3DOMA

Crystal structure of the complex between tfb5 and the c-terminal domain of tfb2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
73
structure length
73
Chain Sequence
VVDQIRLWQLELDRVITYEGSLYSDFETSQEYNLLSKYAQDIGVLLWKDDKKKKFFISKEGNSQVLDFAKRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase II transcription factor B subunit 2
publication title Structural basis for group A trichothiodystrophy
pubmed rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 20
structure length 73
sequence length 73
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18307 Tfb2_C Transcription factor Tfb2 (p52) C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2610 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3domA00
3DGPA 3DOMA
chains in the Genus database with same CATH superfamily
1S59A 4LIWA 1HNXJ 5IM0B 1YITS 3B4MA 2XYGB 1Q78A 3S7RA 2KRBA 2FC8A 4YB7A 4DUYF 2BJ7A 4LSNA 3BREA 3UO0A 3M4XA 3IWNC 1JQGA 2IIHA 4AL7A 3EVOA 3OHBA 2RDJA 2HHSA 4O4GA 2IAJB 4WXOA 4DG1B 1RDRA 5E3PA 2CDQA 4A8YA 1X9SA 3S1TA 5KG2A 5C7PA 2ZDPA 4ZVFA 1MWQA 3GJTB 1JX4A 3M9OB 1VQYA 3A3PB 2IFXA 4OYPA 2DISA 1VQPS 1B0PA 2C2NA 4JI8J 1VRTA 2WVFA 1KEKA 1GAOA 4DX6A 4M5IA 2DHAA 3W5YA 3BGLA 4FYXB 4OZ2A 5B0AA 2QJ3A 4E0DA 4KY3A 3Q8UA 5GAHU 5DG8A 3AOCA 2J7WA 2RAQA 3DLEB 1GEHA 4NCGA 1M5OC 1IM6A 2CNNB 1IQTA 4U96A 1NK9A 4RNNA 1O8BA 1HYSA 2F5GA 2QT7A 3TUJC 1KP6A 2B51A 1X60A 3O1LA 4TKTA 3TR5A 3PV8A 5BYSA 2UUTA 1TL5A 1H72C 2B4UA 3PO5A 5AE2A 1UMJA 1AA1B 3QO9B 1XEZA 1SVDA 5HBMB 3OFEA 3T19A 3V81B 4JV5J 2HBZB 1X8DA 3GSIA 2V2VA 2E1MC 3JSBA 5ETOA 1KHWA 3KNAA 1KVKA 1JJHA 4ED5A 2ZITA 1MWYA 1BE4A 2NUUG 3U1LA 3TO8A 2VQEF 1MLAA 4LFCF 1H0HB 1UKUA 4GKKJ 1Q4RA 2E5GA 2IRXA 3KNGA 3POTA 1X5TA 3H40A 3CCVS 5KFVA 1GXTA 2ZUGA 1PYTA 2QV6A 2PI4A 4WE1B 1OQ6A 4XPEA 3C16B 1H2TZ 4LF5F 4JUZA 2H5EA 4PWDA 1OSDA 3EGNA 2C3YA 3K57A 1RHRB 1SL1A 2UUAJ 4ZJOA 2FLLA 4WTYA 5G4DA 1S48A 3I5AA 4ZPTR 1VGYA 3F0NA 2M88A 2I38A 4X4QA 2HPUA 3CJ2A 5KT6A 2U1AA 2EC2A 5DS7A 4QOTA 3Q2TC 3MM9A 1HWKA 2GZOA 4RW4B 4WFBQ 1P27B 3GCWP 4CLUA 1Z2LA 5J2QA 2XI3A 3MCMA 4EO6A 4HDHA 3I5BA 5HATA 2XM3A 2RKIB 1P8GA 1QTMA 4FYYB 3DM2A 1EETB 2XMVA 1NMEB 3D6TB 4DR6F 5HQ8A 2U2FA 1M5SA 5GMKa 2QLBB 4QPXA 5L9NA 3E8OA 2NUHA 1Y7PA 1GNKA 1RAOA 3ILJA 4KGXB 3I56S 2KHDA 4KR0B 2FLOA 1YG0A 4BC7A 3D3CJ 1PO6A 2E1PA 3FKBA 3TEGA 5KOXA 4B9TA 4WJBA 4HDGA 3PACA 4RUAA 2C1EB 4BCAA 2JC0A 1Y3KA 2K06A 4IG3A 2HBRB 2PC6A 5LMNJ 4U6PA 4DV7F 1H73A 4F3QA 4FF1A 5IFMA 1U2CA 2GVDA 1FWKA 3PFOA 1LNQA 3RAXA 4QWBA 2B5JB 1TVRA 1LW0B 1ZAXA 1RE1B 3JTNA 5BXIA 3GU0A 3NS7B 3VCDA 3DRSA 2W9BA 3NRBA 3KLIA 2CZ9A 4AE5A 3JQMA 2CZVC 2D3ZA 1KQSR 3T9ZA 3AQPA 3U1MA 4LSLB 3KLGB 2HRYA 1WOPA 2GJIA 5A76A 2AYEA 3OXLA 3TQEA 4J37A 4KPCA 4C3MA 1CQMA 1SUQA 2CPEA 1SJ4P 2HNDB 5KFWA 3L95X 1XMOJ 2ADBA 3RG6A 1M0SA 3FSXA 2DCLA 1WELA 1PGZA 4C2MA 3CCTA 3CCRS 3OFHA 5GVQA 4Z7CA 7AT1B 1FJEB 2PEHA 3BH6B 2E1RA 3THPA 4H4MA 3ILOA 2YX4A 3V2UC 5AXNA 2UVVA 1NJZA 3D66A 2FJXA 2L08A 2WTFA 1S99A 5HMYA 5L1IA 5EWEA 2N7CA 3C14B 2MLZA 3TAMB 1A6LA 2DXFA 5THWA 3W60A 5A8WA 1DTTB 2XHCA 3R9LA 2ZNYA 2M5YA 3BN7A 5JVGQ 1YJWS 1UA1A 1RU2A 3T3FA 4YMEA 3MECB 4OI2A 4ZJQA 4A8QA 1P6TA 2GJFA 3W64A 1OS5A 3DU5A 4F2SA 4WP3A 5B0DA 5KFEA 1N5TA 2JEJA 1U0HA 3TVZA 3CT9A 3OTCA 3CVKA 4LSNB 4CO5A 2IPOB 2X3DA 4UW2A 2MSSA 2RRBA 5KG3A 2CPYA 1FERA 3PCOB 2FJEB 3R8YA 2MTLA 2DHSA 4O4GB 4JI1J 1E6YA 5DO2A 1WI8A 1K47A 4NXNJ 5A6WA 2IVYA 1WD6A 1U49A 2PFFB 3B8HA 2VKZG 2HQFA 3QAEA 3LAMA 2JVRA 1NDPA 2IJRA 2GO9A 2EWHA 1YLXA 4DV2F 2YXLA 2EC0A 3WC0A 1FK9A 4IDKA 1PAUB 4IOAQ 5HK4A 2B9XA 3RRHA 2X1BA 3AJDA 1RYRA 3EPGA 2M3DA 1Y5IB 2F1FA 2WVCA 2WB4A 1ZZFA 4KC5A 3EZOA 3PIOQ 4XK8C 3QYYA 5EX0A 1RT1B 4L72B 2ATLA 2CYYA 1JLBB 1N32J 3MCOA 3BKUA 4DL4A 3GP9A 1HYSB 3PEJA 2N3LA 4DV6J 1N33J 2XCAA 1OSCA 2HQGA 4HT7A 2Z2ZA 3Q8QB 1AUDA 4ZKAA 1NPRA 4RL1A 3KHHA 4NMXA 1I1GA 2IJFA 4OJGA 3CXCR 5E3QA 2VFUA 2AMCB 2VA3A 5ETLA 5GAGU 3T5KA 4ITSA 2R7VA 4CT9A 1RKIA 3RW6A 2YTCA 4N7TA 1YBTA 4DV3J 4CO1A 1SXLA 3H8YA 4L3KA 3AJ2A 1LOUA 2PI5A 5ETKA 2F63A 2QYCA 2VPZB 4DU7A 1FX2A 2AJFE 5J2NA 3R27A 2CQPA 2EVZA 4F4ZA 3MUTP 4OHXA 5FIIA 1DFDA 5KFLA 4UOGA 2KJWA 3NBPA 3QIDA 4ES2A 3RZAA 4WFAQ 1REVA 4TN2A 1IWGA 2UUWA 3ILIA 4PWDB 5KG4A 5AE1A 2LQ8A 5KFPA 3BGOP 1Y00A 5DM6Q 2GA7A 4Y2MA 2FHJD 4ECZA 1HHTP 1S9EA 3T41A 4A8XA 3BPDA 1S1VB 5C2GA 3M8PB 2JJ4D 4OYZA 1XMBA 3SSQA 5KFBA 1I94J 3MM9B 5H9FK 3VAJA 2YWKA 2DNZA 5DDPC 2E7XA 4LF7J 1UWAA 3CGIA 2VICA 5D15A 4C8OA 4NZ0A 1XERA 1WF1A 4WBFA 1Q81T 3PXGa 3IAS9 3TUPA 3G2XA 2DNKA 4LBIA 4ZPWR 2A6OA 5HMXA 1V5VA 5E3AA 3IWLA 2DNGA 3SV4A 2O5DA 3BKTA 2RF2A 1NUEA 4PQUA 1HNVB 4QBUA 4F36A 1PAEX 4UZCA 1T9WA 3T6JA 3HMJG 3MTJA 1VI7A 3OVAA 4Y34A 4IG3B 4LVNP 1JLCB 2R8JA 1NAQA 3R1LA 3W62A 1N0VC 1ZYQA 4CIOA 1F5AA 4P10A 2B56A 1T9TA 2ZDOA 1VQ9S 3LGHA 1CLFA 2J9EA 2AIRB 4QIFA 1C1CA 2LCWA 1L3VA 3WBZA 2L41A 4HYKA 5HLFB 3JAMU 3RTVA 3PJWA 4A47A 3OSNA 4O3OA 2HYIB 1V3RA 3HFKA 1FJCA 4F25A 4M95A 1FJGJ 2BM1A 4C0HA 2XLKA 4WIIA 4K2JA 5E33A 2DR8A 1NSQA 1FRIA 3X1LB 5K8OA 2F8MA 2MLYA 2OPQB 5KTQA 4L3NA 4J9UE 4OYAA 1WF2A 3NWRA 3KFWX 5C25A 1Q8BA 1PYSB 1ZM4A 2KH9A 3HFZB 1RT5A 