3DOJA

Structure of glyoxylate reductase 1 from arabidopsis (atglyr1)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
292
structure length
292
Chain Sequence
GSHMMEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEVIKKCKYTIAMLSDPCAALSVVFDKGGVLEQICEGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPVSGSKKPAEDGQLIILAAGDKALFEESIPAFDVLGKRSFYLGQVGNGAKMKLIVNMIMGSMMNAFSEGLVLADKSGLSSDTLLDILDLGAMTNPMFKGKGPSMNKSSYPPAFPLKHQQKDMRLALALGDENAVSMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cytosolic NADPH-dependent Glyoxylate Reductase from Arabidopsis: Crystal Structure and Kinetic Characterization of Active Site Mutants
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords Dehydrogenase-like protein
total genus 119
structure length 292
sequence length 292
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3dojA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dojA01
2J5KA 1WLYA 1GTMA 3LVFO 5GZ1A 4J4HA 5I8WA 1RYEA 1LBEA 1YB1A 1NX6A 3BAZA 3WXBA 4DPMA 1DO8A 2OZPA 1EQUA 2UAGA 4B3IA 4E13A 1JVBA 4JJGA 5A4DA 3EUWA 2BF7A 5L4LA 4XD2A 3ENKA 3JQEA 3FBGA 4TKMA 1P1JA 4BKQA 1NHWA 1WNTA 1T2EA 4CMEA 3GDGA 5BNTA 1DIHA 1SB9A 4BNVA 3NJ8A 3D4NA 3OHSX 1YO6A 3LT0A 4E6PA 2AMFA 3CTVA 1PR9A 3JQGB 1PU2A 2SCUA 3ICPA 1TT5A 4FGSA 4XQ9A 3JYOA 4B3JA 3DMTC 1NASA 3K6JA 4UVGA 4CV0A 2Q2VA 3DTYA 2PD4A 4ESOA 4S3MA 2WD8A 2Y1OA 5I9MA 1MXFA 3DXFA 3JQBA 3IKVA 1DXYA 1NBOA 5JNLA 2DTEA 1HDGO 4PG7A 4BB6A 1YONA 3ZWCA 2BGMA 2NADA 5A9TA 1KEPA 3Q6IA 4QO8A 3INGA 3U62A 3DOCA 1F17A 4WJZA 3QA9A 5AXCA 4LMPA 1GZ3A 4CUZA 5CDGA 5JE8A 2B69A 5BSHA 3BMCA 4KDFA 5L95A 2D5CA 2NU8A 4E2ZA 3C1TA 1Q7GA 2GASA 3CTMA 3V1UA 1IL0A 2YHIB 5KVCA 1OC2A 3TWOA 3UH1A 4DIFA 1HEUA 5TQVA 3HDYA 3JQBC 1NQTA 3D3WB 3WICA 4AJNA 5CEFA 3CE6A 4CMJA 3IJRA 5DT9A 3GHHA 1CRWG 1K6JA 4DYDA 3U49A 3GA0A 5U4QA 1FDSA 4BO2A 1LJ8A 2BFPA 3I5MA 5ICSA 1GADO 2B83A 2FSSA 1A27A 4FOOA 5FFFA 2X5JO 1E3JA 3RU7A 2OBNA 2GUGA 1WWKA 1Q0HA 1MC4A 2EGGA 2WD7B 2XF8A 4HUJA 3P2OA 3UN1A 5I7SA 2XAAA 4DLAA 4YB8A 5JW6A 3E9MA 1KEUA 2HSDA 3F1LA 5JSFA 1EUZA 1IOLA 2FZWA 3L6EA 3KEOA 3NTRA 1HDCA 3W6ZA 4E5NA 4YAKA 1C1XB 3OA0A 3VTFA 4L4XA 1PR3A 4Y98A 3GRKA 1K0UA 3PHJA 1H9BA 3PHHA 4DBVO 2GF2A 4QO7A 3V1YA 1SOWA 1FK8A 1HE3A 3OQ1A 1Y6JA 2X22A 4FC7A 4JGBA 4IDCA 1Z6ZA 1PSDA 1VI2A 3NAQA 1J0XO 2OMEA 4IJVA 5KJCA 4KTVE 5CG2A 1DPGA 4WLEA 4XYLA 4PLYA 5COAA 5FF9A 1VLLA 4K9DA 2C7VA 1X7GA 2B37A 1V0JA 1XLTA 5F5NA 4CM9A 2WWRA 3I9NA 2DT5A 1PS8A 4LRTB 3WIDA 2DFVA 3OJLA 4YPOA 2PH3A 4NFSA 2WYVA 1E0DA 3ITKA 3G3EA 3K2EA 3IP3A 2FPIA 3R6DA 5F1KA 3ROMA 4XB2A 2FHSA 2DTDA 2F1KA 1U4OA 2NVBA 4FFLA 4EYEA 3QVTA 4GVXA 4A5OA 1F12A 4I5GA 2HMSA 4AJEA 1KC1A 4DPLA 1TI7A 3AM5A 1X14A 4RVSA 3OEWA 2VUSA 4BO0A 4ROSA 4YAIA 3ZHZA 1ISIA 3MJSA 3X2EA 2PD6A 4MDHA 1B26A 2P9CA 3DEYX 2A94A 1YOVA 3GMSA 4HKTA 1SZJG 4JIGA 2QRKA 3RJ5A 3ZWAA 4MVJE 1NQ5A 4JBHA 1R4MA 1ENYA 1QKIA 5T64A 4IDFA 1DLJA 1C1DA 3QVXA 4URFA 1Y9EA 3OIDA 3SC6A 3ROQA 3O38A 5HRUA 1D8AA 4NI5A 4XJSA 2GNAA 5JDCC 1MFZA 2CF5A 4BB5A 2Q1SA 3GN2A 4BNTA 4GPD1 4B7UA 1NP3A 1X1TA 5F21A 3LU1A 1P44A 1CQIA 4D46A 3GNTA 4QQRA 4ZQGA 1QR6A 2DUWA 4DUPA 2OP0A 1ISMA 4DIBA 2ZTLA 3LSYA 4XCVA 3TPCA 1DFGA 2QW8A 3QW2A 5ITWA 1DEHA 3BTOA 5AXBA 4WLOA 4J16A 5L7YA 2JKVA 4PRKA 1IZ9A 3GMDA 4P22A 4NIMA 1PJSA 4AJJA 5JYEA 2B4QA 3TSCA 1XDWA 3AOEC 1ADFA 5KTKA 5KVSA 3I6QA 1LLDA 4WOJA 4PZCA 5ITVA 3FD8A 2DBQA 1NAIA 4IUYA 3QVSA 3IMFA 1HDRA 3L4SO 5JYDA 4MO2A 2EXXA 4CV2A 1PQWA 3GPIA 3MTGA 4LCJA 5EMHA 3NDJA 3RUFA 3FR7A 5FYDA 2PKQP 2PNFA 4R16A 2LDBA 3A4VA 4MP8A 3IJPA 3PI7A 3ZNOA 2RH4A 1R6DA 4MIOA 3RBVA 4IIUA 2YV3A 3F9IA 1VJ1A 2F00A 2I3AA 4DREA 4CM4A 2B5VA 3DTTA 3E1KA 2D5AA 3ENNA 2DBZA 2Y1DA 3RC1A 1WDLA 1O95A 1PJBA 1RPNA 4DQUA 3PFWO 1MXHA 4JP2A 1BDMA 2ZQZA 4YJGA 4RCVA 4BQPA 4TROA 1U8FO 4GLOA 3OJOA 3FR8A 3LT1A 2YYYA 2W2KA 3EDMA 3CMMA 1K89A 4EDFA 3EAGA 1Z7EA 3TFQA 1ZJZA 3WDSA 3M6IA 2D2IA 4ND4A 1TXGA 1HE5A 3KZVA 4MVJP 1I36A 2OFPA 4E2XA 4S1VA 2VWQA 3I3OA 3ADPA 3ZV4A 2DFDA 1UAYA 2JFHA 4HBGA 3ORFA 4BNWA 1M76A 3GFGA 1YB5A 2BGKA 3JQ9C 5EJ2A 4Z6KA 2YW9A 3KSUA 1A72A 3PQDA 4D0RA 4J0FA 4JBGA 2GN6A 1ZFNA 4GGOA 4LGVA 4RLHA 4AJIA 2JD1A 2HRBA 3DHYA 4E2YA 1PWXA 2ZQYA 2Q2QA 4I8XA 1EVJA 4I5EA 2GD1O 1MUUA 5I7VA 1ENPA 1XA0A 3WFJA 1CIVA 3TJRA 3GT0A 2CD9A 3Q2IA 4Z0TA 3DZFA 1E6EA 4DC1A 2C2YA 1YQGA 3PQFA 1W8DA 2ILTA 2ZK7A 4OOFA 3WGHA 5I7FA 1PJ3A 4E4YA 4FCCA 1GQ2A 2FWMX 3IQDB 1PZHA 3BMQA 5JDIC 3JQFA 3VVCA 5B4TA 4IJKA 1O0SA 2VHYA 3EVNA 3MEQA 3OFSA 4YJHB 1ISFA 3R1IA 1E5QA 4DC0A 1I3KA 4JQCA 3LF1A 5IDXA 4FFOA 4ZICA 4RZHA 4K26A 5CPFA 1JAXA 1ENOA 2HK9A 1N8KA 3WTCA 5CDYA 3ROKA 4BNKA 4NJMB 3OEYA 2P68A 3QSGA 3B1JA 3B70A 4BO9A 5EQDA 1O5IA 1EFKA 4KWHA 4J90A 2Q3EA 3NYWA 2R00A 4Q3BA 3E03A 1E3LA 4CV1A 4GL4A 1EFLA 1T4BA 2X0RA 4XQCA 3MOIA 3DBLB 4WLFA 5COBA 5TSDA 4PLZA 3F4BA 3GVHA 4LSMA 3RUHA 1KEVA 3WFIA 2EKQA 2O2YA 4CMIA 3WGQA 1GYRA 3LLSA 1GCOA 4B3HA 4OQYA 3L9WA 4B7CA 1BHSA 1XQ6A 3K5PA 3H5RA 1Z73A 2JAHA 3H3JA 2GERA 3PYLA 3DDNA 4R1SA 3LLVA 2VRCD 3GVCA 1NHGA 2QZ9A 4PGFA 4XYMA 3Q11A 1JW9B 1E7WA 5DP1A 1YQDA 4CL8A 1L7EA 3DOJA 5GZ3A 3HADA 5THQA 4UVDA 3F6YA 1BXGA 1O94A 