3DOMA

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
73
structure length
73
Chain Sequence
VVDQIRLWQLELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAKRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords RNA polymerase II transcription factor B subunit 2
total genus 20
structure length 73
sequence length 73
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18307 Tfb2_C Transcription factor Tfb2 (p52) C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2610 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3domA00
3DOMA 3DGPA
chains in the Genus database with same CATH superfamily
1DLOA 2HZCA 4IQMA 3HF5A 1NRKA 4DQQA 3LGNA 2BM1A 4DPXA 1T9WA 2EXUA 1LW0A 4LREA 2HFUA 1IKVB 4PR6A 2CQHA 3H25A 1NJZA 2WSFC 4E2FB 2DNLA 4DV7J 5J1PA 1TMJA 1WG1A 2V34A 1FRKA 4WE1B 4LIRA 4DV0J 2MY8A 1G6BA 1S99A 3PM9A 3W63A 5HJYA 3QZ7A 4LF7J 1T03B 2QMWA 4P2XA 3FJ2A 3P5TL 2N7CA 3VGTA 3MEKA 2CJKA 1DQ9A 3UDVA 1XIQA 4GO7X 3VV2B 4GVLA 3CCVS 4QIFA 5KFQA 2XO6A 3RW6A 3B4DA 1MN7A 3DOLB 3U27A 4UUWA 3SFGA 3R5CA 3D1QA 4LJMA 4CLFA 1UEVA 4TLRA 4DUTA 3W5ZA 2IM2A 2M3DA 7AT1B 2W25A 3OVAA 4ED0A 2IDLA 2KXHA 3FZ2A 3LUYA 1S1VB 4J9MA 1CPZA 2CJYB 1OMSA 2I38A 2PT0A 3OSNA 3DFEA 1N52B 1PKUA 5F8IA 4DV3J 4JI7F 1KLMB 2BOPA 4DV2J 2ZOFA 5C42A 4JI3F 1VRTA 4FS2A 3DYAA 3W2WB 5KG5A 2CPDA 2C2OB 1VISA 1JKHB 1RGVA 2DRDA 4I2QA 3B8HA 2RH3A 5T41A 4F25A 2G2YA 2KO1A 4P75A 2FVPA 1RK8A 4UOGA 4C8ZA 2MGZA 1IKYB 1H2VZ 1X5OA 3QQCD 3NOGA 3MD3A 2NSBA 3BO2A 4DL5A 4ED4A 2IJFA 5F3TA 1NK0A 4A8QA 3TX0A 3IS9B 1NKCA 3GJTB 1WC4A 3M8PA 4RBUA 5C7PA 3MFHA 3BO3A 1QTMA 5K14A 4KV8A 2K3KA 3L7PA 3VHQA 4N8NA 3J80Y 3CB4A 1Q8LA 4ZVEA 5DDPC 3BQ0A 4O23A 4WU3A 1MMLA 3QATA 3MURP 1PC4A 3I31A 4WIQA 2NZCA 3ITHA 5CHCB 4OZ2A 5T7LA 2BM0A 1K73T 2FJVA 4OFZA 2ZH6A 3JQJA 4D3GA 2E9ZA 4BHQA 1KOOA 1A6LA 3MAQA 2FJWA 2HHTA 2ROEA 3WQPA 5J1EA 2R9LA 1LV5A 2HHUA 1KVJA 3C16A 3AOAA 4FYVB 2M0GB 2Q6BA 4XK8C 4C97A 1TR0A 1RAEB 4ZN3A 1M5SA 1P1TA 4PPZA 3FQLA 3ZZRA 3C15B 2CQ3A 5IQ6A 2GS8A 3CW2C 5H9EK 2JHEA 2XI3A 4RZRA 1IR1A 5AJ3F 1EX8A 3KKFA 1D1UA 3PCOB 4AL6A 1TK5A 1D9FA 4ZP7A 2HW3A 3FK4A 1YJNS 2AT1B 3QT8A 4X66F 3CD5A 3ULHA 4A8OA 2JEIA 3CJ2A 4LQ3A 2JDJA 2I1RA 4PXEA 1IKXB 2OPQB 4X4NA 3CCWA 4DV6J 3Q8YA 3R6LB 2MQNA 4NI2A 3LAKA 1FA0A 2A1BA 4CH7A 2XM3A 1WC0A 2XMKA 3MEDB 3MF5A 2J5AA 2FC8A 4IRKA 1RE1B 4EEYA 4OYWA 3R6GB 2B5JA 3SCIE 3OL8A 2UVVA 4LF7F 4FF2A 1GK8A 4DI6A 3A8EA 2ZD1B 1M1GA 2QTWA 3TAMA 2YX7A 1UWBA 3HD1A 1PO6A 2VG5B 3MUTP 2FVCA 2KM8B 4JI8J 3PHEA 5E7OB 1URNA 1UKUA 5H1SV 1N5SA 3KK1A 1S72S 5LSRA 1QD1A 4BS2A 2FIUA 4LFAJ 3J7ZT 3NWGA 4YY3J 3EGZA 2MKCA 1FXLA 2K1RB 4ZVFA 5HSPA 3G96A 3EM1A 2V4RA 4L76A 5G4DA 2WCXA 2QE5A 1P9YA 1H73A 1U02A 1B3TA 2WOMB 2BMBA 4B3RF 2FHMA 2VC0A 2NYIA 2YWGA 3R3TA 3N6LA 1CJUA 1S1UA 1NEEA 2ACMA 2DH8A 5I4MA 1S10A 4NLQA 1YVFA 3NNHA 5HI7A 1NUEA 3RBDA 4K4XA 1KOHA 4U8VA 2VU5A 4W92B 2XSJB 2Y9HA 2JX2A 4HACB 2AD9A 2Z2ZA 3A8KA 4K4VA 2UV8G 5CYJA 1X9WA 4J9NA 3ZTOA 1S1TA 2EBGA 1H2TZ 1VQMS 4PAAA 2B4PA 4NI2B 2E7XA 2XSFA 5CA5A 2JEJA 2ZKTA 4DFJA 4K7QA 3BSOA 2PIIA 5ADZA 1U48A 4HT5A 3Q2SC 1HQ2A 3DRXA 3LPYA 3CF5Q 2CKWA 1P8GA 3MI7X 1RTJB 1ZPWX 1HNIA 3CJ8A 3A4TA 4ANDA 3ENWA 1WF0A 4ZVOB 1TL1A 4LUBA 3M4XA 1IKWA 3WC2A 3J81j 3KJNB 4Y6IA 1IJFB 2IAJB 3W9IA 4DF8A 1S1WA 2ZJPQ 3GSDA 1KHVA 3NBPB 3CE8A 4KV8B 4L75A 5F8HA 2GVZA 1Q4RA 5L1JA 2C2RA 4CO4A 3QAEA 1YITS 2Z2LA 5KFAA 2WZ1A 4HYKA 3H42A 4NA1A 5ETQA 4EBEA 4MTPA 5CCLA 1RABB 1T9XA 3FBBA 4IOCQ 4DSLA 3DLEA 4ZP9A 3CD7A 1AYEA 5J2NA 3JTNA 3NMRA 5KFHA 2J0QD 3GIMA 5HMWA 4MKYA 1N8RT 4F0MA 4DMZA 1Q78A 1SC6A 1LWFB 4EO6A 2ZE2B 4CIOA 3PW2A 1YG0A 2LQ9A 3QRQA 1S7HA 9ATCB 3D0HE 1S0OA 1DQAA 2WB4A 2DY1A 4Y28C 3I56S 5KFNA 3HJFA 2H9ZA 2DBBA 2HBQB 3GONA 2DXEA 3N6NA 2YPYA 5LL6d 1N54B 5C24A 2WHOA 1AXQA 2VBYA 4CH1A 2RNEA 1HR0F 1IBLJ 3KLGA 3RRGA 2CZVC 3DLLQ 1NNDA 2UXCF 1TAQA 4QWEA 4DV4F 4AL7A 3C6UB 3UE2A 3BQ2A 2J6TA 3DLHA 4ID8A 2OO4A 1KHWA 1RWPB 3W9JA 3GJSB 5J2QB 1B4SA 4UW2A 4ZK7M 1X9MA 1WNEA 2RT3A 2R2SA 3D6FB 1HNVA 3PW0A 4G3IA 2HNYA 1O51A 1WJ9A 2BW7A 4OV1A 5JVHQ 2JVOA 5C25A 4ZKAA 2YWWA 2F40A 2AX1A 1HWIA 3Q0AA 5KT3A 4G1QA 1VBXA 1FKOA 2KL8A 1RTDA 2VA3A 1JLEA 1HNWF 5KFTA 2GW8A 3UCZP 4DV5J 2JWNA 1YI2S 2YKQA 2DXFA 3BSNA 2VG7A 3IRXB 3OD2A 2RRBA 4J91A 4JV1A 3KJQB 2CPZA 1YRXA 2DO4A 3HHLB 3IM9A 3OR1A 3E3XA 4H54A 3FRZA 2MTLA 1W26A 2MYFA 2XMAA 1KNZA 1GH8A 1NU4A 2HYIB 3CCZA 2XNQA 1WSRA 1N6QA 1VOMA 5L1LA 1NK8A 4CDIA 3LGMA 2VQFF 3NGTA 2HFNA 1FFSB 3D28A 2L41A 2J6SA 4K0KJ 2H5EA 4KFBB 3LP1B 1N56A 4ZS6A 5BYRA 4IG0B 1U47A 3ET6B 2LQ5A 3RJMB 4KBIA 4NLPA 4PWDB 2HHXA 1S0VA 2HAFA 2BKOA 1IVZA 3HX9A 3HFVA 3PX4A 1FXRA 3M2RA 4QIGA 2AJ2A 3MR3A 3SFUA 1C1BB 2RU3A 2JEFA 1BQXA 1YBAA 2VFRA 3BR8A 3MECA 4Y2KA 5IZHA 2NR0A 1IBLF 1HR0J 3THTA 1K47A 3MCOA 2VBWA 4FXVA 3ZTPA 4N56A 3CJKA 3JYTA 3DC2A 3FRYA 4LF2A 4YN3B 1S1WB 4MK9A 1IUJA 3AB2B 1ZTTA 4NXNF 3M8ZA 4KGZB 1TKTB 2RIJA 2GHPA 4KHRA 2GIFA 2OPRA 2V4JA 3DU5A 4Y2MA 3WZ0A 2HHVA 2YTCA 3EZUA 4MYTA 4DCPB 1LK5A 1NDLA 3CDBA 4F36A 3GSIA 1YIJS 4IH6A 3K17A 1UZDA 3ZZUA 4QCLA 5CQGA 3DOMB 2DKOB 3L7UA 1TL5A 2D69A 4ZPAA 2XLIA 1RT6A 5B0CA 