3VZHA 1NSAA 4HLBA 2OKQA 1OQ3A 1M1HA 1TK5A 5KFTA 3TAQA 2MEWA 2XNRA 1F0XA 2GMHA 4J9LA 4CWBA 1M5KC 2AYGA 2RQ4A 4H4OB 2VBWA 5A8WB 1RHMB 1KFSA 1TFYA 1I5OB 3IR5B 3FQLA 3ZTOA 5AJ3F 1UA0A 4ZVOB 1R3NA 4ECRA 1H6KX 5J2MB 4OHWA 3JXOA 4D3HA 3VGUA 5KFYA 1MN7A 2AGOA 1FJ7A 5SUHA 1H2UX 4RNFA 2V8PA 1RAHB 2ROEA 3K5MA 1KOOA 2NXCA 2PMZD 1D1UA 5LMUF 5L9XA 4DBQA 2CIMA 2UUCF 4GVLA 3RB6A 2LQBA 1QY7A 3FCHA 1UVKA 2XNQA 2WONB 4USWA 2F65A 3MPUB 1C2PA 4ZVHA 4RBUA 4URSA 1XMQJ 3VTIA 2BJEA 5ETSA 2MQPA 5DG9A 3K0JA 1S7HA 2UVWA 1YGYA 3IRWP 2X1AA 2IM3A 1F60B 5ETPA 1WC1A 4JI2J 2KRRA 2Z2LA 3DN9A 3R3TA 3AY0A 2HURA 4IDKB 2EG1A 3PW5A 3TJ9A 3HHLD 2ZBCA 2GX8A 4F7VA 3J7A1 4JI7F 3H5YA 4ZHRB 2RMLA 4J7CA 2CQBA 4YR3A 3VGVA 2HG4A 4CLZA 3DOMA 2RRAA 2ZVSA 2DNHA 1RAFB 2Q6BA 3R1HA 1TZ0A 4X66J 2Z2MA 4M5KA 5HAOA 4O23A 2MKKA 4KGVB 4ZPVR 3EGZA 4NA3A 2ZHAA 4NYZA 3MOJB 2C3UA 3OTDA 1REGX 5KT7A 2DHGA 2FD2A 1NK7A 1CJTA 2W7AA 5IC4B 4Y2AA 1D3WA 1O5JA 1Q86T 5D4LA 1K8AT 5CD4A 1VQ4S 2G1DA 4J9VA 4DV2J 3IM9A 4JYAJ 2XO7A 1S0NA 3OTOF 5DG7A 5J2NB 2GHVC 4OV6A 5JXSA 1QVFR 2X3GA 2BXJA 3Q24A 1VQ5S 5DZ6A 1TL7A 3BR8A 1R6VA 3Q8VA 1JKHA 2KYXA 4IH5A 1AB8A 4DV5F 1VC6A 4A46A 1L3UA 3MAAA 3KYLA 4A8SA 3NBPB 3DRPA 1I6JA 3N6NA 1M5HA 2GAHC 2F3JA 3ET6B 3W2VA 4AXJA 1VK8A 4YY3J 3TZYA 2V8DA 1RXOB 4LRFA 3I9V9 1LWCB 4OYBA 2DR7A 1UFWA 2AU0A 1S9EB 3H2LA 2VPXB 3WZ0A 1YRXA 3BPSP 3UFCX 2VIHA 2A6MA 2HGNA 4PXDA 1Q0NA 1RT2B 1T02A 5E3CA 1LWXA 2O66A 3SCIE 5KFIA 4LF8F 1YJVA 3CCMS 4Y00A 2J0XA 3NAHA 1S1XB 4USUA 3SCLE 1Q79A 2P6TA 3PX6A 4RR5A 3LAKA 3BBBA 3BSOA 2VPYB 5J1EB 5IWAF 1FTRA 4ENOA 1NPPA 4OHVA 1I51B 1BQMB 1WG5A 1RT3A 2RF2B 4PQUB 4ZLPA 3QGPA 5HROA 2CVEA 2G2ZA 2W9AA 1NRKA 5MLCV 5KFNA 4K4YA 2J76E 2OEKA 5CAAA 5HMWA 4IRCA 3CDUA 3NNCA 1URNA 3VAIA 5IT4A 3LO3A 2WOMA 2HAIA 2VG5A 5F8IA 3SBMA 2OTLS 1MWZA 2CQ0A 4K4WA 3US5A 3TX8A 3FMBA 3ZZYA 4DV0F 2ERRA 1RWVB 4WXWA 2XGQA 4I6WA 1AYEA 1UETA 4OX8A 2QA4G 1YHQS 1C1CB 2OSRA 5F9NA 4ZPCA 2ZH9A 2DNMA 1WC4A 4WFZA 4KFBA 2MJUA 4NLTA 2D74B 4RU2A 3GV8B 1DHMA 2M2BA 1FKOB 3GIJA 2Z56B 1TUVA 3N6LA 2ATCB 1ZAVA 4LRAA 4ANDA 5KG6A 2J9DE 1U6FA 2VA2A 5F8JA 1S6UA 4FN5A 2JH3A 4ZPBA 3UD5A 4HEA9 2CPHA 5C25B 1U4BA 4USVA 3G6XA 4P6QA 4X65J 1NO8A 2R42A 3BGFA 4B3TF 3M2RA 3RUBL 1IKYA 4LF1A 3TRGA 3J7ZT 3N4WA 2R2UA 1FKPB 5BR8F 1AZSA 1ULRA 3AOAA 5BYQA 8ATCB 2FVPA 2RH3A 2XGPA 3D6FB 3FJ2A 5HANA 2W01A 2RHQB 3GPAA 1CC8A 3GMGA 2VG6A 4KO0B 3SSRA 1U6BA 5GADI 1VBKA 2ILZA 5M2RA 3DLBA 3M05A 4J9PA 1R0AB 3UVJA 5KOWA 4RUCA 4XO0A 3BGRA 3D68A 2G13A 3M2VA 4DSIA 3MEDB 1SC3B 2HMIA 4ID5A 2DNRA 2MQOA 4CH0S 3VQTA 2BBEA 3PZPA 1M5VC 2FGOA 1XWLA 1H3DA 3MWBA 1S7IA 1VMBA 3D67A 2EFGA 4CYUA 1RU1A 5K5MA 2IVMA 2ZKTA 1VQMS 3TA0A 1X7VA 4ECWA 3LOUA 5KG1A 4RW6B 5ETTA 2WW8A 4KHRA 2W2QP 2OLWA 1KKHA 4J9KA 3ZFVA 1GX5A 4U67Q 4MKAA 3U27A 3M8QB 1S1UA 3MFIA 5KFHA 2GHWA 3CIZA 3D5MA 4LVOP 3NOGA 2W7PA 1VOMA 3UDEA 2YWGA 4P74A 5IT9Y 5IV3A 2OD6A 2NS1B 1KVJA 1WNEA 1SC1B 4OZ3A 1DQAA 4EFAC 2KXNB 2QLFB 1H98A 2QO3A 5B0BA 1X9WA 2HAFA 4ZPDA 4RW8A 2KG1A 5B0CA 1VRUA 1HNIA 3UN2A 3ZZOA 4F3MA 1VQNS 1QLNA 3HSDA 2ZOGA 2FLNA 3ITHB 2WSFC 4WP8A 2R2RA 2Y8WA 1NBEB 4C8LA 2XI2A 3CD5A 1MU2A 1SKUB 3G4SS 2LECA 3UD4P 4I6AA 4ANEA 3CC7S 2CJAA 2HS4A 2V9KA 4ES3A 1B7FA 2BRKA 1D8YA 2L9NA 1S6QA 3KWMA 4V19J 2VB6A 1HBUA 2MZRA 4DQPA 3J81Y 2EPIA 2MZSA 1XNQF 2LXFA 2H4YB 2G2YA 3R97A 3M32A 4KKOB 3WX4A 2MKIA 4P2MA 1S1WA 1EQ0A 3MR6A 3UDCA 3MAAB 3A3NB 2F40A 1WJ9A 2D69A 5KFAA 4OYXA 4Y2IA 2XS2A 2CJYB 3W2VB 4CT8A 4O3NA 4EK2A 5L1JA 2HQCA 3KDNA 4ECQA 3ZC4A 3JSRA 1S6OA 1R89A 4MIAA 4I2QA 3E01B 3OR2A 3KG1A 4RW7B 5FDLA 1IM4A 3PM9A 2IBKA 2RRNA 4FKYA 2KT3A 2MHEA 3IBWA 1OO0B 2JNJA 1KQKA 2QMWA 2AV5A 4FP9A 5EDWA 2DRDA 4CH7A 2IHR1 1VQ7S 4ZLNA 4QIGA 1B99A 1URRA 1T9XA 2HRTA 2DHHA 3IR6B 4USIA 3GG1A 4I69A 1FFWB 3HCXA 3R5GA 4UT4A 2UUBF 4DS4A 2MYFA 3RR7A 1RTIA 4LFAF 1QJHA 3MMJA 2VUGA 4ZVTB 4C4WA 2V94A 3EM1A 3LP0A 3SQGB 5CZVA 1OPZA 2GCFA 2QMUB 2XCPA 4DX8H 1HI8A 3D0GE 4Y0FA 1U8WA 4MH8A 2MB0B 1RT3B 4NA2A 3Q89A 4DCJB 5HROB 5KG5A 1YZ6A 2UXBF 1QUVA 2XO6A 1KOHA 1U24A 2EI5A 1Q1KA 1VJQA 3DDKA 2P2CB 4QIVA 1SCJB 4H4KA 5CYQB 1X4DA 1K1SA 1S9GA 5M2UA 2RT3A 1CS4A 1NSPA 3DOKA 2G0IA 4WYLA 2VG5B 1RLDA 2BRLA 1ZPWX 1D9DA 1FFGB 2RQCA 2M52A 2ZWPA 2WHOA 4CQ1A 4ZDNA 2DYAA 4MT1A 2DGWA 4L6V3 1FTCA 4FBTA 4K4XA 3KLEA 1NJWA 3C3LA 2J9DA 4I7FB 1SJQA 2H48B 5C24B 1WC5A 5IWAJ 4RU9A 1GFWB 3M1VA 5HJYA 1AXQA 4K4SA 4NX9A 3KK3B 2OELA 4DPYA 1TL3A 2ADCA 2ZUAA 2NXNA 1U2FA 1HLWA 3QIPA 4RBTA 4IUFA 5U47A 4DFJA 1YTYA 3M2RB 2B8QA 2OFHX 4ZCIA 3M2UA 1SH3A 4LF9J 2QZ8A 3K2YA 4TVAB 2EFQA 1AZSB 4B3SF 1YKWA 3E51A 3CO0P 4C9DA 2FHMA 1S0VA 1RBAA 4K0KJ 3W66A 1HR0F 2JZ5A 5F8GA 1BMQB 2XZDB 3P3DA 1BXNA 1NLKL 1EHWA 1IVZA 3UVJB 3J81j 1TV6A 4KIAA 4DS5A 3FSYA 2VONA 3HHNB 2ZZNA 3NMAA 3M2VB 2AGQA 2DGTA 3D4JA 2CPJA 1TKXA 2FY1A 4DPWA 3CNQP 1QSYA 3IAM9 4IG0A 4CTAA 4N8OA 4GKJF 1WEXA 2Z8QA 1EARA 1M1GA 2BMBA 5LL6d 3GIRA 6FD1A 3JYTA 1KBRA 4V19X 3H2VE 3T6BA 4NLUA 3D6HB 3H0PA 5JUMA 5BR8J 2GVZA 1TUWA 4DWIA 4O3QA 1KS2A 1SQFA 1CC7A 3G8SA 2OPSA 1RCOB 2JDJA 4FYDA 2R9LA 3FRZA 4LREA 5HVGA 2ZH8A 1ICEB 3AB4B 5CH7B 1LWFA 4IRKA 4C11A 2CKWA 1BGXT 1S1UB 4FDFA 