3DOMA

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
73
structure length
73
Chain Sequence
VVDQIRLWQLELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAKRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
molecule keywords RNA polymerase II transcription factor B subunit 2
molecule tags Transcription
source organism Saccharomyces cerevisiae
total genus 20
structure length 73
sequence length 73
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18307 Tfb2_C Transcription factor Tfb2 (p52) C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2610 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3domA00
3DGPA 3DOMA
chains in the Genus database with same CATH superfamily
4NZ0A 2RUGA 3UI3A 1XR7A 4LF4J 2FGCA 2KHDA 2C2RA 1QUPA 4O4RA 4MFBB 2IDEA 1VRTB 3ZTPA 2PFDA 3UE2A 2OMLA 3W2VB 5K8PA 1M1KT 4F36A 4U95A 1X0FA 4KTQA 2VA2A 3M8QB 1VQ7S 1XC9A 4PXDA 3BDPA 5A76A 5CYMA 4KH1B 1RA7A 2E5LJ 3E01B 1FJEB 4NA2A 1IBKJ 1U7LA 5THWA 2HQFA 1VQMS 2MGZA 2V8PA 1T94A 4LBIA 4B9SA 4W98A 1Q7YT 4PG8A 2RMLA 3OUYA 5KFYA 9RUBA 2R8JA 3PY8A 1NH8A 4OLPA 3DDIA 3V4IA 3MFIA 5DRKA 1MU2B 3V5RA 1YRTA 4O3OA 2MJUA 4Y0FA 1O5JA 4DV0J 2VF3A 5IT0A 2AZ1A 4ZVFA 2W7AA 3BZQA 4OI2A 1W7WA 5KG5A 2D1CA 5RUBA 3OXFA 5IT4A 2FVSA 5F8NA 1OY9A 3ILIA 3AQPA 2IBOA 4P71A 1T03B 2M0GB 4I6YA 2IRXA 1F6TA 2HZAA 3HVRA 2HSEB 4OYZA 2C3OA 4I69A 1I3OB 4R0EA 4WPAA 3W8GA 2IVYA 1S9EB 4W4MA 3QGHA 4LSLA 3RBDA 5LSRA 5I42B 4X4UA 3B4MA 1KOOA 1IKWA 3B54A 3DHXA 2J0SD 2Z4PA 3GR1A 4QWEA 1NUEA 3AODA 1RT7B 4U9RA 2ZH6A 3R7BB 3TWZA 1O0PA 1RA6A 2I1RA 3HK2A 4FYWB 4HVZA 3W9JA 1TAUA 3HI9A 4A46A 2WBRA 3TUPA 5D6GA 2RILA 4O3SA 3IG1B 5IWAJ 5DM6Q 2GVZB 1P9QC 1VQLS 1F9FA 1QUVA 2F9DA 2AJQA 4AQYF 2XS5A 3M2RB 4J9VA 1C1BB 4XAKA 4L6V3 4LVNP 4M5KA 5IZHA 2ZBRA 2BQ3A 1XMBA 3CDAA 1HBNB 2KFYA 4JI7F 1SIWB 3DLHA 3M6WA 4YS2A 2CPDA 3MEDB 2DGXA 1H2TZ 4KB7A 1QSYA 2FYXA 3D6TB 3R5BA 3W61A 2VQFF 3PTWA 3DM2A 3QZ7A 4YQWA 3ENQA 2GMLA 3HJFA 2KB2A 2VC0A 4WIQA 1PJ5A 2V6AA 4PXEA 4CDIA 1AROP 2Z2YB 2AJ1A 5LOQA 2XY7A 4MK8A 3WX8A 3GPAA 1KVKA 2VHGA 3BBCA 2JVRA 3KJFB 3MPDA 4R8UA 1I94F 4P2FA 2Q6BA 3OHBA 1HQUA 5LMNF 1YBTA 2RSQA 3DOKB 3MPWA 4DI6A 1Q8LA 1IM6A 3H4DA 2V68A 3F41A 3MM6A 3EGNA 1HYSA 2GZOA 1S6UA 2EW9A 1FFSB 2W24A 3PKMA 2VDIA 5DQIA 4F3OA 3P96A 5M2RA 3J7YU 1IWGA 1NK4A 4G1IA 2H48B 1VC6A 3BJYA 1WHYA 5KFQA 3W63A 3LAMA 2XSFA 2B0GA 4URQU 3V81A 2KJVA 2LLZA 4I2QB 2V4RA 5D3GB 3DLJA 2M4MA 3PV8A 1LK5A 1NDCA 4X65F 1YDLA 2P5VA 2BJEA 2C2KB 2PEHA 1RWXB 2QYGA 3NGDA 1JJCB 1HNIB 4A8YA 1TKDA 5FLXY 1ZM9A 1JB0C 4DR3F 4ERDA 3BKTA 3ICLA 5L1KA 4CYUB 4GC6A 4F04B 4P2SA 2WB1D 1EETB 3K8WA 3Q24A 2V50A 3KOAA 2NZ4A 1RISA 2EG1A 4RNOA 2CXEA 2O1PA 1KVIA 2UUBJ 4B3TJ 4OX9F 4CWBA 4JI0J 1M5KC 2QL7B 2XZDB 1X9SA 4XDDA 2AW0A 1VS3A 1P6TA 1ZH5A 3KJVA 3K57A 1WG4A 4QIVA 4LVOP 3L9ZA 3AHPA 3ADAC 4ID5B 3EICA 2OP5A 4Y28C 4DR5J 2C2MB 1GAOA 4DU8A 2VUGA 4KE5A 2FJXA 2HFUA 2ZH8A 3QIPB 4IR9A 3DYAB 4TQRA 1T05A 1HPZB 1FDNA 3BGFA 1V3ZA 2DGTA 1KLMB 3R3TA 2Z57B 1E6VA 2A6MA 4OZ1A 3IXQA 1QAYA 5F41A 3JYTA 4ED5A 1N33F 1P1TA 1R0BG 2VG5A 3GFYA 2VASA 3BGOP 3DU5A 3FEXB 3OT9A 1Y7PA 2WVEA 4NCAA 2VIHA 2DNOA 3FC9A 1M5VC 4JYAF 3KUGA 2W9AA 2GAHC 3DLLQ 3QT6A 3UN2A 2V2KA 1S10A 2ZVIA 3G6XA 4DSFA 1UW4A 2G1DA 2R8HA 4OX8A 2QV6A 1JJHA 3RRKA 5BR8J 2JOQA 5GAGU 1Y5IB 3OLBA 4JI5J 1BLUA 2EK6A 3DLBA 2CNKB 2Q79A 1KQSR 3T5LA 5LL6d 3W8PA 2WBMA 2MZTA 4MJKA 5CZVA 1BE4A 2QJ3A 4F2RA 2FQQB 2GW8A 2EEYA 3K7RA 3MEEA 2R2RA 4BCAA 2ZZTA 1NK9A 3I0RB 1K1QA 2DGQA 2ZVSA 2R7VA 1KKHA 4M5JA 5EUHA 1T3NA 4PXCA 4TU7A 3ZZPA 2ASYA 3PW4A 3D54A 5SUHA 1YJ7A 1YZ6A 5M2UA 3BF4A 1Q53A 1CQMA 1X5SA 3EUNA 3VALA 4ELVA 2FZKB 2N3LA 1RTDA 4RJVA 1R8HA 4FVMA 2BRLA 1RHJB 4ETZA 2EXUA 3B4DA 4WFBQ 4B9VA 4DL0C 2AGQA 1SUQA 4C8YA 2KN4A 5DQGA 5DG7A 2GHVC 3Q86A 5D0HA 3G71S 3VAMA 2FB0A 1OO0B 4JV5F 4USJC 3HMJG 2CADA 3I87A 3ENAA 2OTJS 2BEFA 3C6UA 3MHYA 4PZVA 5CYQA 1RQ0A 2M70A 2G1HA 1DARA 3H40A 3QAUA 4CO5A 1UMJA 2E9TA 3PIOQ 3QSYB 2BOPA 4USMA 4OI6A 3CJQA 2BQRA 2CWKA 4FF4A 2AX1A 4ZVOB 1T9YA 4IKAA 1SQEA 4IOAQ 1QJHA 4C11A 5JXSA 4WIIA 2BBEA 3NNAA 4LR9A 5A8WB 3KK2A 3V4MA 1L3VA 4K4SA 2HHTA 4M1KA 3SCLE 1E6YB 3N5BA 4P72A 2ZBPA 2BM1A 1IQZA 1SKWA 3PR4A 3HHLC 5L1LA 2OEJA 3H5SA 4DR7F 1H73A 1RAJA 3CCZA 5ETPA 4BBYA 4BS2A 2YNHB 4YY3F 1YWXA 3MM7B 5CCLA 1YITS 2DRBA 3Q2SC 1U1RA 3H2LA 3IBWA 3OL7A 4LIRA 2VICA 3EZOA 4YN3B 2R4FA 4P7TA 3OLAA 4Q8FA 3CT9A 1PJ6A 5G0RA 1UJ6A 4FNIA 1N52B 3MAAA 5J2NB 4JI2F 2B56A 1S59A 3J7AN 5ETVA 4EYHB 3NOGA 1SC6A 1Z1ZA 5C2GA 5AE1A 3SV4A 3HZGA 4DUZJ 2WVFA 4OV1A 6AT1B 3C14B 2AYEA 4ZVPB 1VK8A 2E1RA 1TL1B 3LF0A 4D3GA 3S8SA 3ZTOA 4ED6A 4PQUB 4UZBA 1QAJA 3V6DB 1QE1B 3M9MB 2HVHA 2RNEA 3ILLA 3KLEB 4ANEA 3KDNA 4NI2B 2DO4A 4FF2A 4LRBA 2VZ9A 3SFGA 1BQNA 4DLGA 3CCVS 3DN9A 1H74A 1WJ9A 3OR2A 4XDCA 1ULRA 5B0EA 4QYRA 1VRTA 4DQQA 4OYPA 1FDBA 5KFCA 5HMYA 4DV7J 5K8MA 4AUKA 2MSSA 2MTLA 4M5HA 3DNCA 5EN1A 2CJQA 3BBFA 3OTOJ 1YGYA 4WZQA 3EPIA 1O51A 2XHCA 4F0KA 3MMBA 4QYZK 4AL6A 3JSMA 3BSNA 3JQJA 3KLIA 1U0HB 3CDUA 3MUVP 2HFSA 3ETOA 2V34A 3H2VE 5DDOC 1R43A 2U2FA 3OQ2A 4EBEA 5E41A 1VIOA 1XNQF 3LWMA 4CM0A 2DPIA 1R8CA 4CRJA 