2QSFA 1UMJA 2WVDA 3KNGA 1Z2ZA 1M5KC 1OPIA 5L9XA 1HNWJ 4DR1F 3UI3A 2VOOA 3CDEA 1U1NA 1HBNB 1FDDA 4DG1B 2KKHA 2LQJA 2KVQE 2MSSA 4DHVA 5FDLB 3JXOA 5HP1B 1GXUA 2BOAA 2DIVA 4DPOA 5RUBA 4EZ6A 2HRYA 4QW8A 3RUBL 2OI2A 2HIQA 2WONA 4QU6A 1WC5A 1KD1T 3EXYA 4K4WA 4FDFA 1RHMB 4ZLNA 5AXKA 4DFKA 1CJVA 1BGXT 1CJTA 3ZFVA 3MAAA 4QR1A 4C8OA 3K7RA 1CVJA 4GKKF 4QPXA 1SJQA 2HURA 4MK7A 2KG0A 1NSQA 1R6VA 1S49A 3IMQJ 3Q86A 4JI5F 1GTEA 1R27B 2CNKB 3KLIB 2V8GA 1R8PA 2Z2YB 4I69A 3CPWR 2VC1A 2D3O1 4ECZA 3PYGA 4OYIA 3UDLA 5HL7Q 1M5OC 1VHIA 2DIUA 2OUGA 1S9GA 1Y10A 4QR0A 5ETMA 4RU2A 4PG7A 2H54B 2FJAB 3UN2A 2UZAA 4CO1A 3L95X 3LP2A 1IN0A 3N5BA 2DGUA 1CLFA 2HQ3A 1NSPA 3ISZA 3HCXA 1SJRA 3T6JA 1BWVA 2KHDA 2VHGA 2DNQA 4KFBA 2PI4A 3ZZPA 1RADB 4OIXA 1N5VA 3T3FA 4IUFA 2Q3PA 1TQLA 1N33F 4N8OA 3Q2TC 2MXYA 1GX6A 3RG6A 2E7WA 1O8BA 1U1MA 4BC9A 4ZJLA 2UUCJ 2B4VA 5KAKA 5A2QY 2LQBA 3O2IA 1TMMA 2EG1A 1SJ1A 2V2VA 5A6WA 4DCJB 3UR0A 4J9SA 2R8KA 1HBUB 4OX6A 1N32J 3OTBA 1ZAWA 3CCMS 4C8YA 2ASDA 1AT1B 3F0NA 2CPJA 3PFEA 4DPWA 3JQKA 3CMAS 2IFXA 2QN6B 2BJ1A 4IO1A 1F60B 4EZ9A 2O01C 3ETMA 2XLKA 4ZCKA 4ITSA 4OYMA 4W90B 1NH8A 4CP5A 5DDOC 1M90T 5FLXU 3MD1A 4P2FA 3G82A 4DV2F 2ZOMA 2PMWA 2HAIA 3LF0A 4O4GA 2CQDA 4F04B 2IA0A 3N28A 3GPAA 4C11B 3EVWA 5IC4B 5C2GA 1FO1A 2YH1A 4I2PA 3DI6B 3L4BC 4DR6F 3TRGA 2DGWA 1YX2A 3MPYA 3E01A 2BEFA 2W4PA 1SKUB 2YQ0A 3HSJA 5IQQA 3RBEA 3MM6A 2F9JA 4OI6A 3G8TA 4N76A 1RYSA 4TKTA 2LQ8A 3AA8A 4XPCA 2QL7B 2V4QA 3D68A 3TR5A 4OJ3A 3EPGA 1RISA 2AIRB 4YHHJ 2P6TA 5IM0B 4I4BA 3BR9A 5KOXA 4CLPA 1RAAB 5CXTA 5FDLA 1NCLA 3TX8A 1WC6A 2FGOA 2DGVA 3OHBA 2XHCA 2R2TA 2AGQA 1FXDA 2LXFA 5D0RA 4J9VA 4G1PA 3IP0A 2JLFA 1FVSA 3W7BA 1KFDA 1FI4A 2F4FA 3CJRA 3HVTB 2IM1A 2RUSA 3KUHA 2GO8A 3M8YA 5KT2A 1YBTA 2W9BB 4ECXA 4ILMA 5LXYA 4ZPCA 3T1YJ 1V5IB 1XNQJ 4LF6J 1N5YA 1LK7A 4XDDA 4DLEA 3H59A 3QO9B 2JSXA 4F4ZA 3KYLA 4FYXB 2APOA 1QTNB 1LKZA 5EHHA 3DKDA 1SUQA 1FRMA 2KXFA 5HBMA 2J7UA 5CYQA 3EGNA 4ZVPB 4PUOB 3UNYA 3O6QA 1JNRB 1HQEA 5HO4A 1FD8A 2OTJS 1V3ZA 2V9WA 1U49A 2H48B 2P9CA 3VWSA 4X66J 1U6FA 1MLAA 1HNZF 1DFDA 3MPUB 2B7BB 4C8MA 2NPFA 4JI7J 2K2PA 1VS3A 3AQPA 5DDQC 4KRWA 2XMVA 2HIYA 2EFQA 5KOWA 1RA7A 4NASA 1J5OB 3W1YC 3AOCA 1FK9B 5EX0A 4F4AA 3H4DA 3CULA 1AFJA 1B99A 2H5IB 2Y0BB 3BS9A 3HDSA 4NYZA 1SB6A 3OTOF 1S1TB 4ZPWR 4JI6F 2CVEA 3MDFA 1Q5YA 2AZ1A 5HATA 3GV8B 1VQYA 2VQEJ 2W2OP 4J5OA 4J9RA 3LP0A 3AB4B 3EDQB 2OPQA 2V8HA 5IM0A 2EK1A 4C8KA 1JQGA 1BE4A 1REGX 1RT5B 1ZA1B 2D7SA 3PV8A 2RHQB 4C7QA 1FTRA 3ILJA 1X31C 4DPYA 4ETXA 4ECQA 3P45B 3EZ5A 2EC2A 4RWWA 3CD6S 1CJUB 4H4KC 3UD3P 1SL1A 1JJHA 3DRPB 2OPSA 3QPIA 5F8NA 2DR6A 4IFYA 3JSMB 4B9UA 1RAIB 3BBCA 4B9LA 3X1LB 3M8SA 3BZQA 2R3VA 4JUZA 2W9AA 3PYFA 4K5RA 5KTQA 2MZ1A 2JC1A 5CYQB 2HLUA 1F9HA 3EMTA 2L08A 2YNFA 3FCVA 3FEYB 4DUYF 1S57A 1RT7A 4CH0S 1ZM4A 4WYLA 3M8WA 2G4BA 1TL1B 1UJ5A 1MG7A 4QQBA 4DPTA 4ZVUB 1Q82T 1K8AT 1CQMA 2RKIA 2AJFE 2FD2A 4HVZA 4S0MA 3R8YA 3MMBA 3KLHB 2UUBJ 3BREA 2DRAA 2W8KA 1RXOB 2O67A 3V4IB 1Y7PA 1ZTWA 2MB0B 3IO1A 4CLYA 3CDAA 4DV3F 4DX6A 3VAJA 4ED7A 4IH5A 4OZ5A 4OHYA 5IT9U 5KFDA 5GVQA 3I4HX 3C6UA 2FHJA 2C3MA 3P96A 3UO0A 1AROP 5LMNF 2ZFHA 1PJ7A 2IVYA 3OFGA 1FE0A 1HBMA 3KLEB 4FYDA 2ZBRA 1TZ0A 3BKTA 5HVFA 3JSRA 4OX9F 2ZVSA 1UFWA 1VQ4S 2HK2A 2IJRA 3KUGA 3M6XA 1RLCL 2DR7A 3BDPA 1K44A 1MROB 2CDRB 1E6VB 1X0PA 2J7KA 3O44A 1F1BB 1KBRA 2F65A 4USUA 3WC0A 1TP7A 2RU9A 4DR7J 2A10A 3T5HA 3FMBA 4PG5A 4WIIA 3HULA 2F4VJ 4B3MJ 1TU0B 5FJ4A 2E44A 2B4OA 4NYOA 1HARA 3TEHB 3LANA 4L3KA 2DYAA 4YB1P 1T8EA 3BBFA 3GIKA 4J9UE 2KT3A 2UXBF 3NNAA 4HL9A 4RWXA 4O3QA 1WSVA 2XCAA 2VG7B 2K7JA 1HNVB 3OR2B 1AUSL 4ILRA 3ZTSA 4N41A 2HK3A 5KG3A 4K4UA 3NKYA 4LRDA 1H72C 4PWUA 1KRPA 5L1IA 1M5HA 3JB9k 4IRDA 2XG8A 4D3HA 4G1QB 1FTCA 4NEZA 3ISND 4AXJA 3K5NA 3B6BA 3J80U 4DV4J 1U7LA 4NA3A 4WFZA 1X8DA 1SQFA 2HVDA 4K5SA 4R25A 1I6JA 3C3LA 2DHSA 4HTJA 1R0AB 1V6HA 2GIRA 2H4WB 5GMDA 4YB6A 3D7SB 1H6KX 3GQCA 1Q86T 2QLXA 2GIQA 1L3TA 4KPYA 1PAUB 1SXLA 5IV4A 2AU0A 2IIHA 1UW9A 5KFIA 3J81Y 3S1TA 5A8KB 1FJEB 1U45A 3HK2A 4ZHRB 2HNDA 4LF9J 3Q8SB 1LW2B 5D4PA 1OY6A 4WBFA 1NZ8A 1IR0A 1FT8A 3EX7B 1YJ7A 4UOFA 5F8LA 1HBMB 1JLGB 2HVEA 1F5AA 1HNXJ 2B8PA 2PEBA 2YKAA 4DL0C 4HDHA 1JJ4A 5ETOA 4RW6B 3PIOQ 1RT2B 3FFIB 4IH7A 3FCWA 2GAHC 2VOPA 1H2UX 1IR2A 3TJAA 1YJUA 3DOLA 4YQWA 1G1XA 3PW4A 2LCWA 2WOMA 1TL4A 2G13A 3K5LA 3QRRA 3MAHA 3G87A 1KEKA 2EG2A 3IG1B 4PXDA 3RB0A 2QLFB 2KB2A 4H4MA 2RF2A 3ZNUA 1U8SA 3MMAB 3S8SA 3THVA 2MKIA 3NNCA 1ZOTA 1S1XA 2X3GA 2HGMA 1ZAVA 1RTHB 5GAHU 1I5OB 1KS2A 3GJRB 1C1CB 5SZTA 3MMCA 2UV8A 4K4TA 2AEMA 3K5PA 5CH7B 4GKJJ 4QR2A 2OD4A 4PQUA 4XO0A 1X5PA 2RRAA 3M2UA 1KC8T 4K59A 2IRYA 4PG8A 1I51B 1DTQA 2HWTA 2DGQA 2QLJB 2RDJA 1NK4A 1KONA 2K7KA 3M8PB 4AL5A 3LH2S 4I1TA 3F56A 4YS2A 5JVGQ 2JNJA 2ERRA 2L9NA 2W9CB 4FBTA 1DZ5A 4UQGA 4A8XA 2P8IA 3D2WA 3BSCA 3HHLC 2NREA 3VGUA 4E8UA 3NS6A 1JLGA 2Y1RI 3C66A 1QE1A 1RT4B 2HHPA 3NGKA 4HHUA 3ZTQA 1YTYA 3BYPA 3DRRB 3HXMA 3KLEA 2FPHX 1CJKB 4ER8A 3H2UB 2DO0A 3V6DB 4EI2A 5A8KA 4OZ0A 1WORA 1UVIA 1AUDA 1YJTA 4K2JA 1W7WA 3QIDA 4WK1A 4L73A 1EQMA 4PEOA 1YRTA 3I5CA 2HS0A 2EFVA 4CO2A 2CYYA 4Q43A 1N36J 