2CY0A 3ANMA 2FP4A 2FPGA 1ISHA 3TZKA 4DLBA 4CQMA 3EY4A 2HMUA 5ER9A 3WS7A 3HDHA 2I9PA 3TOZA 2O2SA 4CLOA 3A06A 4EUHA 1EUCA 1PGPA 4XQEA 2RAFA 5U1PA 1F14A 1H6DA 4U7WA 3WTBA 2IXAA 3UHAA 1UXGA 2EERA 1JKIA 3LDHA 1YL7A 4N18A 3GQVA 3WLFA 4R4JA 3FTNA 3SJ7A 4D0SA 4YVFA 4ND2A 4PRLA 1I33A 2WTBA 4RPKA 2J6IA 3UKOA 2AE2A 1F0YA 1WDMA 4FC6A 1YKFA 1ZUD1 5EESA 3GK3A 2RBEA 5G2OA 3CSDA 4WK6A 4F3YA 3EYWA 4KUEA 2G5CA 4KOAA 1QP8A 2VUUA 1C0PA 3ULKA 3LK7A 5EL0A 1LSSA 1C1XA 3KYDA 3EGOA 1A71A 3H7AA 3KM0A 5CAEA 2JCYA 3WR5A 4LISA 4R01A 2I3GA 3ASVA 4E21A 2G17A 3O9ZA 4MIYA 2A4KA 4CMCA 4YXFA 3L0DA 2NTJA 3ON5A 4JK3A 4R68A 5DF1A 4CQMD 5AYVA 3D3EA 2BFOA 4F46A 5JXWA 4G5HA 1GV0A 1KVSA 1WMBA 5GY7A 1LDGA 2GLXA 4XYBA 3T4EA 1QYCA 2QIOA 1I5RA 4LN1A 1LSUA 1IHXA 2EHDA 1O8CA 2X4GA 3KO8A 1DHRA 5JAQA 3Q3CA 1C0IA 4E30A 1E77A 1NM5A 4I5DA 1R0LA 1SEPA 2C54A 2Y66A 4MIEA 4ZHSA 4PLGA 3AY3A 1LU9A 1YDWA 1VJ0A 5L4NA 4CUJA 2X0JA 3AI2A 4PG6A 1NFFA 4RDIA 3CMCO 4LK3A 3WQQA 2VNAA 2VRBA 2OHXA 4NG5A 4YQZA 4PZEA 1DRWA 3O4RA 4R41A 4WOKA 3ZHXA 5JC1A 4Q39A 5IDWA 4TRJA 3DOOA 5AVOA 5GZ6A 4DBZA 4KUHA 4DYVA 5ER6A 2DQ4A 1KERA 1V35A 3QWBA 4QUKA 4YJFA 3JYLA 2I6TA 1ZBQA 3MOGA 1ISGA 5FWNA 3AY7A 5A1TA 3WGYA 2BMAA 3JD3A 3IL2A 2NUAA 5T57A 3FBTA 5TJHA 1E1KA 4JXKA 3GUCA 4OQZA 3RD5A 4PG4A 4G81A 2ZB7A 4EEZA 2GCGA 4BHTA 2VZ9A 2HQ1A 5HS6A 1T2CA 1LSOA 1DC6A 3E5MA 4NJMA 5KVQA 4WLVA 3GGGA 1VE9A 3G1TA 3AU8A 4J2OA 3E5RA 2WMDA 5KIAA 3CH6A 2CNBA 2UV8A 5LC1A 3RKUA 3W6UA 1HETA 4CM9D 3CPSA 2P4QA 1B3BA 3JQ8A 3NEPX 1RM4A 4IDEA 3I83A 4RVHA 2WYWA 4IDBA 1XQ1A 2ZCUA 3BXXA 4NU6A 1KY4A 3F46A 2WSBA 4BO7A 2B5WA 4YAGA 1E5LA 2IEBA 4WCDA 4J2HA 1ENZA 3D5QA 1SNYA 3WSWA 4NJOA 5HS4A 2H63A 4MP6A 1Y7TA 5TIIA 3JQAA 4JJFA 1GL3A 2DVMA 1RYDA 3C24A 2I99A 9LDBA 2EV9A 1M67A 3V1TC 2GN4A 1XEAA 1L7DA 1LQUA 1P31A 4GX0A 5EPOA 3RUCA 2A35A 3FNGA 4I9NA 3PYMA 3EK2A 3DB2A 3ZNQA 1EDZA 4W6ZA 4W7HA 1I2CA 3C1OA 1YL5A 3K73O 5TT1A 5HTOA 4OGWA 4I5FA 4D7AA 4U5QA 1LC0A 3ZWYA 3Q0EA 2PGDA 4IGFA 2V7PA 4BKUA 1N7HA 1H9AA 9LDTA 8ADHA 4XA8A 4YRBA 3N7UA 3UF0A 1I10A 4BNJA 3HG7A 1ZSVA 4U0JA 3OETA 4FJ2A 1E3WB 1PJQA 5A05A 3GFBA 3VPHA 3PJFA 1RM3A 1Y8RB 4WE3A 2HAEA 2WEKA 5B1YA 2CVZA 1PL7A 1A9YA 4OKNA 4N54A 2JHGA 4CMKA 3MTJA 4CQLB 4M49A 4EJMA 1KBZA 3EZLA 4K1LA 1NVMB 1JWAB 3ETDA 1JQBA 4WKGA 1UP4A 1KOLA 1ONPA 2Q45A 3WLEA 3RJ9A 4ND3A 4J6FA 3C7DB 4R69A 4XR9A 1D4FA 1K6XA 3IS3A 4JP3A 3TN7A 4IINA 3E82A 5HM8A 1JKJA 3NDIA 1EDOA 5TS3A 2QZZA 5HWSA 2IYPA 1Y9AA 2X0IA 4PLHA 2QX7A 1JVSA 3RUIA 5F3RA 1LC3A 5DBFA 1NR7A 2O48X 4Q3EA 3NUGA 2NM0A 3JQAD 4Q3CA 1E3IA 4R51A 4CL3A 2O4UX 2FZEA 4PLVA 2PKQO 4ZVVA 4CM1A 4J1NA 4D3FA 2QG4A 1PS9A 1J5PA 4RF3A 4RVDA 1YL6A 3UCFA 2EJWA 2JHFA 1B8PA 4M1QA 4D3DA 2C7GA 3PPIA 2J8ZA 3QHAA 4XGKA 2CVQA 2Y68A 1XU7A 1ARZA 5A9RA 3ZWPA 1T1SA 4UULA 3PZRA 1B0AA 4MOWA 4AJ2A 2GYYA 1G0NA 1B2LA 2NLOA 3NTQA 4MVJF 4GKVA 5IDQA 1VSUA 4BNXA 5AOVA 1UJMA 4L4SA 3V5NA 4YR9A 3HB4X 4IDAA 5K0ZA 2W2LD 3JQ7B 1PIWA 3RQSA 3JQ6A 3TRIA 3U4CA 2PTGA 2I65A 4YJFB 4RGBA 4GQAA 2WE7A 1WP4A 4ZRNA 2H6EA 4ZQHA 5G4LA 3LZ6A 2X6TA 4ILKA 3U9LA 2Y99A 3ZHYA 5JFOA 3ZWVA 1NVTA 2GR9A 3RFTA 3GRPA 3KYCA 3FWNA 3PGXA 4QFCA 4Y6PA 3HFSA 2QRJA 4WEOA 4ZA2A 5IDYA 1E6WA 3JQ9A 3W4IA 1BDBA 5TT0A 3FPLA 4M87A 2C59A 4FFPA 1MV8A 5T8KA 3OH8A 1P74A 4IQ8A 1TA4A 1TT5B 2X9GA 3CZMA 4BNMA 1N1GA 4YEDA 4UUMA 1YB4A 5AQ1A 1W0CA 1VRWA 3PGJA 5KKCA 7ADHA 3WX0A 1EVYA 1BG6A 3CXRA 3GVPA 1BW9A 2J3JA 2VN8A 4DLLA 3VDQA 1P0CA 2W2KB 4ZQEA 4CV3A 2BHLA 4D3SA 2EKLA 2OOSA 4D41A 2HLPA 2AQHA 1F8FA 1A4UA 3M2TA 1H2HA 1XIVA 1IZ0A 1KYQA 1GFSA 3H6KA 2I66A 5TLSA 1V3TA 3JSAA 3QVWA 3L4BA 1OOEA 1KY5A 1GCUA 2GN8A 4TZKA 4GGPA 3BTUA 4PLTA 3QV1A 4ZGWA 5CP8A 4BO1A 4UVIA 3BA1A 1OMOA 3I9JA 4TSKA 2NVWA 1X0VA 3E8XA 2AE1A 4WASA 5CG1A 2E37A 4M55A 1CWUA 4PG5A 4A73A 1WW8A 4BO3A 3TZQA 4ALJA 4PLFA 4Z0PA 4W99A 1H94A 4II3A 4ZJUA 2J5QA 1LA2A 4BL5A 1PX0A 2B4RO 4UVHA 5CDTA 2HJSA 2WD7A 3PWKA 2PWZA 3ZU3A 5ENDA 3ONFA 3BTSA 3W1VA 1Y5RA 2OL4A 3OBBA 1NFQA 3G49A 2R2GA 4L0QA 1D7OA 3PDUA 4P4NA 1UDBA 2NVUA 3H2ZA 4AVYA 4YDRA 1NPTO 1R4NB 1R66A 1XR3A 1SC6A 5TGDA 1LDNA 1GYQA 1S7CA 4PLWA 4ALIA 1ONOA 5KJ1A 5JAZA 2ZB4A 4DQXA 3PLNA 4K6CA 1IPFA 2IODA 3DO5A 3MJCA 4FFRA 2VHZA 3DBHB 2O4CA 1T2DA 1C0LA 1TVEA 5A04A 3TF5A 2HMWA 2DLDA 2O3QA 5A5FA 4RF2A 3WJ7A 3JQDA 2FMUA 4IMPA 4XDZA 4PN3A 3U5TA 1A5ZA 1A4IA 1NXQA 3DL2A 3HN7A 4GX2A 3PJEA 3VDRA 4B79A 1I2ZA 4PFJA 3STHA 3ZZNA 3GNQA 3DBRB 4OO3A 5KCZA 1X15A 4BNFA 1GU7A 4A2CA 3WGOA 4R1NA 3HQ4O 3GEDA 2WDZA 3ZH2A 5T6BA 2Y1CA 1AXEA 2DPHA 1UP7A 2JCVA 3FPCA 3HJAA 4NFYA 4A10A 2UVDA 1VSVA 2AW5A 3HN2A 2CVOA 3PHIA 4L76A 1BMDA 1X7HA 2NVUB 2TMGA 3VTZA 4YQYA 3T4XA 1N7GA 3DBHA 3QWFA 1SO8A 2O7SA 5MGBA 4HY3A 4AICA 1OBFO 2AQKA 4GMFA 4OOEA 2W90A 5ILGA 1G1AA 5BNIA 5LDGA 1IUKA 1C1DB 3WQRA 4YRAA 5BSFA 2GSDA 1HSOA 3WMWA 1P1RA 2WM3A 3PRJA 4UEJA 4OSPA 4FS3A 1VL8A 2HMVA 3HFGA 4XZ3A 5C37A 3PLRA 3ZI0A 3AUSA 2EIHA 1YOVB 4R5MA 3AJRA 3GEMA 5JCXA 4E5MA 5CEEA 4IJUA 4NMHA 4AJ4A 4BNZA 3D7LA 5JS6A 3I6IA 1E7YA 1FDUA 1MC5A 1PJLA 4OAQA 4B8WA 3SX2A 1PJCA 4JLWA 4PCVA 1L1FA 2PH5A 2J5RA 2GDZA 2Z95A 3QY9A 4U6SA 4E0BA 1LEHA 2Y0EA 4BNHA 1DDOA 3AY6A 2FSVA 3ICCA 