4ID8A 3MMCA 4B9TA 2L9DA 3O6QA 1M90T 4EZ9A 1ZPVA 2ZHOA 1PBUA 4PG7A 2SXLA 5D0RA 3MCSA 4H4OB 1BC6A 4DV4F 2HNYA 2X7IA 3JQMA 3P45B 4NZ7A 4P74A 3A8KA 3D1OA 2Y1LB 1VRUB 2FHJA 4ZHRB 4CO1A 1U8SA 3GB0A 1W2BR 4IRDA 3O3LA 2ERRA 1C0UA 1F5BA 3SV3A 1Y9OA 4K4UA 1BMQB 4PRFA 3HJVA 1RT1A 3CPWR 1HBMB 1YLXA 1UPMB 1UEUA 3MMAA 1B70B 1LW2B 3D3BJ 3M8WA 2M8DB 1HNXF 1H6KX 2WRMA 4M5IA 3ETMA 4F25A 3HSDA 1TL7B 1N5YB 5KFVA 2L41A 4RL1A 1FJGJ 2ZH2A 2FY1A 1RU2A 3UO0A 4PABA 4Y6IA 5FD1A 3MM5B 3VGUA 2AIRB 4OHVA 5EWGA 5CD4A 4C8OA 4NCGB 3OXGA 1RSCA 1HNWF 2HHHJ 2AKWB 2W2NP 5C7PA 2DNYA 3M4XA 3CJKA 5HBMB 2AEFA 3W9IA 2RQCA 3SIPB 4FZVA 2NYIA 2AJ4A 2GVZA 3MXHP 4ECRA 3QFWA 1FRMA 3EWGA 2AHOB 4J9LA 3R7SB 3KLGA 2I9SA 4WYWA 2RKIB 4DQIA 4K2JA 3Q8PB 1LWEA 1S1UA 4HACB 1YIJS 1CJKB 4OYAA 4ZP8A 4CNYA 4B08A 1WEZA 2MXYA 2ZHAA 1TFWA 2YY3A 1FEHA 2J76E 2BKPA 1Y11A 1V5VA 1LWCA 1U1PA 4B3OA 4DUYF 3AXKA 2BYCA 4KKOA 1DZ5A 4G1QB 2J7KA 4JI4J 3CCWA 2NXEA 5G4DA 5AXMA 1VHFA 4GRSA 3TR5A 5HP1A 1TR0A 1KNZA 2KYXA 2E9ZA 2QSFA 5DLGA 3KFWX 1IBLJ 2DO0A 2HQGA 1WC5A 3LP1A 3QAEA 5KFMA 3PEHA 1DTTB 2LU2A 2KFNA 4QWCA 4DMZA 4NE9C 2CPHA 3ITHA 1JXVA 4U7UD 3SI8A 4TY8A 3WIVA 3M8ZA 3U1NA 1R8AA 2XNQA 1XR6A 2J8AA 4LF7J 3FCVA 3M7VA 2HMIB 2H1YA 4FXDA 6FDRA 4IG0A 1H38A 3CCES 3N4WA 5KFLA 2WVBA 3MAHA 1Y4ZB 4FF3A 4RZRA 1Y5LB 2DR8A 2V4JA 2OKQA 1R0CB 3NXZA 2DVIA 1MW7A 3RRHA 5IQ6A 4DCPB 2PDAA 2BJ1A 4NXMJ 4CTAA 5C24A 1FEEA 3CJ4A 5D4NA 4A4JA 3T6BA 3DGPA 4DDFA 4OYXA 2F4VJ 3LW5C 1FHTA 1EB0A 3GJTB 3EDRB 2A6OA 3M2UA 4KV8A 2N4DA 3QJLA 3K89A 1S99A 2QLBB 2RQ4A 1WF1A 4BDPA 3E2EA 3ISND 4WYLA 1GTHA 4X66F 3D0IE 2DHSA 1XIQA 4NLXA 4UY85 3K59A 3TUZC 4PG5A 4KHPF 2BE2A 1U0SA 2CWXA 1U6FA 3MWBA 1VQ4S 3OJUA 1JLCB 5A6PA 3IR7B 3OJSA 5ETSA 1WACA 1SJ1A 2F8HA 2LQ5A 1WKLA 2RB7A 4WE1B 4UF4A 1UWBB 2HQCA 4U8YA 1HWUA 1HWIA 2VQEJ 2OD4A 2Y0BB 1WEXA 3D67A 3Q83A 1NJXA 4AXJA 4OX7A 3QRPA 1JLEB 4JI8F 3Q0AA 3OBIA 4LFBJ 3F56A 1FCAA 1YQHA 1ZOTA 2UXBF 2FLPA 3BO4A 4L75A 3LPEA 4LF9F 4KFBB 2IJFA 3PXGa 2CJKA 4DV3F 4U6PA 3BQ2A 2WAQD 4DV2J 1U2RA 3G82B 2B7CB 1Q79A 3M2VA 3VVTA 4ZVHA 3W1YC 1BHNA 1NPRA 3IP0A 3MMJA 1JLBA 2M52A 5F8GA 2ZJRQ 3IRWP 2HNDB 3Q23A 2VB6A 4FP9A 5DG8A 1FFWB 1WC6A 4FYVB 1CJVA 4K4TA 4KO0A 3VAKA 4GMKA 3T3FA 1UVLA 2VBXA 1HIYA 1XBWA 3G87A 1V5IB 2PI4A 2UXCF 4I2PA 1VQ6S 2FVCA 4WTYA 4ECWA 4F3QA 5HJXA 4G3IA 1NZAA 2WHOA 2DRDA 3ELHA 4JI1F 3ET6B 2BUNA 1RE1B 1NB2A 1U02A 5F9LA 2HGLA 3HT3A 2R42A 1VYAA 5KFTA 1TL3B 4LF2A 1LFPA 5A0YB 2D3UA 4TXSA 1JIHA 5B0FA 4DL6A 5C25B 2JZ5A 2OPRB 3DMJA 4XIUA 2VBZA 3HKWA 4QIFA 4RO0A 4MYUA 3KK3A 4M8LA 4QIWD 3IRXB 1S6OA 4NEZA 1J5EJ 2RH3A 3TAMA 1IN0A 2F8MA 1UPPA 2HFVA 2NXUA 2KT5A 4N5SA 2V63A 5DGBA 3KK1B 4OYOA 3R5CA 4C0HA 1RTJB 5IXUA 2J9DE 4ZPWR 4IDKB 2PA8D 5J2QB 4RW8B 3DLEB 4MIAA 3PNIA 4N76A 2HNZB 2CG8A 5KFOA 1FTCA 3X3UA 3NAIA 1N36F 2ZD1A 2DHAA 1F2GA 3Q89A 2V9KA 4F7VA 1HBOB 3L7UA 5KFEA 1FD8A 4UUWA 2C2DA 4O4GB 3FKBA 2V67A 3EGVA 4NL5A 1SJ3P 1FRXA 3DRXA 3RU0A 1T9TA 4IG3A 4J7CA 1JXLA 2HKEA 2N3OA 2HVZA 5FJ4A 3G8SA 4TYBA 1K8AT 2H3EB 5AJ3F 4X84A 1X9WA 3C15B 4DX5A 2DXDA 1RJJA 1FXDA 1EQMA 1J5OA 3RB6A 1FWKA 4ITSA 1RHKB 2N4CA 4IO9Q 4OZ5A 1JLQA 2YPZA 1NSQA 1WUUA 4F0MA 2QX0A 3HFZB 4E0DA 1RTIB 1N0UA 2VODA 1PC5A 1T95A 3K8VA 2GGPA 3K5OA 3I6PA 1K0VA 2HQDA 4LF4F 3HD1A 2QTWA 3A12A 1LWXA 4YB1P 2CVIA 1KRPA 2JDJA 3DOMB 4WBFA 1DTQB 1SI9A 3J80Y 5BYSA 4RW9B 1JXEA 3SDEA 2AJFE 3NWRA 5ETTA 2E5LF 1C1CB 4DR4J 2HWHA 1IBKF 4QR0A 3UCUP 3N6LA 2A3JA 4Q8EA 4Y2CA 2JFKA 2CPFA 2I5JA 4WZMA 1NBEB 2LYVA 4WP3A 2WOMB 4QZVB 1VDHA 4A8XA 2HWIA 4ILMA 3HF5A 4OL8A 1TUGB 2BOAA 4ZIVA 1S9GA 1WWHA 1PYSB 3J7Z5 4DFJA 5T14A 4B9UA 2PD1A 5KFBA 1TTHB 3RW6A 1MMNA 1WKJA 1LW0B 1YRUA 3N5FA 5T7LB 2VPYB 4EFAC 4FXWA 2QFJA 4X4SA 2B6AB 1TL4A 4YHHJ 3CJ8A 1JNZB 3GFXA 2G2YA 4NI2A 4JB8B 4UOGA 1N48A 3MD1A 2C22A 1ZM3A 4B9LA 2RUSA 1HR0F 1IUJA 3GTYX 2JEJA 3DRYA 4GVBA 5E0OA 1NKCA 4K0KJ 2Y1RI 3POTB 2K7KA 3PFOA 4HT5A 3NP5A 4G1PA 2B5JA 4O0NA 2HK2A 3OL9A 3HHDA 3PCOB 1HFEL 4CO0A 5HLFB 5F8JA 2C3PA 3P6YC 3OXLA 3ZTQA 2KL8A 3GZ7A 1N6QB 1XEZA 1ZS6A 4ZCMA 2DY1A 2UV8A 2QYCA 3NBPB 4FS1A 5F3TA 1T9UA 3NNCA 1Q86T 4LF6J 5ETNA 2PMZD 1FVSA 1RTHA 1FD2A 5IS2A 4LT6A 3HHLB 3CULA 3MAQA 2MB0B 1HBUA 5KOWA 2EPIA 5JMNA 5IWAF 3EZUA 4KBIA 1NCLA 1YKWA 2CQ2A 2B8PA 2MLYA 1UAWA 4RNHA 3D1HA 2DNZA 1T11A 2DEIA 1L5UA 2EWHA 3AD7C 1YG0A 1UVNA 1H72C 3QRRA 4QIGA 5LMUF 2IA6A 3D68A 4J9OA 2R2TA 1REVA 1OY6A 2NLWA 1N34F 3UD4P 5K9FA 2FD2A 4DN0A 4JV2A 2AQ4A 1HBMA 2VPXB 4KGMA 1SJ4P 1RT4B 2ZH4A 1CS4B 3DRRB 3IN5A 1GXTA 5HQMA 3FQKA 2GIFA 2AJ0A 1F9EB 1U6ZA 4EBDA 3FQLA 2X3DA 4LR8A 4K8RA 4C2MA 2POKA 2VJUA 1HI0P 2F4FA 2KG1A 1RT2B 2UU9J 2OH2A 4BLGA 5K14A 3GFZA 4RW4B 4IFYA 3VGVA 2KFZA 4PYDA 4NYOA 1ZETA 5F8MA 1IKVB 2YKNA 1FJCA 4AL7A 1F1BB 5B0BA 2J0QD 2A0FB 2VC1A 1JMTA 3ISZA 1SJRA 2B43A 2JC1A 3US5A 3CD6S 4DOZA 3J7ZT 1UFWA 1G3OA 2KJWA 5ETRA 4J9NA 2WZ1A 2OI2A 4HR2A 2P9EA 1TUWA 2ZDOA 1TFYA 4WJBA 4NMLA 3T1YJ 5F8HA 2AT1B 1TELA 4GO5X 4IH5A 3KUHA 1SC3B 1N54B 3TNVA 1FRJA 3I55S 4W90B 4D3HA 2ADCA 1NKEA 2WCXA 4RUBA 2A18A 5KG2A 1Q8KA 2CUYA 4L3KA 5LM7E 1TKXB 3GJQB 2W2QP 4EI2A 3IS9A 1FJ7A 1NSAA 1S49A 3PW7A 3EXCX 3P3DA 4DV1J 