3MMJA 4Q45A 1KFSA 1U8WA 2Z8QA 3O1LA 1OSDA 4ALZA 1T3OA 4R5PB 1TK8A 2UU9J 1SC3B 1B7FA 2FHOB 4LRFA 4YY3F 3LPEA 5J1EB 1HBOB 2HFZA 1IWGA 4Z7YA 3T41A 3RAXA 1MSWD 3V6JA 3A3NB 2QV6A 4ZCLA 1S9GB 3LOUA 3CMES 2DHXA 4OYPA 2KT2A 2YH0A 4R8UA 5F9LA 4X4RA 1WDTA 2RDDA 5ETVA 1E6YB 4C3LA 4P73A 3QSYB 2NS1B 3C14B 3BV8A 3CCLS 3H2VE 4AYBD 1UFKA 3G4SS 3NCPA 1U1LA 4FXDA 4OZLA 4J37A 3N6MA 4TVAB 3KLGB 4ED2A 2QLWA 3JQMA 4DDFA 2J8AA 1FNOA 3NEKA 1F3FA 1XEZA 3GIJA 1N0UA 3H40A 1RWOB 2HHHF 2J0XA 2M2BA 3HSGA 5F0WA 1KQFB 2ATCB 2FHJD 3FMWA 1VBYA 2XYGB 1QSSA 1CEZA 1YLXA 3K89A 2HBZB 4RW4A 1SPBP 1NPPA 3NAIA 4IG3B 4ZIWA 3DU6A 5GAHI 2JLGA 4KH1B 3LA0A 2ZH1A 1NH7A 4QU7A 3KUEA 2XMJA 5G0RA 2Z56B 4RKUC 1FRXA 2WBMA 3BM7A 2AJQA 4KGMA 1HFEL 3QT6A 2XWYA 4I68A 4KAIA 2GGPB 5CZXA 1Z4UA 1KQKA 2NCKL 1RTDB 2R7SA 3R5DA 4NCGA 3MHYA 2UVRA 4B3OA 4KIAA 2PMZD 2BYCA 3MUVP 3MMAA 3H5XA 1GFWB 3MTKA 4M5JA 2BE7D 3TZWA 4EBDA 2KFNA 2CADA 3QSIA 1Y11A 3UVJB 3TA2A 2DNGA 2ZWPA 4ILLA 2ZBIA 3OR2A 5EN1A 2LDYA 4P2MA 4OX8A 3TO8A 1S0MA 4DQIA 5AE3A 3GILA 7FDRA 3CTRA 5DGBA 5D8HB 3NLCA 2XYHB 4FF1A 3TUPA 2W1BA 3D3CJ 3SIPB 4Q44A 4CLSA 2GV1A 3MR6A 4MT1A 4OYZA 2ABYA 2FDNA 5BXIA 2W9BA 1IBKJ 3R27A 4WP8A 3NXZA 4C0BA 2RRNA 1H74A 1RUSA 2ZH4A 2UU9F 3W65A 2ZUAA 4E98A 2GJIA 3BGOP 2I6WA 1DARA 4M5DB 2MKJA 4DBQA 3SSSA 2OLWA 2P5VA 3H2LA 3US5A 1CC7A 1DBDA 3BGFA 4ID5A 4DSEA 2BRLA 4UTGA 1TUVA 3O5TB 2VD3A 4URQU 5G0RB 5LMUF 4JI3J 2KZMA 5H9FK 2DK2A 3DMJB 1FESA 3HT3A 3DCAA 3RW7A 3DLEB 1Y5NB 1Q53A 2B9YA 3M05A 3CCJS 4JI2J 2BQRA 4EBCA 3IR5B 2GQCA 1FCAA 2IA6A 4N7TA 2OMOA 4AE5A 4M8LA 1GMVA 1FD2A 1T05B 1I1GA 1SL2A 2BJ8A 4DSJA 2E1MC 2M4MA 4RW7B 2XWXA 2ZZMA 4NXNJ 1SQEA 2LFVA 1BMQB 1VDHA 1S1VA 5KFJA 1Q8KA 3VZIA 4DR4F 5DGAA 1GXTA 2XEXA 1EKSA 3UWTA 1EP4B 4RNFA 3EJMA 5AT1B 2MGZB 4EYHB 2CQGA 2R7UA 1D8ZA 2VB6A 5HBMB 4ZN1A 4UOCA 3Q23A 1K9MT 1Z2LA 2BXJA 4CNYA 5B0AA 2OP5A 3OVSA 1Q5VA 2FJBB 1HNIB 3OT9A 4JB8B 3UD5A 3PX6A 2HWHA 2J9CA 1U6ZA 2B51A 1B0VA 4ZMMA 3BKFA 4P74A 3MM8B 4NOHA 1NJWA 4JI4F 3BJYA 2RQ4A 2B8QA 4ZPVR 2XS7A 2HKEA 2YKNB 4ZJQA 3M32A 4TXSA 4DX5A 1AZSB 4YB5A 2GMHA 2X1AA 2IJNA 2VFUA 1RI7A 3D1OA 2KHCA 5KFRA 4LF4F 1ZAXA 3CCTA 4J9KA 2OMLA 4ELVA 3ZNJ1 4UZBA 1RCXB 1ACMB 2B3TB 2QA2A 2ZZTA 1VGYA 1VJQA 3EDRB 3GLJA 5DRKA 4HHHA 4QWBA 1I3OB 1W2BR 4NXMF 1SQGA 2AZ3A 3W64A 5A76A 3OFFA 3R2CJ 2N3LA 1N4LA 4RNNA 4F3MA 3WDOA 2YKMA 2E7VA 3DNCA 2IVFB 2BJ3A 3PKMA 3R7SB 2R7QA 2NYHA 1YJVA 3NS7B 4O44A 4I6YA 5F8GA 1QSLA 4QJVA 3W8PA 1R8AA 3R5JB 1IBCB 1T02A 2KU7A 2XHWA 2DPJA 4F67A 2FTRA 2BKPA 3MEGB 2KZZA 1R8HA 2G9OA 1E6YA 2YX1A 3M7VA 4USWA 3IN5A 2BZ2A 1H7XA 1UL3A 4RW9A 1CJTB 1DY3A 4Q0BB 4JP8A 1TELA 4ED1A 3H8YA 5I3QA 4R0EA 4IR9A 1XNRJ 3M2RB 3NL0A 4U9RA 4Z37A 4DR3J 3DN9A 3KMQA 5KG1A 1HW9A 1S6UA 2BJEA 3PVXA 4A8KA 4U7UD 4QIVA 2WVBA 4FYWB 3DM2A 1IBKF 2DHHA 2HZVA 4DPUA 4KR0B 1IQZA 5ETTA 5HN0A 3RAMA 3TW0A 3RRHA 2A6OA 2WSCC 2DTJA 2VF3A 3NY0A 2JH3A 5LSLA 2W4DA 3FKBA 5KG0A 3T1HF 2EKYA 1UVNA 3C16B 3P6YC 4YP3A 3K0JA 3R7NB 4TLQA 4OI4A 2WSEC 1YGYA 3IRXA 3D6TB 3OL7A 4TY8B 1XTZA 4PG6A 3C46A 3QWUA 1NJXA 3CDWA 5F0UA 1BHNA 2OPRB 1S12A 2V4JB 4WPAA 1FVQA 2HWIA 3HD2A 2IRUA 2A0FB 2BJDA 2GCFA 2SXLA 4I7FB 4Q2MA 1EP4A 6FDRA 8ATCB 3FEXB 2ZH9A 2CJXB 2RKIB 2X3DA 3U1NA 4RUBA 1XR6A 2R4FA 1EB0A 4O44B 1KVKA 4ZLLA 3AXKA 2Y1IA 4Y2AA 1HA1A 1FHTA 3D1HA 3BGRB 4LSLB 2ASYA 1Q81T 3ET6A 3CO0P 1RWNB 1ZPVA 3RGIA 2GX8A 2VL1A 3A3OB 4IRCA 1UZHA 3K2YA 3W5XA 4X62J 2VQEF 5DG9A 2UXDF 3EVMA 2A2CA 2V2QA 3EUNA 3MPDA 2OEMA 3GV7B 4C3KA 1Y3JA 2V6AA 2UVUA 2YKOA 1N5QA 2BJ9A 2MQQA 4LFCF 3DRYA 2MLYA 3AXMA 2R7WA 1X9SA 2YWHA 3I87A 1S9EA 1SC1B 2P9EA 4ID5B 1GNKA 4DL7A 6AT1B 2B5JB 4DV1J 4X4SA 3QFHA 2HHQA 2ZVIA 1RWMB 3CVKA 4Y3CA 1RAFB 3EXCX 3D0GE 2RHSB 3MZIA 5DZ7A 4U6PA 2CG8A 1AZSA 4ED6A 1KSPA 1NSAA 2C2DA 3GIRA 4XTTA 5F9NA 1RWWB 4Y2IA 4A8WA 2HPUA 3BGUA 2VBZA 2IM0A 1VR6A 4WWSA 3DXSX 2C3PA 1N34F 4M1KA 2KM8C 4HACA 1TKZB 2B4UA 1DTTB 4KO0A 5CZVA 2ZC4A 2HNDB 8AT1B 2VFVA 2IPOB 2GVDA 2YNHA 1X4BA 4NE9C 4X62F 3D9BA 1W2IA 3N4WA 1VQNS 5IWAJ 2VICA 4WE1A 4K50A 3FGVA 3TEGA 5MAOA 4KGVB 5AXNA 4J7CA 3UN3A 1JLQB 4QWDA 5DZ6A 2BA9A 2IAJA 3KLVA 2UXBJ 5LXRA 2VPXB 1FJCA 3BGLA 5DO2A 4FVMA 4DV1F 2D41A 4WFYA 2KYZA 1N5YB 4KSEB 3K5OA 2CQ1A 3BB5A 3H4BA 2FLOA 3NCQA 4K8RA 5DQHA 3SQGA 3TJ8A 3M30B 1RBAA 2AEFA 2RF2B 4FPIA 1R89A 1REVA 2PGCA 1SV5B 3GYNA 2DNPA 3W66A 3OJSA 2XULA 3PKYA 1S4EA 4NRTA 4UF4A 1TKXA 4W4MA 2XNRA 3NWRA 3MCMA 4IDKA 3CJ0A 2WVCA 5GAGI 1VQLS 4RUAA 4JI5J 1RBOB 3GR0A 5DLFA 4ELTA 4RW6A 3IBCB 3PEJA 1O5JA 2D9PA 2ZBQA 4LFCJ 2AGPA 2LLZA 2MZTA 4LSLA 3KJVB 1AFIA 4C3MA 1WOOA 2D1CA 2H65B 3GMGA 1CSJA 2WAQD 4DR7F 2MJNA 4L6V3 2G1HA 3B82A 3OTCA 5ETKA 3E01B 4YR3A 4DF4A 1NM2A 4KY3A 3TAPA 4QYZJ 1DTQB 4NRUA 5DQGA 3CC7S 3MEGA 4P9SA 1TVRA 2AQ4A 4I7FA 4KYZA 2CIMA 4CO0A 3VAMA 2V8DA 1UVMA 5IS2A 2AJ0A 3PRBA 2CJ9A 2Y8WA 2VUGA 3D66A 3I9ZA 4U7UK 3CNQP 3MM9A 1QAIA 2GZOA 1D9DA 2MPUA 1QDUB 2GGPA 3TVZA 1RU1A 5F8MA 3NAHA 5T7LB 4RNMA 4DR5F 4F0HA 2B56A 1X4DA 2CPYA 4RPFA 4USTA 4XPEA 3M8RA 4OL8A 7FD1A 2BDPA 5E0OA 3M9NB 3EYZA 3HVTA 1X0FA 2VFSA 2V94A 3LP1A 4OZJA 4YMEA 4DR3F 1Q8BA 1BXNA 4PABA 4F02A 4FZVA 8RUCA 4JV5J 