA 1KK1A 2A4MA 2VF4X 5L3ZA 2JCXA 2YVKA 4CXMA 4FP9A 4F4UA 1RXWA 1SRQA 1TCCA 1YQTA 3G7UA 3BXPA 2DFKB 3R3XA 4RY8A 1KK3A 4I6EA 4NJEA 4B0OA 5JNRA 3LLUA 4LXGA 1IJKA 5HKLA 3JQ7A 2GD6A 1VPWA 1EFRA 5AYVA 1WD7A 4RYDA 3OQNA 3ZVNA 2YJGA 4TMFA 2CFCA 2IHJA 1GGKA 5YASA 2O8NA 4AQDA 4AJ4A 1EFPA 1D4ZA 2F67A 2WE8A 3DTVA 5EWJA 4GKKB 1O5OA 2VKQA 3O1JC 1ZL2A 1TUEA 3GH1A 4QTUB 2NU6B 2GHQA 5E6UA 1MORA 3HCOA 2BGLA 1G6KA 4J7XA 2I29A 1OILA 3AJDA 3SFZA 4C0LA 4BNUA 1QYRA 4GW3A 2Q29A 2DH6A 5KJEA 3IVAA 4QUHA 1USGA 4WH0A 1SAYA 2P9ZA 5DTQA 3RIGA 3T3OA 1NW3A 1AGPA 1V8BA 3CM0A 4RSMA 4IS3A 2PUBA 2F8LA 4RMHA 3DBRA 1Y3DE 4PYOA 3OQ6A 3FTQA 4UDYX 3LQYA 1W52X 2MSEB 4TZ0A 4CM8A 4A0SA 1LZKA 2FW6A 2I3ZA 2XTNA 3MGGA 1C0EA 3O8NA 3T7JA 3I61A 4GPTA 1RXSA 3TZKA 3MUNA 2J3LA 3JR7A 2QTCA 5E3HA 1X1QA 3WA6A 2QTVA 3WX0A 2Z2ZA 1E7SA 1NZJA 1QCDA 1DEOA 1I7PA 1XCJA 3FFTA 2NQ8A 4RM2A 2XJ9A 3QKRA 1GUFA 1L3CA 1WX1A 2QJRA 3MBIA 3E84A 2BUBA 2H29A 4B8WA 1WHTB 3OTIA 5K3OA 3FFBA 4ZU1X 1E99A 4YCNA 1KI8A 4MYRA 5KTOA 1MVOA 4O2AB 2AC4A 1RD4A 1YHNA 4PNHA 3GMIA 1SVMA 3NC4A 3MMZA 3IMKA 4L08A 4BO7A 1YR1A 4JLPA 1BXRB 1F17A 1T5HX 1VHQA 2BTEA 2OUIA 1YNSA 3W1EA 1JG7A 1XTIA 3GJ4A 3IUQA 3FHTA 1ULAA 2PFSA 3Q7IA 5LM3A 5DP1A 1AHHA 5DHFA 3P0JA 3N0TA 2WTUA 1W88A 1YUMA 3PDIA 4XDZA 3K20A 5KPJA 3OCVA 3HDYA 4C43A 4I4TA 1SM4A 3DV9A 3O83A 1II8A 1DKLA 1CUHA 1LBEA 2YWFA 3L8GA 3HYTA 3OOSA 1U04A 4FJ2A 1NNEA 5J2TA 4XIFA 1MN6A 1YA4A 3KX2A 5FEUA 5LU9A 1EDDA 1NM5C 3PL5A 2GCOB 2IS1A 3GPLA 3TN7A 5DWVA 1G0OA 2FMHA 3EJWA 1QX3A 4ETIA 1NQ5A 5FUXA 4AJ1A 1UPXA 1W44A 5EWLB 1KQNA 4NZNA 4I55B 5KCZA 3Q10A 3OX1A 3M4XA 5DYGA 1GKYA 3WB9A 4EYEA 6PFKA 1KI9A 3MTBA 2IUSA 4GG1A 4N8SA 3OZFA 4CMCA 5E95A 2H4XA 3U49A 1JQJC 2W2LA 3IOEA 4KDEA 1PX2A 1JG6A 1B3BA 4WADA 1SA0B 2J5RA 3GAFA 2J3HA 2FZWA 3WRVA 2UZ1A 4A8JC 5CIQA 2R0QC 1YUNA 4MJLA 5LZ2A 2FW9A 1UBMS 2GNPA 2GN2A 2IGTA 4FMBB 4IEIA 4MAMA 3HJAA 3N2LA 1TKBA 3FOBA 2V7TA 1T4BA 3M5WA 4BNWA 4YT4A 2EERA 4ZT5A 1LI4A 2HF9A 5JFGA 4LOAA 3O2SB 3HN6A 5A6SA 1SURA 4CQLB 5AJZA 3RUHA 4U9UA 1M0EA 3K9QO 1DAFA 3AWDA 3FCXA 1OU0A 3X1WA 3GCZA 5AXCA 1W0KD 1V5IA 4MUGA 1KE1A 5F4BA 2WU3A 1L7OA 2PKEA 3FZGA 