3DOUA

Crystal structure of methyltransferase involved in cell division from thermoplasma volcanicum gss1
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
181
structure length
175
Chain Sequence
b'QLRSRAAFKLEFLLDRYRVVRKGDAVIEIGSSPGGWTQVLNSLARKIISIDLQEMEEIAGVRFIRCDIFKETIFDDIDRALREEGIEKVDDVVSDAMAKVSGIPSRDHAVSYQIGQRVMEIAVRYLRNGGNVLLKQFQGDMTNDFIAIWRKNFSSYKISKPSSEIYIMFFGFKAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Methyltransferase Involved in Cell Division from Thermoplasma Volcanicum
rcsb
molecule keywords Ribosomal RNA large subunit methyltransferase J
source organism Thermoplasma volcanium
molecule tags Transferase
total genus 64
structure length 175
sequence length 181
ec nomenclature ec 2.1.1.166: 23S rRNA (uridine(2552)-2'-O)-methyltransferase.
pdb deposition date 2008-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3douA00
5DM4A 3JWIA 3ERCA 5E1BA 1TW2A 3LBYA 5EMMA 5EZSA 2AOUB 3G2QA 2ZULA 2NYUA 2I6GA 1M0EA 1AQIA 3CJQA 5FUBA 3MCZA 3D2LA 1UFKA 2UYQA 3G2OA 4GC5A 1V39A 4BP3A 2C7RA 5E1DA 3R9XB 3PFHA 5ERGB 2ZZNA 2WA1A 3HCDA 1EJ6A 3NVMB 3UJ6A 3KHKA 3GJYA 3GWZA 3GRZA 5FQOA 4GQBA 2OB2A 3ELYA 3DUWA 4YUZA 4F85A 2YX1A 2QRVA 2YUIA 2ZFUA 3KPWA 4IKPA 2R3SA 3PTAA 3LDFA 2O57A 5BP7A 1YFLA 3EPPA 1M6YA 3FPEA 4XUDA 4HRAA 4RWZA 3FTFA 2ZSUA 4BLUA 5JUWA 1VP3A 4MQ4A 2XYRA 1DUSA 2PVCA 3CJRA 3A26A 3T0IA 4RTKA 3V97A 3EVFA 3FTCA 2O06A 1NV9A 3LKZA 5DXAA 5JR3A 1WG8A 3BWBA 4MTLA 3TOSA 3ELDA 4ER0A 4JXJA 1N7IA 3MHTA 2ZIGA 5KYGA 2OZVA 3Q87B 3SMQA 2EJUA 5C9ZA 5EIFA 1I9GA 3LHDA 3MERA 3O4FA 3FTDA 2NNWB 2G70A 2P7HA 4F84A 3TFWA 3HP7A 5CCBA 3LCVB 3AXSA 3DXZA 9MHTA 3A4TA 3EMBA 3JWJA 1VP9A 3KKZA 5DXJA 4RV9A 3I53A 5EKXA 3RIEA 1L3BA 3LPMA 3FUXA 3IYLW 4ER7A 4A6EA 4KVZA 4ISCA 1FBNA 5BW5A 2ZZMA 1R18A 3HEMA 2B25A 4X63A 5F2NA 4NECA 4PONA 3RW9A 2BR5A 4YUWA 2ZBRA 2PXXA 3HCCA 5CVDA 1FP2A 3R3HA 4BP1A 3FUTA 2JH9A 5K0LA 7MHTA 2FPOA 1D2GA 3NMUF 3UJBA 3VYWA 1SQGA 4KWCA 3P8ZA 4ER3A 2G1PA 2AOTA 1RI5A 2IP2A 3B3FA 1UIRA 3BKWA 3DLCA 5HIMA 5EEGA 5FADA 3DOUA 4CKEA 3SSNA 4RTOA 5HFJA 4PYNA 1MHTA 2CWWA 1ZHFA 2YXEA 3AY0A 3LCCA 4ATNA 3I5UA 2IDKA 4C07A 3MB5A 3OFJA 2ZWAA 5GIPE 