1GQEA 1UCNA 2FY8A 2E9RX 1PSDA 3MCSA 4UQTA 1N6QB 2V50A 3SV4A 2OJ3A 2MY7A 4OJGA 2WVFA 1U25A 3LALA 1XBWA 3SCLE 3T1AA 2R2RA 1FRJA 3HI9A 3IM8A 1LXNA 2ACYA 2EFNA 3CCES 3OSPA 5KG4A 2M9KA 4NLOA 1VBZA 3NMAA 3D5MA 5HK4A 4F3QA 2F8HA 1TUGB 2JZ5A 3CMQA 3LWLA 1ZZNA 2X1FA 1H7WA 4X4VA 4WK3A 1JKHA 2MZQA 1MNEA 3VCDA 2MQ8A 2ZH8A 1KTQA 2AV5A 3J7Z5 1C4AA 2C2MB 4OV6A 1VMBA 1KLMA 1OYDA 3OXGA 1RJJA 2CQBA 3AHPA 2HGLA 4G65A 4CNZA 3GR1A 1S59A 3OXFA 1RB0A 4OX7A 3TZXA 4U67Q 3VAIA 1UA1A 3TAQA 2LYVA 1UWBB 4A47A 2N4CA 4QOTA 5A0YA 2HSEB 2ZH3A 4RW8B 4DLGA 4G6VB 2D9OA 2MZRA 1WC3A 2N4DA 1VIOA 4LF1A 2ZC3A 3AH6A 4PG4A 4RO0A 4Y0FA 2OIHA 4ECSA 5KG7A 5K8MA 4YB7A 4TU7A 3KFWX 2XY6A 2VIHA 4C8NA 2R7VA 3EGWB 2R7XA 1BWEA 4DV5F 1V3RA 2J9EA 2BABA 4ANEA 2M8DB 3HM9A 3C8YA 3FQKA 4PUOA 3M2VB 5KT4A 4OHVA 4P10A 4LBHA 3H5UA 1ZZFA 3C15A 4CRJA 5CD4H 1Q7LB 3KG0A 4N77A 2H51B 3D6MB 1IKXA 2MKSA 3JTPA 4I0WA 2HNZA 3Q8VA 5HLFA 4FS1A 1TL7B 4DR4J 5KFEA 1HPZB 3O8WA 4M63A 3PRVA 1SCJB 3LQVA 4PZVA 5FIIA 4ZVRB 4IQXA 4MKVA 4QW9A 2B6AA 2I9SA 2XMUA 1JB0C 3MOZA 5DG8A 1NHKL 1WEYA 1Y5LB 2G0IA 5ETRA 3KG1A 4E0DA 1WHXA 5BYSA 2CDQA 3W60A 4NCAA 3AODA 2FJDB 5GADI 1MN9A 4F2RA 1KP6A 2HFOA 4RW8A 1RYRA 1PCAA 1RP5A 2LU2A 2DNHA 4QBUA 2B7CB 1V9OA 4C0HA 3QT5A 5HVHA 3CCUS 1VQ7S 4C48A 5D0HA 3PXGa 1I94F 4WXOA 1FEEA 4EU0A 2FZCB 3Q22A 4NMLA 1T05A 1QM9A 4P7TA 1PJ6A 4I2PB 4JI2F 1FKPB 5D4LA 4MAKA 2VFTA 2YWKA 2UP1A 1EKRA 1F6TA 1R0CB 1IBMJ 4CCHA 1U0SA 1XR5A 2JFDA 1RWVB 2AP6A 1OQ6A 5E3PA 2E1RA 1NDPA 2G0JA 4C6AA 2ZM6F 4Q8EA 4HT7A 4EUVA 3W3SA 4LRCA 5E3QA 4A46A 4KC5A 4IFVB 2QJ3A 3QFWA 1HPZA 2DCUB 2XSJA 3T5JA 5LT5A 5I3UB 1ZM2A 3OW2R 1DURA 4P7VA 1UJ6A 2XB2D 3GWCA 4M5IA 5EDWA 1S1UB 3EWGA 5EWGA 2DEJA 3TQ1A 1BD6A 2HHHJ 3T9NA 4ETZA 2O66A 1VC6A 3MGJA 2RQCA 1P9QC 1H98A 2J9DA 3ZZZA 4IOAQ 2KT5A 2ZNZA 4I6WA 5HQMA 3G6VA 3FCHA 3UFCX 4AFFA 2CZ9A 3G8QA 2CPIA 2R8IA 3AJ1A 4USKA 3B78A 5GMEA 2CAJA 2PN6A 3FDSA 4Z7CA 3B54A 2XI2A 3LTOA 2MJUA 4F4KA 3CIZA 5AJ3J 2XCPA 4BCAA 2XGPA 1FJGJ 3MOJB 1X7VA 3FBCA 3I0RB 4NLWA 4GVBA 3CCRS 2J0WA 4JI0F 3J7AN 2YBVA 3M8QB 1MMDA 2HFSA 4DWIA 3Q8PB 2X51A 1B0PA 1R8CA 2PC6A 1SIWB 3R5AA 3QJJA 1DLOB 4FPRA 2R7TA 2KRRA 4RX6A 2PSZA 2GA7A 2RSQA 2B6AB 2KJVA 3D0IE 1IJEB 1LWCB 3K8WA 2R8HA 4YR0A 1VQ8S 1IM6A 3JSBA 3F73A 5IT9Y 1K1QA 1OO0B 2HQGA 4NWBA 4OHXA 5HMXA 3HT0A 2KVIA 1T95A 3JSYA 1FFWB 1SI9A 3TUJC 5L8RC 3S6EA 2NXNA 2EI5A 2V8VA 3MEEA 3AFGA 2CXEA 3PACA 5HAOA 4CLUA 1FRLA 1VRTB 2RQMA 1R0BG 1PYSB 1L3SA 1PGZA 1RT3B 2FVRA 3QIPB 1FK9A 1R0AA 3BGRA 2HHWA 2DD8S 3VQTA 2JLEA 3HMJG 4LT6A 5A2QU 1PJ5A 2OEJA 4ATNA 1CULA 2KYXA 1EIYB 2X1BA 3MM6B 1B64A 1S5ZA 2BW2A 1OY8A 3W62A 2ZJRQ 1SIZA 1VYAA 5KFVA 2QSWA 1GAOA 1ZBTA 4KPCA 4WP9A 2FVSA 3R9LA 1NKBA 5BYQA 3QYYA 3R5GA 4WKRA 3S7RA 2ZDOA 4Z2XA 3OJUA 1WACA 2CUYA 3CJ5A 4Y34A 3KK2B 1X4GA 2QGFB 2F1FA 2CNLB 3CJKB 4QWAA 1WD6A 2FYXA 1RT2A 2K3IA 2NXJA 1BLUA 3T19A 4AXIA 3H20A 3DHWC 3R7BB 3RYLA 5L38A 4EK2A 4NX9A 4R5PA 4MYUA 4YDDB 3DLGA 3V81B 3NGUA 4B3TF 1BC6A 2W2PP 2NXCA 6FD1A 2IM3A 2ZITA 2YWEA 2Z2MA 1J27A 4IFVA 3I82A 4IFYB 1TUWA 5JJBA 3JSMA 1MU2A 1FRIA 4KT0C 4DSFA 1U26A 5ETPA 3DLKB 1HHQA 2O5DA 3AOBA 2LU1A 3SCKE 4NLVA 3GG0A 2GHVC 3JS9A 1C0TB 2PA3A 5C42B 2PMHA 1FEHA 4DX7A 5EWEA 2EW9A 2PDAA 3EICA 4WFAQ 3LP0B 4ELUA 4LF9F 3BKUA 4OHWA 1FKAF 2DGTA 2F7VA 3V6HA 1WG5A 5J2PB 4LBPA 2KTQA 4BBYA 3UDEA 4YUDA 5HJXA 1N5TA 3MR2A 3I0RA 3DHXA 4WYWA 3PNIA 2ZD1A 3KOAA 1NO8A 1HW8A 4CLZA 4BDPA 2RB7A 4LIWA 4ZCMA 2JJ4D 2XQCA 3CJ3A 1SKWA 4CLKA 1M1KT 1TFWA 1JLAB 3VAKA 5DJBA 1N32F 3V4MA 3HSDA 1D0EA 5KFZA 3AA9A 1FKOB 4UZCA 1YJRA 1M0SA 1Z1ZA 2GVDB 2E5HA 3OBIA 2IDEA 3OTEA 4KKOA 4OLOA 4RL1A 4TYAA 2KN4A 3TAMB 1H38A 2IMWP 5J1NA 5HANA 2B9XA 1HIYA 3T5LA 1YJWS 3CJSA 2HQCA 3A3PB 2AYMA 2D74B 1FFGB 1UA0A 2BE9B 5E3CA 2A3JA 4EFAC 2E29A 2QL5B 2ADCA 2VONA 3X3UA 2DVIA 1G7CB 2DCLA 3KTQA 2G1DA 2LP4A 3LWMA 1S6QB 1VK8A 1N34J 4NZ0A 5KFMA 4K4ZA 4O3OA 5B09A 2Q43A 1CULB 1VLOA 2MLZA 3ZZOA 4RNOA 4JI0J 1S6OA 1RBLA 1DRZA 1NHVA 1BQMB 5K5MA 3IA0A 4NLGA 4ZDNA 3OQ2A 2H5JB 2WBRA 4OLPA 4U95A 1CBKA 3V2UC 2GHWA 4IG0A 5I42B 4B9VA 3DRSA 3DDKA 3A13A 5ETNA 2CQCA 5KFYA 3SDEB 3WX4A 3KHHA 4JYAJ 1UWAA 2Y1JA 4ZVSB 4C9DA 3DOMA 1SV5A 4K4SA 1UPMB 1UJ4A 3I0SA 1S0NA 3BN7A 5K14B 1WF1A 2CG4A 2D3ZA 3G9CA 4YEAA 4WTYA 2KDOA 2XZDB 2W2MP 2E5LJ 4L3NA 4NCBA 2CQ0A 2QA4G 3GIIA 4ED5A 1U09A 3FZBA 4ECVA 2P2CB 3HHDA 1Y5IB 2D3UA 5KFOA 3Q8RB 2I5JA 1X4FA 1M5PC 1IXKA 5LJ5Y 2KH9A 2MKHA 1WKJA 1XMBA 2AYBA 4CLLA 5THWA 2O1PA 1PBAA 4L72B 3KXDA 3SSRA 4ANCA 3BO4A 1FNXH 1XERA 2G2ZA 3MAAB 4L74A 5KFWA 2ALZA 4CTAB 3U02A 2Z58B 3MXHP 4RW7A 3WIVA 3I55S 3H5YA 2VZ9A 4RBVA 1MW7A 1IBMF 4OI2A 1RHQB 2KG1A 2ZOGA 1K0VA 4PPDA 2X7IA 3TA1A 1XC9A 3AJDA 4DS4A 1S6QA 1HBNA 4WP3A 1MU2B 1Y00A 2YY3A 4PYDA 1Q8IA 1T0TV 5L1KA 5I42A 1KQSR 2LXUA 5AXLA 1WKKA 4WKYA 3PRDA 4WU2A 5AXMA 5D3GA 4X65F 1WI6A 2B9EA 3G86A 2G0CA 3KLFA 4A8SA 1RTZA 1BQMA 5HROB 1BUXA 3H90A 4MFBB 2IYIA 3TZYA 3HHLD 3MPVA 1J2VA 1WHYA 1XJWB 4PXBA 4MK8A 2VJUA 1HWLA 1D9AA 4Q0BA 2BQUA 5BR8F 1OQ3A 9RUBA 1WF2A 2FZGB 1EETA 4UY8T 3ZZYA 5K8NA 4AQYF 1RHUB 3PEHA 4OZNA 2UXCJ 2FQQB 1VQ9S 1HMVA 3ENAA 1JXEA 4M5HA 4USIA 