2JHEA 4A8FA 3AD9C 4KE5A 2XLIA 1HHSA 4K8RA 1HPZB 3VAMA 4OV1A 2DPIA 1Q5VA 2DR5A 1Z4UA 4MK7A 1N36F 1G6BA 1NK4A 2OAUA 3NXZA 4DX5A 1R27B 4CNZA 3DLLQ 3R6GB 4NE9C 4DUTA 4F3OA 1BHNA 2ZC3A 1HMVA 1IN0A 4ERDA 1HNIB 3PJ9A 3EWGA 1CJKB 3FMWA 3DRYA 3NLCA 5HL7Q 1Q8LA 4DPTA 2BUNA 2YKQA 1RWMB 3DYAB 5D4OA 1VQOS 1WC6A 2AJ0A 4B3OB 4MIWA 2BYCA 4EU0A 3ULHA 3SSSA 4DPUA 2CJKA 2F8EX 2YKOA 1HBUB 1UFKA 3L3CA 4F04B 4RLEA 3C46A 4DUZJ 3HVTA 1FX4A 1HWIA 4K4VA 4C7QA 5DM7Q 2AWZA 2YNFB 3EX7B 5CABA 2WW4A 3FEZA 4TY9A 3RW7A 3MR7A 2ZM6F 3QRQA 1NKEA 2HWTA 3K58A 1HNZF 3MXHP 1RAIB 4I2QB 3PHEA 2IMWP 1DY3A 1Q53A 5IOLA 1ACMB 1DJ0A 2LDIA 1XJWB 5AXLA 1Q82T 1JMTA 2YKNA 5KFQA 3SYZA 5D4PA 2BKPA 3EYZA 2DY1A 2ZE2A 2BKNA 1WOOA 2GFFA 2LLZA 3KUGA 1IBKJ 1X4HA 2ACYA 4RUHA 2ZH6A 2HW3A 1RA7A 1WF0A 2WVEA 3HFVA 1HBMB 2CVIA 4GRSA 1RTIB 3G9CA 1WUUA 4HI1A 4X2BA 2LQ9A 4M5DA 4M94A 2CNOB 1HNXF 4ED2A 2XMKA 5F3ZA 1GQEA 1IKXA 4M5NA 3M9MB 1R8CA 3DGVA 4DV1F 1MROA 2QX0A 3HVRA 4LF4J 2KXFA 1PBUA 3ZXWA 4B9VA 4O0IA 4W90B 1E6VA 4C8ZA 2FVCA 1JLQB 1FNOA 2CQ3A 5D3GA 4PCQA 2ZNZA 4P75A 1RTDB 1S9GB 2Z57B 1CS4B 2IYIA 3DOKB 2MQNA 5T7LB 4A8WA 1C0TB 2KHCA 3GFHA 3W1YC 4JI8F 3D1HA 1F1BB 2DVIA 1BQNA 1ROFA 4KH0B 3GV5B 3R7SB 4R25A 2K1RA 4GVBA 2JL9A 4I4BA 5LSOA 1F5CA 3L9ZA 2L3MA 5L1LA 1SBRA 4YDXA 4ZVQB 3UNGC 3PW4A 3T1AA 4DFKA 5IM0A 3C6TA 2Y1IA 3GYNA 1NPKA 4USMA 3QZ7A 3BB5A 4GO5X 1FCAA 2R7SA 2EKYA 1C1BB 3R5JB 1TL3B 4DCPB 2QLXA 2CQ4A 1SH2A 2VC1A 1WKLA 2JFKA 7FD1A 3QIPB 3VAFA 3MMAB 2AZ1A 5CYMA 2IAJA 3I96A 1T03B 3BQ1A 1YBUA 2WZ1A 2YPYA 2IDEA 2Z2YB 1GXLA 3AFGA 2ZFHA 3VZIA 2PMHA 3C6UA 2C22A 3HKWA 2E5LJ 2R7WA 1YSJA 4Q5VA 3KHLA 2ZWOA 5LT5A 1UAWA 1VRQC 3D3BJ 2L9WA 1Y0HA 1SB6A 4QZVB 2DR9A 2ZJPQ 1EIYB 1MMNA 3GONA 1X0FA 1V5IB 3UNYA 2B4PA 1JXEA 3DLEA 5GAHI 2M9KA 4DPOA 1FXRA 2CQCA 4GKKF 1IXKA 2J0QD 1Q7YT 3HF5A 2GC8A 3CC2S 3ZTSA 4AUKA 4OL8A 3GFYA 4P9SA 4ZPAA 1A7GE 4HVZA 2UUAF 2V34A 2J0WA 2Y1JA 2HFSA 3JYTB 3V6KA 3KJVB 2DEJA 3QJJA 3LA0A 1OY8A 3W5XA 3G6ES 3CJKB 2C2OB 2GVZB 4B3SJ 3QT7A 4USHA 1RWUA 5A8KB 1YJUA 2WBRA 3HZGA 3CDAA 3CTRA 4DSLA 4B3MJ 1IR2A 4YEAA 3V81A 4NL5A 4C11B 2YQ3A 1WEYA 4NRTA 2XMMA 2YKMA 4JI4J 4DQQA 3S8SA 3EGWB 4I2PB 4HI2A 5EWFA 2FUG9 2HQDA 2CJQA 3PW7A 1YJNS 2AX0A 2B9WA 3P4UB 2RQKA 5GAEU 5L39A 5HQMA 3N01A 1WORA 5LJ5Y 4WE1A 1DTQB 4IQXA 3SCJE 4UY8T 3C16A 4OLPA 3FBFA 2XWXA 1IKVA 3HHEA 3K8WA 3KMSA 4U8VA 1WEZA 4ZVSB 4GKJJ 1VC5A 5K14B 4UUXA 5H1SV 4NLGA 1GMUA 2BJ9A 3A12A 1TL1B 3BYPA 3BBFA 4K4ZA 5CYJA 3I9ZA 3R5CA 5LMNF 4ZCKA 4FKXA 3OW2R 1UVNA 2FIUA 4DR7J 3J80U 2DGXA 1HIYA 2XULA 3A4TA 3MMCA 4WYWA 3GCXP 1ITPA 2I2YA 3CF5Q 5KFUA 4YR2A 3IWXA 3HVTB 1NZAA 2IRYA 5B08A 3JS9A 2NREA 2R7UA 1F3VA 3D28A 1AUSL 2RKIA 3CJ3A 2CPFA 2CQIA 2JFDA 1JLAB 1LXNA 1GK8A 1XK8A 2MY8A 3KHGA 3GYXB 1N52B 2VBZA 2YWFA 1XMOF 3ZZRA 1O0PA 3LUYA 3LP1B 2DD8S 4C0OC 2DNPA 5LXRA 3MMBB 4JV0A 1IBCB 3ISZA 2J8AA 1FWLA 2FVRA 4HHUA 5F0UA 3CDEA 4HH1A 1Q5YA 1FDBA 1R8BA 3LANA 2YKNB 1UVLA 2N4CA 1WHWA 2ZZMA 3C66A 3CPWR 1ZM2A 3HDSA 5F0WA 1LW0A 3QWPA 3MCSA 3JAMY 4HACA 1HKAA 4ZLLA 2Q66A 4F4AA 4USTA 2P9EA 2CJBA 2ILYA 2R2SA 3K5PA 3ADAC 3M8SA 1B0VA 5HMZA 4PRFA 4LFBJ 4JV1A 2DIVA 3CW2C 1GXUA 4LSLA 4DEZA 1AFIA 3KLGA 1X4AA 1X5PA 2DO4A 4WFYA 1MROB 1Y10A 2BV3A 2H4WB 2ZM6J 4YFUA 2KO1A 1NSKL 5DQGA 1HNZJ 1O6XA 3KK2A 4DF4A 1JJCB 2E9RX 1S76D 5D3GB 3FK4A 1ZOTA 3QGHA 3PKMA 4EBDA 4JI1F 1NB2A 3A8EA 1QVGR 2JEFA 1HQEA 3KUHA 1U1KA 1EZZB 3OXFA 4YHHJ 4NXNF 3R6LB 3C14A 2G4BA 2HVHA 2CNLB 2CQ2A 1DTTA 3UN5A 1HA1A 2DH9A 4KH1B 1N34J 4AL5A 5D8HB 2NPFA 3TWZA 3K59A 4GVBB 2JWNA 5JJBA 2M7SA 3MECA 1YJ7A 3G87A 5IQ6A 2RDIA 2VOPA 3TUIC 1ZTTA 3C6TB 3NG8A 5HVHA 3TI0A 4WU2A 1NDKA 2RUSA 1YJRA 1M5PC 4DV1J 5JVHQ 2R2TA 1N32F 3FNNA 5CZXA 1QAYA 1XN9A 2MY7A 2BE7D 1Y4ZB 3THVA 3RJMB 1VBXA 4DV6F 4LSZB 1N33F 5I3UB 3GWCA 2FC9A 4OYWA 3DMJB 4NYOA 5CYMB 3DOLB 4CZCA 3S01A 2RIJA 2A1BA 4CO0A 1W2IA 1JNZB 3GR0A 4O0NA 4PPZA 2RDDA 3C6UB 2YX1A 3H25A 2BM0A 2DNOA 4M63A 1RB0A 4DV3F 2KJVA 2XWYA 3KTQA 2O67A 3IM8A 4DOZA 2WSEC 2VKRA 5A2QY 2W9CB 3L7PA 5ETNA 1APSA 3Q8SB 4MJKA 3IS9B 1LFWA 4KT0C 2NXJA 3PYEA 3TJ8A 4MFBB 2R7TA 4ATNA 1CJVA 3HP6A 4R0JA 4DHVA 2LMIA 3WIUA 2VD3A 3DDNA 3Q86A 1RT1A 4MYTA 2Q6CA 5T14A 2HEKA 3MOZA 1YRUA 1JLBA 4PG5A 2QLJB 2BVZA 4WP9A 2V63A 1IBMJ 2HZVA 3DI6A 3BQ0A 3D0IE 3DLKA 1VFJA 4QW9A 2GO8A 3BSAA 2MHNA 2P5VA 3W9IA 1F5BA 2RU9A 3QRRA 1QE1A 4Q2MA 3FBCA 3D9BA 1S0MA 5L46A 2UXCJ 1BY9A 3FZBA 4CLPA 3HZEA 1S77D 2HZAA 4FF3A 4HT5A 5GAGI 4PXBA 2A0FB 2VJUA 3GG0A 2DRBA 3LW5C 1RWNB 2WB1D 1RA6A 1I94F 2YH0A 4V1Ak 5C5JA 3KOAA 2BA9A 3BO3A 2VODA 3I0RB 3Q8PB 2YKMB 4LF7F 1U09A 2JEIA 5DGBA 3OR1B 3DKDA 2JLGA 4OX9F 2J0SD 3V5RA 3GB0A 4RPFA 1NM2A 1OWXA 4WU3A 1GMVA 4DN9A 1P1LA 2XSFA 2J7UA 4P52A 1IKVB 4F02A 5FLXU 2NCKL 4YP3A 2HWHA 1T0TV 4R0EA 3SI8A 3B54A 4FVCA 4HTIA 4C48A 3PR5B 2LU1A 2MKJA 4OI3A 1RTJA 3BEGB 3DRRB 4QWDA 4JI6J 2LFVA 1JK9B 3MAQA 2W7OA 1VHFA 3AHPA 2Q1LA 4ZK7M 5KFDA 1J2VA 3CCZA 3M8ZA 1S1VA 3M8PA 2MDAA 4ZP8A 1X4EA 3MMCB 1EP4B 5B09A 3K7RA 1N6QB 4NPOA 3NGRA 4KHMA 1T8EA 5G0RA 3PYFA 4ECXA 4CLYA 1DRZA 1SQGA 3QFHA 3NGKA 3M30B 5F9LA 2IMOA 3W7BA 2HNZB 3ENVA 3B78A 4AQYJ 1NCLA 3ZZUA 3UE2A 4DF8A 1FJGF 3OFFA 