2VOEA 1J49A 1E1NA 1W73A 1YE3A 4CUKA 2DC1A 2AA3A 4WCFA 2O3RA 2V6GA 1V3UA 1SBYA 1Y8QA 3DFUA 4GVLA 1BW9B 2GZ3A 1EE2A 4CQLA 3S2IA 2AG5A 3UOGA 4B4VA 4ND5A 4N5LA 4XB1A 3GN1A 1Y8RA 3GF4A 5G0VA 5K6AA 2I5PO 5A02A 4E12A 4CMGA 3ZWNA 3S2EA 1UAGA 1V6AA 1ZEMA 4YRDA 3DWFA 1DRVA 4RPGA 4BNNA 1YS4A 4GWKA 2FR0A 3SEFA 2GPTA 4J4TA 4ALMA 3VKUA 4RVFA 3I23A 4NK4A 2EJVA 3MJ4A 4XYEA 4FFNA 1GPJA 2E48A 4JJIA 4R54A 1LDYA 3ONDA 4FN4A 3Q9UA 5F1PA 4BMNA 1H6CA 5I8ZA 3MCVA 3Q9NA 4RL6A 4BUCA 2NSDA 2AG8A 3E48A 4DVJA 1WXDA 1MLDA 1HL3A 3PIIA 3PK0A 4WGGA 3H5AA 5DCYA 4EEXA 2VNSA 5C7IO 5A9SB 4J49A 1I2BA 4IJWA 1Q0QA 1AHHA 2POQX 3KOUA 1EMDA 2ZATA 5G0SA 4DMMA 2O3TA 1D1TA 3RFXA 3H2SA 2I76A 3TZHA 4XIYA 4AJLA 5DULA 3PIDA 3G0OA 1I3LA 1ZKMA 4CMBA 4G65A 4RPHA 1ZXBA 4HFMA 4RPJA 1ML3A 1GUZA 4R1UA 3RFVA 3ZWOA 1EUDA 4BIIA 1AUPA 2EWMA 4UEKA 3JQ8B 4RV9A 2C5EA 3G79A 3H9EO 1MP0A 4XDYA 4YWJA 1GQQA 3OECA 3D0OA 2Z1MA 3KUXA 2PGLA 3QLJA 1HZJA 5CPBA 1IULA 1E7MA 3KTDA 5EERA 3QE3A 1P1KA 2AXQA 2C82A 2I67A 4ND1A 2ZYGA 2B36A 1UDAA 2P9EA 3AWDA 1LLUA 1PGNA 1SAYA 4KP7A 3I9OA 1HE4A 4YJHA 4CPDA 4FPXA 4QFDA 4B4OA 1IY8A 3EC7A 2CDAA 2NU9A 3H4VA 1XU9A 3DAGA 4IZIA 3ASUA 4NHEA 1NWHA 2YUTA 3ZNPA 3DR3A 1MGOA 2ZKLA 5BQFA 4BV9A 4YT2A 1QYDA 4AJ1A 2IYOA 1MB4A 4L73A 1J4AA 1N5DA 4YBZA 1E3EA 1R4MB 3DHNA 3RASA 3K92A 1MX3A 4KMSA 4YT8A 5A9SA 5L51A 4E5YA 3PTZA 4BGVA 2GO1A 2EW8A 5KNLA 3BHMA 5BSGA 1QYVA 4KQXA 1P1IA 1HXHA 2HDHA 2HKIA 2RHRA 5EINA 4NBTA 1OFGA 3PEFA 1SB8A 1I01A 2E82A 4ZRMA 1GQYA 2ZIZA 3ST7A 3SC4A 4DIOA 1K5HA 1DC4A 4AJOA 4OXKA 1LXCA 5U9CA 3UUWA 3N58A 3RU9A 2PR2A 3WGGA 1NPYA 5L9AA 4BNUA 1QLHA 2PA3A 2ET6A 2ZTUA 5IZCC 3AOGA 1E92A 4I08A 1NFRA 5H81A 1RJWA 3EMKA 3WNVA 3DQPA 3IP1A 1LRJA 1ZMTA 2ZJ0A 2J3IA 4YJGB 2NQTA 4IPTA 4A7PA 4CLXA 5ICMA 2IE0A 4YAEA 1ADBA 3TZCA 4IIVA 4H15A 4HV4A 3PP8A 1HTBA 4NNJA 4OKIA 1DLIA 1ULUA 2JFGA 4UUPA 3L6DA 4P4LA 4CM5A 2C5AA 1E3SA 4E2WA 3OQ6A 1GUFA 4UEOA 3LT4A 1U1IA 3H8VA 1FJHA 3Q2KA 1T1RA 4R9SA 3GOHA 1E1LA 1Z82A 3NT4A 2JFFA 3L07A 1QYXA 2JD2A 1I30A 4L74A 2NACA 4PVCA 3T7CA 3NT5A 3W8FA 1V9LA 1VM6A 2DPGA 1B7GO 2W2LA 4O1MA 3VPXA 4BO5A 4EBFA 1NYTA 1U2DA 3AI1A 1P3DA 1WVGA 5KVVA 3DZJA 2CMDA 2NU6A 1JU9A 1HLDA 3VZSA 4LMRA 4FR5A 1V3VA 3D5TA 3SLGA 3ZWBA 3BIOA 3BTVA 1UXHA 4PIVA 1FDWA 3S1LA 3S55A 4CQMB 3E18A 4BO6A 2HUNA 5L4SA 1GD1O 2FR8A 1YDEA 4CLRA 3FNFA 4AJKA 1ADCA 2HMTA 1LNQA 4IXTA 1A7KA 1AXGA 3JTMA 1KIFA 3D3WA 5CDUA 2Q2WA 1U8XX 2FY8A 1KEWA 1NQAO 1BVUA 5IXSA 1HT0A 1DHTA 2YHIA 1I3NA 1P45A 4H16A 4N5MA 4C7JA 1KC3A 4FIZA 4MJLA 3F5QA 5A06A 4MPDA 4O5OA 3BMCB 3D64A 1BRMA 4IMRA 4HX5A 4QTZA 1VPDA 1A9ZA 4CM3A 3NGXA 3Q1LA 3FN4A 4XRRA 5DOZA 1X1EA 4RORA 3TOXA 4ZQBA 4R1TA 1I32A 3QJ5A 3ANNA 3E9QA 3LC2O 3VZQA 3RUDA 2NQ8A 2DAPA 3GY0A 1PZGA 3VKVA 3WWYA 2PLAA 1R37A 1A7AA 1Y5MA 1XCBA 4CR8A 4A0SA 5CDSA 3PYXA 2TMDA 4HXYA 1DB3A 4RZIA 3QIVA 3PQEA 1C0KA 1GUYA 1WAMA 2CDBA 3K30A 3COSA 1DAPA 3EZYA 3ZGYA 4I9UA 1T4DA 1PL6A 4JN6B 3LQFA 2Y0DA 4XQGA 3R3JA 3KSZO 1G6KA 4OL9A 1JA9A 3IDSA 1JN0A 1GZ6A 1Z75A 1NPDA 1LSJA 3M1AA 4YA6A 5DBIA 4XWYA 3ANLA 2VTEA 4JROA 4IY1A 3RAJA 5L3ZA 1SCUA 1CDOA 3U0BA 4MKXA 3M1LA 4Q9NA 1W4ZA 4DTIA 5F1OA 3CEAA 5THKA 5L7TA 4J43A 3JD1A 2D8AA 3B6ZA 5BNFA 1B8UA 2X86A 3MJVA 2BLLA 1P1HA 5CHEA 4NZ9A 1T25A 4D44A 1U3WA 4CLRB 5TJ9A 3PWSA 2Z5LA 3UFXA 1ZSNA 2NTNA 1AN9A 1YBVA 3JYPA 3QQPA 4BNGA 1UP6A 2WE8A 2X23A 1DSSG 3B20A 3E6AA 1H6BA 2VCYA 2XOXA 4YTEA 1AGNA 4E32A 4MVJM 1Z7BA 1K3TA 2YQ5A 3U3XA 1E7SA 4A27A 2P9GA 8LDHA 3C85A 2AEFA 2EKPA 2PZKA 3S2FA 2BRUA 2E4AA 1U3UA 3ZHBA 3IAHA 2B0JA 3KEQA 1VJTA 5FI5A 5IFLA 2BFAA 3EW7A 4GX5A 3GG9A 1EEHA 3KBOA 4EUFA 1GDHA 2HU2A 1PL8A 1QYWA 4TMFA 1T2FA 4J9UE 2YV1A 2RH8A 1KETA 4LCEA 3A9WA 3OIFA 3DMTA 4M86A 2YFQA 4J91A 5IF3A 3ETGA 3RVDA 4D43A 5B4VA 1PQPA 1ZK1A 4FFMA 2VT2A 5A3JA 1IE3A 3RBZA 3ETEA 4PLCA 2BGLA 1KVQA 3FHLA 1HDXA 2YJZA 3L9XA 2ZCVA 4BV8A 1D1SA 4EI2A 1PQUA 1U7HA 1OC4A 3L6OO 4GAEA 3V2GA 3ZU4A 1O9BA 2FOIA 5FI3A 2XPCA 4LSWA 2IZ0A 3RUEA 3GG2A 3DBRA 3VZRA 3WOHA 1GPDG 4IM7A 3AFMA 3H65A 2QQ5A 1DJNA 4HNGA 2J3HA 3AI3A 3DBVO 5K9ZA 2IXBA 2YFHA 2UUPA 3CKYA 2C20A 4YYZA 4NK5A 1DOHA 3RIHA 4NDNE 2IZZA 5T67A 3JYNA 2O3SA 4OXYA 3RSHA 4K28A 3ZCXA 2V6MA 1T26A 1Q1NA 2UUOA 1UR5A 4GLLA 4Y9DA 2RHCA 1YVEI 1YJ8A 1UDCA 1UZMA 1YBAA 3DFZA 4JNKA 1H93A 1LUAA 1B3RA 2Q1TA 4A03A 1IYZA 4FJ0A 3ZU2A 3EHEA 4Z9XA 4PZDA 5DP2A 1QRRA 1AHIA 4LRSB 2AEJA 1E6UA 2YHUA 5G0UA 3F1KA 1HYHA 3AUTA 4GX1A 3TL2A 1MG0A 4CM8A 3GUYA 5JDIA 5KKAA 1ZW1A 1ZO8A 3B1FA 4OMUA 2BELA 2FRDA 4BGIA 1Q2XA 1NQOA 4N7RA 4AL4A 1OAAA 2XXJA 1HDYA 2V6BA 3KETA 4AG3A 5IAAA 3VZPA 3K96A 2O3JA 3DHEA 4MVJI 3INRA 3I1JA 2VWGA 3AUAA 4PVDA 4IDDA 1WZIA 3VPFA 4KWIA 4TRRA 2W8ZA 3WQSB 1HSZA 1BXKA 3HWRA 3DZBA 3FNEA 2X9VA 1LDMA 4XYGA 3OICA 1YGYA 4CM4B 4YACA 4Z3KA 3I4FA 3ITDA 5EQFA 1DAOA 4P38A 3CZRA 4O6VA 3NJ4A 1KVUA 3JQAB 1ZNQO 2ZYAA 4J0EA 2OO5A 4P4GA 5TF4A 4JCOA 2V65A 4RDHA 3MJEA 1PGQA 4CLHA 1EZ4A 1LX6A 3ADOA 2VYVA 3H9GA 4F45A 4D79A 1HDOA 5JMPA 3FWZA 1HKUA 2BH9A 1PWZA 1CF2O 2YY7A 4WNIA 1TLTA 1JTVA 4NBRA 4O59O 3OJFA 1ZK2A 4R9RA 2ZTVA 2BD0A 4BNIA 3JQCA 3OF2A 5ENVA 2VRCA 1PZFA 4WNCA 4P8RA 4F6CA 3HNPA 3RKRA 2NU7A 3DZHA 4Z3DA 