4LMZA 2V0NA 3Q8QB 3IGNA 1D09B 1LNQA 1SVDA 3E8OA 3GE9A 4OYXA 3VVTA 2Q6CA 4C11A 5F8JA 3BF4A 2E1PA 5C2CA 4HTIA 4FYYB 1C4CA 4KKOB 4TQSA 1GMWD 3QLHA 3DOKA 2UUWA 4NLDA 1IKVA 3NGRA 1XK8A 5A0YB 4DV0F 2Z30B 2CQ2A 1V3SA 1YSJA 1PBUA 1UVLA 2P9GA 3SYZA 4KE5A 4FKXA 3L7OA 2HZAA 4PQAA 1EJ7L 3SXLA 1UEUA 2HFVA 3ZXWA 4WCEQ 2W8LA 2GNKA 3K58A 4WFNQ 1SBRA 4DR5J 1RT1A 2GJFA 1QUVA 4NPOA 4CWBA 5DG7A 2H4YB 1BY9A 1C0UB 2DT9A 4IOBA 3GU0A 3RTVA 4H4KA 4WZQA 4CYUA 3LAMA 5ETLA 3PW7A 3CJTA 3J81U 1S6PA 1VLYA 2CRLA 1U24A 4N47A 3FEZA 4F50A 2ZBCA 5D4NA 4ES1A 1WOPA 5U47A 4TNOA 3UQSA 3G6ES 1PC5A 3TVYA 3R5BA 4OYOA 1Q7YT 1JLEB 2UUAF 2OEKA 4OZ1A 2EWHA 3SBMA 3CXCR 4DUZF 1SUQB 1KQGB 1XWLA 3FBFA 3G82B 2HRUA 2CA9A 1R31A 5HQ8A 1JLFA 1JLBB 2N7YA 1FERA 3VALA 2E1CA 4Q5VA 4UUXA 3CO9A 4KGXB 2V5HG 4OHZA 3J7YI 2E66A 2EFPA 1U2RA 2MKYA 2HNYB 2VPZB 3RAQA 3D54A 2BR0A 3OVBA 3KJFB 2GQ2A 4PCQA 1T9UA 4NLUA 2OH2A 5KG2A 4LRBA 3R97A 2PA8D 5E3RA 4X4PA 2QEXS 4O0IA 3R2DJ 1LW0B 5D78A 4FF4A 1VQ6S 4N5SA 1HD0A 2X1GA 4LF6F 2M88A 4BLGA 1OWXA 2AEJA 2LECA 2CQ4A 2B0GA 4QYRA 1KDNA 4C8LA 1S7IA 2J76E 4M95A 2AF6A 2QRRA 2HQIA 5K8OA 1WUUA 3IWNC 2QZ8A 4RUHA 1PAEX 1U2CA 2MEWA 3DGPB 3PR4A 1XMOF 1B70B 1R6YA 4TY9A 3N0VA 5KFLA 2N82B 4PWWA 2C2KB 1WOSA 2W24A 3IWLA 3VTIA 4CT8A 2OTLS 5DM6Q 4ERDA 3HSZA 4M5DA 1WKLA 4ZA1A 5IV3A 5LMUJ 1JWWA 3P4UB 4RW4B 1F9EB 3SQGB 2QYCA 1XMOJ 1J5OA 1LWEB 4F2SA 4M94A 2RD5C 2GC8A 2VKZG 3SCJE 3TP2A 3SI8A 2QMXA 3RB3A 2C2EA 1NK5A 1NK9A 2EPIA 3F44A 1JLCB 4O3SA 3BDEA 3KK3B 4YOEA 1X5TA 4IDKB 1T9YA 2DGXA 3M6WA 4LR9A 3KLIA 5E5NA 5DM7Q 3T1HJ 2JRSA 1GXLA 1REVB 3N9UC 3MR7A 1VRQC 4V19J 1N48A 3QLHB 2QIFA 3RZAA 3PYDA 1OY9A 2VPYB 5D0GA 3MUMP 3NGDA 4TY8A 2N3OA 1NLKL 2I8EA 3GTYX 1HQUA 2U1AA 1TV6A 1IWAA 2V2KA 5BR8J 3ITHB 1RKJA 2F9DA 3TUZC 4MMOA 5C5JA 3UVJA 5E33A 2POKA 4ZCIA 4UY85 1RU2A 1B0TA 3OPKA 3AD8C 1QAYA 3U7JA 2FY1A 3T6BA 3OFEA 3IFEA 3MEEB 4XIUA 3IS9A 4M5MA 1DTTA 1RAHB 4KO0B 2RMLA 2YWFA 4NLRA 5D6GA 1T9VA 1NZAA 2DNOA 3MM8A 1RWXB 3QT7A 4DU7A 1JNZB 2A6MA 2M5YA 2V2ZA 3ETOA 3GFYA 2I0XA 4GC7A 3PR5B 3OLBA 4KTQA 1N88A 5JMNA 5A8WB 1UAWA 4MJKA 5CABA 1ELOA 4DUZJ 2BQ3A 2EVZA 2ZHAA 3E51A 1ULRA 2K1RA 3L3CA 5GAEI 2O3DA 3AD7C 4LSZB 3QMQA 4M5KA 2NZ4A 2DITA 4ED8A 3THPA 2WB1D 2ATLA 3KK1B 5DS7A 1WEZA 3SQOP 2CJAA 1QJHA 2IBKA 5JUMA 1JLBA 5E41A 1Y4ZB 3PG9A 4CT9A 1QSYA 4DS5A 1HI1A 4DSIA 2M8HA 3BSAA 1RHRB 1X4HA 2VG5A 2YX4A 1T7PA 1S1XB 4PYAA 5L39A 3BQ1A 3C19A 1U1QA 3IC1A 1RACB 3MEDA 4TU9A 2ZM6J 1Q16B 4W98A 4U96A 2FJXA 1HKAA 1HLWA 5EGYA 5KFPA 4FN5A 3C2PA 2GQQA 3I9V9 1RTJA 1L3KA 4X4OA 2E5IA 1ICEB 3OUYB 1HBUA 2FGCA 3PO5A 4BC7A 2R8GA 4MIWA 1NPRA 2DJWA 3N79A 4NLXA 4USVA 4HHJA 2UUAJ 4B3TJ 2DPIA 1C0UA 4OQJA 2K8GA 3ONQA 1AB8A 1RSCA 1I94J 2HGNA 1LQ9A 1YZ6A 3QGPA 1E6VA 3DLKA 3MM5A 2ZHOA 1ZS6A 5J2MA 3G6XA 2C2ZB 3GFHA 4CLWA 4DCOB 2GAGC 2KFZA 2Y0SD 3HPOA 3MM9B 5K9FA 1OSCA 1MWYA 2YXLA 2DR9A 2FJEB 3HVRA 4HDGA 3GYXB 5K8PA 3UN5A 4Q7AA 2NSCA 3NG8A 4J9OA 3KG4A 1AW0A 2IHR1 1JXLA 3HLUA 1S76D 2Q79A 4GMKA 4DL4A 1U0HB 2RJZA 3LP2B 2FLNA 2RS2A 4B9TA 1TAUA 2WK4A 4DXLA 2PD1A 3WX8A 4FXWA 4LRAA 4JV2A 3VF0B 1UVJA 2PE8A 2LEPA 3I0SB 1O0PA 1F2HA 2ZNYA 1UTAA 1EHWA 5HMYA 2J6UA 5C24B 2ZKUA 2QFIA 5KFGA 1UFLA 3SDEA 4K0KF 1APSA 3WIUA 1JXVA 1C0TA 2XLJA 5F41A 4NLTA 3MM5B 2MQMA 4I56A 2ZE2A 4DSKA 2BUNA 2QLBB 4PKDB 2GFFA 5AE2A 3C6TA 3IBWA 2HHSA 4QWCA 3KHGA 1EAYC 3MFIA 4USJC 1QE1B 1RT4A 3UDCA 3GV5B 1B7YB 2HG4A 1TTHB 2QG9B 4CTAA 2C28A 2AYEA 2DNZA 3CIMA 2MDAA 5HMZA 1X60A 5J2MB 3FSIA 3CCSS 3ZTRA 2VBXA 1FDNA 2DISA 5HROA 4NZ6A 5B0EA 4B3RJ 2VG6A 2C42A 3JTOA 4GVBB 5DDRC 3R1HA 4EO8A 1HYSA 2DNNA 2NUUG 2GO9A 3CGIA 3HHKA 3NBPA 1PYOB 1RDRA 4DR2J 3HO1A 2CNOB 4C98A 1XNRF 1Y9OA 1SH2A 2CJBA 3KDNA 2AYGA 3QO9A 2DGSA 4B9MA 4C4WA 1A7GE 3KNAA 2AMCB 3I5BA 3KDOA 3MMBB 3MMCB 3KLHA 3R1LA 5IWAF 4NXMJ 4FF3A 1HBOA 1VQOS 2I2YA 5B0GA 1KN6A 2VDIA 1LXJA 4JI6J 2RS8A 3H0PA 5A8RB 2CPHA 3CJ4A 3DDIA 3RB4A 1YJ9S 4P71A 5B0FA 3EVOA 2DR8A 4PXCA 4AT1B 3QZ8A 5FD1A 2AWZA 3OV7A 1YRUA 3A8JA 1PIEA 4IKAA 1KKHA 3JAMU 4JI1J 3G71S 3UNGC 1YDLA 4FBUA 2F4VF 1M5VC 1FWKA 2LEAA 2J7WA 1A9NB 4B9SA 2DR5A 2EFGA 2BV3A 4ECTA 2HBRB 4U8YA 1EZZB 1YBUA 1Q79A 3VAHA 2FLPA 2LDIA 4CLTA 1V5VA 4O4RA 3WHIA 3CD0A 3QAUA 5D77A 4AD6A 2GMLA 3GCXP 5ITHA 1EQ0A 1QAXA 1P6TA 1NJYA 1RAOA 2C3UA 4F7VA 1TKDA 1WG4A 2OPPB 4DQPA 1ZH5A 4F3OA 4RBTA 4Y65A 4ECRA 1XR7A 4TYBA 3M6VA 5CCMA 1S79A 2CPEA 3K5MA 2NLWA 3V6KA 4F4YA 3TWZA 2F3JA 2HS4A 4LBIA 5M2PA 4R8UB 2MQPA 2UVWA 1T11A 1OJ4A 4LFAF 1FJGF 2DB1A 1GEHA 1GT8A 2XS2A 3ENVA 1X4EA 4GKJF 3M9OB 3QJPA 2OAUA 2YVSA 1TKTA 4OYBA 3V5RA 1X4AA 2WVEA 3QBCA 4YR2A 3KHRA 2W7OA 1RAGB 4J9PA 2QMUB 3GYGA 1QLNA 1JLQA 1OPZA 3GZ7A 4NCGB 2ADBA 3S01A 1URRA 4I6AA 3MR5A 2CJQA 3FNNA 3KWMA 3TANA 4USHA 3W61A 2LVWA 4MFBA 1EARA 1NAQA 1WC1A 2B9WA 3QIPA 2GMJA 4P52A 4NEYA 1BQNA 1W25A 2FZKB 3QGIA 1G3OA 1NMEB 1SH3A 5LM7E 3OLAA 2B43A 4F4WA 3CSKA 2BANB 4P72A 4KB7A 3P5BP 3RR7A 3QNWB 1MROA 2LMIA 4DL6A 1S6PB 1RZMA 2FC9A 4ZITA 3G6YA 4KJIA 4NYPA 2C3OA 3A8IA 2EK6A 3FVYA 4F26A 2FB0A 4JI8F 1KWMA 4J9LA 2WONB 4FKYA 4RR5A 3IR6B 3M30A 4CZCA 3NCRA 2M70A 4JBCA 3OL6A 4EMDA 2QYGA 1WHVA 2PO4A 