5FKJA 1TQDA 4G5QA 3TD9A 1YL6A 4ZKEA 2A9QA 2WB4A 1BMFA 1ZN9A 1EFPB 3QE3A 1EVEA 1JHRA 3F4KA 4FLMA 4I4IA 5EWJB 3VMMA 4DSOA 3U4QB 1JSZA 5G4LA 4BGIA 3SIRA 1TRKA 1Z28A 2Q5LA 3HDJA 4CF6A 1QQAA 1NVMB 1UBJS 2C4KA 2DM6A 4LJ7A 5EJ2A 1JPNA 3C87A 2ATIA 4EHJA 1VXRA 1XMIA 2XXAB 1MT3A 1WDKA 2IV7A 3QEAZ 1UEXC 3FKSD 3L5OA 1ISSA 3A1CA 1DJMA 2W0MA 4KIUA 4NOLA 5F35A 2CVFA 1BJTA 2E49A 3O4IA 3TE7A 3PCTA 3O8LA 2QZZA 2CXUA 2QY9A 4I5IA 2WNHA 3AF2A 1Y4SA 4G0OA 1NXOA 3JYQA 4NL4H 2IA5A 3TXAA 2QZ9A 4OJKA 2OCIA 4HXFB 3AKYA 2QG6A 3FKQA 3AR2A 4ZOEA 3IQDB 3NXKA 1ZM7A 2D0IA 4B3GA 2HREA 3FBWA 4S2UA 3DT9A 3FVRA 4EX7A 4G23A 4RD0A 1X9GA 4IUBS 4J94A 4BY9E 4JVMA 1UUFA 2GSWA 2ZTLA 4R1LA 4H7DA 4B7CA 2QTHA 3ZWBA 4CQMA 1L7AA 3GC6A 1SU7A 3G2HA 3OUTA 4DUGA 5DIFA 3MQFA 4PNZA 5DLQC 3THXA 4JGGA 5AOCA 4JI0B 1K2VN 3OFSA 4EPWA 3N86A 5JSQA 3GLUA 5FBHA 4NCJA 5IYZA 3ZKAA 4C76A 5BW4A 5TQ2B 5L3QA 2CBGA 4PWZA 1M6NA 4FDUA 3OQVA 3D8UA 4P6VF 3D2AA 3VO2A 4BOYA 3R9WA 1E98A 5CFNA 4M88A 4AWXA 1HT0A 4GHWA 3IT1A 1JWBB 5D8DA 4M4SA 4I4TB 5TSDA 4FX5A 1M8FA 4HQLA 2V7WA 1E2QA 4D0GA 1E66A 3QU2A 1Z15A 5AQ1A 4Y6QA 5J2TB 3H4TA 2Y0CA 4MS4A 4EO7A 1RADA 4EGAA 4FOOA 2D6FA 1PLLA 3N9IA 3OURA 2VA9A 1JEQB 3IOYA 4I36A 2I6QA 2WAMA 1B1CA 5B1HA 1J9EA 3G2KA 2JEYA 1O0SA 1BRTA 3GP8A 1E94E 2A30A 1SG9A 3UAXA 1VBMA 5IBCA 4IQGA 4JLDA 4Y7CA 4ZOCA 2WWYA 4RDXA 3HVRA 1VZ2A 1YCDA 4HH3C 2P2GA 3ENWA 5EXPA 1DKMA 1ST3A 4IZOA 5KYKA 2ZPTX 5AXDA 3GD5A 1U3WA 3ODPA 4E4RA 4Z8XA 5F73A 4HR7A 5LQUA 2UZ1B 5G0SA 4HQ0A 3GT3A 2PMCA 4PG4A 2B0JA 2XV1A 3JQ9C 3ROPA 2GMWA 3B3FA 4RD2A 3USES 1OZHA 3B52X 3UJHA 5KQPA 4J1SA 3LBFA 1U2TA 5A6SB 3WBFA 3F97A 2Y9YA 2G9VA 3W7AA 3WK9A 3PDHA 4ZYLA 4UDXX 4NAHA 5A62A 5K7SA 2H2AA 4YRPA 3EXIB 3UAOA 3UMYA 4B5KA 2F17A 5KJ6A 2RCYA 4KR9A 4R1UA 1PNVA 1RWXA 4XEHA 2ZRFA 3PX7A 3THRA 3ZW9A 1A98A 3ND7A 2W6CX 3UXEA 4IYJA 3PRYA 3SHVA 4OK5A 1Z7BA 2I4NA 2V7VA 3R5KA 3L6DA 1DQSA 4EDFA 2QBYA 3HJHA 1VPTA 2YRWA 5DNUA 4NPHA 4H31A 4YJ2A 3ULKA 1D2GA 2FLVA 2ASEA 1KVTA 3T7TA 5HUHA 2ZJ6A 5HZMA 4ZCPA 4MO2A 4AO7A 1R3UA 4YRBA 1YHZA 4FT2A 1NJ2A 1YRYE 4TTRA 3KSZO 3FDFA 4DYVA 4YPOA 3NRJA 1Y8CA 1W1UA 5F2NA 1G1AA 4ZPJA 3SZUA 2EJCA 