1LDBA 5IXYA 4J7XA 4IGEA 4FGWA 4CMEC 1JLLA 1ZK4A 2OGUA 2Q4BA 2Y1FA 4O63O 1VC2A 1LLCA 3JYQA 5JCJD 2OUIA 2OORA 4GSLA 5IN5A 4I9HA 1NNUA 3FTPA 3WGZA 4KZPA 2P91A 4II2A 4N5NA 2UYYA 1N1EA 1PGOA 2O50A 5IN4A 1CJCA 3KYBA 2E6UX 1O6ZA 2PD3A 3NV9A 2FN7A 5DN9A 3VPGA 1BTOA 3RC2A 2PV7A 4X54A 4J1QA 3OP4A 3JQ7A 3F3SA 1R0KA 3O8QA 4DQVA 5HA5A 3RBXA 4R3WA 1H2BA 2VYVD 2X5KO 3DMYA 2P5YA 1ZIDA 4F6LA 3IKTA 4BMSA 4UUOA 4RPLA 1VL0A 4CMIB 4YCAA 1IPEA 4FW8A 2A92A 2H5LA 2JD0A 1Z45A 2YZ7A 2QHXA 2FR1A 2IZ1A 2VHWA 3DBLA 1YJQA 3OSUA 4E33A 1DIBA 4RJTA 4TRMA 4Y67A 3DZGA 3HE3A 1JAYA 1YXMA 4BNLA 1M6HA 3QWHA 3JD2A 4KDEA 4ZD6A 4MINA 4FB5A 4CM7A 3BYZA 5DZSA 2JCXA 4CLEA 4DA9A 3WNQA 3ZV6A 1Y1PA 2G0TA 4J9VA 4DPKA 4ZN6A 1DRUA 3RUAA 1B14A 1C14A 3PVZA 1M6WA 5TC4A 1XWFA 2J3KA 5AXAA 2VZ8A 4GMGA 2EF1A 4M8SA 4DL9A 5I9NA 1DJQA 1H6AA 3K9QO 1U9JA 3W4KA 5T8KC 3JD4A 4CLDA 5I7EA 4K6FA 4NR0A 5G4KA 5JY6A 3DZKA 4OM8A 3I9MA 1XG5A 5I9LA 3BMNB 5FEUA 4BO8A 2VWHA 4W4TA 1BVRA 1GY8A 1HRDA 4E5PA 4OIMA 2X9NA 2ZB3A 3U4IA 1QORA 2WYUA 2D3TA 4LVUA 2VUTA 2HRZA 4M54A 1WZEA 1W6UA 3WWZA 4U0KA 3WB9A 1PZEA 5DBGA 3V2UA 4B7XA 2AQIA 2DU8A 4YJDA 2AEMA 4UAGA 2OXIA 2IDZA 2NWQA 4ALKA 3VOSA 4LW8A 1I8TA 4HP8A 3NTOA 3H9JA 4CMHA 3H5NA 1DFHA 5L45A 1X7DA 2P2SA 2DTXA 4XRGA 1ZEJA 5IZCA 1YQXA 4J4BA 2Y1GA 4NBWA 3V8BA 3F5SA 3C7AA 2VQ3A 1Y81A 5EN4A 4JBIA 4MVJA 4PG8A 4D42A 5MDHA 1DFIA 3HDQA 3WYBA 3BHJA 3H9UA 4GKBA 4EUEA 4TWRA 3CIFA 1KS9A 3OJEA 3R0IA 3SLKA 5B12A 1H5QA 1I3MA 1SOVA 3DZIA 1PJTA 2OBYA 3A28A 1WPQA 4C7KA 3HZZA 3D4OA 4YT4A 1C3VA 1P9LA 3N74A 2IRWA 3IIEA 1KVRA 4WLUA 1N2SA 1R12A 2PZMA 1ID1A 1HE2A 5G0TA 4CMAA 5G4KB 3U09A 4BQRA 1NAHA 3QRWA 3W8DA 5JAMA 1VKOA 1YRLA 3PWZA 4RF4A 2D1YA 3CINA 2IEDA 1Q7CA 4ONEA 3W4JA 4CR7A 2CDCA 3OM9A 4E31A 1M2WA 1DBVO 2CSUA 1QLJA 5DDIP 5C5IA 1LTHR 3OIGA 3PHLA 2C29D 1EVIA 3GR6A 5TNXA 5IG2A 5HBRA 1SEVA 3SVTA 3JQGA 4E5KA 3BMOA 1YWGO 1TB4A 5DCWA 1DC5A 1P33A 5K6AC 1XGKA 4W7IA 5AXDA 3PZBA 3GZ4A 4TQGA 1ULSA 4WEQA 1QG6A 2Q49A 3DC2A 4HFNA 3H3FA 4XEHA 5KJEA 3W8EA 3WBFA 3VH3A 2NNLD 2VWPA 4WCFC 1EQ2A 3GGOA 1TT7A 1XELA 4G2NA 4ID9A 2Q1UA 4JX8A 1VL6A 3TDKA 1GEEA 3O8QB 2PY6A 3UVEA 2CF6A 2YDYA 4QECA 3GEGA 3UICA 4CODB 1WDKA 4CM6A 1ORRA 1F8GA 3QVOA 3IUSA 5ADHA 1OZAA 4GWGA 2LDXA 1AE1A 5DOVA 4NU5A 3R3SA 4QXMA 1PJ4A 4A26A 2EW2A 3WGTA 1LQTA 5TX7A 1CETA 1J6UA 1ZH8A 2DBRA 2C0CA 3DONA 3O26A 4WECA 1UUFA 1UXKA 4IXWA 3GLQA 3KSDO 4B4UA 4Q3AA 3F47A 2Y1EA 1H0KA 5BT9A 3SJUA 3UXYA 1N92A 1T24A 3P5SA 4OHUA 4W82A 3WYCA 4H7PA 2VZ0A 4DWVA 3NT2A 3RC7A 5BR7A 5IZ4A 1LRKA 4IS3A 1E3WA 4IBOA 4CLOB 3ZV3A 3AM4A 3UGKA 3BMQB 3JCZA 4CR6A 1NWCA 4IQGA 3OJ0A 3KYDB 2HK8A 3MWDB 3UW3A 3ZNNA 2X1HA 1RWBA 1BSVA 4Y8VA 4AJHA 3LC7O 2Z1NA 4B4WA 2VHVA 2EP5A 1B15A 3WGIA 1Z74A 4BGUA 1JKFA 1N9GB 4RF5A 4I1IA 2G1UA 1NVGA 1IHYA 4L4RA 2JJYA 5DCUA 3RCBA 3AK4A 3JD0A 2RCYA 3I9LA 3ROPA 3HDJA 1HYGA 3T7EA 3S8MA 1JDJA 4UVEA 5JO9A 3ZW9A 2X0NA 2DUUA 4RQTA 4Z9YA 3K31A 2WJPA 3M2PA 3H9QA 1LLQA 4DXHA 4W9NA 4MVJH 4GSKA 3P7MA 4C4OA 3TNLA 3NDRA 4KTTE 2FPPA 1K2WA 5BSEA 2VOJA 1R15A 2EG9A 2O23A 2Q50A 5EIOA 3PHGA 5TRTA 1E7RA 2O7QA 2BFMA 5A5EA 3WSVA 2Y0CA 4FOSA 1ZCJA 1U3VA 2PK3A 3GNSA 3HB5X 2D4AA 2YQ4A 1ZJYA 2X7HA 4J1SA 3UAGA 3C1AA 4FJ1A 3RROA 5A03A 4UUNA 4BVAA 4E3ZA 3BHIA 2QYSA 2VT3A 1JWBB 1NTOA 3C7CB 4BO4A 3KXDA 4XKJA 3VH4A 4D45A 1FDVA 4EJ6A 3QWAA 1FDTA 4BKOA 5F5LA 1ZXLA 4GI2A 2EP7A 3A1NA 3KLPX 3WJAA 1BXGB 3LYLA 3GDFA 1SPXA 4AFNA 1PTJA 4ITUA 4R3NA 3CUKA 3LF2A 1E1MA 3ZDFA 1LI4A 4XGNA 3KB6A 4U6QA 5LCXA 3RI3A 2ZJ1A 4W9NC 1UH5A 2ZYDA 2Q99A 4TZTA 4J7UA 4L8VA 3B1KA 3ZV5A 1I0ZA 3ONEA 4J7CA 4ZU3A 4KQWA 4WUVA 3GC6A 3KHUA 2YV2A 4HFRA 4TVBA 2UDPA 5B37A 2QYTA 3DAPA 3GVXA 3L4BC 4Q3NA 4RQUA 4XGIA 1QV6A 2CFCA 3SXPA 3GPDG 3JV7A 2VHXA 3VH2A 2VYNA 3D4PA 3FRJA 4WLNA 1IB6A 5GMOA 3ZWMA 5KOIA 2VTDA 3KLMX 3ZU5A 4DGSA 5JCJA 1E7QA 1DIRA 3FNHA 1QXSA 2Y05A 6ADHA 1EBFA 1M66A 3KRTA 1DIAA 1OI7A 3WBBA 3C8MA 5JLAA 2ZB8A 3RC9A 3EVTA 2BKAA 1PJ2A 1FMCA 5CEJA 4YAJA 5H82A 3BZUA 4BOYA 2A9FA 4OXNA 3MJTA 4M89A 4ZQFA 1EK5A 1QSGA 4CJXA 3GDOA 1G0OA 1MFPA 2D0IA 4UREA 1DC3A 1NR1A 1GV1A 4ALNA 2DBVO 3AU9A 2B4TO 1UXIA 3PDJA 4BS9A 3P2YA 1P0FA 3DAFA 5T5QA 4QEDA 3OA2A 3HHPA 1BWSA 4XJTA 2Q1WA 5JPIA 1I24A 1HDZA 4L9RA 4NBUA 4BGEA 2GZ1A 4EZBA 3AUUA 1X0XA 4MP3A 3FF4A 3PXXA 1CYDA 3ZN2A 7MDHA 4GBJA 4LVCA 4U8GA 1V8BA 4BNYA 2PGJA 2W4QA 4INAA 1YBMA 3IOYA 2DKNA 5ILOA 4HFJA 3V2HA 4OJNA 4Y6SA 1KVTA 4IZHA 3UCEA 4FQ8A 5C7OO 5A3VA 1VKNA 3PJDA 3SBOA 4IQ0A 2R00C 4QT0A 1F06A 3GAFA 2Q4EA 3F4LA 4GH5A 3LT2A 1XYGA 1XHLA 2H9IA 4H3VA 1U2GA 4QSMA 4B8ZA 4EITA 4EW6A 5C3MA 4OH1A 3QP9A 4MVJG 5L7WA 2PZLA 1PS0A 3G17A 3X2FA 1ZK0A 1EK6A 3VH1A 5IJZA 4BKPA 1ZK3A 4HWKA 3S2GA 2G76A 1P1FA 2GZ2A 2CZCA 4J1TA 1TEHA 3TQHA 2YDXA 4CM8B 3JQFC 3I4CA 1YH3A 1RM0A 2NTVA 3TL3A 4NPCA 3U4DA 1U5AA 5COQA 5L40A 4IS2A 4RVGA 5JMWA 5L53A 3FSRA 4FD3A 4Q3DA 4DRYA 1Q0LA 1GAEO 2Q46A 3LC1O 3UCXA 3GHYA 1DIGA 3ABIA 3GH3A 3NGLA 1RM5A 4QX6A 5B4UA 4J3FA 5JC8A 1S6YA 4WCFB 3GZNA 2BI7A 5JY1A 4AJPA 3MZ0A 4TVOA 6LDHA 1N9GA 2RIRA 1RKXA 3VHRA 3K8ZA 3ZW8A 4MVJD 2P5UA 2O3UA 3P19A 1QMGA 2PFGA 1UXJA 3FI9A 1FXSA 3QWIA 1K6IA 1HLPA 2Y93A 1CEQA 1XKQA 4NH4A 