1VHFA 4H4OB 3T5KA 1TKXB 1NB2A 2CQPA 1HI0P 4QYZK 1M1HA 4HI2A 1LEOA 2MQLA 1YWXA 3M8QA 3W8GA 2QT7A 2DH7A 2OFGX 5KFXA 2XGQA 5A8RA 3HHNB 2W2QP 2ROGA 2V8PA 3VGSA 2DNMA 3K8VA 5IT4A 3CC4S 1TFYA 4KHPJ 1XNQF 5J2PA 1RTIB 4A8YA 3SZ2A 2MHNA 3EZOA 1L3VA 2K06A 1T94A 2RVJA 2IC3A 3RR8A 3CCQS 1VRUA 4CM0A 2AKWB 3POTB 4DN9A 3K57A 3PTWA 2VA2A 3DLJA 3I32A 4HR2A 5KFUA 3EPIA 4B9NA 1JMTA 4DG1A 1GTHA 1NXIA 1NSKL 3I4PA 3W2VB 4B02A 1TVRB 2OHDA 3I6PA 4DV6F 3BH6B 3GB0A 1WTFA 3FFIA 3FSXA 4DEZA 1FX4A 4ZVQB 2C22A 3DRRA 4IR1A 3B4MA 4RNHA 1S77D 4RLEA 4KQZA 3BN4A 1NDCA 1G4CA 1HWJA 4B3SJ 3UW1A 1HHSA 2BVZA 3MTJA 4LF8F 1SJFA 2HVIA 4MIBA 1LW2A 1RWKB 3L9ZA 2QFJA 3A1YG 4FNIA 2Y3YA 4IYQA 2FHKA 3M1VA 4WXWA 4ZOSA 3FBEA 3KK2A 2LKZA 4YHHF 3IGVA 1FE4A 2RE1A 4PQUB 4DN0A 3RBXA 1AA1B 3GJQB 2L9WA 5L9NA 1S97A 5LSOA 1Q95G 2HBYB 2HS3A 3ZC4A 4RUCA 1R7IA 1RTHA 2ALYB 2CNNB 4FNHA 4O4GB 5JXSA 3G8SA 1J5EF 4EWTA 1QUPA 4NLYA 1D8YA 1JJCB 2V67A 5I3PA 1U1RA 3AJ2A 2DEIA 3IG1A 5KFSA 4JOUA 5IFMA 4DR1J 1U1PA 4DR6J 2ILZA 3OXLA 3FUYA 1RT3A 4KGKA 3TYTA 3K59A 4DZDA 1VC0A 2OSRA 4A8FA 4JV5F 1UEKA 2NQPA 4AUKA 1FF2A 1D3WA 4K2XA 1HD1A 1UPPA 1Q1KA 1DJ0A 3EGVA 3MM7B 2ILYA 2R42A 2YKMB 3DRSB 3T9ZA 1RHJB 1S48A 5C25B 1OIAA 1X4CA 2DH9A 2E5JA 1NB7A 4DV7F 4NMXA 1ZM3A 2CPFA 4O3NA 1SJ4P 1SKRA 2LA6A 5T14A 4F8RA 2LXIA 1N36F 1F3VA 3W5YA 4LR7A 2ASLA 4I64A 4URSA 3IAM9 3ISNC 1TL7A 1CQNA 1P27B 2XMWA 3LO3A 5DQIA 1RQ0A 2BANA 4J90A 4ZVGA 2ZH5A 2UUCF 3HP6A 3DM2B 1MWZA 2YKNA 2LEBA 2Z57B 3TNVA 2YQ1A 4Q2LA 4IO9Q 2WRMA 3H7HB 2DGOA 1KTVA 2OELA 3DLGB 1FKPA 2KRBA 3HJVA 2IBOA 2HQFA 2OD6A 3IBFB 4AQYJ 1FDBA 3UCUP 3V6DA 4JV0A 1KR4A 1TL3B 5CAAA 3M2VA 5CD4A 4MKBA 3OR1B 5KFBA 2E9TA 2VASA 1F5BA 3CEDA 4MKAA 5GMKa 2C2NA 2QA1A 2BX6A 2Z4PA 3TA0A 4X2BA 2R7OA 1HQEB 4CO3A 3MCNA 2V63A 5DETA 1HWUA 2XY5A 4Q8FA 4OJ1A 4X65J 4M5NA 1GX5A 1N0VC 4OX9J 4WF9Q 2OGUA 4DOZA 4MH8A 1LWFA 1RWUA 2XZTB 2IVMA 3IAS9 1ZYQA 4LF4J 1VC5A 3PDNA 1RCOB 1DHMA 1ROFA 2XC9A 3TARA 1L5UA 5LMNJ 2H1YA 5F3ZA 2XY7A 3A12A 3ENQA 1RTIA 3DRPA 1F5CA 3TVKA 4XAKA 4UT4A 4O3RA 3ILOA 5H9FJ 1NK7A 3LGHA 2HMIA 2AW0A 1VFJA 4ES2A 4EYIB 2HVZA 5HP1A 4GKKJ 3J7YU 1R43A 3M9MB 1P1LA 3F41A 2OSQA 3V81A 3H5SA 4IG3A 5FLXY 3HKWA 3L09A 2AJ4A 2UUBF 2KJWA 2MZJA 4I2QB 4LF8J 1FNMA 3DGVA 3DMJA 3P8BB 4OMFG 4CQ1A 1U6BA 5A8WA 1WELA 4B08A 5LJ3Y 5SUHA 2JOQA 1IKYA 2MLXA 4O0NA 3HFZB 4Y00A 4X64F 4MIAA 1HWKA 4Y2CA 1MMNA 2NXEA 5D4OA 4ZJOA 3NP5A 1ZETA 1XMQF 4DZ6A 3HKZD 2UUTA 3PJXA 4HI1A 4ZPDA 3NOCA 4JYAF 1F9FA 4F0KA 2ZJQQ 1RT6B 2W7AA 2HLTA 3TJ9A 3PZPA 1RAJA 4LSNA 4BWJA 3ELHA 3P3DA 2CWKA 3V4IA 4DU8A 3PX0A 2J9DE 2DNKA 2KI2A 1U2FA 2DHAA 2KFYA 4B3SF 1Y3KA 2ZH2A 3BBBA 4YDXA 2IC3B 5B08A 2YNFB 3UPFA 3FSYA 4TU8A 1SL0A 4I67A 2CPXA 3WBZA 1KVIA 1T3NA 2YNIA 3PHTA 4NZ7A 4GC6A 5H9EJ 4TN2A 2FUG9 4ZIVA 5KFFA 1WDDA 5M2UA 1NHUA 1S4FA 5J2QA 2VG6B 1ITPA 2RAQA 2RDIA 4ZLJA 2JL9A 1EETB 3IR7B 4LVNP 5M2RA 3ZZ0A 2JVRA 4X4QA 2ZH7A 2F8EX 2MSTA 2YNHB 4DL2A 3QRPA 5IT0A 1C1BA 2QL9B 2QC3A 2U2FA 5HQLA 2YKPA 2BRKA 1RT7B 2Q1LA 3QGHA 4ED3A 3NGSA 5EUHA 3HFKA 1RT5A 1JLCA 4LF5F 1QVGR 3Q83A 4ZPTR 1UVKA 5K20B 2EEYA 2EKNA 3CWJA 2NXUA 4DJBA 1WTBA 3AQOA 1S9FA 4KHPF 1VCTA 2VKRA 3RB6A 1QVFR 1VBKA 2OPSB 3AD9C 3NS5A 5MLCV 4P6QA 5GADU 4QIEA 1JK9B 3N5FA 4X4TA 1WHWA 2CZ4A 4U7CA 1IQTA 4WFXA 1LWCA 2J8SA 3DI6A 4C0OC 2D3OR 2JEGA 3DGPA 4LFBJ 4CM2A 2JFKA 3HHLA 1NKEA 3OL9A 2V69A 1TV6B 3DOKB 2OKQA 2HMIB 2LA4A 2MQOA 3BEGB 4ZVHA 2VPWB 1R8BA 2AHOB 1U0HA 1Y0HA 1K1SA 4M5LA 2W7PA 1RHKB 4OI0A 2VODA 3HVAA 2Y1LB 5D0EA 3BYRA 1QAJA 2IYGA 4LR8A 1U1KA 3MPWA 1TK0A 4CO5A 3PY8A 1HL6A 3VAGA 4F4XA 4ICLB 4NLSA 2L3MA 2QO3A 3VR1A 4C2MA 1R3NA 1SC4B 1ZM9A 1YKWA 4DQSA 2FVQA 3FC9A 2W4CA 3ZO7A 2ZZNA 2JC0A 2HQDA 1FRHA 1PG5B 3HHEA 3QJLA 5L46A 3Q89A 2F8MA 2RILA 3SEOA 1U1OA 3I96A 1JLAA 3J7A1 4O3PA 4KH0B 4HEA9 4X84A 5ETSA 1VI7A 1K0TA 4ZHRA 3C6TB 1HYSB 4CI0B 1RLDA 5KFCA 3DDNA 4LSNB 1LOUA 4ECYA 1CS4A 1VJWA 4ES3A 1F0XA 4BWMA 1FDAA 2XBPA 4ZLPA 2R2UA 4K4YA 4HH1A 1HNZJ 4UOHA 2Y8YA 3GG1A 4R0JA 2AJ1A 3KJVA 2ZDPA 2R7RA 3M2UB 1LFWA 1OS5A 2W2NP 3AT1B 4DQRA 4PRFA 2DRBA 2IRXA 2DNRA 4LQ9A 4YFUA 2L9DA 2EC0A 2NPIA 1RT1B 3KMSA 2W9CA 3TUIC 3Q24A 1WI8A 3SV3A 1PYTA 3EE3A 1JIHA 4H4MB 1HNXF 2DXDA 2VDHA 5D15A 1CG2A 3T1YF 4DFPA 3G2XA 4TQRA 2YNIB 1DAXA 1C1CA 1H3DA 1BQNB 4USMA 2XO7A 2ZHBA 3VAFA 2XYPB 3NRBA 1DQ8A 4RW9B 1SJ3P 3M6UA 2Z0GA 3OTDA 3GP9A 1N33J 3PW5A 3SSQA 2H3EB 1LWEA 1O6XA 3DXBA 5KFKA 2GVZB 3GFXA 3GFZA 2I5JB 4DX8H 3D6HB 2QX0A 2WW8A 5IXUA 3QWPA 1VQ5S 4X4UA 2CVIA 1IKWB 1FWLA 2VH7A 2ZEJA 4WFBQ 3ICLA 2COLA 3O3LA 5GAGU 2HVHA 2UXDJ 4DFMA 3M32B 1CJKA 4WJBA 3IXQA 3PFOA 2G2OA 3HZEA 2FLLA 2IMOA 1MWQA 3PYEA 3BPSP 1S9EB 2E5GA 4OZ3A 2PEHA 2YPZA 3ADAC 1RA6A 3IWXA 4QIWD 5CYMA 1HQUB 3UR3C 3VVUA 1JJ2R 1H0HB 3CC2S 4DR2F 4JI4J 2XS5A 2C1EB 4B3MF 5GAEU 3QGGA 3PJWA 2M7SA 4G1IA 4KHMA 3CT9A 3N01A 3RRKA 2YNGB 2WTFA 1NDKA 3POTA 2PI5A 4V19X 3Q8UA 4XDCA 2DHGA 4NA2A 2VQFJ 4HH0A 2ZWOA 2HRTA 5J2NB 3VQSA 4A8MP 1T03A 3OUYA 3KHLA 2W01A 1NJIT 1LFPA 4RU9A 1TKZA 3CJQA 3RU0A 1C2PA 3ZZTA 3PIPQ 4A48A 4ZPBA 2BACA 2MHEA 3AAWB 1VQKS 2GJ2A 3C14A 4NL5A 4RJVA 1SH0A 2A18A 3IRWP 3DLBA 1HMVB 2CFXA 