1SC4B 1XMOJ 3VR1A 1LKZA 3R7NB 1Q5YA 1PKUA 4ZIWA 1FE4A 1WELA 1S72S 2J9DA 1VJWA 2RS8A 5IC6B 2WONB 3IC1A 4PAAA 1F3VA 4B3TF 4JI0F 3SFUA 2IYIA 1EP4B 1FO1A 4B3RF 3O1LA 4DPOA 3CDBA 3LH2S 1DQ9A 2CZ9A 2UZAA 3K17A 1UTAA 2K1RA 4TVAB 1FERA 1JLGB 4DR5F 1S1XB 1MN9A 1HQEB 2QFIA 2V4QA 4YR0A 1HNZJ 3D66A 4M5NA 2CQ0A 4NASA 1SH3A 4NLUA 2UVWA 1X7VA 2K3IA 1BGXT 3HHLD 4ANCA 1G6BA 2MKSA 2H65B 2XMWA 2HYIB 4B9MA 3T9ZA 3M1VB 1YJNS 3B6BA 2HZVA 2DNGA 4MKBA 3KYLA 1DRZA 1X4BA 4MH8A 1B7YB 1APSA 2DITA 4MT1A 2R8KA 4LRCA 2MQQA 3HVAA 4YEAA 1H3DA 1J27A 1I6JA 4ED4A 1KFDA 4P73A 4Z37A 2LQBA 2AYGA 2Y8WA 2Q6CA 4OJHA 5J2PA 3PW5A 3TEGA 2W4DA 1TL5A 2W01A 4A48A 3TO8A 1XNRJ 1RT3B 2KRRA 4QWBA 1V3SA 4P10A 4HDGA 1RWPB 3BDEA 5BR8F 3KJQB 2YKMB 4JI5F 3FBEA 4OIXA 3PIPQ 3GIJA 3D6MB 4QWDA 2VG6B 4F67A 2Y1IA 4MMOA 5HMWA 2C3YA 1L3UA 2NPFA 2GV1A 1RT6B 1FT8A 4R0JA 2M3DA 2XHWA 2CZVC 3W65A 5L8RC 4MK7A 3FRYA 1VIXA 2CQDA 4YDDB 4ZJQA 4DG1B 1DLOB 3HKZD 2G2ZA 4WKRA 4DL2A 4Y2IA 5E3RA 4NRTA 3U1MA 5K8NA 3BKFA 2FGOA 2OSQA 4OJGA 2E7VA 2OMOA 3GYNA 3DLGB 2ZHBA 3RR8A 3D28A 3AY0A 2YKPA 2V8HA 1IKXA 1XERA 3CJTA 2IPOB 5KFXA 4A8OA 4M5DA 2R7RA 3VZIA 4E98A 2G13A 2Z2ZA 3BGRA 4IOCQ 3A3NB 4F02A 3TZYA 1HWJA 3A8EA 4O3NA 2GFFA 2IM3A 1TQLA 3GV7B 1RWVB 1QDUB 2VFSA 2HBZB 2DHHA 5GADU 4ICLB 5JJBA 4DPYA 4J90A 3IFEA 1ZM4A 2BMBA 4RNNA 2GQCA 3UNGC 1ITPA 2XY5A 4ZDNA 2JHEA 1S7IA 1T3OA 8AT1B 1KDNA 1UZDA 2HIQA 3IR6B 4ZN1A 4OHWA 3LP0A 4U8VA 2DY9A 2R2UA 4HTIA 2E5HA 2RDIA 3MECA 3MCNA 2DH7A 5T41A 4BHQA 3FBBA 4DZDA 4ALZA 1VOMA 3GIRA 5FDLB 2GQQA 2X1AA 2A2DA 1ZTTA 1U1OA 4B3MF 2E7WA 1RGVA 2UP1A 2CJAA 1U49A 2O3DA 4AQYJ 4C97A 1CPZA 3VAIA 2KKHA 4HL9A 2E7XA 2RDDA 4KRWA 5I3UB 1FNOA 3R1LA 2RDJA 2VL1A 4WK3A 4WXOA 5J2QA 1FKPB 1IQTA 2ZC4A 3VV2B 5F0WA 2JWNA 3M32B 3EVOA 4GKKF 1TKTA 2JEGA 3HLUA 4U7CA 1TKZB 4Z7CA 4FN5A 4DEZA 2VQFJ 3M8RA 2GVDB 2ZDPA 3DRSA 1HW8A 2HHQA 5HROB 4TNOA 2OAUA 1SV5A 3R5AA 4RNFA 3EZ5A 2YNGA 1Y5NB 5M2PA 1Q8BA 2BE9B 1JLAB 4TLRA 3CIZA 3KJNB 3KDOA 1CJUB 2RT3A 2QLXA 3QT7A 1I94J 2HK3A 3KLHB 1Q82T 4J91A 2FJEB 2W9CA 3GG0A 2CVEA 4USUA 5LMNJ 3BH7B 5C42B 1MROA 2ASJA 1IKYA 2BV3A 1S1VA 1XJWB 2OPSB 2FDNA 1FK9B 3GJSB 4AL5A 3R5JB 1KBRA 3PHEA 4LREA 2B9EA 5F8LA 2GAGC 4UTGA 4FKXA 3EMTA 5EWFA 5ETMA 2AX0A 7AT1B 2KM8B 3MR7A 4F4WA 4DV7F 1M5HA 2NZCA 2CKWA 1PILA 5AE3A 4O44B 3FGVA 3OTOF 4A8QA 4ANDA 5KFUA 3QT8A 2XG8A 4X65J 4KGXB 2UVUA 5EDWA 3NGTA 1ZTWA 4I68A 2WOMA 3OTCA 5E3QA 1C0TA 4NA3A 2W9BB 2J5AA 3GSIA 2FTRA 4RR5A 4DR6J 3SQGB 1NU4A 1HMVA 2Z2MA 3QO9B 1PO6A 3BYRA 2FPHX 3IWLA 2VFTA 1JNRB 1MWQA 4CH1A 3D6HB 4Q45A 4OZJA 2HFOA 4UOHA 5B0GA 2A10A 2PMHA 1W26A 1XTZA 1S6PB 1S1TB 2ZC3A 1TMJA 3UDCA 3J80U 2M7SA 2YX4A 5J1EB 3TW0A 1NHUA 3BREA 2AJ2A 4NEYA 1VQNS 4OJ1A 1F0XA 1N5SA 4X64J 3ZZOA 2GIRA 3WZ0A 2DNHA 2PC6A 2YNIA 2CQCA 3H42A 1RK8A 1VHIA 1FJGF 2XLJA 3K5MA 3C6TA 4CI0B 1MWYA 1VC0A 1GMWD 2R2SA 2PT0A 2M2BA 3RJMB 2C3MA 2UXDF 2DEJA 3ZZZA 1N33J 1FKOB 4LFAJ 2X1GA 2FZGB 2DNLA 3IGNA 2HHHF 4IQMA 4OJ3A 3TZWA 2ZNYA 3QJPA 3HHLA 1NHKL 2QSWA 3D7SB 5D4OA 1LXJA 3BQ1A 2W1BA 4ECVA 1T0TV 1JKHA 4JYAJ 3IMQJ 2HHSA 3M30B 5IOLA 2CA9A 3CC2S 4I6AA 4LSNB 3TOQA 4ZJLA 3SCJE 2E5JA 3C16B 1RT5A 4FBUA 3UD3P 2DNRA 4QU6A 4KSEB 3QT5A 1V6HA 4OFZA 5F0UA 3B78A 3H59A 2I0XA 1G7CB 5CABA 5IT9U 2IJNA 1YVFA 3MM9B 1CJTB 1B0PA 4C0BA 4OI3A 4Q44A 3CGIA 5KFFA 3NLCA 4XPCA 2ASLA 2LKZA 5L1JA 4CZCA 3VQTA 1GK8A 1Y10A 1TVRA 3EJMA 5K20B 4K50A 3MD3A 2GO9A 3Q8UA 3GIIA 3W2WB 3CCQS 1IBLF 2OPPB 1HNVB 3DOLA 4PPDA 2HHWA 4F4YA 3LPYA 4YUDA 3RBEA 5KFRA 2IHR1 4BC9A 3T1HJ 4CP5A 4CLFA 4Y2MA 3IWXA 1B4SA 5D77A 2DGUA 1Z2LA 2E1MC 2XEXA 2IIHA 2NREA 3GWCA 1VRQC 3VGSA 4L74A 3CJ0A 1SL1A 3HVTA 1QVFR 2D7SA 1BUXA 4IQXA 4WFNQ 4LUBA 5ETKA 4JBCA 2VONA 1HL6A 1T02A 5JUMA 2E1CA 2QMXA 3AH6A 2IMOA 2V2VA 3C3LA 3HHKA 1EHWA 2DISA 4F50A 4RNMA 4WU3A 2L08A 4M5LA 2B9XA 4ECSA 4NXMF 1FRHA 4ZA1A 5KG6A 3KG1A 4OZ2A 4M5GA 4O3RA 1LWFB 1S1WB 2BE7D 4USHA 4CO3A 2A1BA 2ZJQQ 4U7UK 3PVXA 2F4VF 2NXCA 3W7BA 4DR1F 3I0SB 5E7OB 1TV6A 3PX4A 1S6QA 4DZ6A 4I7FA 4ED0A 2WVCA 3ZTRA 1R3NA 3HVWA 1N32J 3HZEA 4NLQA 2VG7A 3LGNA 2BA9A 2EK1A 4M95A 1URNA 3KHLA 4RW6B 2QRRA 2ZZNA 2FLLA 1U2FA 4PQAA 4NLYA 1AZSA 4ECZA 2QA2A 2QEXS 1UA1A 4DR7J 2J6UA 3H7HB 4QU7A 1OQ6A 4QPTA 2B4UA 3CCLS 2XMTA 3AA9A 4QWAA 3CO9A 4DJBA 3OHAA 3RYLA 4N8OA 2MKKA 5CYMB 3VCDA 4CM2A 4LFCF 2VQEF 1KC8T 2W8KA 4NA1A 3HULA 1K1SA 4OQJA 2QGFB 1SQGA 4TN2A 4I6WA 4C3KA 2MGZB 4LFBF 2BANA 2Q66A 4OYIA 3MUTP 3GLJA 1OQ3A 3T19A 4QPXA 3QYYA 2JEIA 3OUYB 1S79A 1RCXB 1IM4A 3EVMA 2G0JA 3NCPA 3HDSA 2ZE2A 3EDQB 3V4IB 1R0AA 2C42A 1M5SA 2BVZA 2ZKTA 2V94A 2KDOA 2CIMA 3RAXA 5L39A 4FF1A 3TZXA 2V2ZA 4U67Q 3D3CJ 3GJRB 1GX5A 1XR5A 1T9VA 3U02A 2MKHA 2Z58B 2BJDA 2CQIA 2MPUA 3L95X 5AE2A 3M8PA 4WFAQ 2VA3A 4H4MA 3W62A 3UN5A 4O0IA 1JJ4A 1SC1B 2RVJA 5E3PA 4QR1A 2FHOB 2B51A 2XYGB 4PXBA 3CCMS 3CCJS 4LSLB 3JSRA 4TYAA 2VOOA 3MM8A 1IKWB 1D3WA 1UETA 4OZNA 5KFPA 3TEHB 1LXNA 3VAFA 3MOZA 1W2IA 2XCAA 4MAKA 3RW7A 3QGPA 1KTVA 1BWVA 3IM8A 2QMUB 1EARA 4UW2A 4LBHA 5GAEI 3OSNA 3FJ2A 3O8WA 1KEKA 1ZZFA 4PUOA 1X0PA 3DLKA 2HEKA 2K3KA 1TK0A 4ED7A 3DRPA 2F5GA 4E8UA 2HLTA 3DI6A 3AB2B 4IH7A 4NX9A 1NEEA 2GJIA 