4MIYA 4RK4A 1WSBA 2C0CA 3FSGD 4D9IA 2B5WA 1ADYA 3MTDA 3PJEA 2VDQB 4MW2A 5FYDA 1B7GO 1UBCA 5TPZA 1NVAA 5TF0A 3KQYA 1UC9A 1ZUIA 3OT4A 5KX5A 5IC5A 3CZAA 1YIDA 4C0KA 2H1SA 5B4UA 4YCCA 1QKJA 2G5GX 2O1WA 5FTMA 1FU8A 2OFPA 2TRSB 4MINA 1ZGZA 5F2OA 1QYDA 2HTFA 3OWOA 2JBWA 3TLJA 1X8XA 3BGIA 5BSEA 1KAQA 2UVQA 4RABA 1Y82A 1IHOA 3RVMA 1MB9A 3U7QA 4F2DA 3THXB 3C1OA 1DBVO 1IPEA 3CURA 1NBIA 5FOTA 2X9QA 3Q7EA 2PGXA 1CR4A 4B4WA 2ZSHA 3LOQA 4H27A 1XTZA 3HBMA 3VYWA 1X7WA 4B48A 5KNCD 2JLYA 5MHTA 1IM2A 3PK0A 3REOA 3EEQA 3H9GA 4KE7A 2XKJE 4DADA 2Q50A 1XDSA 2QQEA 3GX1A 1F7VA 2FRDC 4OY3A 5BO5A 3C8ZA 4PFKA 4RK5A 4KZPA 4YMLA 1FLNA 2QNIA 1MHTA 4K26A 1MO6A 2QP4A 1B43A 2GQ0A 3BIJA 3VSDA 1FTSA 2CJFA 5H16A 8ADHA 2Z6UA 3AXTA 1T8SA 1Q3KA 1T25A 2Q2WA 3B2EA 3SLRA 5HQTA 4V2UA 5DW0A 2C96A 4JUFA 1QF7A 1X3SA 3I0ZA 2EQAA 2GBPA 3NKLA 1Z74A 5DWQA 4WA7A 2NT4A 2PX8A 4HXGA 1PBNA 2BDUA 2JF0A 1FFYA 3ETGA 4EY6A 1RC8A 4ERNA 4JI7B 1RLOA 1E5DA 1V8FA 1X87A 2GJSA 5G53C 5F9FA 2G0NA 3B7GA 1T6BY 1J0AA 4KO8A 1K6XA 2QX6A 4TWZA 4FHFA 3TL2A 1YRQA 2H17A 1HRDA 1NR7A 3M6AA 4OIFA 3AP1A 3H9BA 4URWR 3TEFA 4MVJA 4Z3KA 2PFGA 4OREX 4P83A 3JQ8A 2ZRMA 4ZO7A 4QHTA 1XKTA 4E1AA 2R84A 2OOKA 1IL0A 1XCBA 1QFMA 2P2CA 1Z39A 3AGQA 4LZOA 5ES4B 2JIPA 3DO8A 3LX6A 2V7QD 2F9FA 3AM5A 4MV7A 5DP2A 1QCCA 1RM3A 3FCOA 3RUFA 1ACMA 1QS0A 3WWZA 1Q1GA 2DUMA 1AV6A 3OD1A 4P5EA 1Q0SA 1A9XA 4GRAA 2A0UA 4OQYA 2FEWB 3LRPA 4UQPA 2HYIC 1NVVQ 3GUCA 1T0PA 3TXYA 5HNKA 3I64A 3L7KA 3R3UA 2RGEA 5IZCA 2ZYRA 3JD4A 3I5YA 2W6JD 4YMSA 1IQPA 1G5RA 1ZD1A 221PA 3OIVA 4E5MA 3CF6R 5TC4A 3DKPA 4YJ2B 3OIYA 4FW9A 1FS4A 2Q5FA 3O9VA 1ZJYA 4NBUA 1BD4A 3C8HA 4Q7EA 3SFTA 3STTA 3E7XA 1RI1A 2Q7XA 5J5AA 5KAMA 2VWQA 1QXSA 4I1OA 2YINC 3ERCA 3TQIA 2ONYA 5B4VA 2DX7A 1YZKA 1DOHA 3OOYA 3GJ5A 2NSLA 1WZUA 2JCYA 3PB3A 5J1SB 1O0BA 2B4RO 4M99A 2PZLA 1GKUB 5KYUA 3WWOA 2FSHA 5BWBA 3PU6A 4C4OA 2IHUA 2O2SA 3L77A 2G9NA 2IELA 4GC5A 5HXAA 4WZZA 5JD5A 4GWLA 3KKOA 3MZ0A 3O4JA 2A33A 3JQGB 1IUOA 2LTAA 1T8UA 3M49A 1R9NA 2C5FA 1L7DA 2HV8A 3GEMA 3E4DA 3RLIA 5HKOA 2Z6AA 4WOCA 4OF4A 2CN1A 3OTWA 4KQ9A 5FQNA 4NICA 3CVJA 1CRPA 1RI3A 3DOUA 4B82A 4PICA 4ALIA 2XSZA 