4OYRA 1ZSYA 1PGJA 1MA0A 4BMVA 4Y6RA 2B35A 5JBIA 1Q7BA 2GN9A 3BMOB 3WYEA 3KVOA 3E9NA 1HZZA 3AM3A 5J23A 3G1UA 3NKLA 2PZJA 3PFFA 4RLSA 3VAZA 3OMLA 3GGPA 3U4HA 2ZTMA 5JAIA 5C7LO 1U3TA 2CUKA 3KYCB 2C07A 4NBVA 2HCTA 4OSOA 1R0SA 1MG5A 1M75A 2JL1A 2GGSA 3NX4A 2JAPA 3AFNA 2GRAA 2EGHA 3RWBA 4TKLA 5CFZA 3VVBA 3IC5A 1CQJA 3KV3O 1U28A 3L77A 4Z9FA 2EEZA 3ZWWA 1R16A 1GR0A 1ZVMA 2HJRA 3WMXA 5JDCA 3I52A 1UZNA 1HF3A 2AQ8A 4RO0A 3TZ6A 1XSEA 2V6FA 2PKRA 1U4SA 2W98A 4KUGA 3OQBA 1D3AA 3ZWXA 1ADGA 4ALLA 1EE9A 1B8VA 1GZ4A 2G82A 2OP1A 1HYEA 2Y67A 4FSHA 4YT5A 2BI8A 3GZNB 5KWEA 2HK7A 1PEDA 5KJ6A 5KJFA 1X13A 4XR4A 4Z0HO 2R6JA 1T2AA 4NFHA 2P4HX 2AHRA 3VPSA 3NRCA 4EJ0A 1BGVA 3AOEA 2D59A 3TFOA 1QV7A 3I9KA 1U5CA 3MWEB 3HSKA 2XXBA 5LDHA 4MKRA 1EBUA 2QRLA 2NV6A 3WIEA 4R5HA 1B16A 4PLPA 4BKRA 2H1SA 4NQZA 2VYND 1CERA 1HWYA 2X8LA 4MKZA 5ES3A 3VC7A 1ZZEA 2HO5A 3FCOA 1ISJA 4RVUA 4FDAA 3PJGA 4HADA 4HNHA 4L75A 5G0WA 4TRNA 1U7TA 1UZLA 1R4NA 2DM6A 4XIJA 5H83A 4DMLA 2C2XA 2X58A 1SMKA 3AW9A 1EVZA 3C3XA 3INTA 3O03A 3K2BA 1WMAA 3A14A 1GEGA 1Y8QB 2X5OA 1ZMOA 4EGFA 3GAZA 4FBGA 3IUPA 1O89A 1GYPA 3D1LA 5JO0A 3WG9A 4IDGA 4WPGA 4XX0A 3HUDA 1LDEA 1FF9A 1ONNA 1LRLA 4O0LA 1BXZA 3BMNA 5DNAA 1P77A 3GVIA 2E49A
chains in the Genus database with same CATH superfamily
2VHUA 4RADA 3TMAA 4J4HA 2H7CA 3J7TA 1YB1A 4IXMA 3IQEA 5F9HA 2HIAA 3EODA 3NHSA 1EQUA 4B3IA 1WA5A 2FZ5A 1BQEA 4E13A 1MH1A 2QVXX 5IK2D 5K0TA 5IT0A 4QBKA 2W37A 4NAHA 2OXTA 1N4AA 3L8HA 4NOJA 2BF7A 1SKBA 5KQLA 1USGA 1SU7A 3ENKA 3HBLA 3FBGA 2Q9UA 1E3MA 1RC0A 4CMEA 1QM5A 3LCVB 3GFFA 4Q4AB 5BNTA 5F78A 4Z4HA 1R27A 4KQMA 3T3EA 1UKEA 2WHYA 3M4XA 4YJ2B 4NEQA 4YFVA 3CWZA 4H1WA 2PEZA 4KQGA 4WKNA 2AOXA 4FGSA 4R1LA 2H59A 1VCOA 2AYZA 3SOPA 2NXWA 3K6JA 3BFXA 4CV0A 3DTYA 5D8DA 2PD4A 1YQQA 3Q88A 2VF4X 2VJMB 5E1BA 3WKCA 2NOGA 3OOYA 2BFEB 1WBDA 1KMQA 2Q29A 5DXAA 1JIIA 5J63A 1GNQA 3I39X 4EVQA 5JNRA 3A1EA 1R9MA 4UXIA 4EOGA 3HVRA 2DTEA 4B6GA 2R6R1 5BW8A 5EUCA 2HRCA 4ON9A 4LJAA 1O57A 3NU1A 1OFUX 3Q6IA 1PL0A 3R5HA 3U62A 3DOCA 2G6BA 3ACBA 2X9QA 4EATA 4WCVA 4LMPA 3GEPA 2B69A 3BMCA 1ZU4A 2NU8A 2NXEA 4R7TA 2B1IA 2XW6A 3WKEA 3CTMA 4WHMA 5AHOA 5IC5A 3K70C 1AV7A 3E9RA 2QJOA 1QTNA 2FMHA 4X8HA 2UXDB 3UH1A 2JLYA 1P6UA 3OQPA 4LXIA 4Y2RA 1ISSA 3HDYA 4DMFA 1J2YA 1N7IA 1NQTA 3D3WB 3NIBA 4X1YB 1ZUHA 3WICA 4AJNA 5CEFA 1XYVA 3GHHA 3HA3A 1K6JA 3EULA 1KRXA 4Q9IA 3GA0A 3I3SR 2JCSA 3I5MA 3AX6A 2GBIA 3W04A 4BWVA 2FSSA 2ZANA 3TSOA 1OASA 2F59A 1R6AA 1EGQA 2PJUA 4RV5A 1YRBA 1DZIA 5ALIA 4FLEA 2AOVA 4F92B 1E6LA 1PK7A 2DWPA 3HYLA 4GP7A 4I3HA 1Q0HA 1I1OA 5JUWA 4KR7A 2WD7B 3FDZB 4HUJA 4DUZB 5JSZB 2A4MA 4RGVA 3C5CA 2NZUG 4RK5A 3R7WA 4PSDA 3U3OA 5LMUB 2HGSA 1E3DA 2Q5LA 5EE9A 3KQKA 3NJRA 6ABPA 3K6KA 3F1LA 4B6PA 3W06A 3ZHRA 2FZWA 1IXRC 3L8EA 4PYMA 4TTJA 1TF7A 5JRJA 2ZZNA 1HDCA 1FDIA 1ZJ6A 4XWWA 2RJ3A 2YMQA 3R7LA 2RHMA 3TTXA 1YCGA 4KVFA 4DLPA 1X7ZA 3OA0A 4IP0A 1E59A 4L4XA 4MA0A 4Y98A 3PHJA 3N8GA 4XGQA 4QTUB 3D9QX 5DPMA 3HU2A 3OX3A 3PHHA 1YDMA 4IHKA 3VC1A 3X43A 4DBVO 4EWLA 4YIHA 3LUGA 3G88A 4Q48A 3TQFA 2G40A 3IMGA 1JHDA 3CSUA 4IJVA 4ZVNA 5KJCA 4KTVE 1RTKA 4F3KA 2VSYA 1UWKA 5TDHA 4HDNB 3LDAA 2A14A 4X1IB 1X7GA 2XLBA 4MW7A 2JASA 2R751 1O54A 1Z6TA 1UBTS 5CLHA 5F5NA 2WWRA 4MWGA 5DBOA 2DH6A 2H11A 4WN9A 3SQLA 1TMKA 4GI7A 2WYVA 4NFSA 1G21A 2PX3A 4DQDA 1LI5A 3K2EA 2W6JA 4JL6A 1Q11A 2B8JA 3D6FA 1BEUB 4F4FA 5F1KA 5KSZA 1D2AA 1W9HA 2C7OA 4LFBB 2KS6A 4AUMA 1X74A 4PX3A 5ALQA 4A23A 3ZXSA 2DTDA 4LNAA 4C76A 5L3QA 3HP7A 4I5IA 1CR6A 1XZQA 4FKMA 4CG1A 3G2HA 4EYEA 4JLMA 5FP0A 3SFTA 3WFZA 2PBZA 2ZBFA 4I5GA 2IZ6A 2HMSA 4RSRA 1HY3A 4B5LA 3H4TA 3MD9A 2A9OA 1TI7A 3MS2A 3VMMA 1TL7C 5EJ6A 1X14A 4RVSA 3EPJA 4ER0A 4FWIB 4ROSA 5JPCA 1EM8B 1ISIA 2ERCA 4GPZA 3K9CA 3X2EA 2AMVA 2IU4A 2G9RA 1QLWA 4K2AA 3DEYX 3EEOA 4AKEA 1V2HE 3ICVA 1KARA 2JIDA 1SZJG 2P9FA 4D8VA 3TO5A 4H77A 1XTVA 1NQ5A 3HU1A 5JS8A 2JBAA 1L7BA 2FAXA 3GWGA 2VS1A 4XPIA 1U0JA 1DLJA 1UPXA 4KWTA 1FRFS 5EKTA 2BHNA 4BBPA 2QLFA 4Q93A 1NMZA 4KE6A 5I7WA 5HRUA 1JIVA 2I2DA 3FG9A 4WOCA 1F7VA 4FILA 1HMPA 4XJSA 1MFZA 2V0CA 1O6CA 4G1VA 3HY6A 3N7TA 4GPD1 2FPGB 4PO1A 3D8SA 1NP3A 5FTKA 3T3MB 4URUR 3UQYS 1EESA 3DJFA 1CQIA 3AHHA 1H8ED 3KDPA 4IFIA 4QQRA 5LB2A 1VRCA 1GSOA 2R4TA 4URHA 1XRQA 4V0ME 3THOA 4EB3A 4ETWA 1JKMA 1SC1A 2G80A 3RNLA 3LSYA 3TPCA 2QW8A 2C8JA 3QVUA 4C0AC 2ACKA 1DEHA 5AXBA 2XRYA 4ETNA 3GMDA 1GHTA 4QAJA 1TJPB 1UOEA 5CK4A 2WA2A 2C5LA 5CD9A 2G5TA 4ES6A 3FDJA 2VUHB 1T8UA 1P4HA 1P81A 1VYVA 3C3YA 3CVUA 4PZCA 2QENA 4HQRA 1FOEB 3FD8A 3VAYA 2GYUA 2YJGA 2DBQA 5BYAA 3LP6A 1QIGA 4C5AA 1FNMA 3IMFA 4W1PA 2Y9YA 3NRJA 3VSEA 1P4JA 2BDUA 5JYDA 1J21A 2BPOA 3AG5A 2EXXA 1P6XA 2HBZA 4C3UA 3EOZA 2I3BA 3GFTA 1TQ8A 2VF7A 3MJFA 4LCJA 4RMGA 5EMHA 4JQYA 3RUFA 3UV6A 4B2PA 4WY8A 2GARA 3WJ2A 1F8XA 1Z0UA 2AKEA 3A4VA 4JGIA 3ZNOA 5CDHA 3A27A 4NJEA 4G01B 3H97A 4ESHA 1QHIA 4MIOA 2IPAB 1GPLA 3DMGA 3GGDA 4JLUA 4K86A 3Q3IA 5CT8A 3UC9A 4ZCIA 3GLFA 4LC1A 2WNIA 1Z9BA 1M1XB 2IUUA 1GLVA 2DQSA 3AIOA 2WIGA 4J16C 5BR8B 1Z62A 2F43A 2AFVA 3DTTA 3H2KA 1T34A 3EISA 3W0LB 4PYJA 1CRQA 4R05A 2Y1DA 3CJQA 1G42A 3C4VA 3Q3EA 2IPLA 4J29A 1G20B 1KYWA 4TROA 1ESNA 