3QJPA 4D3GA 1R7IA 2WVDA 3MEGB 2RNEA 4F0MA 1FDAA 5IV4A 1HNVA 2K3KA 1NHVA 1KNZA 1RT6A 4G1PA 3OUYB 4IFVB 3UR3C 1VQLS 2XBPA 2HHWA 2D3OR 2YWEA 1JLCA 1DLOB 3HKZD 2Y1RI 2V50A 2RHSB 4BBYA 5DJBA 5M2PA 3NS6A 1VYAA 4EYHB 4IR9A 3W8PA 3LPYA 1LK7A 1SPBP 1UL3A 3NY0A 3IRXB 1JLGB 3PFEA 2XG8A 3UCUP 4HACB 3W3SA 4KHPF 4ETXA 3ENQA 3ETOA 3P5BP 4ZP7A 5HLFA 4TLRA 1RUSA 5EWGA 2XLJA 1HBOB 2BE2A 4I0WA 2EW9A 1NB7A 2CG8A 5HSPA 3C19A 3BDEA 3A8IA 3W2WB 4ZS6A 3GFXA 1F9FA 1YRTA 1GT8A 4X84A 2MSTA 1P9YA 2AJQA 2OPQA 3KK2B 1JJ2R 2IDLA 5LOQA 4QYRA 1YWXA 1HQEB 3OL7A 4USKA 4NLRA 1XMQF 1R0BG 1QDUB 3Q0AA 2YKPA 4PAAA 1N5YA 3W61A 4H4OA 3HO1A 4JI2F 4G65A 2MKHA 2VBYA 4TQSA 2FHJA 2ZH2A 4RKUC 2DK2A 5J2MA 4LUBA 1FT8A 3NGUA 4NYPA 4C8MA 2FJDB 1S49A 1CG2A 4OIXA 4HH0A 1KVIA 2EK1A 1OIAA 1LV5A 3MURP 4X66F 2DHXA 4PYDA 4TXSA 2WAQD 1V6HA 2WONA 2B0GA 2IJNA 3D0HE 1K73T 4IO1A 4M5GA 2VQFJ 4YQWA 2QA4S 4QPTA 2P8IA 4ER8A 4UY85 3FFIA 5KT3A 4DL3A 3CMQA 1VK3A 3R2DJ 2B6AB 3V4IA 3MEEA 3VGSA 1Q8KA 4M5JA 1FESA 1PILA 2FJBB 4PZVA 2UVRA 2RS8A 4JYAF 2ALYB 1AT1B 3MEKA 2OSQA 2QSFA 3H4DA 1VQ6S 4KSEB 2AHOB 1WHXA 2QFIA 5LJ3Y 2I6WA 3FCVA 4ZHRA 1GTHA 3NGSA 3QNWB 4YDDB 1CJVB 3D1OA 2GIFA 5A6PA 5MAOA 3DXBA 1K9MT 4NLQA 3J7AN 5K8PA 4Q44A 1S1TB 2IRUA 2FDNA 1JB0C 2NR0A 4IOBA 3NCQA 5CCLA 3DI6B 3DLKB 5A8RB 3VAHA 1SV5B 4JP8A 1TTHB 2WK4A 2OI2A 3OJSA 4LR7A 2DRAA 4YY3F 4ANCA 1Z2ZA 3BSCA 1FRMA 1X5SA 1QE1B 9RUBA 1IKWA 3OL9A 1NDCA 1FI4A 2IM2A 4DV4J 2MQLA 4LRDA 4UOFA 3MM5B 4DR1F 4O3RA 1CVJA 3GILA 1X0PA 2ACMA 3P8BB 1XR6A 3K5LA 3MM6A 2G9OA 3GYGA 1VQ8S 2ROGA 2H54B 4N8NA 1S57A 2JRSA 4NXMJ 4NEYA 2N3OA 3GSDA 2ALZA 2KM8C 2OPPB 3MUMP 1N88A 3SV3A 1R0CB 3MPDA 4K4TA 1PC5A 2IM1A 4ELVA 4MMOA 3FQKA 4ZN3A 2LQJA 5F8LA 3LF0A 2MJNA 4C8YA 5KT2A 4TYAA 2YWWA 4JI3J 2RB7A 4PG8A 3NAIA 3E3XA 3ET6A 2BKOA 3PW0A 3TW0A 2EFNA 3ETMA 4PKDB 3R7NB 3MF5A 4RNHA 1T05B 1RTJB 2BW7A 3T1YJ 3CMAS 4NOHA 4RWWA 2B3TB 1CBKA 3WC2A 3MGJA 3QGIA 4C6AA 1MG7A 1LWCA 1F2GA 3X3UA 4ELTA 1CJUB 3KK1B 3HSZA 4PWWA 2VL1A 5AXKA 3P49B 2ZOFA 2VFTA 2QL5B 3L4BC 3PO4A 4NLOA 4I1TA 5K20B 1TFWA 2AW0A 1RT2A 4ZOSA 1OPIA 4F4WA 4N5SA 4JI0J 2GQCA 5L38A 5G0RB 1S1XA 1FE0A 4OX9J 2B7CB 2K2PA 4KAIA 4ED0A 3L09A 2KDOA 4YUDA 4FF4A 5J1EA 3I6PA 3CEDA 4H54A 1PBAA 2CQGA 1BQMA 3O2IA 2POKA 2KU7A 2M8DB 3C15A 2GV1A 1FVSA 4ZP6A 4DLEA 4NZ6A 3L7UA 1RT6B 3NNAA 2W1BA 4X65F 2Y1LB 3NCRA 3DC2A 4IOCQ 2V69A 2KVIA 1Q95G 2KG0A 3CB4A 2YNIA 1HNWJ 1SJRA 4F26A 2FB0A 1XNRF 4R5PA 4X62J 1X4CA 4WK3A 1VBYA 1VHIA 4I64A 4X4UA 2E29A 2KT5A 4A8OA 1O51A 1L3KA 3ENWA 2K8GA 3IGNA 2OMLA 4FF2A 1K1QA 2X1FA 5E41A 2A3JA 2A10A 2MKSA 2E5IA 1WKKA 2BE2B 4UOCA 3IC1A 1U1OA 1JJ4A 4J9OA 1J27A 2G1HA 1FKOA 3FGVA 2VPWB 1SJFA 1WC0A 3GJSB 2GAGC 4X4NA 3DLGA 3J81U 2I1RA 1JLEB 1PYOB 3UCGA 5I4MA 5HP1B 3R2CJ 2D1CA 4EGLA 1YJTA 4URGA 1YZ7A 1RADB 4DL2A 3H5SA 1S0OA 2V2ZA 2YNGB 4OJHA 1OYDA 1FKPA 4FXVA 5E7OB 4PQAA 1SKWA 2ROPA 2W4DA 2I5JA 4AXIA 2KKHA 4FYVB 1N5YB 4LBHA 3UW1A 5H9FJ 2JSXA 4QWAA 3IFEA 2MMYA 1KTQA 2ZOMA 4FXWA 4KHPJ 4PG4A 2V8HA 3N0VA 3MR2A 4KO0A 3NS5A 2YY3A 4Y2CA 3Q23A 1R0AA 3G8TA 3TA1A 2W2OP 3LPEA 1RSCA 4PXCA 2GQQA 3MEDA 2K3IA 5HI7A 1V9OA 4J5OA 1PKUA 2GNKA 4HR2A 3OJUA 1IUJA 2ZC4A 2HHQA 2LA6A 1HWJA 2FHKA 4E98A 2KZMA 4X4RA 1VQSA 3IG1B 4KTQA 4GO7X 4DFPA 3WX8A 2EKNA 4RWXA 2KTQA 1N8RT 2XY6A 2YH1A 4ELUA 4RW6A 1RTHA 1ZETA 3PNIA 3FFIB 2CWKA 3GR1A 4C97A 3RB0A 3V4IB 3DLJA 2WVBA 3DU6A 3MEEB 1SL2A 3OD2A 1RABB 1ZPVA 3M8QA 4O3PA 2XMWA 2N7YA 3FEXB 1ZTWA 2UZAA 4JB8B 4TNOA 4ZITA 2A2CA 2XEXA 4MIBA 2VF3A 3RU0A 1NHUA 3L7OA 1TKZA 3W9JA 5RUBA 4LMZA 1T9VA 2DGVA 2WRMA 4ZJLA 3DCAA 1S5ZA 1TAQA 4EEYA 2GGPB 3AD8C 2HK2A 4UF4A 1FD8A 4M5LA 3G8QA 2C2ZB 4A8MP 2HNYB 2AZ3A 1FDNA 5KT5A 2IVFB 4UQGA 4G6VB 4FS2A 1ZH5A 3ITHA 4EO8A 3CWJA 4Q45A 3I82A 3HJFA 1IKWB 4KV8B 1T7PA 4J9QA 2BANA 2ZKUA 2DNLA 4G3IA 2MKYA 1UWBA 4ES1A 5DGAA 2DPJA 2ZH4A 3MM6B 1EKRA 1DARA 4AD6A 1X4BA 3MPWA 2JLEA 2HFVA 2PFDA 3MCNA 5KFSA 2HHVA 2V2KA 3QAUA 3CJTA 5F8NA 1J5OB 4CO3A 4LRCA 1SKRA 4KKOA 1S4FA 1RKJA 4IRDA 4LF6J 2CZ4A 5C42A 7FDRA 3CUNA 1N0UA 2VASA 3W5ZA 4FVMA 5KFZA 2ZHBA 1S97A 3P45B 3DHXA 4DR2J 1WDTA 3ZNJ1 2WCXA 1IR0A 4N47A 1WOSA 3BQ2A 3WQPA 5E2QA 4AT1B 3H20A 3E01A 2XZTB 2BJDA 3EICA 4LT6A 3CULA 4RW7A 4ETZA 2PEBA 5BJRA 4OYIA 1T9YA 2P9CA 3HHKA 4NLPA 3KKFA 2MQ8A 1SI9A 2VDHA 5JMNA 4DR1J 4MTPA 4QYZJ 3HT0A 2JVOA 2C42A 1T3NA 2PT0A 4J90A 2BX6A 2HFNA 1FO1A 1KTVA 1SIWB 3EVWA 4ZCMA 5DDQC 5IZHA 5GMDA 4OMFG 5J2PA 4Y3CA 4Q8FA 4MKYA 2GJ2A 1UW9A 2C3MA 4DR4J 2QTWA 4Y28C 2V5HG 2HQ3A 3MI7X 3SQGA 2YQ0A 3SIPB 1FF2A 2OPRA 2Y0BB 3RRGA 2OIHA 3DGPA 2E1CA 2HLTA 2B8PA 2VZ9A 3C15B 5A0YA 4KGMA 1G2EA 3F41A 2XS5A 3HHLB 4RUBA 3G6VA 4WF9Q 1CPZA 3TQ1A 1Y5NB 2VG7B 4YN3B 1N54B 3KG4A 2YNIB 5CYQA 2R8GA 4K59A 4LF9F 1HW9A 4R5PB 3CD6S 1X31C 1YI2S 3BO4A 3JSYA 1RAEB 3GFZA 3GLJA 1IR1A 3MZIA 1MSWD 4K0KF 4DR5J 3SDEA 2V6AA 1TELA 3CD0A 1UJ5A 1RAAB 4HHJA 3TVKA 2LEAA 4GMKA 3AA8A 1FRXA 2AEMA 3R5DA 4F0KA 2ZBRA 4I7FA 3EXYA 4ZCLA 2QA1A 1SC4B 1TKDA 2V8VA 5I3QA 5C24A 3AJ1A 3O6QA 4P72A 2J7KA 4QU6A 3KK3A 2XMTA 1GH8A 4L73A 1RWPB 3UI3A 3EMTA 1QD1A 3FBEA 1RK8A 3DLGB 1L3SA 5IS2A 3HXMA 2XMAA 1RGVA 4ZIWA 4DSEA 5FD1A 3IO1A 3RAMA 1HI0P 