5AVWA 4LKOA 1CQPA 5KBYA 1UXGA 1DZ3A 4GM0A 1FJHA 2HSWA 4Q4LA 3RSCA 1EFDN 5AJTA 5KI6A 5J63A 3VO1A 3MWFA 1LDBA 2BR4A 3X2SA 3TQRA 2XT9A 3ETEA 3WOHA 4IXTA 1EI9A 1JFLA 1R37A 2GRAA 3O3MB 3QVTA 3QW4B 1X7WB 4HDSA 3AT1A 2IEGA 4NFHA 4RVGA 2BRUA 5KYYB 2QX7A 3F3SA 1G19A 3B9BA 2F3TA 5L8VA 4PPGA 1O95C 3UMJA 3JYPA 1M76A 4U5XA 3LNTA 3AZOA 2EDAA 2GK4A 3BXHA 1PG0A 2JARA 2VP3A 4GKAA 3QUBA 3OETA 5JU6A 3NGLA 4QUEA 3TLGA 3BGWA 3W5HA 2A0WA 2JG3A 5G1OA 3PEUA 3LT4A 3ENNA 3PFCA 3WL5A 2OV3A 1UDXA 1BE6A 4UU0A 2W71A 3H2IA 1N5IA 3T7EA 1PLKA 1XZ8A 1PGOA 3VPDA 2D13A 3PNSA 3FDIA 1CHNA 4HDRA 4HK4A 2ZB3A 3D3QA 1UJ5A 1IWPB 4G24A 1OC2A 2XOKD 4KMOA 2ZRAA 4UHDA 3WQRA 3VO9A 4F3YA 1HNWB 3SEFA 1TB4A 2VJPA 2Y27A 4TWAA 4PINA 4GOLD 2ASVA 5IDQA 3D6FA 1ZIXA 4EUEA 3ON5A 3C39A 4EJ6A 3KO8A 2R6JA 1ZRNA 1M34B 3OX2A 3BF7A 3NXSA 2BGIA 4D41A 2ZIWB 3MINA 4X1KB 1NBHA 5DBGA 2O59A 3QYFA 4ZT4A 1X8KA 3KC2A 2RK6A 1LXCA 4UJ3A 4XVQA 2WM9B 5FP0A 3MAGA 4QL3A 5LUBA 1SXJC 5HP4A 4PLPA 1QS0B 4KIGA 3VPBA 4KXVA 1TO6A 3NHWA 1RYFA 2QT1A 1R66A 4C4AA 5E2BA 1RPAA 5IT5A 1A9XB 1U8UA 3UUEA 4KSBA 1KEZA 2YMQA 3AVOA 5JMTA 1DT5A 3VPHA 3YASA 2XCRB 3ABRB 4G6ZA 1WXFA 1VL2A 3MMPA 2W2OA 4M46A 4NU5A 4Q9AA 1ZCJA 4X71A 4EG6A 1G20A 4F2PA 2PAAA 4P08A 1J42A 1TD1A 4JQSA 3RROA 2DWOA 4PAQA 4DR4B 3DO5A 4NF2A 4EELA 1N1GA 3AI7A 4ZHQB 2C3OA 2PQMA 4ER3A 5FA5A 5IF9A 2ZTHA 5KWEA 2EV9A 1JR2A 4MUXA 2NVBA 3A1EA 3NH6A 1T1EA 2GVDC 3D59A 1RCFA 2E6UX 4IS2A 3HG7A 3KHTA 1OKKD 4NE2A 1Q1QA 3IKLA 4B6SA 3HKBB 1A04A 2QQ0A 4L4XA 3D81A 1GGMA 3G2PA 5JZVA 2WEKA 4KFRA 4JOQA 4NWIA 1HYGA 3CH7A 5FF9A 2XGOA 3C4JA 1J8DA 4CPDA 5KYUB 2CXSA 2HBQA 4KLAA 1FSZA 3TINA 2ANCA 4RA9A 1IY2A 2XQGA 5LZ9A 1C4XA 2FWMX 4L5AA 1O08A 5CXUA 4P82A 4KXUA 4Y6OA 4LSGA 1EK1A 5BRNA 3KB8A 1U2GC 1M2VA 1W8IA 3KVOA 3FYDA 4LZJA 3HJUA 4RDCA 4BMNA 2JAHA 2QN8A 1YA6A 3FPSA 3NVMB 3HN7A 2ADMA 5JAQA 3ZJYA 2H65A 1YRWA 4B2LA 4D7AA 5KSWB 1Z45A 2C82A 3E1GA 3KKPA 4GFDA 1KAOA 1GL7A 1T2VA 1LF5A 1HT1E 3TGWA 5JXWA 3QXXA 1KMMA 3ZY2A 1KYYA 4OGLA 1H8EA 4X45A 3T3PB 4X90A 1XI2A 1NONA 3Q7RA 3OF3A 3HKDA 4G9GA 2A58A 3HYNA 1YKSA 1Y37A 4M9UA 1GZVA 2DEUA 4Z7JA 2Q4DA 1CEYA 2EP8A 3IJEB 3JD3A 3UYLA 