4MYDA 4C22A 4O02B 1YB6A 2LV8A 3FSEA 4U2BA 5LM3A 3WAGA 1QPZA 4EDFA 3CMMA 5B1DA 3WHIA 3EAGA 4LZOA 1HQKA 1OTHA 2EG5A 1BCRB 1YUNA 2EBHX 3L49A 5GONB 3RIGA 3UTDA 1HE5A 1ECBA 3CNNA 4D0LB 4MVJP 5EE3A 5EJAA 4EGAA 1C7EA 4M6WB 4E2XA 4S1VA 3I76A 3DV0A 3I3OA 3KE9A 3ZV4A 4F11A 5LQDA 2X13A 2FPSA 1P3JA 2DFDA 3EF1A 1W76A 2PYZA 2JFHA 3CF4G 5FA5A 5KWJA 3ORFA 2FW8A 1OZHA 2OILA 3GFGA 5EXEA 2BGKA 3JQ9C 3TXXA 5K8TA 1JH8A 1KRWA 3KIPA 3A2LA 2D2XA 4C4TA 2A33A 4GKJB 4MR7B 1V48A 3P9CA 4ZRDA 1G5IA 2V7VA 5ALGA 4LGVA 1NMXA 4RLHA 4XOUA 2OD7A 5KTYA 1NLMA 2COKA 2XY4A 1XP5A 3DUWA 3EBOA 4E2YA 1TO6A 4PXYA 4HF7A 2ZQYA 1EVJA 4I5EA 1NONA 4KVGA 1S1CA 2BFCA 5CB4F 2ZCJA 1CBUA 1TQ2A 3WFJA 1M2VB 3TJRA 3GT0A 3L06A 5SY4A 1TECE 2CD9A 3MMNA 3LGSA 1H2EA 3Q2IA 2WUVA 4R8KA 4Z0TA 3ZJTA 2C2YA 1MZPA 1W8DA 3ZKAA 2ILTA 2M6LA 4ARUA 4MRPA 4OOFA 1Q74A 2ECQA 3UHOA 4HMOA 1GQ2A 4ZV7A 5LLSA 4HWTA 1TKRA 2R7AA 2ZUDA 2A3RA 5B4TA 3O8BA 3ME5A 5H7XA 1O0SA 2ID8A 3MEQA 1EB9A 1IAQA 2FB9A 1ISFA 2QMHA 1E5QA 1EFPA 3OFSA 4NWIA 5K0EA 2WJ3A 2IPMA 3OCUA 2O2IA 4P84A 5F64A 5KEIA 5CPFA 4DCGA 2I78A 3N6RA 2HK9A 2M9MA 3IPRA 4GRDA 3T1YB 4EG6A 1S8AA 1W29A 3GUVA 5FBRB 3SM9A 1MPTA 3R2JA 1XV5A 1SQSA 3H9BA 5FEMA 1EVEA 1DKLA 4BO9A 4RULA 4BVHA 5EQDA 3A58B 2VBCA 4AWAA 3L02A 1FMFA 1Z4JA 1EFKA 3NCHA 1P9WA 2Q3EA 5BSMA 4CCWA 2R00A 3H2YA 3D02A 3E03A 1E3LA 3RS3A 4MRNA 3PUYA 4CV1A 3OQNA 3QYJA 1UZAA 2DFNA 5IMSA 3O8LA 4JI1B 2EARA 4A4DA 4PLZA 1JQ3A 3S7TA 3T1NA 4KLCA 3RUHA 4QM7A 1NVFA 4LYHA 1XZCA 4Y0NA 1GYRA 1C9EA 1GCOA 3WGQA 4BY9E 4IKOA 2C2ZA 4X1KA 4BXOB 5AKHA 2CFRA 2E21A 5FUYA 3OT4A 1UL1X 1JEOA 3FDIA 2CMKA 2C84A 1DZ3A 3KAPA 2OEPA 5BSRA 4B7CA 4B43A 1XQ6A 3H1EA 3DL7A 5BN4A 4Q1DA 3R40A 4GI5A 4BDTA 1EJBA 4DUGD 3LRXA 1JQLB 2WIFA 3FMOB 1DJLA 3LLVA 2C9OA 2OXRA 1QVZA 5F9FA 2OKCA 4P2GA 4PGFA 2IIQA 1KORA 1YBHA 1YJXA 2XSZA 1OILA 1QVVA 4IH4A 3WMFA 4CL8A 3DOJA 5GZ3A 2JHAA 4DLYA 2GJKA 2H2DA 2VCEA 1VKZA 1RVV1 3F6YA 2CY0A 3NC1C 3PNYA 2CJFA 1CRLA 2QTHA 3AR4A 1GGHA 3B6KA 1ISHA 3TZKA 3VV2A 4IILA 4BX2A 5IT4A 1M1NA 3HKBA 1NOIA 5DIZA 1DGQA 1OW3B 4TQAA 4CDMA 4BZWA 2IW1A 5ER9A 2NU7B 4F91B 1AGRA 3LFUA 2I9PA 3VZBA 1S89A 1G8JA 3A06A 4YO8A 1PGPA 1AVTA 1C3LA 5CW1A 4UKDA 1F14A 1H6DA 4U7WA 4YMWA 2VK8A 5FOUA 4QLOA 2C61A 5FLEX 3KXLA 3QXHA 1H0SA 4QJ3A 5CAEB 3UYLA 3M0EA 3VDMA 1N2EA 3X0DA 3HCFA 3GQVA 5H4HA 4ZEMA 1SU6A 4D0SA 4YVFA 3GV0A 3QY0A 4ND2A 2OZKA 2VDWB 3H6GA 1GZ7A 1I33A 1K5DA 5B2FA 2BKUA 2AE2A 1F0YA 3CLKA 1Y48E 4O2AF 4R8VA 4KMMA 1ZUD1 3ESCA 4ZARA 3U6BA 5CK5A 3B2QA 4BPRA 1UMKA 2RBEA 2FA9A 1C0EA 3CRNA 5G2OA 3CSDA 3Q7QA 1JFFB 4DSTA 1GG5A 2XUAA 5A1JA 1UDWA 1OWMA 2CVHA 2G5CA 1VJ5A 3EYWA 4TT8A 4DXDA 3JAMA 3LK7A 3JVVA 3BXHA 1ZJJA 3H04A 1Q0TA 5AUPB 3KYDA 2PE5A 2AJLI 1SBIA 3HKCB 4B81A 3EGOA 4TLBA 3TM5A 3H7AA 2VTKA 4KRYA 2JCYA 2XCRB 1EUYA 5U4XA 4BC1A 1O4VA 2DX7A 2HWXA 4RTQA 2PMWB 1HNNA 3QX3A 3GI1A 2PCLA 4GC5A 3ON5A 4GPTA 3MRTA 3LX5A 4LUCA 2CEKA 2J6HA 2BFOA 1KA9H 4RETA 5AH0A 3TGPA 1KZYC 4N0MA 4CBVA 1T9DA 1KVSA 1WMBA 4GXRA 4WKBA 4AIIA 4N3BA 4FEEA 4OAOA 3T4EA 3LM8A 1UBGA 1LSUA 3DNFA 1IHXA 1PBNA 2WJHA 1UKCA 3GA7A 8AT1A 5J4VA 1SULA 1MORA 4MRVA 3RADC 3G9QA 1EWVA 2G7ZA 3B3JA 1NM5A 1T1GA 3G0BA 1D4AA 2BH2A 2OFFA 2Y66A 2BT4A 5JI3E 4PLGA 1KWGA 1TM2A 1O6FA 3AY3A 3I2IA 3S99A 4BUJA 1U8AA 4I55F 4V0LA 1YDWA 1VJ0A 5JNWA 2QR2A 1YR3A 5ITZB 3S2SA 3SIRA 4C01A 3GGSA 4XI9A 3RF7A 2IHYA 3CBGA 4QICA 1PDOA 1NA5A 4DCNA 2ZT5A 2FSGA 2ST1A 1ZONA 3BE5A 3NTLA 1KOJA 3O3OB 2VRBA 2YZNA 4K6MA 3WHPA 2Q5FA 4YQZA 5EWLA 1A7UA 4I50B 3W2EA 3KZKA 3ZHXA 1W49A 4RGYA 4TRJA 5AVOA 5GZ6A 3PCTA 5IDWA 1KO1A 4KUHA 2GCPA 1N25A 2JGDB 3QE0A 1QGAA 3TS1A 3U7QB 5MFPA 4D98A 3PFBA 2FLKA 3IIJA 2QM0A 3M3HA 3T9EA 4AP6A 1QHFA 4WDRA 1V35A 3BDIA 4X00A 1OXMA 4YJFA 1DAGA 1XAGA 1TVCA 3JYLA 3ISVA 3A1WA 3MOGA 1ISGA 2D54A 4MYHA 1F6WA 5SYNA 3T4UA 4EL5A 2WFLB 2XDWA 3BJRA 1J8QA 3PNLA 3CH5A 4G9BA 4UHHA 4RY0A 3RD5A 3MMPA 1W88B 5DISB 4G81A 2ZB7A 1AIPA 4DZRA 3RAEC 2VZ9A 3SR0A 4MHTA 4P53A 3Q8LA 1L7QA 4IOLA 2JGIA 5AVYA 4DRZA 3EGCA 5B7GA 4D5EA 1L4UA 1ORVA 3QYPA 1EH5A 3WLAA 2BISA 1WABA 1D07A 1UJ5A 3C3PA 3PNMA 4RIFA 1KI7A 1XTSA 4DRXA 3KU1A 4CEJA 2Y0BA 1V96A 1S2OA 1PK9A 4AJ9A 1RM4A 2Z2ZA 1EDDA 2JLBA 3O0DA 1T0IA 4EG8A 3E9DA 4TWAA 1JE1A 2ZCUA 4RQBA 4IW3B 2WSBA 3V33A 2HNBA 3NVKI 3NBQA 2J0EA 1NU6A 4KBGA 4YAGA 1M74A 2J7KA 1A9RA 4QU0A 5E3IA 2MHCA 1RXUA 1C3OA 3IVRA 1CCWA 1V8OA 3ASZA 1PWYE 4BV2A 2CNNA 2CXNA 2DVMA 4WACA 1SXQA 4JI7B 5JD6A 2I6XA 3K0HA 2O57A 2VJKA 5DCLA 2HF7A 4XWKA 2A0WA 1J7KA 3P8ZA 1P31A 4GX0A 1RJ9A 1IEQA 1QG0A 3IP6A 4XFDA 3A2NA 4R2JA 7ABPA 1L5WA 3BHNA 3KT6A 1ZOOA 1CE8A 2APJA 3GRFA 4KQFA 3G5UA 3L6BA 2WAOA 1KAHA 2OHOA 4TYWA 1X2EA 1C9DB 2PNJA 5ICCA 3B53X 3K73O 5TT1A 5CGZA 3QKTA 4AZ3A 1JDBB 1R6XA 3BIXA 1EWQA 4M6WA 2VSXA 4I2NA 3DHWC 4LE2A 3GFQA 4W1QA 4BMCA 4YUZA 1URPA 4FONA 1KJZA 1M1NB 3HKBB 4ISBA 4NECA 4O4JB 4OHBA 2XCTB 1N7HA 1IK6A 3V7FA 1Z15A 1UADA 2HHJA 4YRBA 3UAZA 1I3CA 4JP5A 2IYZA 4OHFA 4ZC1A 1I10A 1UM8A 4GWLA 2QTAA 2OXEA 4WD3A 3C3EA 2ZI4A 3SVLA 1Z6QA 1PR4A 5EFOA 4YRIA 3DYBA 4IMJB 4AZ0A 1FP2A 2OBFA 5A05A 1FCJA 3OCWA 3VPHA 3VR4A 1RYBA 4L2IA 3MUOA 3V80A 1PL7A 3M89A 3VU0A 1GPMA 3BXZA 5FHRA 