2RU9A 4J9UE 1HQ2A 4QW9A 2NYHA 3PYFA 4DV6J 3V6JA 1P8GA 3FFIA 4CLKA 5GAHI 3RUBL 3W9HA 1RHQB 4DCOB 3LP2A 3O2IA 1IBCB 5KG0A 2MHEA 2BJ8A 1SXLA 2R7QA 4HH1A 4K4XA 2C28A 4URGA 3BEGB 1RCOB 4RKUC 2IAJA 3F44A 3SSRA 1A9NB 3H90A 3PR5B 3DM2B 4MKAA 2J6SA 1HNXJ 3MEGA 1N5TA 2AD9A 4DX8H 3DU6A 3T5HA 5AXKA 4QCLA 2YWWA 4RW7A 1R8BA 5B09A 1VQOS 2HRYA 1X9MA 4X62F 3UDEA 2IBKA 2QZ8A 4R8UB 2E1AA 3LWLA 1NJZA 2DNPA 1WHXA 2RHQB 2YXLA 1HQUB 1HNWJ 3NRBA 2P2CB 2PO4A 2DGSA 4KIAA 2R8IA 5B7WA 2HRTA 4KQZA 4WFYA 3PHTA 1GMWA 3MM6B 1SKUB 4ZP6A 1HYSB 4AYBD 3P4UB 1KVJA 2LDIA 4G65A 4LBPA 2RHSB 3MTJA 3EGWB 1AXQA 2HBQB 2P6SA 5ETQA 4Q43A 2LECA 4KY3A 1FKPA 3V81B 4JUZA 2CQ3A 4YB5A 1H2VZ 3H20A 5DO2A 3RB4A 2PA3A 3FZ2A 1WNEA 3GR0A 4J9SA 4P7VA 3BO3A 2GCFA 5KFSA 2Z30B 4X4VA 2R3VA 4Q0BA 3WX4A 4UOFA 6FD1A 3HSZA 3EXYA 3CCUS 4DV5F 4CO2A 4JV0A 4Y65A 2D3OR 5LT5A 4ED2A 1X60A 3GONA 2ZBCA 3PYGA 1Q5VA 3GFHA 1UJ4A 2DK2A 1WD6A 4DSEA 1IBMJ 1PYTA 2CDRB 2UUCF 2HFNA 1FA0A 4EU0A 1HWKA 3OVAA 4F4KA 1ZPWX 3KXDA 4ZS6A 2CRLA 2NXJA 2XMKA 1CULA 4QBUA 3KJVB 4HYKA 2EBEA 2E66A 3VWSA 1MNEA 2IC3A 3UVJA 3CVKA 2XNRA 4K7QA 3SMZA 1REGX 3EVWA 2YNFA 3PO5A 3AJ2A 2D3O1 4YDXA 5J2MA 2WSEC 4DQSA 2RE1A 4HLBA 4F0HA 2IM2A 2VH7A 3MEKA 4OHXA 2UUTA 1T05B 3AAWB 4J9PA 2ADBA 2EG2A 1E6VB 4PWWA 3N9UC 3WBZA 2JLGA 2DPJA 3JYTB 2IVFB 1YJWS 5EHHA 1RDRA 2VG5B 3LGHA 3SXLA 2ZH7A 3TA2A 3DXSX 4NOHA 3OR1A 5D0EA 2RF2A 2ZUAA 3LA0A 4YP3A 3W66A 2FJAB 1LV5A 4PKDB 4IH6A 3GV8B 3BGLA 1NB7A 4KGZB 3D0GE 3I5AA 1FXLA 2HFZA 3H4BA 4HI1A 3RR7A 3G8QA 4CT8A 1K44A 5BJRA 1X5OA 2XMVA 2ZKUA 2MKCA 3VAJA 1ELOA 1VQ8S 2V69A 3A4TA 3LGMA 1YJUA 3CCTA 1F60B 1RAIB 1OWXA 5A2QY 1FRIA 1QAXA 3T1AA 4C3LA 4HI2A 3M9OB 4X4OA 4GO7X 5GMKa 4TQSA 2CQBA 1FXRA 5DJBA 3QPIA 4IFVA 1UFLA 2NSBA 1VQKS 1AA1B 3VGTA 5A8KA 2GHWA 1FWLA 2DXFA 3F0NA 4Q5VA 1D8YA 3IR5B 2RRNA 4EGLA 2ATCB 3MEEB 2DNNA 4CLWA 1SJQA 1BQMA 3QLHA 2UXBJ 1RHRB 1SPBP 2AEMA 3IAM9 4FPRA 2MJNA 2JJ4D 2ZITA 2VKRA 4G6VB 4MKVA 2O5DA 2B8QA 4DS4A 1RTDB 2IRUA 1U45A 2WK4A 3D9BA 4RX6A 1V9OA 2LCWA 5HL7Q 1SUQB 1MMDA 4BC7A 2XZTB 4C3MA 2GS8A 1FDDA 1WF2A 4HDHA 5A8RA 3THVA 4CCHA 2AWZA 2J9EA 2NS1B 4DFMA 2D74B 1VCTA 1PBAA 2JNJA 3C6UB 1NK6A 3J7A1 4B9NA 3I4PA 5CYQB 1R8PA 3RGIA 1HI8A 1NRKA 5BYQA 3C19A 4XK8C 3BR8A 5L38A 1FDAA 1WC3A 3PM9A 1QTMA 3OFGA 2QLJB 4MFBA 3TAPA 1SBRA 3NY0A 3R6LB 3W2VA 1A6LA 3DKDA 3VF0B 3JAMY 3M8QA 5HJYA 2ZH9A 1WORA 4KGKA 2PSZA 2QO3A 2OEMA 3E01A 3QRQA 1YRXA 5GMEA 4CIOA 2F3JA 4KGVB 1D0EA 3TA1A 3P5TL 1GQEA 1A0OB 3TP2A 4C11B 5KFIA 3O44A 2OPPA 2H9ZA 3LTOA 3BS9A 4NYPA 3KK2B 4HHJA 4K5SA 1MMLA 1XMOF 3KNAA 3CD7A 3T41A 2YKOA 3L09A 2O01C 1MU2A 1N5QA 1N88A 3T9NA 4ZN3A 3Q2TC 2QL5B 1KFSA 3BKUA 1JLFB 1KQKA 2LDYA 2MYFA 1ZZNA 5HI7A 3I4HX 1GNKA 2RS2A 1NM2A 3TYTA 2YX1A 1RUSA 2YQ1A 3FCWA 4Z7YA 1KR4A 2CJXB 3C46A 3KMQA 4OYWA 1T03A 2HS4A 3HHEA 4S0MA 2XY6A 2G0CA 1HNZF 1N36J 4DF8A 4EK2A 2QE5A 4HH0A 3MR6A 2XLIA 3ULHA 5G0RB 3JXOA 4DQPA 3MAAB 4L72B 2JC0A 5DDRC 2IVMA 4YR2A 4J9KA 1GX6A 2Y3YA 4J9RA 4PEOA 1S9EA 1C4CA 3HFVA 3CWJA 4B17A 4DPWA 1U1NA 5I42A 1ZYQA 3ZTSA 3HCXA 3DDNA 2P9GA 2M9KA 3D2WA 3BH6B 1RT7A 3MR3A 3PEJA 4ZPCA 3KG4A 1TU0B 2H51B 4ZCLA 3QFHA 3RAMA 1ZAXA 4KPCA 1HHSA 1U4BA 8ATCB 2AMCB 3JTPA 3D4JA 4ES2A 4PYAA 3IG1A 1H2UX 2PMWA 1BQNB 4DCJB 2K06A 1XNRF 1VQYA 3OR2B 3GIMA 1LEOA 3M2RA 1UKUA 1C1BA 5K8OA 3OFHA 2R9LA 2QT7A 2OPQB 3I31A 2G0IA 2RIJA 3TX8A 4C4WA 1HBNA 3CCSS 3P5BP 1WC4A 4LF8F 4F3MA 4UZCA 4R5PB 3DFEA 1QTNB 3A1YG 2Y8YA 1U25A 1G4CA 1KS2A 3MEDA 3MMBB 2XSJB 3JSMB 3KLIB 3H5YA 2BX6A 1X4CA 2XMUA 5B0DA 3AXMA 4GKJJ 3CTRA 4DPXA 3MCOA 3E51A 3TVZA 2LP4A 4RBTA 3KMSA 1Y3KA 1Y0HA 3O5TB 1PJ7A 1IJFB 3MMCB 1WSRA 1NJYA 1SIZA 2DNKA 2XLKA 3R5DA 2GO8A 4EEYA 2HNYB 4P75A 2J6TA 5D78A 2UUAJ 2ZOFA 4KHRA 1Q4RA 4CQ1A 1YJTA 3MDFA 2ZH1A 5L9XA 4JI6J 2V5HG 4URSA 1C0UB 3DOKA 1F9HA 4NYZA 4ZLLA 2Z2LA 5I3PA 4NRUA 1RT1B 4N56A 2H54B 1HR0J 2F63A 4QOTA 4NXNF 2CJ9A 3MMAB 2MQMA 1B0TA 2BDPA 3NNHA 2NUUG 2EC2A 2EKYA 4JOUA 1M1GA 3CJRA 2ZFHA 2DR5A 1YBAA 2HW3A 4FS2A 1KHWA 3T6JA 2AYBA 4OZLA 2Y1JA 1WF0A 4ENOA 4I2QA 2DRAA 4EZ6A 5D3GA 1RXOB 3AJDA 1X4DA 5DDPC 5E33A 5KT5A 2J9CA 4RU9A 4OYBA 3TJ8A 2DD8S 3CJKB 1HNIA 2QMWA 1GXLA 5DDQC 5LSOA 1S76D 2N7YA 4IR1A 2IFXA 4JV1A 4CYUA 3TZZA 3KLGB 3EE3A 5HANA 2RRAA 4DHVA 1EETA 2YQ3A 1RBAA 1LWEB 1S1UB 3PX6A 5LMUJ 1DQ8A 3BO2A 1DAXA 4ZVUB 2I2YA 2PFFB 4FYXB 3LQVA 3B8HA 2AV5A 1LWCB 4YMEA 1N34J 2F40A 1S0NA 4B3OB 4H4KC 4W92B 4KKOB 1SH0A 4CLLA 3TVKA 4V1Ak 4ID5A 5KT7A 2PI5A 1LFWA 2E5IA 5HP1B 2YWFA 3HFKA 3MUMP 2IA0A 5A6WA 1K0TA 5F9NA 4ZVSB 1EAYC 3QIPA 2AP6A 4ZLNA 1TZ0A 2RJZA 3DYAA 1HPZA 1NKBA 3LP1B 5FLXU 1KLMA 5F3ZA 2R7TA 1HD0A 4EO6A 1VI7A 2RQKA 4ZVGA 3M6VA 3ITHB 2DT9A 2OHDA 3K5PA 1QAIA 2ZUGA 1FKAF 1G1XA 3EX7B 2JL9A 1Q1KA 2W7OA 2EBGA 1KHVA 1M5OC 1PGZA 4TY8B 2LMIA 1L3SA 1UL3A 3CF5Q 2WW4A 2J7WA 1N56A 5CQGA 2VBYA 1GT8A 2QA4S 2NSCA 4DFKA 1GFWB 1HKAA 5IC4B 1PC4A 4IG0B 3GU0A 3K5NA 3S6EA 4AD6A 2PEBA 2F9JA 1HD1A 2V4JB 2X1FA 1BWEA 5CYJA 5ITHA 4BWMA 5KFWA 1U09A 3NCQA 2FJBB 4CTAB 2AU0A 1UVMA 5C24B 4LRAA 1U8WA 3G8TA 1U26A 3BBBA 4A8FA 1VQ5S 2HHVA 3DGPB 3BR9A 4ES3A 4Q7AA 4TLQA 1MWZA 1RABB 3NAHA 3UDVA 2KH9A 3M2UB 5CA5A 