3D54A 1NKBA 5KFOA 1U8SA 1XNRJ 3BM7A 3HD1A 1NDLA 2I5JB 1S79A 4QCLA 3VQSA 2VU5A 4DR3F 4DXLA 5KFRA 1TR0A 4JV2A 2XY7A 4BWJA 3BKFA 4FNIA 1W7WA 3LGNA 1FDDA 2WSCC 4KQZA 3DHWC 2CFXA 4DSFA 1S4EA 2D3O1 4S0MA 4FS1A 4QW8A 2W4CA 1TAUA 1A9NB 3U02A 1H7XA 1SKSA 4CP5A 2MQMA 2YKAA 1S6PA 3RBXA 3NL0A 3Q8RB 3M8WA 3J7YU 1FFSB 3H2UB 4EI2A 1TQLA 2HS3A 2QG9B 4OZLA 4ECVA 3FSIA 4MK8A 2B9YA 2MLXA 4J9MA 4UOHA 2CPXA 1UJ6A 3VAKA 1RTHB 1LW2B 2MGZA 2Q79A 1KDNA 2PMWA 1B4SA 4Z37A 3EVMA 4OZJA 5L1KA 3QFWA 3CJSA 1DURA 2W25A 5BYRA 4EUVA 3CJRA 3HHLC 5I42A 4W98A 2KVQE 4DUZF 3PX4A 2K7JA 3IA0A 4ILLA 3HM9A 4PEOA 1HPZA 2R7OA 2FZCB 4I68A 3QZ8A 1N5QA 1TKZB 3O3LA 2PSZA 2H5IB 2EEYA 2LVWA 2NSCA 1LK5A 1IWAA 4OZ5A 5DLFA 3H5UA 2AKWB 2ZBPA 4IKAA 3DFEA 1PG5B 2M4MA 2OUGA 1VLYA 1CJKA 2XY5A 3PJXA 4RW9A 1CULA 1LFPA 2UXDJ 4FZVA 4FPRA 4U7UD 3DYAA 1YVFA 2QMXA 3J80Y 3OTBA 2FHOB 1EKSA 3WIVA 3BN4A 4B3OA 3KDOA 2BANB 1UWBB 3VF0B 3KLFA 2EK6A 4YB6A 1MMLA 3EGVA 1IBKF 4CLKA 2ZHOA 2XHWA 2DY9A 4J9SA 3FDSA 4MYUA 1M90T 1U1PA 4F67A 2FJWA 2PE8A 2F4FA 3OPKA 2DXDA 2JX2A 1YK9A 2YNFA 3ZZTA 2J5AA 2J6SA 5C42B 3H59A 1UFLA 4ID8A 1VRTB 2E66A 1XR5A 3SCKE 2FZGB 4LF4F 4B3RJ 3LTOA 2NZCA 2HLUA 4QIWD 1EX8A 4HKQA 3EZUA 2DT9A 2HZCA 4C3KA 1HARA 4RZRA 1SIZA 1N5VA 4P73A 4IH7A 3UPFA 3HX9A 1FVQA 2MKCA 4NCGB 3OV7A 4X4TA 1YDLA 3T1HF 3HI9A 4XPCA 1WWHA 2I9SA 4L76A 3P5TL 3T5LA 2QA2A 4DUYJ 1AW0A 1XR7A 5KG7A 5F41A 1UVMA 4C8KA 2KI2A 1K0VA 5J2PB 3FEYB 2HHHF 4KPYA 3QQCD 1HBMA 4DI6A 2KFYA 2HHTA 3AD7C 1NNDA 3O44A 2C2EA 3PYDA 2MZTA 4UUWA 3NCPA 4EYIB 3BGUA 3NKYA 3P96A 1LKZA 3RAQA 3TZZA 1A0OB 2W2NP 2R8KA 3UDVA 1TKTA 3MR5A 1JWWA 2OPRB 2CJ9A 4RBVA 1RACB 3DGPB 4NLSA 4BHQA 3FZ2A 1VLOA 2PD1A 4IH6A 2PA3A 5A0YB 2W8KA 3AH6A 1S10A 4WIQA 4UZBA 4KYZA 3G71S 1JLQA 4NLDA 2F9JA 3POTB 1UW4A 5D77A 4NLYA 1RTDA 2QIFA 1QAJA 3JSMA 4DCOB 5T7LA 1C0TA 2E5LF 3BBCA 2CPZA 2H65B 3GTYX 2BACA 4OJ3A 3SDEB 4W92B 3RBZA 1TK8A 3BYRA 2DGOA 2VJVA 3QWUA 3NNHA 1XIQA 1OY9A 3M7VA 5CQGA 4ED1A 1JXLA 4E8UA 2XSJA 2AJ2A 4CO2A 4EMDA 3EZ5A 5D0GA 5CA5A 1CQNA 4PG7A 2GHPA 4QWCA 3A8KA 4USJC 3I87A 3EPIA 3ISND 1C1BA 3N5BA 4J9RA 5J2QB 5DDOC 2XTJP 3OFGA 1Q8IA 3R5BA 2AYMA 1ZS6A 3MMAA 4DX7A 2I8EA 2CQ1A 3TP2A 3TANA 2VQEJ 1T03A 4LFCJ 2XMUA 3DM2B 1ZZNA 1XTZA 1T11A 2RS2A 2HVZA 3ZNUA 3DRXA 4ALZA 1PJ7A 1R8AA 4AL6A 4LF5J 2PN6A 4ZLJA 3F44A 1RYSA 1Y9OA 2FYXA 4B3MF 1UCNA 3PEHA 3AAWB 1U26A 4WCEQ 4BC9A 1PIEA 4CCHA 4JI4F 3I4HX 5D4NA 2Y9HA 2W4PA 3T5JA 3VVUA 5F3TA 2GVDB 3BSNA 2PDAA 5EN1A 1B70B 2R4FA 1VC0A 2XC9A 1WTBA 1S6PB 4ICLA 5HJXA 2COLA 2CAJA 3GE9A 1TVRB 3PKYA 1PJ6A 1WACA 2HGLA 3E2EA 2EFVA 2Y3YA 2KXHA 4IO9Q 3DRSB 2W9BB 3FRYA 3KLIB 3OSPA 4F50A 1T3OA 4MK9A 2OMOA 2B9EA 3KJVA 4DR6J 1TP7A 5EUHA 3MD1A 2BQRA 3CJKA 5DETA 1VDHA 3THTA 2G2OA 1SUQB 4KRWA 5KFJA 2MGZB 5A8KA 4DR7F 2YNHA 1U02A 5D0HA 2OJ3A 2CRLA 3MTKA 3TUZC 4DR3J 4DSKA 2BDPA 1RBOB 3HSJA 1RI7A 1QUPA 1U7LA 2D7SA 3DXSX 5I42B 3PRDA 4H4MB 2L9DA 2CPIA 4I2PA 3C8YA 1VIXA 4K7QA 2HFUA 4DV7J 4ZVUB 4ECYA 3CJQA 3K89A 2V4JA 5LXYA 5GAEI 3U1NA 1U47A 5FLXY 4DDFA 3AQOA 1DTQA 1H7WA 3EJMA 4TU7A 1ZA1B 2YBVA 1SC6A 2NQPA 1QM9A 5K14A 2V67A 1U2RA 2ZVIA 4WZMA 3IN5A 1TL1A 1RAJA 4RW9B 1KC8T 1CULB 3HT3A 3QLHA 1G3OA 4CM0A 2E9ZA 3TYTA 2MXYA 5DQHA 1MW7A 4PXEA 1U0HB 4BWMA 2GMJA 3N79A 4X64F 3KLFB 3OQ2A 1B3TA 3D2WA 3QT6A 4WFXA 3LQVA 2IBOA 3FVYA 2HFOA 3UR0A 2BOAA 1QSSA 1E6YB 4NLXA 1HFEL 4MAKA 1JIHA 2BJ3A 4ED3A 1UPPA 4LFBF 4QYZK 1NHKL 2OHDA 4PR6A 4U7UK 3DLHA 1JLAA 1D9FA 1NZ8A 3IMQJ 1KWMA 6FDRA 2ZBIA 2C3OA 2MQQA 1NEEA 2KN4A 1B0TA 1U1QA 2BQUA 1VR6A 1FK9B 6AT1B 2ASJA 1RHQB 4F0HA 2OD4A 4X4PA 2VDIA 4KBIA 3HULA 3LP1A 5A2QU 2BQ3A 2Z30B 3LALA 3MMBA 1AROP 4UTGA 4DL7A 1RZMA 1OMSA 4J9NA 3CIMA 2HIQA 1OYEA 4YHHF 2GS8A 3LWMA 1NK5A 1KN6A 4KGKA 4P2XA 3SQOP 3BR9A 4NA1A 3HVWA 1N34F 3CCLS 2YVSA 2HBYB 1EJ7L 1EAYC 4QJVA 3HK2A 5D6GA 2QL9B 3LWLA 5B0FA 2XYPB 1UPMB 2F7VA 3NGDA 2FLPA 5SZTA 2VH7A 3R5AA 2EBGA 2HHUA 3CCES 1TKTB 3IXQA 2BW2A 2YWHA 4B9NA 3P6YC 3H5XA 1HHQA 2B43A 5IXUA 1SJ3P 4OZNA 1GMWA 4ILRA 1IBLF 4NRUA 5KG0A 1VIOA 5AT1B 4I56A 3JQJA 3A3OB 3OXGA 3T1HJ 1DQ8A 4FNHA 2HSEB 1HD0A 3JSMB 1S9FA 1OY6A 4DU8A 1REVB 1BUXA 5KFCA 2QRRA 3OLBA 4C98A 2BE9B 3U7JA 2N4DA 4N41A 4QU7A 3F73A 5KAKA 1RBLA 1UEKA 2KT2A 3KUEA 2HHHJ 3G82A 3OL8A 3KJFB 2D41A 2X51A 2ASLA 3ENAA 3B6BA 2C2MB 1YJ9S 3BS9A 2R3VA 1F9EB 5ITHA 3EDQB 4GC6A 2XSJB 1CEZA 3QT5A 2GIRA 2AP6A 1B7YB 4BS2A 2Y0SD 3N5FA 3ISNC 3ZZ0A 2SXLA 4CO4A 1IBMF 4LIRA 3T9NA 3KLVA 4CI0B 4ED7A 1KQFB 5I3UA 3GZ7A 3DMJA 1WKJA 3DOLA 4G1IA 4QR1A 2AQ4A 4URQU 4XAKA 2UXCF 1KLMA 2C2RA 2W8LA 1JNRB 1QTNB 2W24A 1FRJA 3ZO7A 4A48A 2ZD1A 3LGMA 3QMQA 2W9CA 2VOOA 1NXIA 5CCMA 2MZJA 5GMEA 2F4VF 3ZTPA 3UQSA 3IS9A 3I55S 2OEJA 2QYGA 2DGSA 1LEOA 4CRJA 4MFBA 3LP2A 1U6ZA 4OX6A 3PY8A 3V6DA 4OHZA 2KB2A 3SZ2A 4YB1P 2NLWA 3SFUA 4Q2LA 4CH1A 1U1NA 4ICLB 1LQ9A 4Z2XA 5IQQA 1RWXB 3IBFB 1HWLA 1RT7A 2Z4PA 4DQIA 1NU4A 4RNMA 2H9ZA 1PJ5A 4P2SA 2DJWA 4QR2A 2QE5A 4JI6F 5DLGA 5FJ4A 2F8HA 2AJ4A 2V2QA 3K17A 1ELOA 5DZ7A 3GIIA 1VQKS 1Z1ZA 3QSIA 2YNHB 2MPUA 2RILA 3FC9A 3GIKA 1HQ2A 2LP4A 2FY8A 1EQMA 3TA2A 2ZEJA 3I0RA 2MZ1A 4M8LA 2HVIA 4ED4A 2LEPA 1RT5B 2V8GA 2PO4A 3OR1A 4B9LA 