3X1MA 1YTUA 3MTJA 5JVDA 1HNZB 2WZBA 1IN5A 2ALJA 3A05A 4MHSA 4NZPA 3ZCQA 3GEBA 3ZZMA 3QLEA 4CI0B 1NN3A 2P9ZA 5A4IS 1XRNA 1KOLA 1ONPA 4XVHA 3EQ2A 3TAHA 4HYTA 3GCXA 5AW9A 4Y2TA 4N6GA 3ZJ5A 4R69A 4XR9A 4ER5A 3QKRB 2WSMA 1ZD3A 1QGOA 5E6RB 4JSRA 4UTVA 1OXXK 2C83A 2Y6VA 3IS3A 1RCFA 1H69A 1VCNA 4IINA 3E82A 2ZBPA 1Z5GA 3A9VA 3LY9A 4MQFA 3QG5A 2I6GA 1EDOA 1PD0A 1ZH6A 3L2OB 4JT9A 2RHJA 5AK6A 3DG9A 5KOJB 1OFHA 1SHKA 5E2BA 3WK7A 4HX2A 3TVYA 1SC9A 2QX7A 4UM7A 4B71A 3RUIA 1R2QA 4TMYA 5F3RA 5IH3A 1NRXA 1GRQA 4W5RA 3G7UA 2CJYA 3WZ2A 1T8RA 4MCIA 1NULA 3MGGA 4LTMA 5I9SA 1MPXA 3PSAA 3Q8KA 2W2MA 2NM0A 3L4KA 1RYFA 4OHYA 5HK8A 3L41A 1MO6A 5DLEA 3MG9A 2O0HA 4EFMA 1Y4SA 2E5WA 2O4UX 2FZEA 4MS3A 2PKQO 4CM1A 4EUSA 4D3FA 1FMLA 3OWOA 1VGQA 1A8IA 1ZW6A 3PE6A 4RVDA 1YL6A 2CL7X 4JODA 4EHHA 1WTCA 2P78A 1YVRA 2PGIA 3FJ1A 4FFVA 1B8PA 2RGAA 3ND8A 3TOVA 4WZ6A 1QGUB 4YONB 2XKBA 3ID6C 3T9DA 1ARZA 4HXEB 3ZWPA 4M0LA 3PZRA 4AJ2A 4JI8B 2ENWA 3OOWA 4BVGA 5IVDA 5HQ3A 1B2LA 1NW4A 1ZY2A 2A30A 1Z6PA 2NLOA 1JILA 2NYVA 3AEKA 3NTQA 1ML4A 4MVJF 1TLFA 4UATA 2K5UA 3RSFA 5IDQA 5BSTA 2H1WA 5AOVA 2MINA 3R3YA 2ZYIA 1UJ6A 4L4SA 4EHJA 1EFUA 1K6EA 2B8TA 2GF9A 3HB4X 4HLNA 4IDAA 4P4TA 3TLGA 4R84A 5EWMB 1CF9A 5DKFA 1FP7A 1RWPA 3F5DA 2R2AA 1ZQ1A 4LOAA 3L5KA 3JQ6A 1GZ5A 3GJ3A 3GRAA 4TUYB 5DU2A 4EA7A 1MT3A 5IAEA 2W2PA 3AEQB 4YJFB 4RGBA 1C7RA 3ZYZA 2B25A 2BFDA 2KM1A 3PGKA 10MHA 4KR9A 1JI0A 4LWOA 1SVIA 3C7TA 3LZ6A 5E8RA 3I4LA 2ZVDA 2Y99A 5BV7A 5T6MA 3NEYA 3CRZA 3TRKA 5AJTA 2VP5A 1CYEA 1F4VA 3NWPA 2P8JA 3RFTA 1PBTA 4HYEA 2HFJA 1YA6A 1ZGJA 2FQXA 2O8EA 1TJ3A 2IQ5A 3W4IA 4FGLA 1U8ZA 1UBEA 1BDBA 2X3UA 3TQCA 2Q3BA 2WZCA 5FTJA 2BSQA 4F38A 4D02A 4M60A 4FFPA 5GINE 5T3UA 2ODWA 3OH8A 4X6LA 2GN2A 3CZMA 5A3QA 5ALZA 1N1GA 3MMXA 3W3AD 1T6NA 3EXHA 5FOVA 3WLLA 5AQ1A 3PXCX 3OWXA 4KYVA 3TGWA 3WX0A 1EVYA 2CHVA 2EZTA 3QPBA 3CXRA 1H8EA 1U7OA 4PAMA 2FCRA 2J3JA 4FT2A 5IM4F 3QENA 1DXHA 1UPFA 4E70A 3PICA 2R5WA 4JUDX 1L7RA 1ZJWA 4CV3A 1W85B 5JZVA 3U9TA 4J0DA 2FGKA 4HATA 3QXXA 5LNK1 3VU8A 3WWPA 1J00A 2AQHA 3GFVA 2L82A 3MT9A 2GXAA 3DV2A 4B40A 4EKDA 2OE2A 4LQDA 2YH2A 5DW3A 2I66A 3P2IA 2Q3LA 2OQVA 3QELB 4E5DA 1FDOA 2IOQA 3L4BA 2QQFA 1YE8A 3HUFA 5AW7A 1KY5A 2Q41A 3JPYA 3N2IA 3G0GA 4GGPA 4TZKA 2FUCA 3BTUA 1CE8B 4PLTA 1TVMA 2RHBA 4DVGA 5BSVA 3GUUA 3RVBA 4C0XA 4KQKA 5HIMA 4WASA 1PNVA 1A2KC 5CG1A 2C3PA 1NYQA 5EFZA 2Z2JA 1VLMA 3IV6A 4LRXA 2PUVA 4A73A 4IOMA 3OZTA 4BO3A 2D6FA 1L4GA 2J31A 2BOVA 2PXHA 1L2TA 2EKBA 1OKKD 2PRYA 2J5QA 3HBNA 1OAKA 1QE3A 1LA2A 4BL5A 1PX0A 3O9VA 4ZXFA 2HLDD 4FBLA 4UVHA 2KB0A 1DL5A 4N4AA 3IE0A 4GLBA 5ENDA 3T7JA 2C9BA 1AKEA 3NBYC 4YRNA 3ELDA 1RHKA 1NV9A 2JI9A 1HG1A 1NFQA 4JYPA 4H18A 5CCBA 2EQ5A 3PDUA 2XMQA 4KXUA 4KACA 4P4NA 1UDBA 5K6RA 2NVUA 2VA8A 2YJ3A 1R66A 4ML3A 3DFFA 3E3NA 1GTVA 2ZUTA 1ZJ4A 3HDTA 1T2VA 4JXXA 4JMPA 1GYQA 1BN7A 2HBRA 3P9PA 2W6MA 1KKMA 1S7CA 4P7BA 4PLWA 1ONOA 3DEKA 1Y63A 3FTEA 1IPFA 3NW9A 1E98A 5KO2A 2VHZA 1SD2A 3WP0A 4UJ5A 1TVEA 5HX7A 4UE2A 3NAGA 4LJYA 3TF5A 5LQJA 1N6HA 3B6IA 2XMBA 5A5FA 2CLOB 2R68A 1EE1A 2C3OA 4PX2A 3NHKA 1CS4C 3JQDA 3SG0A 3FYSA 1NP6A 5KTPA 4MB6A 4PN3A 2Q9CA 1HH4A 2GVDC 4GX2A 1D8TA 2RK4A 1O97C 4PPQA 4DA7A 3VDRA 1I2ZA 3UANA 2JLAA 2IYQA 1F0KA 2BHSA 3JALB 3DBRB 1JQ5A 5KCZA 1DRJA 1X15A 2MOKA 1RABA 4BNFA 2R8EA 1JI3A 1XEWX 4X1KB 5FLXA 4MV4A 4QTTB 1WG8A 1Z6GA 5IUNC 4R1NA 3L8CA 2Z30A 4K9RA 1G18A 1KI4A 3A3YA 5L3QB 1D5WA 4PC6A 2J3LA 2R85A 1AXEA 1OQAA 4NFYA 2JCVA 1P60A 3AESB 3OT5A 5AJZA 3ZY3A 1RLMA 2CVOA 1RYYA 3FIJA 4RHXA 3UAXA 1BMDA 1X7HA 2DWQA 4FCVA 4R9NA 3EASA 1AK9A 3EZ9A 2NVUB 4EY6A 1WOMA 4YQYA 2XZTA 3T4XA 1RHUA 2B8WA 2GX6A 2PX0A 3DBHA 3H0EA 4Y1RA 4FINA 5JNSA 2WKRA 2IU3A 4I81A 5FI0B 3WSTA 2C4UA 2PMFA 3IUMA 2TYSB 3OD1A 4P34A 2OZLB 2GAIA 4GMFA 1RPAA 4XGRA 5TPZD 2W90A 5DXJA 3A1UA 4BU0A 5TQ2A 4BLVA 4JOBA 4M1EA 5LDGA 3RE1A 5JCOA 1ECJA 3AW8A 3WQRA 5BSFA 2C7RA 3SSNA 4Y9UA 3WMWA 2DPMA 2OMKA 5B6JA 2VA9A 1NRWA 4DS3A 5LWHA 4IR7A 1FRVA 3I1YA 1HLFA 4MS1B 3IAXA 4F72A 5DM70 2YXNA 2P6RA 1XNQB 2AF3C 5KSPA 2XKKA 2AK2A 3HL0A 1G8GA 1C8KA 1YOVB 2VH2A 3AJRA 3GEMA 3UMFA 3VO2A 4AROA 5EMLA 1RWXA 3D7LA 3GLSA 4CG2A 5EJ7A 1PNTA 4A6DA 3E84A 1LY1A 1S01A 4DBLC 4JSYA 2A57A 2C5GA 2AD5A 4RD2A 1MC5A 2Q0QA 1U0NA 4RCZA 1I9CA 1PJCA 4JLWA 4PCVA 5H1YA 1RVDA 2ZJ2A 3X1DA 5I7RA 2XQFA 3MJRA 3V7UA 4P7KA 2Y0EA 4BNHA 4KBYA 1BKDR 3AY6A 2FSVA 1MO2A 1XA3A 1E1NA 2WMNB 4IQ4A 1WE2A 2ZYVX 1T1IA 2O3RA 1I7SB 3EPPA 1RC1A 2FQ1A 3KLNA 1QIIA 1VECA 4C4YA 4Q6BA 1BJKA 1JPJA 2AG5A 3EEYA 3D2AA 4ZYXA 2OECA 2ZREA 1J2JA 1MABA 4N5LA 3O3NB 2CZGA 4XB1A 1UIRA 1Y8RA 3VNQA 3I34X 1PR2A 2JBHA 1KYVA 3EXHB 4ZV9A 1DQPA 2QRQA 2D1QA 3PC2A 3DD5A 4PY2A 4E1BA 3K0CA 3G2QA 4DDVA 4E12A 1QMPA 2VL7A 3EBPA 3MTIA 1JTFA 3AINA 3ZWNA 5J4HA 3S2EA 1NBWB 3NO4A 3V7YA 3JWGA 4OAPA 3SNKA 2FWNA 3TBFA 1J0EA 2BHRA 5JD3A 1QGZA 1TOAA 2OCXA 3H16A 3RVJA 4EDHA 3ROEA 2XRZA 1U0BB 3A2KA 5BUCA 3NH6A 1A7JA 3NIFB 4R7GA 2AT1A 1R7RA 3ZZTA 2DUNA 1J2EA 2AC2A 1VZ3A 3ABOB 5AR1A 5IC4A 2H1CA 2AWNA 1N0VC 2Q8PA 4F93B 3EEIA 3Q9UA 3E0XA 2QT0A 4KQCA 4RL6A 3CZQA 5FOWA 5I8ZA 3LQYA 3NWEA 1HL3A 2DR3A 4EEXA 2Z5FA 3H5AA 2ID7A 2XUKA 3OLYA 1FLDA 5ELLA 2I9KA 