1LNQA 4KV8B 2KM8C 4A8KA 2CQPA 2FHJD 3VAGA 3PW2A 4DR6F 3I0RA 4NLDA 2YPYA 3UPFA 4FBTA 4TKTA 1KOHA 4I1TA 1AT1B 4Z2XA 2OELA 1CEZA 2BE2B 4DXLA 2CJBA 4KT0C 1ZBTA 3BPDA 3L7PA 2UVRA 3CMES 2QL9B 5L46A 3MPVA 4JI3F 1YJ9S 5GVQA 2YKAA 4ED8A 4ECXA 4DSLA 4B3RJ 3FSXA 3HHNB 3HSJA 1VLYA 3FK4A 1DBDA 2VV5A 3DDKA 1NDLA 3R5GA 4RLEA 4X64F 3M05A 5DZ6A 3C66A 1J2VA 1OYEA 5KFNA 2DHXA 3DXBA 4UY8T 5CD4H 2OUGA 3GP9A 4LF5F 2ZM6J 4TY9A 3FMBA 3M2VB 4ES1A 1U47A 1RBOB 3G2XA 2IY5B 4LFAF 4HKQA 5E5NA 4HEA9 4ZITA 2DH9A 2B4OA 3VTIA 1JLBB 4IRCA 1T9XA 2V8DA 4CO4A 2OTLS 3CJ3A 2YKQA 1R27B 5CH7B 1CJVB 4KO0B 3R97A 1Z4UA 3QQCD 2LQ8A 5A8WA 4RUAA 1Q95G 3PDNA 1RHUB 3FSIA 4I2PB 3UW1A 2R7WA 3AOBA 5BXIA 4NLVA 1E6YA 1Q81T 1B3TA 4DR2J 5BYRA 1C2PA 5ETOA 2YTCA 1ZAVA 1UW9A 2RRBA 4KJIA 1WI6A 3RG6A 3KTQA 2OEKA 4FYDA 2YNHA 3U1LA 5KT4A 3S7RA 4RWWA 2BR0A 2CQ4A 4NLGA 3MM7A 3J7YI 3PX0A 2YH1A 3QSIA 2GJFA 2VD3A 3HSGA 3U27A 4CH0S 4ZPDA 2E1PA 4I4BA 3OTDA 2HLUA 1JQGA 1JWWA 2W2MP 4USVA 4QR2A 3DMJB 2JX2A 3GG1A 4TU8A 3D1QA 3KK3B 4EMDA 3M8SA 3AT1B 3I5BA 1ZM2A 3R2DJ 5J2NA 2D69A 3CC4S 3CUNA 3TAMB 3OSPA 3PRVA 4RU2A 4ZCIA 3T1HF 1VR6A 4FKYA 2UUWA 3C14A 2XGQA 1JX4A 4DS5A 1NK0A 4DV0F 4UUXA 5HN0A 3K5LA 2MKIA 2PE8A 1YI2S 1TL1A 5C2CA 3BQ0A 1S97A 3WC0A 5AT1B 2R7SA 4PQUA 4P2XA 3V6DA 1QE1A 2YX7A 3PJWA 2CFXA 5A2QU 3KLEA 4ZPAA 3NMRA 3CNQP 3FRZA 5I4MA 3KUEA 2ZD1B 4UQGA 3W5YA 1VQ9S 1MLAA 3D6FB 3A3OB 4NLPA 2XGPA 3BYPA 3KLVA 4WFXA 3IAS9 3OFEA 4IG3B 3FDSA 1OSDA 5B08A 1B99A 2XMJA 1PCAA 4QW8A 2ZH5A 4K2XA 5IV4A 5IQQA 5KFGA 3H2UB 2XS2A 1S4FA 2K8GA 1Y00A 1WOPA 4AT1B 4C8KA 1J5OB 1U0HA 1SL0A 3UCZP 5KOXA 1JLQB 1N32F 1Q7LB 2BJ3A 4B3MJ 5AXLA 2X3GA 5D15A 1N5VA 2KVQE 1XMQJ 1NXIA 2GGPB 2M5YA 3BGUA 3EGZA 1NAQA 1JLFA 3BB5A 2FHMA 3N0VA 1M1HA 4ZLJA 2LXUA 4ECQA 3TUIC 4WFZA 4H4OA 1O6XA 2CPZA 2XI3A 2XZWA 1R6YA 4WTOB 3R2CJ 1S57A 1D09B 1VRUA 4C8MA 3SDEB 1HA1A 4ZHRA 4USTA 1QY7A 1RADB 4GKKJ 1U1KA 2ACYA 4NWBA 3J81Y 5HAOA 5GAGI 3K58A 3JAMU 2XO6A 3NL0A 3TVYA 2I5JB 4AE5A 5KT3A 1GTEA 3WIUA 4N8NA 1QSLA 2CPXA 1LW2A 3TJAA 1U1LA 5EX0A 1YK9A 2XO7A 3M6UA 4MYTA 3CXCR 1S9GB 1UCNA 3MTKA 1X4HA 2QIFA 4ELUA 1TL7A 1N5YA 1YZ7A 3VQSA 4ZPTR 3UR3C 3FSYA 5HMXA 3P49B 2NR0A 5CCMA 1FRKA 3MM5A 3WQPA 2HAIA 3QMQA 4ZPBA 4KPYA 2R7UA 4NCGA 4L76A 3UWTA 4K59A 3GV5B 1XQIA 1Y3JA 5C5JA 2IM0A 2I8EA 2CQ1A 2CG4A 1JK9B 5DQHA 3NEKA 2LXIA 3SBMA 1T9WA 2HBRB 2JH3A 1OPZA 2K2PA 2W4PA 5HBMA 2W25A 2XCPA 3PRBA 1RB0A 4GVBB 1P1LA 2Z0GA 1X8DA 3UFCX 2FUG9 2MMYA 2RKIA 4AFFA 2B5JB 2HVDA 2CJYB 4WF9Q 5DETA 4DSJA 2HQIA 2WTFA 2NPIA 2BZ2A 2OPQA 1T8EA 3DC2A 2ALYB 4HACA 5HSPA 1CJKA 1Q16B 2XC9A 3MR5A 3T5JA 1NO8A 1U6BA 5KG4A 3PYDA 4R5PA 2HVIA 4F4AA 4OI1A 3EM1A 2CPJA 3CJSA 2MZRA 2DNMA 3CMQA 4G1QA 2YBVA 2LEBA 2XSJA 3RB3A 4OX6A 1WKKA 2YWKA 3UN3A 3HM9A 3W64A 2KVIA 2GC8A 1RTHB 4DU7A 4P2MA 1HBUB 3Q8RB 2CNOB 1RWNB 2MQPA 2O67A 3HP6A 1TK5A 4ZCKA 4K4YA 4TU9A 3G6VA 5LSLA 4DV6F 3QWUA 4YB7A 1D8ZA 3NGRA 3UNYA 4LF1A 1DTTA 1WTBA 3TI0A 1YTYA 2HS0A 1REVB 1NHVA 2GIQA 2UUBF 5LJ5Y 3OL8A 4CLTA 3NS5A 4NCBA 3CSKA 3LANA 2BJ7A 3AJ1A 3HXMA 3I9ZA 3EPGA 4DF4A 2HHXA 2HMIA 2E5GA 4ILLA 2H5IB 4USWA 3ZFVA 2W4CA 2ASDA 4A47A 4OV6A 4B3SJ 3TQEA 1KWMA 2WB4A 2YWGA 5KFKA 3G9CA 1V3RA 4M63A 4FNHA 1EJ7L 2ABYA 5K14B 2JVOA 4IFYB 4ZVQB 3KHHA 2UXDJ 5LXRA 1D1UA 2YKNB 4X4QA 1ACMB 5CZXA 3K2YA 3CCRS 1HHTP 1RWUA 2ZWOA 1KLNA 2XI2A 2KT3A 4FXVA 4LRDA 1X5TA 3SZ2A 5DGAA 2NCKL 3ZC4A 2I6WA 2DTJA 1R89A 3MGJA 1FNMA 4QJVA 4H54A 4V19X 4KC5A 5CXTA 3FEZA 4HHHA 3WDOA 1JLCA 4ECTA 2V8GA 3N28A 4LQ9A 1OMSA 2DBBA 4MTPA 3M6XA 4NLSA 2R7OA 4CLYA 4BWJA 3R27A 5CHCB 4WE1A 2VFUA 5KG7A 1K73T 1Q0NA 1UWBA 2F7VA 3JS9A 3GQCA 1TK8A 2KXHA 1F5AA 2WSCC 1CSJA 2MZQA 2MQOA 1JLEA 3PO4A 3L4BC 2VDHA 1NSPA 5J1PA 2DYAA 1RAEB 4DN9A 4P52A 3IS9B 4WWSA 4A8MP 8RUCA 1VBZA 3R1HA 4OZ0A 4KFBA 2NUHA 1CBKA 2F8EX 1HI1A 2Q43A 2FVQA 2L48A 2ZEJA 1YBUA 3G82A 1IBMF 3CDEA 1ROFA 3B82A 1RAGB 2HURA 3PKYA 3UCGA 2OSRA 2FC9A 2DGWA 1OIAA 2MEWA 1NK5A 2FVPA 1RACB 5I3QA 9ATCB 1GXUA 2W2OP 1NJWA 2EC0A 3OVSA 2HNDA 3OD2A 5KG1A 4XPEA 2G9OA 2K1RB 1VMBA 2FJDB 1X4AA 1NK8A 2LFVA 1RAAB 3SYZA 3ENWA 4IOBA 2V9WA 2YWHA 4KYZA 2QA1A 1SKRA 4V19J 2HZCA 3CIMA 1IR0A 3ET6A 4WK1A 3CJ2A 2HRUA 1LOUA 1NH7A 3AFGA 4DR1J 4ZJOA 3BM7A 3H0PA 1TL3A 5A0YA 1KN6A 4ILRA 1FESA 3FNNA 5C25A 2OPRA 2FIUA 3WHIA 2KHCA 2C2EA 3CMAS 4IYQA 4YR3A 2HHPA 3IRXA 1TMMA 4PWDB 3KWMA 4FVCA 2BKNA 5J2PB 3F73A 1N0VC 3AOAA 2J8SA 3KLFB 1XN9A 2CNNB 3NGSA 3FCHA 2F65A 4C7QA 5HO4A 1U1QA 5EGYA 2C2NA 2NXNA 3FVYA 3KK1A 4OLOA 4IRKA 4J9MA 2KG0A 1RTJA 5KAKA 2VJVA 4IDKA 4LFCJ 3NOCA 4RW8A 4JI7J 1VQSA 4X2BA 1VC5A 3DLEA 3GE9A 1UVIA 2FC8A 1D9FA 3VHQA 2HNZA 3E3XA 1X4GA 3R8YA 2DCLA 2HGNA 1M5PC 2WVDA 2QC3A 1NK7A 1HBOA 3C8YA 3QATA 2IJRA 4WKYA 2EFGA 2ROEA 3KKFA 3MI7X 4O4GA 4DX7A 1S4EA 5JVHQ 1RBLA 3ILJA 2OJ3A 1WHVA 4MKYA 1SKSA 2VKZG 4DUZF 1IKXB 4OHYA 2L9WA 2BABA 3C15A 2QG9B 4M5DB 3VZHA 4EUVA 1KTQA 2DIUA 3BGRB 5HATA 3QJJA 3JB9k 5L9NA 2HPUA 1GEHA 2Z56B 1I1GA 4F2SA 2ZNZA 2Q3PA 3DGVA 1FNXH 5F8IA 1NNDA 4LMZA 1RTIA 3MPYA 3JTNA 2MZSA 2D41A 4QQBA 2XS7A 1VK3A 2EVZA 3OL6A 3DCAA 4NLRA 1ICEB 3MCMA 2K7JA 4PPZA 5CAAA 2ZBQA 1U1MA 3DOMA 4WP9A 5IFMA 4IUFA 