3T9AA 4UUOA 2DCMA 2ZBGA 3BD9A 3D7RA 3SE0A 4NYJQ 3TLGB 2B1IA 3JWGA 3KM0A 4EG1A 3PNVA 2Z2KA 5HYVA 4KNVA 3FJ1A 5C81A 1R0CA 2XB6A 3GN2A 4OIMA 5CM2Z 2F3SA 3I9OA 3ZJTA 1DQNA 3VKFA 1KXJA 3N53A 2CXTA 4ZDJA 4LISA 4Z3DA 1MIHA 2FPGA 1I7LA 2X4LA 2XPCA 1YVEI 2Q3MA 2VPXA 4QOHA 3TNFA 4B34A 2V3CC 5IJ9A 4HWKA 5CM8B 2P69A 2DLCX 3ZHQA 1UQRA 2Q2VA 4JLMA 2Z0MA 3D3NA 4B32A 2YS7A 4L57A 2CLDX 2JAUA 4NV3A 3A9CA 4AUEA 3RBVA 2X3FA 5EQFA 3SHOA 3ZDQA 3O4GA 3PYMA 1IRIA 1O8CA 2FPIA 2UZ3A 4K03A 3FSEA 4NH0A 4FHZA 5HMLA 3LJKA 2NUAB 4K8OA 2I2WA 2IIPA 3ZCQA 3OH8A 2XE6A 2C9DA 2ZYUX 3OQPA 2LNDA 4HYYA 2B94A 1CZNA 2XOEA 3W78A 1LVGA 3BK1A 5AI5A 3U9TA 4CYMA 2CKDA 1OWNA 3BDVA 3F1KA 1XRMA 1CIJA 2CYBA 3QBDA 2JPDA 4WY8A 1FMTA 2DHDA 3WTBA 3I2YX 3CIOA 3PXUA 3BMXA 4R0NA 2PMDA 4XQ9A 1ZGHA 3QVMA 2EP7A 1XRJA 2L18A 4RKFA 5K45A 4PNPA 4C4RA 4FGZA 2I33A 1Y3CE 5D51S 2C4TA 2XB4A 2E1RA 2XNKA 2GFIA 2ZUWA 4G36A 4UU1A 2HJ9A 5H80A 3PNOA 4LTNA 4YMVA 1HMPA 1FSFA 1PEKE 4E13A 1UBUS 3LE8A 4CL0A 4DLKA 5IVPA 2B36A 2J9ZB 1UKVY 5EZYB 5CVDA 5G0WA 3FNBA 4EKEA 3R75A 1FF9A 1FFSA 2VS1A 5JSKA 4F56A 3ZD7A 3QXHA 1RJFA 3OIDA 3ICQB 1YAJA 1NE7A 4NABA 1JKIA 4MYHA 2HU5A 3W8EA 4BEJA 3JPWA 2PGIA 2H31A 3G79A 4LJ6A 4KREA 3L46A 1GXSA 3REFA 4ONEA 3ZLUA 1PDWA 3T3MB 4LRQA 5ALJA 5DNDA 4F3KA 2NNWB 1OFIA 2WSSD 4ZARA 3LIIA 2O0KA 1BW9A 3WLTA 2BGJA 3Q6IA 5KX5F 2WJJA 3BTOA 2FMTA 4IF4A 2V0GA 3INRA 5BQPA 4GDFA 1AHNA 1OBOA 1C5KA 4U7HA 3RS2A 4MRMA 4IFTA 4QXAA 4AAYA 5IU6A 3TMKA 4Q9DA 1FE8A 3N0XA 3QGMA 5AHWA 4ZU3A 2C2MA 3X43A 1ANKA 3A26A 1JGTA 5FYQA 4RZ3A 3T35A 4YCAA 3TNYA 4CUZA 1RLUA 3HUUA 4AKGA 1TVEA 3P9XA 1ADCA 3J81k 2P5UA 2CLHB 4N47A 3BRQA 3E9EA 1XA4A 2Z2YA 3VH1A 1G3MA 3MW8A 1KVQA 4LRYA 3MOIA 3O47A 4UFPA 1P0QA 5FTWA 2FZEA 1YI0A 2BMJA 2XD4A 2W0SA 3P97A 2WNSA 2C2ZA 1K98A 2XRMA 5HBRA 1XG5A 2PT5A 2R86A 4WGFA 2ZYHA 3NTUA 4KUGA 5AXAA 1N6NA 3ILVA 3ORQA 5E7MA 4EFDA 3RK4A 1X1BA 1LA2A 4IJKA 5BMVA 2OESA 5LQDA 1VG8A 1XN1A 2XR1A 4CIXA 5A4AA 1FQJA 3L49A 5TDHA 2ZWVA 1J8QA 1VE7A 3EAQA 4X0EA 4LF6B 1QJ4A 1FMCA 2G83A 5LL6P 2CNLA 5TIIA 1V45E 1IJBA 2GPTA 4H0FA 4LNHA 5F2EA 1GGFA 5CYPA 4AZ0A 5I45A 1OH7A 2AN9A 4FWBA 3IA2A 1MAWA 