2BMWA 4O25A 5A7HA 4DE5A 4ZVOA 1TF5A 4IJWA 4ZC8A 5I48A 5LP6B 2V7QD 4YP1A 3CYFA 1E2QA 3RYFA 2IYSA 5HSGA 3PPXA 2H7VA 1EMDA 3LG2A 3PV0A 5G0SA 4EG5A 4C9BA 2QJTA 1Z39A 3DF9A 3ABSB 4GC9A 4F5YA 5K4HA 1APBA 3AVWA 3TZHA 1V7CA 3CW2A 1AKRA 3LUAA 3QOXA 4XIYA 4LDAA 1GM5A 5H16A 1HO3A 3I04M 3G0OA 1I3LA 2PO7A 2J9YB 5JECA 1HUQA 3GARA 5D5HA 4W9RA 2B3DA 2BZ1A 3Q5DA 4TS3A 4ZU1X 4RPJA 4YN3A 3T9AA 5BVHA 1E94E 3W5CA 2JW5A 4R1UA 1AZLA 3T5PA 3URKA 4AZTA 4ZAFA 4BIIA 2JI6A 3PHCA 1CZHA 1WXGA 2CXSA 1UJCA 1YA4A 3G79A 3PQ2A 4GBGA 4B3MB 1MP0A 3ESBA 3U4GA 3CM0A 5HIJA 3VBEA 1PWHA 2IIVA 2RGEA 3D0OA 5D5QA 3UWDA 1HZJA 3H4MA 4LZPA 4RSMA 1CUEA 5J4KA 1GQRA 2FPKA 1Z63A 1YAHA 4BMXA 3WLIA 2DR2A 1USWA 3L1JA 4RWZA 4ZZ2A 1XZKA 1LGYA 4EUKA 2WU0A 4GQIA 4X1YA 4D82A 4ZYYA 2X0FA 3ET5A 5KPJA 1PGNA 3I9OA 4CPDA 3BGWA 4MUHA 4PTLA 4D6XA 4QFDA 1PUJA 1WPGA 2NU9A 3O21A 1FTWA 1JIUA 4AO7A 3OG9A 4YX9A 4S24A 1DTWA 5CA0B 1N6LA 4NHEA 1NWHA 3F4KA 1AKQA 3V32A 2BEVB 1YAJA 1RMQA 1MGOA 2YUTA 1UBUS 2FG5A 2M1ZA 5EUBA 3ZNPA 4D9IA 5A6VA 4BV9A 4YT2A 2GD2A 3BWYA 4MS4B 1GCIA 1V4BA 4AXXA 1N5DA 4YBZA 1R4MB 2OHJA 3EVGA 3OU6A 2XNDD 4MXDA 1BFDA 1NI4B 1XCPA 1Z0AA 4S1TA 4XTCS 3N2ZB 2QD2A 3KKQA 2Q07A 5IKOA 1JHUA 2FEOA 2GRJA 3WLSA 3HK2A 3S3TA 2IPOA 1XRJA 5MF6A 2GO1A 3PCRB 3KDSE 4CW7A 5ITZA 2YY5A 3RHFA 3G6WA 3TBKA 5KNLA 2OTCA 1RRCA 2XVMA 1YRYE 5T4BA 4C7OB 2HDHA 3F96A 2FF5A 4R1PA 3L0PA 3KB1A 1OVGA 1ZNZA 1I5EA 1OFGA 2P9TA 4FKZA 1J23A 621PA 1VQ1A 2PRSA 1GQYA 2ZIZA 2G63A 4NYJQ 5DI3B 1QYRA 3TSAA 3AWIA 4E7OA 5DV9A 1Q1BA 1N2OA 1LXCA 4KLNA 5U9CA 1NBHA 1W36B 5J59A 1N34B 1CUIA 4DEXA 4YJ3A 5DASA 1NPYA 2C98A 3PT5A 1C4KA 1QLHA 3M3DA 2ET6A 2ZTUA 5IZCC 2JIZA 2VQSA 1E92A 1EM6A 1CQXA 5JS7A 3VV3A 1R8YA 5H81A 2ERYA 4ZK6A 2TS1A 3IP1A 3QVVA 1DX9A 4HDMA 3T3NA 1EP2B 1Y98A 4DADA 1ITZA 5IT5A 4KQ2A 1QIHA 4IPTA 1VYHA 5ICMA 1G8HA 1GN8A 1Z38A 2IUTA 3NWBA 3T9BA 2ECKA 2N42A 3PE3A 3SDZA 4H15A 1CT9A 3GYBA 4H2DA 4NNJA 4UHEA 4CTNA 5A4AA 1WUHS 1XTTA 3OJWA 1OIXA 3ZX5A 1GGEA 2CLKB 3CF2A 4UUPA 1XYYA 3REOA 3S7ZA 3SLRA 4GMHA 2UVQA 4UOZA 4L5YA 1VMEA 3FPAA 2AMYA 2QM3A 3QJGA 4L5IA 1QNLA 3LT4A 5EMKA 3REQB 1WPRA 4WZZA 3W2FA 3Q12A 3H8VA 3EAQA 5A62A 1T1RA 5D87A 3TH5A 1E1LA 1Z82A 1MHPA 4H0NA 4CIVA 2RK6A 1QYXA 2NUPB 3L8YA 4LNHA 4EK9A 4AKTA 4UHJA 4JY7A 2NACA 3WAJA 4DA4A 1M10A 3ER8A 3T7CA 1JRLA 2OVBA 2X0DA 1NNSA 1V9LA 2W2LA 4CIWA 4JCCA 3AI1A 4DF3A 3U4QB 1CP2A 1P5FA 2NU6A 1WETA 2X6QA 3R7WB 1KEKA 4X62B 3IELA 3SQWA 2EFGA 5AJYA 1POXA 3RSOA 3D5TA 1VHDA 2DJ5A 1Z7YA 4GMKA 4IZ6A 1O0BA 2VAVA 1GUDA 3BTVA 1FDWA 3KCQA 1ZYUA 3H5OA 1YOBA 3QXJA 1J8DA 4M0KA 4Q18A 3HPQA 5IJAA 4BO6A 3GD7A 4IO0A 3SCZA 2QVLA 3FRIA 1XD2A 1NBIA 5JS1A 5K4AA 1N2HA 3RVKA 4ITVA 4QDTA 3JTMA 3KZOA 3GLIB 4H31A 2ZDGA 1EU1A 3D3WA 3GEIA 2VIIA 2Q2WA 4OATA 5AM1A 5HFJA 4H27A 3QQ5A 3KAQA 2HXYA 1QZXA 1VBMA 1C9MA 4H16A 4DY6A 4FIZA 4MJLA 2BYTA 3FZNA 5ECYA 1Q1EA 1V1MB 4O5OA 3SQMA 5EMMA 4ZDJA 1C3XA 4M0CA 1G2QA 3S8YA 1T13A 1BRMA 1VOTA 3QLTA 1OBCA 2FSPA 4FHCA 4EPXA 4LJLA 3VX4A 5BRNA 4DLWA 5J47A 3NGXA 3Q1LA 4Q19A 3TOXA 1Q7TA 3FOAA 4AB1A 3OX4A 1BZYA 2B6NA 4C78A 3E9QA 1T91A 3CRMA 3KUDA 2Z4RA 3VZQA 3WWYA 3LNTA 2PLAA 4XUDA 5K8IA 4A0SA 5CDSA 4B2IA 4P83A 2HMAA 5E6UB 1YUMA 4U7FA 1EA7A 3MB5A 1L4EA 3PQEA 4KIFA 2ZSKA 1WAMA 4B34A 4CU2A 1QRUA 3Q0IA 1R18A 4P9NA 5HGJA 3DNPA 1WU8A 5DGCA 3EZYA 5KYKA 1AGXA 2FW1A 3DZDA 3EXG2 3OX2A 4I9UA 5BQ5A 3S1AB 5EWJB 1T4DA 4CG3A 1CUFA 1T8TA 4WVLA 5CRIA 1Y6GA 2Y0DA 2P1RA 4TWBA 3SGLA 4JOQA 5HIIA 5IBRA 4OL9A 1RPJA 3C7KA 1JA9A 3DL4A 3COWA 3O1HB 1AUXA 4FXPA 4LYYA 4B6EA 2I03A 3LXMA 1VLZA 1LSJA 2MSKA 1U2ZA 3QIAA 3A32A 4H3SA 4YA6A 4EABA 1LNZA 1W4RA 1JB1A 4MITA 2NOAA 3O74A 5DBIA 5JVDB 4GOMD 3PEWA 3RAJA 1V8DA 2J9FB 1SCUA 4JB0A 3T34A 5AW8A 2I91A 5KREA 4Q9NA 4RM3A 2IPXA 5F1OA 2DKFA 4E03A 2JH9A 1FFBA 4Q1FA 4MGYR 2ZYTX 1W0KA 3UK6A 2D8AA 1X19A 3QG1A 2X86A 3WBKA 5AI5A 4N8DA 4NZ9A 1T25A 4EIWA 1INLA 1M2NA 1ZC3A 5TJ9A 1OJLA 3PWSA 1UWLA 4F9FA 4QGSA 5F3WB 1N3YA 2Z5LA 4NNOA 1ZOIA 1AZTA 1AN9A 1X42A 5HUQA 1FP4A 3LSTA 2QYOA 3B20A 1DSSG 1UEJA 3V4PB 2VXYA 3EZNA 2X8JB 1LFAA 1DELA 2VCYA 1N0IA 2IEGA 1HDIA 4KMRA 4E32A 1F5NA 4MVJM 3D6VA 1JAZA 3UM9A 4GOOD 4A6PA 1G6Q1 5KYUA 2P9GA 4A27A 1RHRA 2ZFUA 3IUNA 4UTZA 8LDHA 2BRUA 1M3SA 2XUFA 5JQGF 4O2BA 3EPKA 2R4UA 3ZHBA 1FW8A 2C2BA 5IVHA 2BFAA 5A0FA 2EFHB 2XTJA 5HK9A 2I55A 3RYHB 2H7YA 1X2BA 2N46A 3WKBA 1P5JA 2WJAA 1Z4PX 1ZG3A 1A8HA 4X24A 2HU2A 5AKYA 3TJZA 4Z1OA 1A9QA 2C99A 4ARBA 2C94A 2BHTA 1B6SA 4LCEA 4XWAA 5C4IA 3DMTA 2YFQA 1QRTA 4J91A 3H2JA 4LGMA 3ETGA 2PUEA 1CQJB 1BD4A 1G5PA 3MHTA 2VT2A 1Y9DA 3D6MA 3QV2A 1DWOA 5JMOA 3WLKX 1GU1A 3SE0A 4KPUB 3H5LA 5LMNB 3CLTD 2RC6A 1VBNA 1YRWA 3MJDA 1EXNA 2BGLA 3PL5A 1KVQA 5KC8A 1KHTA 1WSBA 1YC2A 4FSXA 1XMPA 3L9XA 3VNSA 3TE6A 2IQIA 2R62A 2XA1A 5EIWA 1TD1A 3E3AA 4YFYA 4YJ3F 2XB6A 4YHHB 2DSNA 1U7HA 3CISA 1SU8A 4GAEA 1UKBA 5C35A 2XPCA 1DJPA 4JZKA 4LSWA 1JEEA 3VZRA 1LH0A 3AO0B 3GT3A 2JLXA 1Z4QA 2G25A 3AFMA 4GMXA 4KI7A 5E1MA 1UXOA 5A0VA 2C5FA 1SBHA 4OQPA 2J3HA 1NDHA 2ORWA 2PS0A 3A3KA 5K9ZA 2ZU0C 4M7RA 5KMGA 3O93A 2C20A 5J1TB 4YYZA 3VI4B 1DOHA 2QOEA 3RIHA 4NDNE 2WZQA 4JOCA 2IV7A 1QHYA 4ZVSA 2O3SA 2AOTB 4OXYA