2MSTA 1DTQA 2P8IA 2OFHX 2HQ3A 3FUYA 3CD5A 4RW9A 4CLPA 3PW0A 1IR1A 1RKJA 3ZZRA 3THTA 1EKSA 2VPZB 1C1CA 1X4EA 2E9RX 1RAOA 3LP0B 2NQPA 2Y9HA 4PCQA 2MKJA 3MECB 4FPIA 2QLWA 1BD6A 4IO1A 2KZMA 1K9MT 2IM1A 3A13A 3LUYA 5KFDA 4NPOA 5H9FK 1CVJA 2CDQA 3ONQA 4OYMA 4OI4A 4DUTA 2X51A 4DR3J 1S12A 1KSPA 3CE8A 2DIVA 2W8LA 2BACA 1RYSA 1QLNA 3RAQA 1KD1T 3PJ9A 4DWIA 4F8RA 4QYZJ 1LW0A 5T7LA 2DXEA 3ZNUA 3V6KA 2IDLA 5ETLA 2KT2A 2HIYA 2YWEA 3N6NA 4OX9J 2B6AA 2KYZA 4ED3A 4DL3A 1DURA 1TKTB 1P27B 2GHPA 2ZBIA 1MG7A 3RB0A 1VFJA 5IV3A 3C2PA 3MR2A 1U24A 1QSSA 3G4SS 3DRSB 2ZOGA 3AD9C 3POTA 1SV5B 5IM0B 1KQFB 3SSSA 2YNGB 3J81j 1UEVA 2DKOB 2O66A 1UVJA 5HLFA 1T7PA 4CLSA 4X62J 1N6QA 4WU2A 1WDDA 2ROPA 3NBPA 2ATLA 1NPKA 2W9CB 3TRGA 3PRDA 3NGKA 1WTFA 3I5CA 3NKYA 3RBZA 3IM9A 2KZZA 2LEAA 1MROB 1IKYB 1S1VB 4P9SA 1S9FA 3CJ5A 1QD1A 3OPKA 2B9YA 2MY7A 2VOPA 2HWTA 1CC7A 1H7WA 2ROGA 1NDKA 2V8VA 4HT7A 3TUJC 2D9PA 1HWLA 4LRFA 2C2OB 2Q1LA 2GJ2A 2IRYA 3R6GB 1DHMA 1RKIA 3H98A 3QBCA 4GC7A 3RZAA 1W25A 3G6ES 2C2ZB 4I0WA 3GMGA 3UDLA 4LQ3A 3X1LB 4EBCA 2XULA 4ZOSA 4I64A 5DZ7A 2OD6A 1RT4A 3HT0A 1WC1A 1CS4A 4JI4F 3DRRA 4PR6A 1C0TB 1OY8A 1H98A 2G2OA 4GKJF 4CH7A 3SEOA 5SZTA 1WHWA 4DV5J 2CYYA 4LIWA 4C8LA 4NZ6A 2EKNA 1HMVB 2JFDA 2CPEA 3KHRA 1SJFA 1F5CA 3PG9A 2B3TB 2G4BA 3MF5A 1RT2A 5K5MA 2UV8G 3JSBA 4RW4A 2LA6A 4C8NA 2UUAF 2QA4G 2FLOA 2UUCJ 2DR7A 1LK7A 3THPA 1IKVA 4N7TA 1RWMB 3ZZYA 5E3CA 4K4ZA 4J5OA 4JI6F 2MKYA 1M0SA 3AB4B 2KXNB 2KRBA 3OTBA 5AXNA 4Y00A 1D9DA 1RP5A 4B02A 1H7XA 1AUSL 2ZH3A 4LF7F 4JV5J 3MPUB 2GA7A 3AA8A 2MLXA 3N01A 1EIYB 2ILZA 3J81U 2L9NA 3TA0A 2LEPA 5IT9Y 1FE0A 1S77D 3IGVA 4RBVA 2YNIB 3LAKA 3NG8A 1OS5A 3GSDA 2CPYA 1WOOA 4M5MA 3H5XA 3C6TB 2BM0A 1SL2A 5GMDA 4OHZA 5GAEU 2ZJPQ 1F2HA 2PIIA 4JP8A 3GCWP 5E2QA 4DL4A 2MZJA 3NCRA 2A2CA 3HO1A 3H8YA 3NWGA 3AQOA 3TARA 1X4FA 4ETXA 4XTTA 3FBFA 1BXNA 5DG9A 5KFZA 2B9WA 1TKXA 3ZZ0A 1F3FA 1JKHB 4Q2MA 2E29A 4Y2KA 3VAHA 5GAHU 2DNQA 3PYEA 2LQ9A 3MFHA 1LQ9A 2F1FA 1B64A 3D5MA 2AZ3A 3FEYB 3BV8A 2HAFA 1RT5B 2WONA 4C98A 2IMWP 2W2PP 5ADZA 1CLFA 3N79A 2J0XA 3FBCA 1EP4A 5KTQA 4YY3J 4U96A 1UJ5A 1CC8A 3OFFA 2DCUB 1TAQA 3Q22A 4X4RA 2AYMA 1Z2ZA 1JLGA 1RZMA 1S1XA 2MDAA 1N8RT 1HQEA 1TVRB 3Q8SB 5E3AA 3I82A 5HMZA 4F26A 1FRLA 1EKRA 5EWEA 3OW2R 1SCJB 3BSOA 3DOLB 5D0GA 4X4TA 3D0HE 4JI2J 3SCIE 1S0MA 2ZWPA 1VJQA 5FIIA 3TJ9A 3I9V9 4YOEA 1PG5B 2H5JB 3HD2A 5B0AA 3W5XA 3M1VA 2JEFA 4DV2F 3ENVA 4RBUA 4DLEA 4RUHA 1WDTA 1UZHA 3UQSA 4MIBA 4MIWA 1AB8A 1WOSA 3MZIA 2W7PA 3N6MA 3HVTB 2EFNA 4F4ZA 4A8WA 2H5EA 3W60A 4OMFG 2XYPB 3QGIA 4ZKAA 4I67A 3LO3A 4ZLPA 3NS6A 3TANA 1XWLA 4WCEQ 7FD1A 1VQPS 1VBKA 2KTQA 3TX0A 3SQOP 3KNGA 4HHUA 1U48A 2DR6A 1DQAA 3A8IA 2RQMA 4DFPA 1RT3A 1NDPA 3HPOA 2LU1A 3RRGA 2XB2D 1KP6A 4FYYB 2YKMA 3QZ8A 1Q8IA 1RLCL 4RPFA 1WG1A 1WEYA 3SSQA 4XO0A 2VG6A 2Y0SD 5DM7Q 2JLEA 3H25A 1RYRA 3GILA 1RT6A 2COLA 1R7IA 3PACA 3CW2C 1HARA 2EFQA 2P9CA 4L3NA 3ZZTA 2N7CA 1VISA 4PWUA 2LQJA 4C8ZA 4AXIA 1TV6B 1N4LA 4LR7A 4DG1A 1DLOA 2VU5A 4DQRA 2EFVA 1S6QB 1X31C 1VGYA 4I7FB 1RWOB 3QGGA 5KT6A 4ELTA 2VFRA 4J37A 1OPIA 3CO0P 4I56A 4R25A 1UFKA 2EFOA 2VG7B 1I51B 3BN4A 4YB6A 3IBFB 3A3PB 2M8HA 1J5EF 2XTJP 1XNQJ 3CEDA 3GYXB 1ZA2B 3DLGA 4KH0B 3S01A 1DY3A 1RWKB 1AZSB 2FHKA 1TP7A 2QN6B 4DV4J 2EFPA 1IXKA 2PGCA 2D9OA 2JSXA 3ZZUA 3ZO7A 2OGUA 5H9FJ 4OI0A 4DL5A 4RUCA 3CD0A 1FX4A 1AFIA 4DPUA 2DH8A 2FZCB 1YJVA 1GMUA 4HTJA 1JJ2R 2BANB 4ICLA 1UVKA 1WG5A 3JQKA 3OTEA 2B4PA 2C1EB 2XQCA 1L3TA 2ZE2B 4K4WA 2CQHA 2P6TA 3QNWB 3WC2A 2VPWB 3SCKE 2LVWA 1R0AB 1A7GE 4ZVEA 4ECUA 3ZNJ1 2ZM6F 3TAQA 1UA0A 1VLOA 2MZ1A 3TQ1A 5H9EK 1RAHB 1HLWA 4OZ3A 3K0JA 2HHUA 2BQUA 2GNKA 2CAJA 5HVFA 5L1IA 1NSKL 3W3SA 4E2FB 1FTRA 2YVSA 2R8GA 2BRKA 1EQ0A 2CZ4A 2MLZA 2WW8A 5KT2A 5FDLA 3I56S 4QIEA 4PWDA 1R31A 4DSIA 2AGOA 2FJWA 3M8PB 2CPIA 1WI8A 4H4KA 4H4MB 3KLFA 4ECYA 1TUVA 1S0VA 4DR2F 2GMJA 5HQLA 2BKOA 5U47A 4NMXA 2QLFB 1RWWB 4EWTA 4EYIB 3M9NB 5LXYA 4DL7A 2L3MA 3Q8QB 4ZP9A 1AUDA 5I3UA 2J7UA 2XWYA 2IYGA 4NLTA 1SQFA 4LJMA 2LA4A 5MLCV 2KXFA 3MM8B 2RAQA 4LF8J 4O3QA 2WSFC 1UWAA 3BSAA 4DUYJ 3M32A 4DR4F 1MSWD 1VBXA 2OIHA 2GMHA 4P6QA 1TKZA 3JTOA 1R6VA 3OVBA 4PUOB 3DLKB 2GVDA 5D4LA 3FZBA 3QWPA 3S1TA 4C0OC 5HROA 1S0OA 2FLNA 1B7FA 3G96A 3DRPB 3DI6B 4J9QA 2N82B 2DJWA 2EI5A 2DHGA 3G86A 4ER8A 1JLAA 3EYZA 4WP8A 3FFIB 1CJUA 2HGMA 1IVZA 3LP2B 1RAFB 2CNLB 2KI2A 4N41A 1SH2A 3KLHA 5KFHA 1YX2A 1P9YA 4YFUA 2MQLA 5DS7A 2FJVA 4YHHF 5C42A 1B0VA 5KG3A 3T5KA 2XWXA 4CLUA 2U1AA 4DPTA 2IAJB 2XMAA 1OYDA 2OPSA 1FK9A 3RBXA 5HVHA 1FFGB 4NXNJ 2VFVA 1CQNA 3MEGB 1BQXA 2X1BA 4FDFA 4K0KF 5EX3A 2DR9A 4KHMA 2XBPA 3A8JA 3V6HA 1U2CA 4X4NA 3BSCA 4KR0B 1FVQA 2AGPA 4RW7B 1RU1A 2OFGX 2XMMA 2UVVA 2APOA 4O44A 1OSCA 1YSJA 5J1NA 3IA0A 1BY9A 4Y2AA 3L7OA 4KAIA 7FDRA 3R9LA 4LF6F 3NGUA 4DX6A 1IR2A 1HW9A 3IWNC 1QVGR 2W9BA 3IO1A 3HX9A 3OV7A 4O23A 3NMAA 4L73A 3SQGA 1XMQF 5KFAA 2D3ZA 4M94A 4RWXA 2FVRA 4F4XA 4X66J 1NPPA 3QO9A 2B7BB 3DHWC 3GCXP 3W5ZA 4USKA 2B4VA 3NS7B 4ED1A 4KHPJ 1PIEA 4K4VA 4DSKA 1IJEB 1CG2A 4K5RA 3PJXA 3ZXWA 3PZPA 4CLZA 2XYHB 2KU7A 4GVLA 2ILYA 1S6PA 1S1TA 2ZOMA 4Y3CA 1RI7A 4C9DA 1KQGB 4ATNA 1NJIT 2HG4A 5J1EA 1WSVA 