2JIRA 3F8SA 3INYA 4HFJA 2NYAA 2V6GA 3OQHA 3VVBA 4UZSA 3WK7A 1RJ9B 2GK7A 1LC3A 2J0UA 3RW9A 1KQOA 3Q98A 4X94A 4WKBA 3UXHA 4P34A 2FG6C 2HFKA 4L85A 1WUJS 2B9EA 4TQUS 4QTYA 4EPXA 5IJ9B 1X7XA 2I4MA 3H75A 4Q3CA 5JS7A 3WGKA 1VPVA 4HNUA 3D3JA 3EMKA 3KTOA 3DF7A 5KDOA 1Q0TA 2DAPA 1WWKA 4H60A 4XD7D 3NP7A 4AW9A 2OZEA 4Q03A 1N0UA 4JBXA 1TFRA 5SYNA 1RRVA 5K3FA 3O3NB 4I2NA 5C2JB 3OCUA 2FPIB 4RD1A 3MYRA 4ZCRA 5LXTA 4NARA 3SQXA 1HI9A 4KQEA 3R8CA 4GPZA 4QXQA 3HLTA 2F9MA 5CH8A 4FW8A 5LB2A 4KR7A 4UMDA 4LF4B 1CIVA 5KJFA 4OM7A 2WG1A 2YN0A 1UC5B 1Z7EA 3A32A 1OYYA 1C3JA 4TT3D 4NBWA 4MS1A 1F0YA 4CEIA 1RZRA 4RLQA 5AH0A 4URVR 2E37A 3Q7SA 2O48X 4G0NA 4R1PA 1I33A 4X6LA 5B4TA 4ZT6A 1V5EA 4S3MA 5EMNA 1PS0A 2FQQA 3N2NA 4LOIA 1W7AA 2YUIA 1X14A 4QTZA 4GAEA 4D8YA 4ESEA 1K6IA 2LCFA 4IINA 3UWKA 4AJOA 4LRXA 4JV5B 4JFRA 4J91A 5CVJA 5E7QA 4X97A 3LUKA 4A8JB 5IK2A 1EGMB 4ID9A 5ECYA 2IHZA 2EKZA 4MPRA 4WLVA 1ONSA 1FTQA 3ZCVA 4RJIA 1N77A 1EFUA 3JQAB 4B3BA 4EO9A 1NRWA 4OI1A 4R31A 3CTMA 2C03A 1GXSB 1DDOA 2YVAA 4HVCA 4LJKA 1FIUA 1ODKA 2HLHA 2R8XA 2WV9A 5AOVA 5LU8A 3LHFA 3K9FC 3GQVA 3EUEA 5ARCA 1Z4OA 4HRYA 3B78A 4ZOLA 4F0JA 3RWBA 1L7RA 3FCUB 4IWXA 2DC1A 5CT4A 4KE8A 4A2QA 3UWPA 4GKVA 4MRMB 5T57A 4FB4A 3K0BA 3A0UA 2F3UA 6ADHA 3LAWA 3EGXA 2GH1A 4RV5A 2VHWA 5JARA 2R6DA 3DXXA 5F12A 5D7BA 2QV7A 3L1JA 2OY0A 3QNUA 2JRLA 4GYYA 4BUCA 1RZ3A 3HA3A 4DJTA 4RHEA 1KDPA 1MTZA 3H5RA 4YN3A 4O2BF 4BV2A 1RPNA 5JXHA 1H22A 3T52A 2B37A 2HMWA 3ZWWA 4CV3A 3KQTA 1F8YA 1BYUA 1HQDA 4JA0A 4LS3A 2JDID 1OI4A 2Q4RA 2VYFA 3O2NA 4R6XA 2EKLA 4J0GA 3LO5A 4X7RA 5KMGB 1XRLA 3V4FA 2LCIA 2YXPX 2PUJA 4JL5A 2IBTA 1UKBA 5JRJA 3CVWA 2D2XA 2EC5A 3SKYA 3L7CA 4YBZA 1DELA 3TZQA 1T8WA 4CIWA 3CZRA 1S8NA 1P9RA 4FFLA 4PSCA 2C2HA 2OAGA 2DFNA 2YTZA 1E4OA 1WZCA 1IK6A 1PWHA 1T6NA 1TEXA 3A4LA 2HNKA 2NXCA 4KKVA 4BWVA 5LLDA 2AJDA 3CVXA 2CBZA 1N2OA 3DMDA 3AVPA 4QWWA 2QV0A 3STUA 1J0CA 2WHYA 2WZCA 3QV2A 2GNAA 3E48A 4MWBA 1X7XB 3FFWA 4E22A 3NW9A 1R6UA 1G5IA 2ZCUA 3RWOA 2FZLA 4QJ3A 1RWNA 1CW2B 1RE0A 1I4OA 2AJ8A 4JDUA 1RQ7A 1WVIA 4RFSB 5FPKA 4YRDA 4FDMA 4WLEA 4P2BA 4P4GA 2DBRA 1DC6A 3RAGA 4IJWA 2FRDA 1EK5A 5FLEX 1HSZA 5K3FB 