4OI1A 4HKQA 2BE2B 2RUGA 3SMZA 4H4OA 4ECWA 2EFOA 2F5GA 5IC6B 4GO5X 3KK3A 2ASJA 1KLNA 3GCWP 5KT7A 4LF5J 1HHTP 1WEXA 3D3BJ 5HVGA 2J0SD 2NUHA 3CDUA 4LFBF 4WZMA 2V68A 2HEKA 1WWHA 3E2EA 3VGVA 4QZVB 2KXNB 4JI1F 1HI8A 3HVWA 4PWDA 1CC8A 2AX0A 3RBZA 3U1MA 1YZ7A 1VQSA 1UW4A 5D3GB 3I5AA 3D67A 1NPKA 4EGLA 2CQIA 5EWFA 2AGOA 1XQIA 1A0OB 2M52A 3P49B 2F63A 2E1AA 1CS4B 1QY7A 4X64J 3M1VB 2E5LF 1RKIA 2XMTA 4B17A 1F2GA 1IM4A 3TOQA 5LOQA 1NBEB 2C3YA 3DYAB 2A2DA 3W2WA 5CYMB 2R8JA 5B0DA 2Q66A 1UETA 2L48A 3AY0A 2HNZB 4FP9A 2MKKA 1VK3A 5HLFB 1OYEA 1VRUB 5B0BA 1YK9A 2OFHX 2P6SA 5EX3A 3W9HA 2VJVA 1FX2A 2ZUGA 1J5EJ 1JX4A 3MM7A 1LWXA 2DY9A 4P2SA 3W2VA 3BPDA 2XMMA 3JYTB 2XZWA 4J9QA 2YQ3A 3HZGA 4OI3A 1GMWA 1UP1A 1NK6A 2VV5A 4OJHA 3MECB 1YHQS 2CWXA 5DLGA 3OTOJ 1U4BA 3U1LA 2MZSA 1SKSA 1JLFB 4GRSA 1XN9A 4HLBA 2BKNA 4ICLA 1L3UA 1PILA 2BBEA 2DNYA 4OYAA 4V1Ak 4ZVTB 1TL3A 3H98A 1VQPS 2WW4A 1GMUA 1T9TA 2EBEA 5KG6A 3ILIA 4DL3A 4B3OB 3OFHA 4ZP6A 5AE1A 3KLFB 1X5SA 2BE2A 2BJ7A 5BJRA 4A4JA 2OPPA 3TZZA 3UCGA 2PFDA 2V9KA 1FJ7A 1XMQJ 5A6PA 2ZBPA 5E2QA 4ZP8A 3D4JA 4URGA 4WTOB 1CJVB 4CYUB 3MWBA 3PJ9A 5I3UA 1VIXA 1YQHA 1ZA2B 3LW5C 4QPTA 3VZHA 2XTJP 3ILLA 2RQKA 4LVOP 5E3AA 3BH7B 4ENOA 5IOLA 3JAMY 1FWPA 2ROPA 4M5GA 2QA4S 5B7WA 4ECUA 4FVCA 5KT5A 3CUNA 3PO4A 2YNGA 3OHAA 2IY5B 2PFFB 2MMYA 4DUYJ 3UD4P 3TQEA 5KT6A 1G2EA 1Q0NA 3TI0A
chains in the Genus database with same CATH topology
1DLOA 2HZCA 4IQMA 3HF5A 1NRKA 4DQQA 3LGNA 2BM1A 1KN6A 3H25A 1LW0A 4PR6A 1IKVB 1NJZA 2CQHA 2WSFC 2DNLA 5J1PA 1WG1A 1FRKA 4WE1B 4LIRA 2MY8A 1G6BA 1S99A 3PM9A 3QZ7A 1T03B 2QMWA 3FJ2A 3P5TL 2N7CA 3MEKA 2CJKA 1DQ9A 3CCVS 4GO7X 3RW6A 4QIFA 5KFQA 3B4DA 3DOLB 3U27A 5HROB 4UUWA 3SFGA 3R5CA 3D1QA 4LJMA 3H4BA 1UEVA 4TLRA 2IM2A 2M3DA 2W25A 3OVAA 4ED0A 2KXHA 3FZ2A 3LUYA 1S1VB 4J9MA 1CPZA 3OSNA 2I38A 2PT0A 3DFEA 1N52B 5F8IA 4JI7F 1KLMB 2BOPA 2ZOFA 5C42A 4JI3F 1VRTA 4FS2A 3DYAA 3W2WB 5KG5A 2CPDA 1JKHB 1RGVA 4I2QA 5T41A 3B8HA 2RH3A 4F25A 2KO1A 2FVPA 1RK8A 4C8ZA 2MGZA 1IKYB 1H2VZ 1X5OA 3MD3A 2NSBA 3BO2A 4DL5A 2IJFA 5F3TA 1NK0A 4A8QA 3IS9B 1NKCA 3M8PA 4RBUA 3MFHA 3BO3A 1QTMA 5K14A 4KV8A 2K3KA 3L7PA 4N8NA 3J80Y 3CB4A 1Q8LA 4ZVEA 5DDPC 3BQ0A 4O23A 4WU3A 1MMLA 3MURP 1PC4A 3I31A 5CHCB 5T7LA 3ITHA 1K73T 2FJVA 2BM0A 4OFZA 2ZH6A 2E9ZA 4D3GA 4BHQA 1KOOA 1A6LA 3MAQA 2FJWA 2HHTA 2ROEA 2R9LA 5J1EA 1LV5A 2HHUA 1KVJA 2M0GB 2Q6BA 4XK8C 4C97A 1TR0A 5LSOA 1J5EF 1M5SA 1P1TA 4PPZA 3FQLA 3ZZRA 5IQ6A 2CQ3A 2JHEA 2XI3A 4RZRA 5AJ3F 1D9FA 3KKFA 1D1UA 4AL6A 1TK5A 4ZP7A 2HW3A 1YJNS 4X66F 3CD5A 3ULHA 4A8OA 2JEIA 3CJ2A 4LQ3A 2JDJA 2I1RA 4PXEA 1IKXB 2OPQB 4X4NA 3CCWA 2MQNA 3LAKA 1FA0A 2A1BA 4CH7A 3MEDB 2XMKA 3MF5A 2J5AA 2FC8A 4IRKA 4EEYA 3SCIE 2B5JA 3OL8A 2UVVA 4FF2A 3A8EA 2ZD1B 3TAMA 2YX7A 1UWBA 1PO6A 1URNA 2VG5B 3MUTP 2FVCA 2KM8B 3PHEA 5E7OB 1UKUA 5H1SV 1N5SA 3KK1A 1S72S 5LSRA 4BS2A 2FIUA 3NWGA 3EGZA 2MKCA 2K1RB 4ZVFA 3G96A 5G4DA 2WCXA 2QE5A 2WOMB 4B3RF 2FHMA 2VC0A 2NYIA 2YWGA 3R3TA 3N6LA 1S1UA 1NEEA 2DH8A 5I4MA 1S10A 4NLQA 1YVFA 3NNHA 5HI7A 3RBDA 4K4XA 1KOHA 4W92B 2XSJB 2JX2A 2AD9A 4K4VA 2UV8G 5CYJA 1X9WA 1S1TA 2EBGA 1H2TZ 1VQMS 2B4PA 2E7XA 2XSFA 5CA5A 2JEJA 2ZKTA 4DFJA 3BSOA 2PIIA 5ADZA 1U48A 4HT5A 3Q2SC 3DRXA 3LPYA 3CF5Q 2CKWA 1P8GA 3MI7X 1RTJB 1ZPWX 1HNIA 5C25B 3ENWA 1WF0A 1TL1A 4LUBA 3M4XA 1IKWA 3WC2A 4Y6IA 1IJFB 2IAJB 4DF8A 1S1WA 2ZJPQ 3GSDA 1KHVA 3NBPB 3CE8A 4KV8B 5F8HA 5L1JA 1Q4RA 2C2RA 4CO4A 3QAEA 1YITS 2Z2LA 5KFAA 4HYKA 4NA1A 4EBEA 4MTPA 5CCLA 4IOCQ 4DSLA 3DLEA 4ZP9A 3CD7A 5J2NA 3JTNA 3NMRA 5KFHA 2J0QD 3GIMA 5HMWA 4MKYA 1N8RT 4DMZA 1Q78A 1SC6A 1LWFB 4EO6A 2ZE2B 4CIOA 3PW2A 1YG0A 2LQ9A 1S7HA 3D0HE 1S0OA 1DQAA 2WB4A 4Y28C 3I56S 5KFNA 3HJFA 2H9ZA 2DBBA 3N6NA 5LL6d 1N54B 5C24A 2WHOA 1AXQA 2VBYA 4CH1A 2RNEA 1HR0F 3KLGA 2CZVC 3DLLQ 1NNDA 2UXCF 1TAQA 4QWEA 4DV4F 4AL7A 3C6UB 3UE2A 3BQ2A 2J6TA 3DLHA 4ID8A 2OO4A 1KHWA 5J2QB 4UW2A 4ZK7M 1X9MA 1WNEA 2RT3A 2R2SA 1HNVA 3PW0A 4G3IA 2HNYA 1O51A 4OV1A 5JVHQ 2JVOA 5C25A 4ZKAA 2F40A 2AX1A 1HWIA 3Q0AA 5KT3A 4G1QA 1VBXA 1FKOA 1RTDA 2VA3A 1JLEA 1HNWF 5KFTA 2GW8A 3UCZP 2JWNA 1YI2S 2YKQA 3BSNA 2VG7A 3IRXB 2RRBA 4JV1A 2CPZA 1YRXA 2DO4A 3HHLB 3OR1A 4H54A 3E3XA 1KNZA 3FRZA 2MYFA 1GH8A 1NU4A 2HYIB 3CCZA 2XNQA 1N6QA 1VOMA 5L1LA 1NK8A 3LGMA 2VQFF 2J6SA 2HFNA 2L41A 3D28A 2H5EA 4KFBB 3LP1B 1N56A 4ZS6A 5BYRA 4IG0B 1U47A 2LQ5A 4PWDB 4KBIA 4NLPA 2HHXA 1S0VA 3HX9A 3PX4A 1FXRA 3M2RA 4QIGA 3MR3A 3SFUA 1C1BB 2RU3A 2JEFA 1BQXA 1YBAA 3BR8A 2VFRA 3MECA 4Y2KA 5IZHA 2NR0A 1IBLF 3THTA 2VBWA 4FXVA 4N56A 3CJKA 3JYTA 3DC2A 3FRYA 1S1WB 4MK9A 1IUJA 3AB2B 1ZTTA 4NXNF 1TKTB 2RIJA 2GHPA 4KHRA 2OPRA 2V4JA 3DU5A 4Y2MA 3WZ0A 2HHVA 2YTCA 3EZUA 4MYTA 1LK5A 3CDBA 1YIJS 4IH6A 3ZZUA 4QCLA 5CQGA 1TL5A 4ZPAA 2XLIA 1RT6A 5B0CA 2QSFA 1UMJA 3KNGA 1Z2ZA 1M5KC 1OPIA 5L9XA 4DR1F 3UI3A 2VOOA 3CDEA 1U1NA 1HBNB 1FDDA 4DG1B 2KKHA 2LQJA 2MSSA 4DHVA 5FDLB 5HP1B 1GXUA 2DIVA 4DPOA 4EZ6A 2HRYA 4QW8A 4QU6A 2HIQA 2WONA 1KD1T 3EXYA 4K4WA 4DFKA 5AXKA 4C8OA 1BGXT 3ZFVA 4QR1A 1CVJA 3K7RA 4GKKF 1SJQA 4MK7A 2KG0A 1S49A 4JI5F 1GTEA 1R27B 3KLIB 3CPWR 2V8GA 1R8PA 4I69A 2VC1A 4ECZA 3UDLA 1M5OC 