1S48A 1NZ8A 2KO1A 1ZAWA 4ZP7A 1URRA 3Q8VA 1AFJA 4UQTA 4Q0BB 4JI8J 5IM0A 4UT4A 4ZPVR 1MN7A 5MAOA 1NLKL 1I5OB 2ZZMA 4LF9J 2GX8A 1AYEA 3I32A 4DV3J 2H4YB 4EO8A 2UU9F 4ZVTB 2RD5C 1UEKA 5HVGA 2AF6A 2HVEA 1DJ0A 2VBWA 1FKOA 1WC0A 2J0WA 3FMWA 1CULB 3H5UA 2C3UA 3V2UC 1RTZA 2DB1A 1VBYA 2IC3B 1OJ4A 3UVJB 2XM3A 1AW0A 2YQ0A 1IWAA 3VVUA 3KHGA 4A8SA 2CQGA 1FWPA 2YNFB 1NMEB 2DGOA 1FF2A 3M30A 4ZVRB 5KFJA 5D8HB 5J2MB 1H0HB 2UXCJ 4LSNA 2I38A 3C16A 3MURP 5GADI 1K47A 3T1YF 2HBYB 2BXJA 4ZK7M 1YHQS 4NLWA 4JI1J 4LSZB 2Z8QA 4X4PA 4N47A 2H4WB 4N77A 3MM9A 1FI4A 1CJTA 2HS3A 3IBCB 1PAEX 5D4PA 4PG6A 4CT9A 3M8YA 5LJ3Y 2M88A 3KG0A 5H1SV 2DGVA 1SB6A 1ZA1B 3CB4A 4DBQA 1KONA 5HQ8A 3OR1B 2RF2B 1EZZB 2E44A 3W2WA 3U7JA 1SVDA 5HK4A 1QM9A 3BN7A 3AD8C 1HNVA 2R7XA 3CC7S 4DV1F 2JLFA 2V0NA 3UR0A 3AOCA 2ACMA 3GIKA 3ILOA 3JSYA 1D9AA 3LOUA 2ALZA 4JI3J 1FX2A 1HHQA 1PYOB 2MHNA 3I96A 2BW7A 3Q8YA 3PFEA 4CNZA 2AEJA 3LALA 5B0CA 2OLWA 4IFVB 2MY8A 1O8BA 5A8KB 4C48A 2V2QA 1S5ZA 4C6AA 3E8OA 1RHMB 1BQMB 3QLHB 1PSDA 4USIA 1YJRA 2MQNA 1GH8A 4B3SF 3P8BB 2BJ9A 4O3PA 3ISNC 3G6YA 3QIDA 1XK8A 2LXFA 1G2EA 3RTVA 1S7HA 4LF5J 2YH0A 2PN6A 1LWFA 1EX8A 1S1WA 4MK9A 5DLFA 1DFDA 5AJ3J 4Q2LA 3L3CA 1UP1A 4UOCA 3I0SA 2OO4A 5A8RB 1PAUB 2BW2A 1L3KA 4PG4A 2MQ8A 2FY8A 1X5PA 4WXWA 5JVGQ 3BPSP 1RLDA 2JRSA 2GQ2A 2RU3A 4NLOA 1GMVA 4Y34A 1Q78A 3CDWA 3MOJB 3UD5A 3GYGA 1C4AA 4ZMMA 5H9EJ 4RW6A
chains in the Genus database with same CATH topology
4NZ0A 1K0VA 1FNMA 4LF4F 4QJVA 4H54A 4V19X 4KC5A 2RUGA 3MTJA 3UI3A 5CXTA 3EGWB 2CVIA 1XR7A 4YB1P 3FEZA 1AXQA 2FGCA 1KRPA 2JDJA 2KHDA 3WDOA 2C2RA 1QUPA 2P6SA 4O4RA 1JLCA 4MFBB 4ECTA 2V8GA 3N28A 1VRTB 1DTQB 1SI9A 4LQ9A 4Q43A 2DBBA 2LECA 3UE2A 2OMLA 3W2VB 5K8PA 1M1KT 1FKPA 4MTPA 5BYSA 3M6XA 4NLSA 3J80Y 3V81B 1X0FA 4KTQA 2VA2A 2R7OA 3M8QB 4JUZA 4RW9B 4BWJA 1VQ7S 1XC9A 1JXEA 3R27A 5CHCB 3SDEA 4PXDA 3BDPA 2AJFE 2CQ3A 4YB5A 1H2VZ 3H20A 5CYMA 5DO2A 4WE1A 3RB4A 2PA3A 2VFUA 5KG7A 1K73T 2E5LF 1C1CB 1RA7A 1UWBA 2HWHA 2F7VA 3FZ2A 1IBKF 1WNEA 4QR0A 3E01B 1FJEB 3GR0A 3GQCA 3N6LA 3UCUP 1TK8A 2KXHA 4J9SA 2A3JA 1F5AA 2WSCC 4NA2A 4P7VA 1CSJA 2MZQA 4Q8EA 1U7LA 4Y2CA 3BO3A 5THWA 2JFKA 2GCFA 2CPFA 2I5JA 5KFSA 1VQMS 2MGZA 4WZMA 4X4VA 1T94A 2MQOA 1JLEA 2LYVA 4B9SA 3PO4A 2WOMB 4QZVB 1Q7YT 4PG8A 4Q0BA 2RMLA 5J1PA 3OUYA 4A8XA 3WX4A 2HWIA 4DN9A 4ILMA 5KFYA 3IS9B 6FD1A 3HF5A 4OL8A 3EXYA 3CCUS 4DV5F 4A8MP 1VBZA 1S9GA 2R8JA 1WWHA 3PY8A 3R1HA 4CO2A 3J7Z5 4DFJA 1NH8A 4OLPA 3V4IA 4JV0A 5T14A 3MFIA 5DRKA 4OZ0A 4Y65A 1MU2B 4KFBA 2D3OR 4B9UA 2NUHA 5LT5A 2PD1A 3V5RA 5KFBA 1YRTA 2F8EX 4ED2A 1HI1A 2Q43A 3RW6A 2FVQA 1MMNA 2ZBCA 4O3OA 2L48A 3GFHA 1UJ4A 2DK2A 2MJUA 1IBMF 1WD6A 1LW0B 4DSEA 1YRUA 1ROFA 3B82A 3CDEA 4Y0FA 3PKYA 1O5JA 3N5FA 2OSRA 3UCGA 5T7LB 5IT0A 2UUCF 2VPYB 4EFAC 2HFNA 1FA0A 2FC9A 4EU0A 4FXWA 4ZVFA 1HWKA 2DGWA 3OVAA 4X4SA 2QFJA 1OIAA 2W7AA 3BZQA 4OI2A 4F4KA 1ZPWX 1NK5A 5KG5A 2FVPA 5I3QA 4ZS6A 1GXUA 2CRLA 2D1CA 3OXFA 2B6AB 1TL4A 5IT4A 1NJWA 2FVSA 2XMKA 2EC0A 4QBUA 1JNZB 3GFXA 3OVSA 2HNDA 3KJVB 4HYKA 5F8NA 2EBEA 5KG1A 2E66A 3VWSA 1MNEA 2IC3A 4XPEA 3CVKA 2G9OA 2XNRA 2K1RB 3SMZA 3AQPA 2IBOA 1VMBA 1T03B 2FJDB 2M0GB 4I6YA 1X4AA 2IRXA 2YNFA 3MD1A 2C22A 1N48A 3PO5A 1ZM3A 4B9LA 3AJ2A 1HR0F 1IUJA 2JEJA 3DRYA 1NK8A 5E0OA 3HVRA 4YDXA 5J2MA 2WSEC 4DQSA 2RE1A 3SYZA 1NKCA 4HLBA 2Y1RI 3POTB 2K7KA 3PFOA 4HT5A 3ENWA 3NP5A 2IM2A 4G1PA 4IOBA 2V9WA 2YWHA 2B5JA 2C3OA 4I69A 2VH7A 3OL9A 3MEKA 4OHXA 2UUTA 3HHDA 2QA1A 4R0EA 1HFEL 4CO0A 1T05B 3AAWB 1SKRA 2IVYA 4V19J 1S9EB 5HLFB 2HZCA 3QGHA 3CIMA 2C3PA 4LSLA 4J9PA 3OXLA 1IR0A 2ADBA 3RBDA 3P6YC 2EG2A 1E6VB 4WK1A 5LSRA 3GZ7A 3N9UC 1N6QB 1XEZA 3CJ2A 3WBZA 4ZCMA 5I42B 4X4UA 2HRUA 3B4MA 1KOOA 1IKWA 2UV8A 2JLGA 2QYCA 3NBPB 2DPJA 3DHXA 4FS1A 2J0SD 3JYTB 5F3TA 2IVFB 1LOUA 2Z4PA 1YJWS 3GR1A 3NNCA 5EHHA 4QWEA 1Q86T 1RDRA 1NH7A 2VG5B 1RT7B 2PMZD 3BM7A 4U9RA 3SXLA 2ZH6A 1TL3A 5A0YA 1KN6A 1FVSA 1O0PA 4ILRA 1RTHA 1FESA 1RA6A 1FD2A 2ZH7A 2I1RA 3FNNA 3TA2A 3DXSX 5C25A 2OPRA 5IS2A 2FIUA 4LT6A 3HK2A 3HHLB 4NOHA 3OR1A 4HVZA 3CULA 3MAQA 2RF2A 2MB0B 1HBUA 5KOWA 4YP3A 1TAUA 2KHCA 2C2EA 2EPIA 2FJAB 1LV5A 4PKDB 4IYQA 3CMAS 4IH6A 3GV8B 3HI9A 4YR3A 2HHPA 3BGLA 4A46A 3EZUA 5IWAF 2WBRA 3IRXA 4KBIA 2RILA 5D6GA 4O3SA 4PWDB 3IG1B 3KWMA 4FVCA 2CQ2A 5DM6Q 1NB7A 3D0GE 3I5AA 5J2PB 1P9QC 1UAWA 4RNHA 3F73A 1VQLS 1FXLA 3D1HA 1N0VC 2DNZA 2HFZA 3H4BA 4HI1A 1F9FA 3KLFB 1QUVA 2F9DA 1XN9A 2AJQA 1L5UA 2EWHA 3RR7A 1YG0A 4AQYF 3G8QA 3FCHA 4CT8A 2XS5A 5BJRA 1X5OA 2XMVA 3M2RB 2ZKUA 1C1BB 2MKCA 1UVNA 4XAKA 3VAJA 1ELOA 4C7QA 4L6V3 4LVNP 5IZHA 5HO4A 4QIGA 1U1QA 1VQ8S 5EGYA 5LMUF 3LGMA 2IA6A 2BQ3A 1YJUA 3CCTA 1F60B 3FVYA 1REVA 2R2TA 4J9OA 3KK1A 1OWXA 4OLOA 1XMBA 5A2QY 2NLWA 3CDAA 1HBNB 2KFYA 1FRIA 1QAXA 3T1AA 4IRKA 4J9MA 2KG0A 4C3LA 4HI2A 3M9OB 1RTJA 1N34F 4X4OA 4GO7X 4JI7F 1SIWB 3UD4P 5KAKA 5GMKa 4IDKA 3DLHA 5K9FA 2FD2A 4DN0A 4RW8A 1VQSA 4TQSA 2CQBA 1FXRA 3M6WA 1VC5A 4X2BA 3DLEA 5DJBA 3QPIA 3GE9A 1UFLA 2NSBA 4IFVA 1VQKS 4JV2A 2AQ4A 1HBMA 2CPDA 2GHWA 5A8KA 2VPXB 3MEDB 1UVIA 2FC8A 2DGXA 1D9FA 4KGMA 1H2TZ 1SJ4P 2HNZA 1RT4B 4Q5VA 3E3XA 2ZH4A 1X4GA 4KB7A 1QSYA 1D8YA 