2GPYA 1RI4A 3DXXA 3R0QA 1P1CA 2P40A 3ANXA 1JQDA 1G8SA 1ZQ9A 3IV6A 2ADMA 5D1NA 3TM4A 2JJQA 4HGZA 5HIJA 1KPGA 3HCFA 2FK7A 4PIPA 5DTQA 2FHPA 3DXYA 4M7RA 4C08A 5ICEA 5E9WA 5EEHA 1Z3CA 2HR1A 2Q41A 4OBXA 1EJ0A 3O31A 3V8VA 4FGZA 1RI3A 4IV8A 5DM0A 4CTKA 4DM3A 2IH5A 3GCZA 4M37A 2ZIEA 4HH4A 3UJAA 4ZTBA 4AZSA 1OR8A 3G7UA 1X1DA 5GINE 4E70A 1JQ3A 2NP6A 1G6Q1 1WXWA 4QTUB 2AOVA 4POOA 1ZG3A 1AV6A 2OPBA 3UJCA 3KQOA 3JWGA 3HVIA 5FWDA 4R6WA 3NDIA 5LQUA 1KYWA 1NKVA 3LDGA 3E7PA 3C0KA 4C03A 3E8SA 3HCEA 2C7QA 4C05A 4AZVA 1L3IA 5E1MA 2B78A 4RVDA 2FCAA 5K05A 4DCGA 5EMLA 4RTJA 3JWHA 5K0CA 3HCAA 3K6RA 2Z6AA 2P3LA 2GS9A 4KDRA 3F4KA 3KU1A 4FZVA 5LQRA 3KQMA 5LQKA 2DULA 3CBGA 1WY7A 2EJTA 4RTMA 5DM1A 1ORIA 4FP9A 4U7PB 1YB2A 1X1AA 5DX8A 1YF3A 3EGEA 5EQJB 1XDUA 1NW8A 3C3PA 1NT2A 1VL5A 4EKGA 1JSXA 3REOA 4RTRA 2BH2A 2CMHA 5FA5A 2BR4A 1G55A 3OE4A 4BY9E 5LQNA 1JTEA 3KQTA 4YV2A 3SM3A 3CVOA 3ER9A 5FHRA 2FRXA 2ZBPA 1QAQA 4U7TB 3P2KA 4AX8A 4PGGA 4CTJA 3PX2A 3L8DA 3P9IA 4PYJA 2P1DA 4WXHA 1VE3A 5E9QA 5F2OA 1INLA 2V74B 2IIPA 3EMDA 4DMGA 2GB4A 1KIAA 1VLMA 3HVKA 3DH0A 2UYOA 4DQ0A 2VDUE 3ER8A 1Q0SA 4GOOD 3FRIA 3EEOA 2AOUA 2NXJA 4AZTA 4YMHA 3MCTA 2VDWA 3B7PA 4E33A 4GC9A 2HMYB 4DA4A 4BLWA 2OO3A 4RVHA 1L9KA 2JHPA 1VQ1A 3SX0A 3EGIA 5DX1A 3GXOA 5FQNA 5HIIA 3UJ9A 5KQRA 1SUIA 2BM8A 3GO4A 1PRYA 1I4WA 2PXCA 3FPGA 3GRRA 3GRVA 3H2BA 1SUSA 3GU3A 3P2EA 5DLYA 5E9JA 2B2CA 4PYQA 4CKBA 4CXMA 3CJTA 2ZBQA 5C0OE 5K09A 2AVNA 5DRTA 3MGGA 4LWPA 5K0GA 2BR3A 1VPTA 2VP3A 5K0NA 3VSEA 2Z6UA 4AZWA 4FSXA 3PB3A 2VDVE 4HSGA 5FHQA 3HA5A 2AZTA 4KIFA 5KQSA 4OQEA 3NWBA 1KP9A 3PX3A 1SKMA 1ORHA 3LL7A 1JG3A 1RI1A 5HZMA 3KQPA 4KW7A 3UZUA 2R6ZA 3A25A 4R05A 4PIMA 2ONZA 1KPIA 1QZZA 2PWPA 3B3GA 1TPYA 1NW6A 4PGHA 5CVUA 4DKJA 2ZCJA 2O05A 3EVAA 4PYKA 5EKUA 1XDSA 2ESRA 4X1OA 4RTLA 5K0FA 3M4XA 3TLJA 2AN4A 2WK1A 1P39A 1RJDA 3M6WA 4C4AA 2P41A 5ICGA 3UBTA 3EEYA 1EQAA 4MWZA 2I9KA 3FTEA 1JSZA 1RI2A 2JH8A 2IPXA 1ZKDA 2PJDA 3B3JA 5EZQA 3M33A 3TM5A 2JHCA 4CKCA 5H02A 3BWMA 3E05A 3OZRA 1N2XA 3ORHA 4PYIA 2Y1XA 2I7CA 2ZW9A 2K4MA 1KPHA 2PT6A 3QOXA 5HILA 2EFJA 2EX4A 4PYOA 1X1BA 3P2IA 4Y30A 5CVJA 3UJ7A 3FUUA 2LD4A 4QTTB 1WS6A 1BKYA 3G89A 3NTVA 