2RSQA 2E44A 2DNQA 1FNMA 4LRBA 2GW8A 2HVEA 5HO4A 1F9HA 3I31A 4AQYF 2FVQA 3Q22A 2V4JB 2HK3A 2W2PP 1Q16B 2QFJA 1L3TA 4DFMA 2GMLA 5F8MA 2OGUA 4WZQA 3OVBA 2V68A 4N76A 4F4YA 1UZDA 1WDDA 2OTJS 3OLAA 3UCZP 4EBCA 1WSRA 2H3EB 3DRRA 2OFGX 3CCUS 4WKRA 3QLHB 4N56A 4Z7YA 4LQ9A 2HKEA 4P71A 2CPDA 3HSGA 1NJYA 4JI5F 4X4VA 4YR0A 2DGQA 1RWKB 4LR9A 1C0UA 1EP4A 4O44A 4DSJA 2R8HA 1N6QA 2DGUA 4PWUA 4OZ1A 3QSYB 3PTWA 3K5OA 5KFMA 3M30A 1X5OA 1H2VZ 2HNZA 5ADZA 5H9EJ 3B82A 1HQUA 1WG4A 1T94A 2UV8A 3V6HA 2HVDA 3FBBA 3MEGA 2HIYA 4OZ0A 2AEFA 3I0SA 1V3SA 3CDBA 4ZIVA 5AJ3J 5HQLA 1P1TA 5KFKA 1ZM9A 2IC3A 2PGCA 3Q2SC 5J1NA 3OUYA 1W26A 4IFVA 3HPOA 4O4RA 2D9OA 4HHHA 1RHUB 4DL0C 1DLOA 4IR1A 2IM0A 2YX7A 5ETQA 3DOMB 2AF6A 4X64J 2PA8D 1LWEA 2B4OA 5LMUJ 2AYBA 2AEJA 2ABYA 2UUCJ 2A18A 4LBPA 3MM8A 3HVAA 1NK8A 3NOCA 3IRXA 2JOQA 1RTZA 1JLGA 1KHVA 2HGMA 1R8HA 4WFNQ 4KB7A 4CLLA 4K5SA 1KSPA 2VFRA 3A13A 1H74A 2D3UA 2JEGA 2E7WA 1HBOA 4M5MA 2OO4A 1CJTB 1N4LA 2DB1A 2LXUA 3RBDA 3I32A 5CXTA 4RO0A 3BDPA 3W2WA 3CCWA 3OTEA 4GC7A 4PG6A 4ZA1A 1P9QC 2VFVA 2FTRA 1FWPA 4XDDA 4PUOA 4NZ7A 4Y6IA 1Y11A 4YB5A 4X4SA 2QL7B 3EE3A 2APOA 2HRUA 2C2KB 3F56A 4CLFA 8RUCA 4C3LA 4JI7J 1JLFA 2FQQB 1TL7B 2JLFA 1YIJS 1JKHB 3KJNB 3OT9A 1FA0A 1HW8A 1FXLA 2CDRB 4F4XA 3BZQA 3PRVA 1NK6A 2HS0A 2VQFF 3C2PA 4NLVA 2M0GB 3DRPB 3VALA 3SMZA 2HFZA 3OHAA 1D0EA 3PYGA 1YX2A 3VR1A 1YBAA 2CQDA 5E5NA 2RD5C 4EZ9A 1BWVA 2C2DA 3G82B 2LQ5A 1TK0A 3ZTQA 1SL0A 3M8YA 3EDRB 1T9UA 3NWGA 2FJVA 3CCQS 3QATA 4ZP9A 3PW2A 3MR3A 2KYZA 3RBEA 2FVSA 1WTFA 3D6MB 1Q7LB 3W63A 1RJJA 1DAXA 5B0GA 1BD6A 1NJXA 4P7VA 4ECTA 1RCXB 3A8JA 3OTOJ 2AX1A 3D7SB 4U8YA 1IBLJ 1VBZA 3VAGA 4DV5J 1U48A 3UD3P 1Y3JA 2BEFA 2CWXA 2DEIA 2ZH3A 1KLMB 4DV4F 2FPHX 4OLOA 2CQHA 2WBMA 4PYAA 2B6AA 1QAXA 3CC4S 3BJYA 5K8NA 2AJ1A 2ZJRQ 3HD2A 1PC4A 1U25A 4CLWA 3DNCA 3AXMA 1WHVA 2ZD1B 2G0JA 3PHTA 3CSKA 1FHTA 1FRKA 1BQXA 1WC3A 4I6YA 4NXMF 3KMQA 3WHIA 2X1GA 2P9GA 4CM2A 1AFJA 2WOMB 3FCWA 3I5CA 2DH7A 5E0OA 3LP2B 2EG2A 1J5EF 2QLWA 3V6DB 3M6UA 4K4UA 1U1RA 4PABA 3IGVA 3BV8A 3TZWA 1RLCL 3QRPA 2LKZA 2CA9A 2HHPA 1HWUA 2Q3PA 1S1TA 1U0SA 4JI3F 4NLWA 4LF8J 2V4RA 1RT7B 4QIEA 2CUYA 5A8RA 4K2XA 3H98A 3ZTRA 1SV5A 3UWTA 4KFBB 2G0CA 3T1YF 2NYHA 4RNOA 2Y8YA 5F8HA 2A2DA 1DZ5A 5EX3A 2YPZA 1X4GA 4DJBA 5CD4H 1FRLA 1NJIT 4K5RA 5C2CA 3MM5A 4DZDA 5T41A 4O3SA 4B9MA 3AA9A 2BJ8A 3HHDA 3QPIA 2RE1A 3TX0A 1K0TA 1TU0B 5J1PA 4JI0F 1LXJA 3V4MA 4OX7A 4WWSA 4B17A 1HD1A 2F4VJ 4OFZA 1IKYB 1MMDA 2H51B 2OPPA 1WSVA 3UDLA 2K7KA 1NK0A 1UEUA 3SEOA 4TU9A 4WTOB 1UZHA 2FJAB 2E7VA 4DV0J 2X7IA 2XQCA 2ZH1A 4G1QA 2VG6B 2UP1A 2NYIA 2LA4A 4AYBD 2VHGA 5GADU 3GV7B 4NCBA 4IQMA 2OH2A 4EBEA 2HBQB 1T05A 4X4OA 2E9TA 3BF4A 3MAHA 4ZVGA 2IY5B 3KLHA 3BGRB 1CJUA 4NI2A 3KK1A 3VVTA 5DRKA 2ZH5A 1HNWF 2HMIB 4ID5B 2GQ2A 2UU9F 1TMJA 4X62F 3H42A 2LDYA 4IYQA 2R7QA 3JB9k 1C0UB 3SFGA 1ZA2B 4O44B 3DDIA 5KFGA 4CYUB 4B3TJ 1PSDA 2B4VA 1WI6A 4YS2A 5CHCB 3ONQA 3BO2A 1RAGB 2BJ1A 4EZ6A 4LQ3A 3EUNA 3CJ8A 1HQUB 4HTJA 1NH8A 2OEMA 5KT4A 1FNXH 2BOPA 5L8RC 4B08A 3KG0A 4ZVRB 2M8HA 3CD7A 3I0SB 4C8NA 3TJAA 3MPYA 1X4FA 2IC3B 5D78A 1KR4A 2C3PA 2BZ2A 5IT0A 3GJRB 4ZVEA 3TEHB 2XS7A 2E5HA 4FXDA 2VC0A 1ZBTA 4J91A 4DL5A 2QGFB 1FEHA 4U7CA 4JI5J 3MM7A 1LWEB 5IC6B 2DR6A 1IJEB 5ETRA 4RW8B 2XB2D 4XTTA 2I0XA 3MM8B 3N28A 4WPAA 5K9FA 1VRUB 1ZAWA 2Q43A 4I67A 1UTAA 4TYBA 3KHRA 1HI1A 2C28A 3A1YG 3NMRA 3K5NA 2Z58B 2B7BB 4Y2KA 1G7CB 1N5SA 1JXVA 1MU2B 2VFSA 2FGCA 4A4JA 2IA6A 3M6VA 1R43A 1S6QB 4ILMA 4UQTA 2CG4A 3LH2S 2EFOA 2NZ4A 1H38A 3AT1B 4PUOB 4Q8EA 2RUGA 1JLEA 1JLFB 2KM8B 3M32B 5HP1A 2RU3A 4TU8A 1RWWB 1S1WB 2DXEA 3CE8A 1KD1T 1VJWA 2YNGA 2KFZA 4OI1A 4ECSA 5EGYA 1BLUA 5E3RA 2ZZTA 2DITA 3QBCA 3QGGA 4QR0A 4TY8A 2MZQA 4QQBA 1G4CA 4R8UA 1TUGB 4U9RA 4Q0BA 1BC6A 1SJ1A 3OR2B 3W8GA 5FDLB 2LXIA 4M1KA 1MNEA 1NKCA 1RT4A 2EFPA 2DNNA 2UVUA 3Q83A 3H4BA 2RVJA 4P2FA 2CNKB 3AXKA 1VISA 2PIIA 4W4MA 5KFXA 3RGIA 3TOQA 2KFNA 3HJVA 1XNQJ 1S12A 2HWIA 2QN6B 1FE4A 3J7Z5 3GIMA 3T5HA 2BABA 3IG1A 4A8KA 1DBDA 1U1MA 3LP0B 2ASYA 3B4DA 2ZH7A 2BR0A 2NPIA 1FXDA 3TARA 3JTPA 5AXMA 2J6UA 2VBXA 1I3OB 2Z0GA 1KLNA 1UP1A 2KL8A 1QSLA 1R8PA 5D0EA 3JQKA 4BDPA 3PRBA 3CDWA 1XBWA 4NWBA 4OYOA 3Q8YA 3MFHA 4CNYA 4FBUA 3CCJS 1D8ZA 2JC1A 3CJ0A 1HBNA 3AOBA 2HQIA 1G1XA 4CLTA 2XZWA 1YQHA 2AD9A 3QJLA 4K50A 2DH8A 4DQSA 2CJXB 4LF6F 4IFYA 3S6EA 5KFFA 2DKOB 1WHYA 2H5JB 8AT1B 2GGPA 2UUBJ 1KQGB 4XIUA 4B9SA 4DR2F 4FPIA 2HNYA 5ETVA 1M1KT 3MD3A 1UVIA 4E2FB 4LFAJ 2CXEA 4ZMMA 3KLEB 1FEEA 4MKBA 3VGTA 1TL4A 1X9MA 1Y5LB 4NMLA 2IYGA 3W65A 2R8IA 3ILLA 1IJFB 4KV8A 2XYHB 4L75A 3KJQB 1CSJA 4DZ6A 3M1VB 2AGPA 4Q7AA 2E1AA 4ED6A 2OP5A 1U1LA 3AODA 4KJIA 4ED8A 1S72S 2UXBJ 3WDOA 3N6MA 4DN0A 1PCAA 4F8RA 3RB3A 4DG1A 3RB4A 1R6YA 2DIUA 3M2UB 3M6WA 1J5OA 3FUYA 4DQRA 3I4PA 4DR4F 2QSWA 2FZKB 1J5EJ 3PIPQ 1D9AA 3RYLA 3G96A 4NCAA 2V4QA 4JV5F 2QEXS 3KXDA 1T95A 4G1QB 4F4KA 4U95A 3MHYA 2DBBA 3H7HB 4YOEA 3CMES 1TV6B 3HLUA 3KLHB 5H9EK 2D9PA 3PG9A 1C4CA 4NI2B 3NEKA 3GQCA 1SH0A 1W25A 1TKXB 3V6JA 1RISA 3W9HA 1RWOB 2P6SA 4IG0B 2N82B 4CTAB 4LF2A 3QT8A 4F2RA 4OHYA 2NSBA 4Y65A 2VV5A 2M70A 4DR5F 4BLGA 1N56A 3CO9A 1U45A 2J6TA 3VV2B 2KZZA 2RJZA 2J8SA 