3IR5B 3DRRB 3IN5A 2RRNA 1GXTA 4EGLA 3MEEB 2DCLA 2DNNA 3R5BA 3FQKA 2HGNA 2VQFF 1SJQA 1M5PC 1BQMA 3DM2A 3QZ7A 2AJ0A 3QLHA 1U6ZA 4YQWA 1NK7A 1HBOA 3ENQA 4EBDA 3IAM9 3FQLA 4FPRA 3C8YA 2MJNA 2JJ4D 4WKYA 2ZITA 2EFGA 2GMLA 2VKRA 3HJFA 2KB2A 4G6VB 2ROEA 3KKFA 3MI7X 4O4GA 4C2MA 2VC0A 5JVHQ 2OJ3A 2O5DA 2POKA 1HI0P 4PXEA 1AROP 4DS4A 2AJ1A 1WHVA 2KG1A 1RT2B 2XY7A 4MKYA 1SKSA 2OH2A 4MK8A 2VKZG 5K14A 3GFZA 1RTDB 2IRUA 4RW4B 4IFYA 2KFZA 1U45A 2WK4A 4NYOA 4DUZF 4RX6A 1IKXB 1ZETA 1V9OA 2LCWA 4OHYA 2JVRA 2L9WA 5F8MA 2BABA 5HL7Q 4R8UA 1I94F 1IKVB 1SUQB 2Q6BA 2YKNA 1MMDA 4M5DB 3VZHA 4BC7A 4EUVA 1KTQA 1FJCA 3OHBA 2DIUA 4C3MA 4AL7A 3BGRB 3QJJA 1HQUA 5LMNF 3JB9k 5B0BA 1FDDA 2J0QD 5L9NA 2VC1A 2HPUA 1WF2A 4HDHA 2RSQA 3DOKB 3MPWA 5A8RA 3THVA 1I1GA 4CCHA 4F2SA 2AWZA 2J9EA 1Q8LA 2ZNZA 2Q3PA 2NS1B 1JMTA 3ISZA 1FNXH 3H4DA 5F8IA 1NNDA 4DFMA 2D74B 4LMZA 1SJRA 3F41A 2B43A 2JC1A 1RTIA 3MPYA 3JTNA 3US5A 3CD6S 3C6UB 2MZSA 3MM6A 2D41A 4QQBA 2XS7A 4DOZA 3J7ZT 1NK6A 4B9NA 1UFWA 3EGNA 3J7A1 1HYSA 1G3OA 2KJWA 3I4PA 5CYQB 1VK3A 2EVZA 3OL6A 1R8PA 4J9NA 3DCAA 4NLRA 1HI8A 1S6UA 1NRKA 2EW9A 2P9EA 5BYQA 2W24A 3PKMA 2ZDOA 5DQIA 4F3OA 4XK8C 2K7JA 1TFYA 3P96A 3BR8A 4PPZA 5L38A 5M2RA 4WJBA 3J7YU 1U1MA 4NMLA 1FDAA 3PM9A 3DOMA 1QTMA 1NK4A 3OFGA 4MFBA 3TAPA 4G1IA 5IFMA 1SBRA 4IUFA 2MSTA 1DTQA 1VC6A 5F8HA 3BJYA 2OFHX 1WHYA 2HQ3A 5KFQA 3W2VA 3LAMA 2XSFA 2B0GA 1A6LA 4URQU 3V81A 4GO5X 2KJVA 2LLZA 3CD5A 4IH5A 3VF0B 3JAMY 3M8QA 4I2QB 2V4RA 4RW9A 5D3GB 1N54B 3PW0A 3TNVA 3DLJA 1FRJA 2M4MA 3PV8A 3ZZRA 3I55S 1RKJA 1LK5A 2ZH9A 3THTA 2VPZB 4KGKA 1C1CA 1X4EA 2E9RX 4W90B 3LP0B 4X65F 2NQPA 4D3HA 2PSZA 2QO3A 3E01A 4PCQA 1YRXA 2ADCA 2MKJA 3MECB 2P5VA 2QLWA 1NKEA 4CIOA 2BJEA 2PEHA 2WCXA 1BD6A 2F3JA 4IO1A 2A18A 5KG2A 2KZMA 1D0EA 1K9MT 3TA1A 2IM1A 3P5TL 1GQEA 3LUYA 3NGDA 5KFDA 3TP2A 4NPOA 1HNIB 4A8YA 4C11B 1TKDA 1CVJA 5KFIA 5FLXY 1TKXB 1ZM9A 2CDQA 1JB0C 3O44A 3ONQA 2OPPA 4DR3F 4ERDA 2H9ZA 3IS9A 3BS9A 1FJ7A 4OI4A 4NYPA 3KK2B 4HHJA 2X51A 1S49A 1KSPA 3CE8A 4K5SA 1MMLA 3EXCX 3PW7A 3ICLA 1XMOF 5L1KA 3KNAA 3P3DA 3CD7A 4GC6A 2DIVA 2YKOA 3L09A 2O01C 3VR1A 1MU2A 1N5QA 1N88A 1LKZA 2W8LA 2BACA 4P2SA 3T9NA 1RYSA 2WB1D 3Q2TC 1QLNA 1EETB 3K8WA 1FE4A 3RAQA 1KD1T 3Q24A 1WELA 1KFSA 1S72S 3KOAA 4DWIA 2NZ4A 4F8RA 1JLFB 2J9DA 1KQKA 1RISA 2EG1A 1VJWA 1LW0A 2LDYA 2MYFA 2RS8A 4RNOA 2WONB 2O1PA 1ZZNA 5HI7A 3I4HX 3IC1A 5T7LA 4B3TF 4JI0F 1GNKA 3SFUA 2RS2A 3V6KA 1KVIA 3TYTA 4OX9F 1M5KC 2IYIA 2KT2A 1EP4B 2YX1A 2YWEA 1X9SA 4XDDA 3N6NA 2AW0A 2B6AA 1VS3A 1P6TA 2KYZA 1FO1A 4ED3A 1ZH5A 4DL3A 4B3RF 3O1LA 4DPOA 3KJVA 1KR4A 3CDBA 1DURA 3LH2S 1TKTB 3K57A 1WG4A 1P27B 1DQ9A 4QIVA 4LVOP 2UZAA 3C46A 3AHPA 2K1RA 3KMQA 2GHPA 2ZBIA 1T03A 2HS4A 3RB0A 1VFJA 1FERA 1JLGB 3HHEA 4DR5F 1S1XB 4ID5B 2XY6A 3C2PA 2G0CA 2OP5A 3MR2A 1HNZF 4Y28C 4DF8A 1HQEB 2QE5A 4HH0A 3MR6A 1U24A 1QSSA 2V4QA 1GAOA 4YR0A 3G4SS 2XLIA 3DRSB 3ULHA 2ZOGA 2VUGA 5G0RB 2CQ0A 1SH3A 4KE5A 3POTA 4NLUA 2FJXA 4DQPA 2UVWA 1SV5B 5IM0B 1X7VA 4L72B 2ZH8A 3QIPB 2JC0A 2K3IA 1KQFB 3SSSA 1BGXT 2YNGB 3HHLD 5DDRC 4IR9A 1G6BA 2IVMA 3DYAB 1UEVA 2MKSA 4TQRA 4YR2A 1T05A 1HPZB 1GX6A 2XMWA 4J9KA 2O66A 1FDNA 3BGFA 1V3ZA 2DGTA 1UVJA 4J9RA 2HYIB 4B9MA 1KLMB 1S9EA 1C4CA 3T9ZA 5HLFA 3CWJA 3M1VB 3R3TA 4B17A 1YJNS 1U1NA 1T7PA 1E6VA 1N6QA 4WU2A 5I42A 1ZYQA 4OZ1A 3IXQA 2ROPA 1QAYA 3NBPA 2ATLA 5F41A 2DNGA 4MKBA 2W9CB 3JYTA 3TRGA 3PRDA 3NGKA 4ED5A 3DDNA 3KYLA 2P9GA 1WTFA 3I5CA 1DRZA 1N33F 1P1TA 3NKYA 2M9KA 2VG5A 1X4BA 3D2WA 4MH8A 1RT7A 3GFYA 2KZZA 3MR3A 3PEJA 4ZPCA 1APSA 2DITA 2LEAA 3KG4A 1MROB 2VASA 3DU5A 3FEXB 1Y7PA 2R8KA 4ZCLA 3RAMA 1ZAXA 1IKYB 2MQQA 1HHSA 1S1VB 3HVAA 1U4BA 4NCAA 4YEAA 1H3DA 1I6JA 2DNOA 1S9FA 3CJ5A 3OPKA 2B9YA 2MY7A 1KFDA 3JTPA 4Z37A 1M5VC 2VOPA 4ES2A 2LQBA 2AYGA 4JYAF 2Q6CA 2HWTA 1CC7A 1H7WA 2ROGA 3IG1A 4OJHA 1H2UX 2W9AA 5J2PA 3PW5A 1BQNB 2W4DA 1TL5A 3DLLQ 2V8VA 4HT7A 3TUJC 4A48A 1XNRF 1VQYA 2D9PA 1HWLA 3OR2B 2V2KA 3GIMA 3TO8A 1S10A 1RT3B 2KRRA 3G6XA 4QWBA 1V3SA 3M2RA 1UKUA 1C1BA 2Q1LA 4HDGA 4DSFA 5K8OA 1UW4A 2G1DA 3OFHA 2GJ2A 2IRYA 2R8HA 4OX8A 2QV6A 3BDEA 5BR8F 2R9LA 2QT7A 1JJHA 2OPQB 3I31A 2YKMB 3RRKA 4JI5F 2RIJA 1DHMA 2JOQA 4OIXA 5GAGU 3PIPQ 1RKIA 1Y5IB 3H98A 3TX8A 4C4WA 3OLBA 3GIJA 1BLUA 1HBNA 4QWDA 2EK6A 2VG6B 4GC7A 3RZAA 1W25A 4F67A 2Y1IA 3DLBA 3CCSS 2Q79A 3G6ES 4MMOA 1KQSR 4LF8F 4F3MA 5HMWA 3T5LA 5LL6d 2C3YA 4R5PB 1L3UA 4I0WA 3DFEA 2NPFA 3GMGA 2GV1A 1RT6B 3UDLA 1FT8A 4R0JA 4LQ3A 3X1LB 2M3DA 2WBMA 2XHWA 2CZVC 4EBCA 2MZTA 2XULA 4MJKA 5L8RC 5CZVA 3A1YG 4MK7A 4ZOSA 3FRYA 4I64A 1U25A 2OD6A 1VIXA 2CQDA 4YDDB 1KS2A 3MEDA 3MMBB 4F2RA 2XSJB 4DG1B 1DLOB 1RT4A 3HKZD 3KLIB 3JSMB 3H5YA 2GW8A 4JI4F 3DRRA 4PR6A 1C0TB 1X4CA 3K7RA 4WKRA 3MEEA 2R2RA 1H98A 4GKJF 4BCAA 4DL2A 4CH7A 4Y2IA 2XMUA 1NK9A 3I0RB 5B0DA 1K1QA 2DGQA 2ZVSA 5E3RA 3SEOA 4NRTA 3U1MA 5SZTA 1WHWA 2R7VA 3CTRA 5K8NA 5EUHA 2CYYA 1T3NA 4LIWA 4C8LA 3E51A 4PXCA 4TU7A 3ZZPA 3TVZA 2ASYA 4RBTA 3PW4A 3D54A 5SUHA 3KMSA 2FGOA 4NZ6A 2OSQA 4OJGA 1Y3KA 1HMVB 2JFDA 2OMOA 5M2UA 3GYNA 1Y0HA 3O5TB 3DLGB 3BF4A 2CPEA 1Q53A 3KHRA 1IJFB 1CQMA 2ZHBA 1F5CA 3MMCB 1SJFA 1X5SA 1NJYA 2B3TB 1SIZA