3AHCA 4BWFB 1JJIA 1EDZA 2I7VA 1UT8A 3EDCA 621PA 1N8KA 2J7PD 3V1UA 2I22A 2QTFA 1VIAA 3DJYA 3AEXA 2GSDA 2FFHA 3LQFA 2NP7A 2IF0A 2G5TA 1P6UA 2RAVA 4J1QA 4HGNA 3CHYA 1S5PA 1EESA 1CNFA 2FWBA 3F71A 3PC2A 2VDKB 3I9V6 7REQA 4M1QA 1T4GA 3BIXA 4NESA 2FJ0A 2X76A 2C2OA 4F1KA 3QFTA 3TLYA 4YRIA 1Y9ZA 4CEIB 1WVMA 2FAXA 1THMA 4QBGB 3SMQA 2C20A 3CGWA 5D00A 3OFKA 1DEAA 2FF7A 3T1NA 4ZC8A 4C5AA 3GR6A 2YYAA 1ZSVA 4DMMA 2C4NA 3T5MA 2IIBA 1AQIA 3EDRA 3QUAA 2XNSA 2R8BA 4RL4A 2QTGA 1ST2A 4DYDA 1VYTA 1PD0A 2AW3A 5CFQA 1UJ6A 3GUYA 1O94D 2GAIA 3P0RA 1YMUA 2BBWA 2Y1WA 3ITEA 1I5OA 1Q21A 5DDIP 1OB5A 4KNYA 4L3WA 5JXJA 2IUUA 2QL6A 5K0CA 5KYXB 2F62A 4FGKA 1P0PA 1KEEA 1LS6A 4BXOA 3CWQA 4EJSC 4UOEA 3PXDA 4MPDA 3WDKA 3B1XA 1JR3A 1HOTA 4NSNA 4ZOLB 1CTQA 1SVWA 4QPNA 4IVPA 3G9TA 3NBKA 1CUZA 1EP3B 3JU3A 3K31A 4D4KA 4F5DA 3AIOA 3R1IA 3EPJA 3G82C 1GRVA 4OHRA 5CLJA 4GMFA 3UM9A 3ANLA 2B1GA 3VR4H 2P6NA 5JANA 1FVHA 3GNQA 3T9CA 4Z4FA 3C15C 3UWDA 1E3WB 2GO7A 1O6GA 5CW2A 3X1YA 4JKIA 4WOKA 3UKDA 4EFLA 4TMVA 4HY3A 5E4FA 2D5AA 2NXJA 4PONA 5JPIA 3AY7A 2IYZA 3QXJA 1DLJA 5FI3A 4YAWA 1H6DA 4YJ3A 4BZPA 2I7TA 3A4NA 4HDKB 4N8EA 2FRVA 4O4LF 1DMRA 1LTHR 2AUTA 4JK3A 1RYNA 3GJ8A 2Q4OA 3IIIA 3TUJC 5EUMA 5GZ6A 1QVRA 1S6YA 1G8KA 1LPBB 4KODA 4G0WA 2IEYA 3DW1X 3KJQA 1HPLA 1DC7A 1Y5RA 4KDRA 5ALXA 3V8RA 4D9NA 1MC5A 3G1TA 3IP1A 5CVUA 5DHQA 4Z9FA 3RS3A 2TYSB 2J31A 3IAS1 4FHEA 1ADGA 5DFAA 4DKXA 4H6XA 2PBLA 5K09A 4W5RA 4JL6A 1THTA 1CVLA 2I2XB 2YFHA 4TYWA 4KJXA 1AC5A 1KI7A 2BM8A 3WK6A 2ZJAA 2FKAA 2IUFA 2WJHA 3T7CA 2IZ1A 4UCFA 4X1IB 1RLJA 1U90A 3F6BX 3KWLA 2DHRA 1EK2A 3WAJA 3G17A 3LGSA 2O3JA 4G0QA 2ESRA 1W581 2PQ2A 4Q93A 5LMUB 1W48A 4JCOA 1M8PA 3EGCA 3H9QA 2GAJA 5A2QA 4R2HA 1DO0A 2IU3A 2ZYSA 3BJRA 2GLTA 3LCJA 2DFLA 4W8OA 1E89A 4PBSA 2WZDA 5JSZB 2I3DA 1E3SA 1S8AA 4KNWA 4M7RA 3UJ7A 5DN6D 1GA4A 4PO8A 5IVDA 1Z62A 2PNFA 5AO9A 4TVOA 4RTPA 2H7YA 4WT7A 4EA7A 2PX3A 1LU9A 2E3JA 2VAVA 4Q3KA 2SBTA 5IAJA 5EQDA 1AS2A 2C5HA 3AYZB 5AIAA 2XZLA 1XRQA 2VHVA 2ZVPX 3OJEA 4DMLA 4N4AA 5DOZA 3UMCA 2VAXA 1QRAA 1G6Q1 1RHQA 4IDGA 4MA5A 2ANBA 2P4QA 2AK3A 1XEAA 2QMUA 5CLFA 3E23A 1N92A 4M36A 2AH5A 3GRKA 4CGZA 