4RJVA 3VHQA 3MUVP 2OPSB 3QO9A 9ATCB 2RQMA 1NH7A 1XC9A 5D0RA 2V0NA 2LYVA 5HBMA 3IR7B 1RHJB 1LWFB 1GX6A 4OYMA 1HR0J 1K44A 4RX6A 1UEVA 4Q43A 1OJ4A 3HHLA 4XDCA 1GMWD 3ZZZA 3CCSS 2VG7A 3NP5A 4H4KC 4L74A 5B7WA 3TAPA 1FD2A 5IT9U 2R7RA 3G6YA 3PX0A 2UU9J 3MM7B 1DQ9A 3TZXA 1FKAF 1HMVB 4JBCA 1F6TA 3TVYA 4AFFA 2J9CA 4PPDA 3RR8A 1RP5A 2ASDA 2HHXA 3K8VA 1UVJA 1FRHA 4B02A 3EXCX 1ZM3A 3NGTA 3PVXA 1XQIA 4DMZA 2EXUA 4JOUA 4CLSA 4OI0A 4LJMA 4KGZB 4OQJA 3TNVA 2GIQA 1W2BR 3IP0A 3JTOA 2CADA 3ICLA 4RW4A 4HL9A 2ZJQQ 4OI4A 4DLGA 2YQ1A 2LU2A 1MN9A 1QAIA 5ETMA 2DCUB 1KRPA 4B9UA 4ECUA 2ZBQA 1R31A 1N36J 1EETA 1VCTA 3OBIA 5HVFA 4OJ1A 3ELHA 2IA0A 5I3PA 2NXUA 1TMMA 4TY8B 1D09B 4CDIA 3M8RA 5LM7E 4P7TA 2QC3A 4R8UB 1IQZA 1RQ0A 3GJQB 4OI6A 3IBCB 3R7BB 4Q0BB 5DQIA 4FYWB 1RT4B 3O5TB 2W2MP 1WG1A 3CJ4A 2O1PA 2ZE2B 2DTJA 4DPXA 3SXLA 2B5JA 2O01C 3J7YI 3AB2B 5LSLA 5LSRA 1KONA 5EHHA 1C4AA 3PR4A 3M9NB 5HN0A 2F9DA 2UV8G 4QWEA 5K8MA 2DO0A 4M5DB 2V9WA 4C0BA 2UXDF 4ZVPB 3MPVA 3VWSA 1IKXB 2DNYA 3RRKA 3O8WA 3OL6A 4MKVA 1LW2A 1L5UA 2EBEA 2O3DA 1V3ZA 3PDNA 1UJ4A 2HNDA 3H90A 4LR8A 3BH7B 4TQRA 1KFDA 4WK1A 2L48A 4NEZA 3UN3A 1E6VB 3CJ5A 1B64A 1GTEA 3G86A 3OVSA 1SQEA 3ZZPA 5B0EA 4N77A 4DL6A 1HBNB 2XMJA 4M5HA 4TLQA 1N48A 2NXEA 1HL6A 5DDRC 3D1QA 4EWTA 4IFYB 3TAMA 4WKYA 1BQNB 4ZN1A 1EB0A 2R7XA 1F2HA 4NASA 1BWEA 1F3FA 2E5JA 2K1RB 1VS3A 5AE3A 4B3RF 1RHKB 3M6XA 2AT1B 2H1YA 3N9UC 2LEBA 3MDFA
chains in the Genus database with same CATH topology
3NGDA 2FLPA 1FESA 3ZC4A 3JSRA 5SZTA 1S6OA 2VH7A 4LIWA 1R89A 1PILA 2FJBB 4MIAA 5IM0B 4I2QA 3R5AA 2EBGA 2UVRA 1YITS 3E01B 3OR2A 2RS8A 2HHUA 3B4MA 3KG1A 4RW7B 3CCES 4JYAF 5FDLA 1IM4A 1TKTB 3IXQA 3PM9A 2IBKA 2RRNA 2BW2A 1Q78A 3MEKA 3S7RA 2KT3A 2MHEA 2OSQA 2QSFA 3IBWA 1OO0B 3H4DA 2KRBA 2FC8A 2YWHA 4YB7A 1VQ6S 1KQKA 2QMWA 4KSEB 2AV5A 1WHXA 1N33F 4DUYF 4FP9A 5EDWA 5LJ3Y 4B9NA 4LSNA 3P6YC 3BREA 3H5XA 4CH7A 2IHR1 2B43A 3M4XA 1VQ7S 5IXUA 4QIGA 1SJ3P 1URRA 4ZHRA 1GTHA 4OZNA 3IWNC 4AL7A 3IR6B 4ILRA 4YDDB 4NRUA 5KG0A 1IBLF 3OHBA 4USIA 3D1OA 2RDJA 3GG1A 1VIOA 4I69A 5A6PA 5MAOA 4I56A 2HHSA 3DXBA 4O4GA 2IAJB 1K9MT 4WXOA 4NLQA 4DG1B 2UUBF 5K8PA 3OXGA 4Q44A 1DQ8A 1RDRA 4DS4A 1S1TB 2IRUA 5E3PA 2CDQA 4FNHA 4A8YA 1X9SA 2FDNA 1JB0C 2MYFA 3S1TA 5KG2A 1HD0A 2ZDPA 4IOBA 3NCQA 5CCLA 3JSMB 2NR0A 3RR7A 1RTIA 1S9FA 4LFAF 4ZVFA 3DI6B 1QJHA 3MMJA 1REVB 3DLKB 2VUGA 5A8RB 3VAHA 1JX4A 1SV5B 3M9OB 1VQYA 2WK4A 3OJSA 4C4WA 2V94A 2IFXA 5KFCA 2QRRA 2DRAA 4YY3F 3OLBA 2DISA 3LP0A 3SQGB 4C98A 1VQPS 5CZVA 1B0PA 3U7JA 1OPZA 2N4DA 4N41A 4QU7A 3F73A 2GCFA 1Z2ZA 3BSCA 1FRMA 5KAKA 2XCPA 4DX8H 1X5SA 1QE1B 1HI8A 2KT2A 1VRTA 3D0GE 3OL8A 1KEKA 1GAOA 2D41A 2X51A 1IKWA 4Y0FA 2ASLA 2DHAA 3OL9A 4MH8A 2IM2A 3BGLA 2MB0B 2MQLA 1RT3B 4NA2A 3MM5B 4DR1F 1YJ9S 3BS9A 5B0AA 4O3RA 1CVJA 3GILA 1X0PA 5HROB 5KG5A 5ITHA 1XR6A 3K5LA 1QUVA 4E0DA 2UXBF 4GC6A 2XSJB 1CEZA 5GAHU 5DG8A 1KOHA 1U24A 2GIRA 2J7WA 2AP6A 2EI5A 3DLEB 3MM6A 2G9OA 1Q1KA 1VQ8S 2ROGA 4BS2A 4NCGA 2Y0SD 1M5OC 3DDKA 3N5FA 4QIVA 3ISNC 3ZZ0A 1IQTA 4N8NA 2SXLA 2JRSA 4CO4A 4H4KA 2N3OA 3GSDA 5CYQB 1X4DA 1IBMF 4LIRA 2ALZA 1K1SA 1NK9A 2KM8C 1S9GA 5M2UA 2OPPB 4RNNA 3MUMP 2RT3A 1N88A 3T9NA 3KLVA 1O8BA 1HYSA 3SV3A 3DOKA 4CI0B 4ED7A 4WYLA 2QT7A 1KQFB 3TUJC 1PC5A 4K4TA 2IM1A 2VG5B 3GZ7A 5I3UA 3DMJA 4ELVA 4MMOA 2B51A 2BRLA 3FQKA 3DOLA 1ZPWX 1D9DA 4G1IA 2RQCA 2M52A 2LQJA 5F8LA 4QR1A 3LF0A 2MJNA 2AQ4A 3O1LA 4C8YA 4URQU 2WHOA 4TKTA 5KT2A 3TR5A 4CQ1A 3PV8A 4TYAA 4ZDNA 4XAKA 2UXCF 1KLMA 2RB7A 5BYSA 4PG8A 3NAIA 3E3XA 2UUTA 1TL5A 3PW0A 2B4UA 3PO5A 3TW0A 2DGWA 4L6V3 5AE2A 1FTCA 2C2RA 4FBTA 2EFNA 4K4XA 3KLEA 1NJWA 4PKDB 2W8LA 1JNRB 3C3LA 1UMJA 3MF5A 4RNHA 2J9DA 1T05B 2W24A 1RTJB 1FRJA 4I7FB 4A48A 3CMAS 3QO9B 4NOHA 4RWWA 2B3TB 3WC2A 3MGJA 3QGIA 2ZD1A 1SJQA 3LGMA 1XEZA 5HBMB 1LWCA 3OFEA 3QMQA 1F2GA 3T19A 3X3UA 2W9CA 3V81B 4ELTA 5C24B 1X8DA 3KK1B 2VOOA 4RU9A 5CCMA 3M1VA 2VL1A 2MZJA 2F4VF 5AXKA 3P49B 1AXQA 3UQSA 2E1MC 3IS9A 4NX9A 3JSBA 4K4SA 2ZOFA 3I55S 3KK3B 2VFTA 2DGSA 1KHWA 1TL3A 2ADCA 3KNAA 1JJHA 4ED5A 2ZITA 1MWYA 4MFBA 1U2FA 1U6ZA 3LP2A 4OX6A 3PY8A 3V6DA 4OHZA 2NUUG 2KB2A 3PO4A 3SZ2A 4YB1P 3QIPA 4NLOA 4RBTA 4IUFA 2NLWA 3U1LA 5U47A 3SFUA 4Q2LA 4CH1A 3TO8A 4I1TA 2VQEF 4DFJA 1YTYA 1U1NA 4LFCF 1TFWA 2AW0A 1H0HB 1RT2A 1UKUA 4ZOSA 1Q4RA 2E5GA 2IRXA 1OPIA 3KNGA 3POTA 1X5TA 4ICLB 1LQ9A 4Z2XA 5IQQA 4N5SA 3H40A 4F4WA 3M2RB 3CCVS 5KFVA 2GQCA 5L38A 5G0RB 1GXTA 2OFHX 2ZUGA 4ZCIA 3M2UA 1S1XA 2QV6A 2PI4A 4WE1B 1FE0A 1HWLA 1OQ6A 1SH3A 4XPEA 1RT7A 2Z4PA 1H2TZ 2QZ8A 3K2YA 2EFQA 4DQIA 1NU4A 4RNMA 4B3SF 4LF5F 2B7CB 4JUZA 2H9ZA 2K2PA 3E51A 2H5EA 4PWDA 4P2SA 4KAIA 1OSDA 3EGNA 2DJWA 4ED0A 2C3YA 3L09A 3K57A 4QR2A 2QE5A 4JI6F 1SL1A 5DLGA 2KDOA 4YUDA 4C9DA 2FLLA 5FJ4A 2FHMA 4WTYA 2F8HA 5G4DA 4FF4A 1S0VA 5J1EA 3I6PA 3CEDA 4H54A 1HR0F 2AJ4A 2JZ5A 2CQGA 1BQMA 3O2IA 5F8GA 1S48A 2POKA 2KU7A 3I5AA 2M8DB 1ELOA 3P3DA 4ZPTR 1VGYA 3GIIA 1VQKS 1Z1ZA 2YNHB 2M88A 2GV1A 2RILA 2I38A 1FVSA 2MPUA 4X4QA 2HPUA 3CJ2A 1TV6A 3GIKA 4KIAA 4ZP6A 5KT6A 4DS5A 4DLEA 4NZ6A 3FSYA 2VONA 3HHNB 2U1AA 5DS7A 1RT6B 3M2VB 2ZZNA 3NNAA 3NMAA 3TA2A 4QOTA 3Q2TC 3MM9A 4X65F 1HWKA 2AGQA 