5HL7Q 2DIUA 1S9GA 4QR0A 4RU2A 4PG7A 2FJAB 2UZAA 4CO1A 3L95X 3LP2A 1IN0A 3N5BA 2DGUA 1CLFA 2HQ3A 3ISZA 1SJRA 3T6JA 2KHDA 2DNQA 4KFBA 2PI4A 3ZZPA 4OIXA 1N5VA 3T3FA 4IUFA 2Q3PA 1TQLA 1N33F 4N8OA 3Q2TC 2MXYA 1GX6A 2E7WA 1O8BA 1U1MA 4BC9A 2B4VA 5KAKA 5A2QY 2LQBA 3O2IA 5A6WA 2EG1A 1SJ1A 3UR0A 3H4DA 4J9SA 2R8KA 1HBUB 4OX6A 3OTBA 1ZAWA 3CCMS 4C8YA 2ASDA 2CPJA 3PFEA 3CMAS 2IFXA 4IO1A 1F60B 4EZ9A 2O01C 2XLKA 4ZCKA 4ITSA 4W90B 1NH8A 5DDOC 1M90T 3MD1A 4DV2F 2ZOMA 2HAIA 3LF0A 4O4GA 2CQDA 2IA0A 3N28A 4C11B 1FO1A 2YH1A 4I2PA 3DI6B 4DR6F 3TRGA 2DGWA 3MPYA 3E01A 2W4PA 5IQQA 3RBEA 3MM6A 2F9JA 4OI6A 3G8TA 4N76A 1RYSA 4TKTA 3AA8A 4XPCA 2V4QA 3TR5A 3EPGA 4OJ3A 1RISA 2P6TA 5IM0B 4I4BA 3BR9A 5KOXA 5CXTA 5FDLA 3TX8A 2FGOA 2DGVA 3OHBA 2AGQA 2R2TA 1FXDA 2LXFA 4G1PA 2JLFA 1FVSA 3W7BA 1KFDA 3HVTB 2IM1A 2GO8A 5KT2A 2W9BB 4ECXA 4ILMA 5LXYA 4ZPCA 1N5YA 1LK7A 4XDDA 4DLEA 3H59A 3QO9B 2JSXA 4F4ZA 3KYLA 2APOA 1LKZA 5EHHA 1SUQA 1FRMA 2KXFA 5HBMA 2J7UA 5CYQA 3EGNA 4PUOB 3O6QA 1JNRB 1HQEA 5HO4A 1FD8A 2OTJS 1V3ZA 2V9WA 1U49A 2P9CA 3VWSA 1HNZF 1U6FA 1DFDA 4C8MA 2B7BB 2NPFA 2K2PA 1VS3A 3AQPA 5DDQC 4KRWA 2XMVA 2EFQA 5KOWA 1RA7A 1J5OB 1FK9B 5EX0A 1AFJA 3CULA 4NYZA 3BS9A 3HDSA 1SB6A 3OTOF 1S1TB 4ZPWR 4JI6F 2CVEA 3MDFA 3GV8B 4J9NA 2E9TA 1VQYA 4J5OA 4J9RA 3LP0A 3AB4B 4C8KA 2OPQA 2V8HA 5IM0A 2EK1A 1RT5B 3PV8A 2D7SA 4C7QA 1FTRA 4ETXA 4ECQA 3EZ5A 4RWWA 3CD6S 4H4KC 3UD3P 1SL1A 1JJHA 3DRPB 2OPSA 3QPIA 5F8NA 4IFYA 3JSMB 4B9UA 4B9LA 3X1LB 3M8SA 3BZQA 2W9AA 4JUZA 5KTQA 4K5RA 2MZ1A 2JC1A 5CYQB 2HLUA 2L08A 2YNFA 3FEYB 4DUYF 1RT7A 4CH0S 1ZM4A 4WYLA 2G4BA 1TL1B 1UJ5A 4QQBA 1Q82T 1K8AT 1CQMA 2RKIA 2AJFE 2FD2A 4HVZA 3MMBA 3KLHB 3BREA 2DRAA 2W8KA 2O67A 3V4IB 1Y7PA 1ZTWA 2MB0B 3IO1A 4DV3F 3CDAA 4ED7A 3VAJA 4IH5A 4OZ5A 4OHYA 5KFDA 5GVQA 3I4HX 3C6UA 2FHJA 2C3MA 3P96A 1AROP 5LMNF 2ZFHA 3OFGA 2IVYA 3KLEB 1FE0A 1HBMA 4FYDA 1TZ0A 3JSRA 4OX9F 2ZVSA 1UFWA 1VQ4S 3M6XA 2DR7A 3BDPA 4X4UA 1MROB 2J7KA 1E6VB 1X0PA 3WC0A 3O44A 2VODA 1TP7A 2RU9A 2A10A 3T5HA 3FMBA 4PG5A 4WIIA 5FJ4A 2E44A 2B4OA 4NYOA 1HARA 3LANA 4YB1P 1T8EA 3GIKA 2KT3A 2UXBF 3NNAA 4HL9A 4RWXA 4O3QA 2XCAA 2VG7B 2K7JA 1HNVB 3OR2B 4ILRA 4N41A 5KG3A 4K4UA 3NKYA 4PWUA 1KRPA 5L1IA 1M5HA 3JB9k 4IRDA 2XG8A 4D3HA 4G1QB 1FTCA 3ISND 4AXJA 3K5NA 1U7LA 4NA3A 4WFZA 1X8DA 1I6JA 4K5SA 4R25A 3C3LA 2DHSA 4HTJA 1R0AB 1V6HA 2GIRA 4YB6A 1Q86T 1H6KX 3GQCA 1L3TA 2QLXA 2GIQA 4KPYA 1SXLA 2AU0A 2IA6A 5KFIA 1FJEB 3J81Y 3S1TA 5A8KB 3HK2A 1U45A 4ZHRB 2HNDA 3Q8SB 1LW2B 5D4PA 1IR0A 1FT8A 3EX7B 5F8LA 1HBMB 1JLGB 1F5AA 2YKAA 4DL0C 4HDHA 1JJ4A 4RW6B 3PIOQ 1RT2B 3FFIB 4IH7A 2VOPA 1H2UX 1YJUA 3DOLA 4YQWA 1G1XA 3PW4A 2LCWA 2WOMA 1TL4A 2G13A 3K5LA 3MAHA 1KEKA 2EG2A 3IG1B 4PXDA 3RB0A 2KB2A 4H4MA 2RF2A 1U8SA 3MMAB 3S8SA 3THVA 2MKIA 3NNCA 1ZOTA 1S1XA 2X3GA 2HGMA 1ZAVA 1RTHB 5GAHU 1KS2A 1C1CB 5SZTA 3MMCA 2UV8A 4K4TA 3K5PA 5CH7B 4QR2A 2OD4A 4PQUA 4XO0A 1X5PA 2RRAA 3M2UA 1KC8T 4K59A 2IRYA 4PG8A 2HWTA 1DTQA 2RDJA 2DGQA 1NK4A 1KONA 2K7KA 3M8PB 4AL5A 3LH2S 4I1TA 3F56A 5JVGQ 2ERRA 2L9NA 2W9CB 4FBTA 1DZ5A 4UQGA 4A8XA 3D2WA 3BSCA 3HHLC 2NREA 4E8UA 3NS6A 1JLGA 2Y1RI 3C66A 1QE1A 1RT4B 2HHPA 3NGKA 1YTYA 3HXMA 3DRRB 3KLEA 2FPHX 3H2UB 2DO0A 3V6DB 5A8KA 4OZ0A 1UVIA 1AUDA 1YJTA 4WK1A 3QIDA 1YRTA 3I5CA 2HS0A 2EFVA 4CO2A 2CYYA 4Q43A 3MMJA 4Q45A 1KFSA 4ALZA 2Z8QA 3O1LA 1OSDA 1T3OA 4R5PB 1TK8A 1B7FA 2FHOB 4YY3F 5J1EB 1HBOB 2HFZA 1MSWD 3RAXA 3V6JA 4ZCLA 2QV6A 1S9GB 3LOUA 2DHXA 4R8UA 2KT2A 2YH0A 5F9LA 4X4RA 1E6YB 4C3LA 2NS1B 3CCLS 3H2VE 4AYBD 3G4SS 3NCPA 1U1LA 4FXDA 4OZLA 4J37A 3N6MA 3KLGB 4ED2A 2QLWA 4DDFA 2J8AA 1FNOA 1XEZA 3GIJA 1N0UA 3H40A 2HHHF 2J0XA 2M2BA 5F0WA 1KQFB 1QSSA 2FHJD 3FMWA 1VBYA 1CEZA 4RW4A 4IG3B 3NAIA 5GAHI 3DU6A 2JLGA 2ZH1A 1NH7A 4QU7A 2XMJA 5G0RA 4RKUC 1FRXA 2WBMA 3BM7A 2AJQA 4KGMA 1HFEL 2XWYA 4I68A 4KAIA 2GGPB 5CZXA 1Z4UA 1KQKA 1RTDB 2R7SA 3R5DA 4NCGA 3MHYA 2UVRA 4B3OA 4KIAA 2PMZD 2BYCA 3MUVP 3MMAA 3H5XA 3MTKA 4EBDA 2KFNA 3TA2A 2DNGA 4ILLA 2ZBIA 3OR2A 5EN1A 2LDYA 3TO8A 4OX8A 1S0MA 4DQIA 5AE3A 3GILA 7FDRA 3CTRA 5DGBA 5D8HB 3NLCA 4FF1A 4Q44A 2GV1A 3MR6A 2W9BA 2ABYA 2FDNA 3R27A 4C0BA 2RRNA 2ZH4A 2UU9F 4E98A 2GJIA 1DARA 4M5DB 2MKJA 4DBQA 3SSSA 2OLWA 2P5VA 3H2LA 3US5A 1CC7A 1DBDA 3BGFA 4ID5A 4DSEA 2BRLA 5G0RB 1TUVA 3O5TB 2VD3A 4URQU 5LMUF 2KZMA 2DK2A 3DMJB 1FESA 3HT3A 3DCAA 3RW7A 3DLEB 1Y5NB 1Q53A 2B9YA 3M05A 3CCJS 2BQRA 4EBCA 3IR5B 2GQCA 1FCAA 2OMOA 4AE5A 4M8LA 1T05B 1FD2A 1SL2A 1I1GA 4DSJA 2E1MC 2M4MA 4RW7B 2XWXA 2ZZMA 1SQEA 1S1VA 5KFJA 3VZIA 4DR4F 5DGAA 1GXTA 2XEXA 3UWTA 1EP4B 4RNFA 4EYHB 2MGZB 2CQGA 2R7UA 1D8ZA 2VB6A 5HBMB 3Q23A 4UOCA 1K9MT 1Z2LA 2BXJA 4CNYA 5B0AA 2OP5A 3OVSA 2FJBB 1HNIB 3PX6A 2HWHA 2J9CA 1U6ZA 2B51A 1B0VA 4ZMMA 3MM8B 4NOHA 1NJWA 4JI4F 3BJYA 2RQ4A 4ZPVR 2XS7A 2YKNB 3M32A 4TXSA 4YB5A 2GMHA 2X1AA 2IJNA 2VFUA 1RI7A 3D1OA 2KHCA 5KFRA 4LF4F 1ZAXA 3CCTA 4J9KA 2OMLA 4ELVA 2B3TB 2QA2A 1VGYA 4NXMF 5DRKA 4QWBA 1W2BR 3OFFA 2N3LA 1N4LA 4RNNA 4F3MA 3WDOA 2YKMA 3DNCA 2IVFB 3PKMA 4JYAF 2R7QA 4O44A 1YJVA 4I6YA 5F8GA 1QSLA 4QJVA 1R8AA 1T02A 2KU7A 2XHWA 2DPJA 4F67A 2FTRA 3MEGB 2KZZA 1R8HA 2G9OA 1E6YA</