4YCSA 1AM4D 1N2BA 1SULA 1XVTA 3OLVA 4M7OA 3B8EA 1E0DA 1WUYA 1F60A 1X1AA 3FWKA 5ALHA 1Y8ZA 4NATA 1V2GA 3KJGA 3O8RA 4HRXA 4MAAA 2O6LA 2FTKE 4B75A 1QQ7A 5I8WA 2AHRA 1L0BA 1UKEA 2WFLA 4Y2TA 1JSCA 2IUEA 2QZJA 2X8AA 1U3GA 3QUSA 4E3WA 5FL3A 3E22B 1II0A 3R0VA 3B13B 3QH4A 4ENRA 1RPZA 3NTQA 2GZ2A 4HWRA 3MJRA 4XB1A 2XX3A 1Z0JA 3ZZ0A 3JYOA 4LMBA 3K9CA 1SXJA 3P9IA 4XGRA 1QHXA 3L7DA 3MPOA 1JG2A 5BSKA 2Y1EA 1K08A 4RSRA 4QNNA 3Q7PA 1KEEB 4M0CA 3AFIA 4CLXA 2XE8A 2ZDQA 4ZMSA 2CHVA 3KCQA 1PBTA 3OO0A 4MO9A 1JDVA 1E64A 3ZS8A 1VCIA 1KQFA 1LK0A 1B8NA 3SHWA 3KQUA 1XDWA 1F8UA 1ZXBA 3KXKA 1USVA 4I3GA 3PA6A 3NKFA 1XTPA 3HVKA 4Y2UA 1L7NA 2EBWA 1T8RA 3BMOB 4KQ6A 4HTFB 4RHTA 3QTTA 3NBQA 1Z5UA 3P26A 5FI0B 6ABPA 2ZUEA 3SP1A 2H54A 1QC5A 2K2WA 1AUPA 2YDYA 2Z3ZA 4H1UA 4DJEC 5TMEA 4A3SA 2QLJA 3P52A 1MAUA 1VE1A 2A9OA 4LTDA 4FGSA 4YJGA 5ICEA 4C2TA 3NEAA 4I19A 4QYIA 3G23A 4Z0PA 1RJWA 2P8JA 3UGQA 5HQ3B 4LHEA 4RFVA 1PZFA 4JLSA 1IN6A 3ENKA 1X7HA 1LSUA 1DC5A 2I03A 1G1MA 2E4WA 3ENQA 2NXEA 4YRZA 3I3OA 2P0EA 1QRTA 4YALA 4KPYA 1V9SA 4X20A 1K3TA 2QYSA 2XQJA 1D2HA 1U2GA 2V5VA 2QN2A 3HY6A 2HO5A 5D87A 1A8HA 1XTSA 4KLZA 1J2JA 1GTG1 2CF5A 5CJ2A 2CL5A 1XZHA 4Q48A 4Q02A 1VKOA 1MH1A 5AJYA 2DWPA 5AM2A 4MUKA 4RBNA 2GEKA 2R47A 1XDUA 6AT1A 3IUNA 4Q19A 3FZNA 3EGVA 2WILA 3FA2A 3MBKA 1I6LA 4JLJA 1V4NA 3C6XA 2YR0A 3GH3A 4ROSA 2VYND 3AILA 3TH5A 2VPTA 1JDJA 4XJVA 2DJ5A 1IBRA 1HEIA 5CBPB 2ALJA 3BXOA 3HXQA 2WU1A 3H6GA 1NVGA 2BFDA 2XLBA 2YZ7A 4G0ZA 2PG3A 4GOJA 4KN5A 1M0SA 4X8OA 1A5AB 4W7SA 3WKEA 2ZJ8A 3UK7A 1V3UA 5KCMA 4KQMA 3AP2A 3CRZA 1YCGA 2J67A 3LZ6A 2C0QA 3DLCA 4PSVA 2AG0A 4MKXA 2DB3A 3MTGA 4OOEA 2B30A 3Q8KA 4JKOA 2JD0A 3EY9A 1ZZGA 4ZAYA 7AT1A 1WEKA 5ADWA 1KQGA 3TD2A 1EFHA 1CFZA 4HEJA 4OHXA 5HF6A 4N8DA 1XZPA 4J2HA 1GDTA 1UCFA 3N8DA 4QPCA 3R4CA 3PQ4A 5JSFA 4N5MA 2QUIA 1GUYA 3SGLA 4WKOA 1POWA 3G2OA 1UT5A 3F5FA 3W6NA 4YFVA 1CERA 1IY1A 4FMCF 2BZSA 4FNOA 1E5LA 3WLEA 4ZQBA 1Q77A 4MH0R 3NHFA 3ELDA 3ZU3A 3NGXA 3RNOA 1Z0ZA 4KVAA 4C0JA 2BSXA 1V96A 1LPNA 5CB4A 1SXJB 2GJ4A 2P79A 2ODTX 2QRVA 3NG1A 1C41A 1YZHA 3GFBA 2FQ1A 4CN8A 2H59A 4IGKA 4R83A 2Q3FA 3VPXA 4MARA 2CCKA 2D1QA 5B2ZA 4DANA