3I0RA 2DGTA 3NCRA 3DC2A 2MZ1A 4M8LA 4IOCQ 2KVIA 2HVIA 2LEPA 1RT5B 4RW4B 3CB4A 2V8GA 4WFBQ 2CPJA 1P27B 2PO4A 2YNIA 2KG0A 1TKXA 1SJRA 2FY1A 3OR1A 4F26A 4B9LA 1Z2LA 5J2QA 2RSQA 2XI3A 2FB0A 1XNRF 2E44A 4HDHA 4EO6A 4R5PA 1QSYA 2DNQA 3I5BA 1FNMA 1X4CA 4WK3A 3IAM9 4IG0A 2GW8A 4CTAA 4N8OA 5HO4A 3I31A 1VBYA 4GKJF 4AQYF 1WEXA 2Z8QA 2FVQA 3Q22A 2V4JB 2RKIB 4I64A 1P8GA 1QTMA 3DM2A 1Q16B 5LL6d 2E29A 4X4UA 1EETB 2QFJA 2XMVA 4DR6F 6FD1A 5HQ8A 1L3TA 2KT5A 2U2FA 4A8OA 1M5SA 5GMKa 3JYTA 4QPXA 4DFMA 1O51A 5L9NA 4V19X 3E8OA 3H2VE 2GMLA 2NUHA 5F8MA 1L3KA 3ENWA 4WZQA 2K8GA 3IGNA 4NLUA 2OMLA 3T6BA 3OVBA 1Y7PA 1GNKA 4FF2A 4N76A 3I56S 4F4YA 1K1QA 5JUMA 2X1FA 2KHDA 2OTJS 3OLAA 5E41A 4DWIA 4O3QA 2A3JA 3UCZP 1KS2A 2A10A 2MKSA 2E5IA 4KR0B 2BE2B 2FLOA 1YG0A 4UOCA 1CC7A 4BC7A 4EBCA 3IC1A 3G8SA 2OPSA 2JDJA 4FYDA 3DRRA 1U1OA 2R9LA 1JJ4A 1PO6A 3FRZA 2OFGX 2ZH8A 3CCUS 4J9OA 4WKRA 1FKOA 3QLHB 3AB4B 4N56A 3FGVA 5CH7B 1LWFA 5KOXA 4B9TA 4IRKA 4WJBA 4C11A 4LQ9A 4HDGA 2CKWA 3PACA 1BGXT 1S1UB 4RUAA 2VPWB 2CPDA 4BCAA 1SJFA 2JC0A 1NJYA 1Y3KA 2JHEA 4JI5F 4IG3A 4X4VA 4A8FA 4YR0A 2PC6A 2DGQA 4KE5A 4U6PA 4X4NA 2XLIA 4DV7F 1HHSA 4F3QA 3DLGA 1HPZB 4FF1A 3VAMA 5IFMA 4OV1A 2DPIA 2I1RA 2DR5A 1C0UA 1JLEB 1Z4UA 4MK7A 3PFOA 1EP4A 3UCGA 5I4MA 3RAXA 1N36F 5HP1B 4O44A 1G6BA 4QWBA 4DSJA 1NK4A 2D1CA 2OAUA 2R8HA 1N6QA 4EGLA 1YJTA 4URGA 2B5JB 4DL2A 2DGUA 3H5SA 4PWUA 4OZ1A 1TVRA 1LW0B 1ZAXA 1S0OA 2YNGB 3K5OA 1R27B 3JTNA 4OJHA 4CNZA 3DLLQ 5KFMA 3M30A 1FKPA 4FXVA 5E7OB 4F3OA 1X5OA 4PQAA 1SKWA 2ROPA 1H2VZ 2HNZA 2I5JA 2W4DA 2ZC3A 1HMVA 4AXIA 3VCDA 2KKHA 3DRSA 2W9BA 5ADZA 3NRBA 3KLIA 1IN0A 1N5YB 4ERDA 5H9EJ 4AE5A 1HNIB 3B82A 1HQUA 2CZVC 2D3ZA 3UW1A 1KQSR 1WG4A 1T94A 3T9ZA 3AQPA 2JSXA 2UV8A 5H9FJ 4QWAA 3V6HA 3FMWA 3DRYA 3NLCA 3U1MA 3IFEA 2MMYA 4LSLB 5HL7Q 3KLGB 1KTQA 1Q8LA 2HRYA 2ZOMA 3MEGA 4FXWA 2GJIA 2BUNA 2AYEA 3OXLA 2V8HA 2YKQA 4J37A 4PG4A 3N0VA 3MR2A 4C3MA 1CQMA 1SUQA 3I0SA 4KO0A 1V3SA 4OZ0A 3CDBA 3DYAB 2CPEA 3NS5A 1SJ4P 5D4OA 2HNDB 1VQOS 5KFKA 1P1TA 2YY3A 1ZM9A 5KFWA 2IC3A 2AJ0A 3L95X 4Y2CA 4B3OB 3Q23A 1R0AA 3G8TA 3TA1A 4MIWA 2PGCA 2ADBA 2BYCA 4EU0A 1M0SA 3FSXA 2DCLA 3Q2SC 5J1NA 3ULHA 1WELA 1PGZA 3OUYA 4C2MA 4PXCA 3SSSA 4IFVA 3CCTA 2GQQA 3CCRS 3MEDA 3HPOA 4O4RA 2D9OA 2K3IA 3OFHA 5HI7A 1V9OA 5GVQA 2CJKA 2F8EX 1FJEB 2YKOA 4DL0C 1HBUB 2PEHA 4J5OA 1DLOA 3L3CA 2E1RA 4IR1A 2GNKA 2IM0A 3THPA 4H4MA 3OJUA 4RLEA 2YX7A 2YX4A 1IUJA 3C46A 3V2UC 2ZC4A 5AXNA 2LA6A 3HVTA 2HHQA 2AF6A 1NJZA 2UVVA 2PA8D 2FJXA 1LWEA 2L08A 1HWJA 1HWIA 1S99A 2B4OA 2FHKA 5HMYA 2WTFA 5L1IA 5EWEA 2AYBA 4K4VA 4C7QA 2ABYA 5DM7Q 2A18A 4E98A 3MM8A 2N7CA 3HVAA 2KZMA 4X4RA 1NK8A 1VQSA 2AWZA 3IRXA 2YNFB 3TAMB 1A6LA 2JOQA 3IG1B 4KTQA 1JLGA 1KHVA 5THWA 3EX7B 2HGMA 4GO7X 5A8WA 4DFPA 1DTTB 1R8HA 4WFNQ 4KB7A 4RWXA 2KTQA 1N8RT 4K5SA 1KSPA 2VFRA 2ZNYA 2M5YA 3FEZA 2XY6A 2YH1A 3BN7A 5JVGQ 2D3UA 4ELUA 4RW6A 4TY9A 1RTHA 3RW7A 1YJWS 1UA1A 1ZETA 3PNIA 2JEGA 2E7WA 3FFIB 2ZM6F 3T3FA 1HBOA 3GR1A 1NKEA 4C97A 3RB0A 2HWTA 2OO4A 1N4LA 3V4IB 3DLJA 3DU6A 4YMEA 2DB1A 3MECB 3MEEB 2LXUA 3RBDA 1SL2A 4OI2A 3I32A 4A8QA 1P6TA 3K58A 5CXTA 1HNZF 1ZPVA 3MXHP 3BDPA 3M8QA 3W2WA 4I2QB 3PHEA 4O3PA 2XMWA 1OS5A 2IMWP 2N7YA 3CCWA 3DU5A 3OTEA 4F2SA 5B0DA 3FEXB 4GC7A 4PG6A 1Q53A 5KFEA 1N5TA 2JEJA 1DJ0A 1ZTWA 2UZAA 4TNOA 4ZA1A 2LDIA 1P9QC 2VFVA 2FTRA 4XDDA 4PUOA 4NZ7A 4Y6IA 3TVZA 2A2CA 5AXLA 1Q82T 4YB5A 4X4SA 1JMTA 2YKNA 3CT9A 3OTCA 3CVKA 4LSNB 2APOA 2XEXA 4MIBA 4CO5A 5KFQA 2HRUA 3RU0A 4UW2A 5D4PA 3SYZA 2MSSA 1NHUA 2RRBA 3F56A 3L7OA 5KG3A 4C3LA 3EYZA 1JLFA 1TKZA 2CPYA 2ZE2A 4LMZA 2JLFA 1YIJS 2DGVA 1FERA 1JKHB 2GFFA 2FJEB 2WRMA 2LLZA 1FA0A 2DHSA 3DCAA 1HW8A 4O4GB 1FXLA 1X4HA 2ACYA 4F4XA 1TAQA 3BZQA 4RUHA 1NK6A 2HS0A 2ZH6A 4EEYA 2HW3A 2VQFF 1RA7A 1WF0A 2GGPB 3C2PA 1FD8A 4NLVA 1E6YA 5DO2A 1HBMB 2CVIA 2M0GB 3DRPB 1WI8A 1RTIB 3G8QA 3G9CA 5A6WA 2IVYA 3VALA 2HNYB 4A8MP 1WD6A 3SMZA 1U49A 2HFZA 4HI1A 2PFFB 3B8HA 4X2BA 3OHAA 2VKZG 2LQ9A 1D0EA 3QAEA 1FDNA 3LAMA 5KT5A 4M5DA 3VR1A 4M94A 2IVFB 2JVRA 4UQGA 1YBAA 4G6VB 4FS2A 1HNXF 4ED2A 2XMKA 1ZH5A 5F3ZA 3ITHA 4EO8A 1GQEA 2CQDA 1IKXA 3CWJA 5E5NA 2GO9A 2EWHA 2RD5C 4EZ9A 4Q45A 2C2DA 3M9MB 4DV2F 1R8CA 3I82A 4DV1F 3HJFA 1MROA 2EC0A 3WC0A 1FK9A 4IDKA 2LQ5A 1IKWB 1TK0A 4IOAQ 4KV8B 1SL0A 1T7PA 2B9XA 3RRHA 2X1BA 1RYRA 3NWGA 2FJVA 3HVRA 3EPGA 2BANA 4J9QA 2M3DA 2KXFA 1Y5IB 2F1FA 2ZKUA 2DNLA 4G3IA 3CCQS 4B9VA 1UWBA 4O0IA 4W90B 4ES1A 2WB4A 5DGAA 4ZP9A 1E6VA 3PW2A 1ZZFA 2DPJA 3MR3A 2ZH4A 2KYZA 3RBEA 4C8ZA 2FVSA 4KC5A 1WTFA 3MM6B 1DARA 1Q7LB 1X4BA 3PIOQ 3MPWA 2FVCA 2JLEA 1JLQB 1FNOA 1RJJA 1DAXA 2CQ3A 3QYYA 4XK8C 5EX0A 5D3GA 5B0GA 1RT1B 4PCQA 1BD6A 1NJXA 4L72B 2ATLA 5KFSA 2HHVA 2CYYA 2ZNZA 4P7VA 1JLBB 2V2KA 4ECTA 3QAUA 5F8NA 1RTDB 1S9GB 4DL4A 1J5OB 2AX1A 2IYIA 4CO3A 1HYSB 3DOKB 1SKRA 2MQNA 4KKOA 3PEJA 5T7LB 4A8WA 1C0TB 2N3LA 1S4FA 1RKJA 2XCAA 1OSCA 4HT7A 1VBZA 4IRDA 2KHCA 2CZ4A 3GFHA 4JI8F 3D1HA 3Q8QB 3VAGA 1AUDA 4ZKAA 2DVIA 1BQNA 1ROFA 5C42A 7FDRA 3CUNA 1N0UA 3UD3P 3GV5B 3KHHA 1U48A 2VASA 1Y3JA 4R25A 2K1RA 4FVMA 1I1GA 2JL9A 2IJFA 5KFZA 4OJGA 4I4BA 2ZHBA 2ZH3A 1S97A 1KLMB 5LSOA 3CXCR 1F5CA 4DV4F 5E3QA