3T7TA 5LQAA 1ZGAA 1G38A 3T7SA 3FUWA 4EKIA 1I1NA 5K8VA 3P9CA 5ICFA 4YV1A 1EG2A 4QPNA 5EG5A 2IH2A 1QAMA 2GLUA 4KDCA 5HEKA 2AOTB 4E32A 1KHHA 1N7JA 3OZSA 4OX9Y 1JG4A 1R6AA 1NBIA 3HCBA 1F38A 4GOMD 2PGXA 5CCXA 1F3LA 4KRGA 3RODA 3OU6A 3KR1A 3TQSA 4ER6A 1NBHA 3LKDA 3KPJA 4V0QA 4YUVA 3B89A 1AQJA 2IFTA 4RYLA 1VBFA 4B17A 4DF3A 1R8YA 2IGTA 3SXJA 4EK9A 1SVUA 3KQQA 3BXOA 3KR2A 4HTFB 1EIZA 3ME5A 4G56A 2OY0A 4PYLA 4RTNA 5CVEA 3SSOA 4GOLD 3FYCA 4OQDA 1WZNA 5EVJA 3T7RA 5LQCA 2ZZKA 4P7GA 4UOEA 3NVKI 3DLIA 4DZRA 1BOOA 1FPQA 2XVAA 3VC1A 4RX1A 2ZVJA 4XUCA 2YXLA 1NW5A 3LSTA 4QQKA 5FCDA 4C06A 5CIYA 2PX8A 2H1RA 1O54A 3GDHA 3LBFA 3OU2A 4F86A 3BT7A 3UFBA 4RVGA 3KPUA 2F8LA 1R74A 3ID6C 4R6XA 3EGVA 1JTFA 3SSMA 3UWPA 4A6DA 3GRYA 3G2PA 5EPEA 2EG5A 1XCLA 1H1DA 3ELUA 3G5LA 1KYZA 2ZLBA 5DX0A 3P9NA 4OBWA 2FYTA 4GOND 4PCLA 3NWEA 4HG2A 2IDJA 4P7KA 4YV0A 4MIKA 3BWCA 4Z2YA 5DM2A 4QDKA 2PWYA 3CC8A 5IH3A 1X1CA 3LGAA 1XCJA 3KR9A 5DTMA 3OE5A 4P58A 4YUYA 1YZHA 2PBFA 2V7EA 3DTNA 3BUSA 2UYHA 8MHTA 3M6UA 2OB1A 4OA5A 3DMGA 2IH4A 3PS9A 5EC8A 4AUKA 3PVCA 1AF7A 1IM8A 2AN3A 1O9GA 3EVGA 4FT4A 1NW7A 3KQSA 3PFGA 3BKXA 1FJXA 3HNRA 3A7DA 5CUQA 1SQFA 3QV2A 5EMKA 2VS1A 1TW3A 1PJZA 2AR0A 3DMFA 3R6TA 4FSDA 3I64A 1KXZA 4X60A 1BC5A 5EHIA 3TKYA 3KQVA 4FS8A 1VIDA 2G72A 3E23A 2PV0A 4E2ZA 3S68A 3SGLA 4M38A 1R00A 4QPPA 2YVLA 2XYQA 5GM1A 2QE6A 3FUVA 1IXKA 3BGIA 3CGGA 3M70A 2UZ4A 2PX2A 1YZ3A 2CKDA 2H11A 2ZIFA 3I58A 4IWNA 3OZTA 4E2WA 5MHTA 1QANA 2QRVB 3G8BA 4RVFA 5EIWA 3GRUA 4V0RA 1UWVA 4X41A 4GUAA 5DRYA 3TKAA 2VZ9A 5F2KA 3GIWA 4GEKA 2QY6A 3P71T 2HWKA 2BZGA 5K03A 4RSRA 3NJRA 2HTEA 5D1HA 5P8WA 3EVDA 5K0JA 2B3TA 1XVAA 5EOVA 5U4XA 5IKMA 4MHTA 1G60A 3IEIA 1O9HA 3BGVA 2XVMA 1RJGA 1R8XA 2CMGA 2HNKA 3FRHA 4X61A 3UJDA 3X0DA 4E30A 3HA3A 3SR4A 2C7PA 1HMYA 1DCTA 5EHGA 2AVDA 5E2AA 1EAMA 3R24A 3FYDA 1XDZA 3G5TA 4PWYA 4R8RA 3TR6A 3PT9A 1DL5A 1QAOA 3BZBA 3DMHA 4L7VA 3G2MA 3A7EA 3WSTA 2GA9A 1ZGJA 5DPMA 5GM2A 4QDJA 3BGDA 2GH1A 3C3YA 3DP7A 4E2XA 1L1EA 2B9EA 4M36A 2NXNA 2AOWA 4YUXA 2KW5A 3EVBA 4Y2HA 5DT2A 1JG2A 3TRKA 3AJDA 2ZTHA 2I62A 3MTEA 2Z6QA 5BXYA 3G88A 3HA7A 4H0NA 3HTXA 1MJFA 4LECA 1BHJA 4BLVA 5G02A 2CL5A 10MHA 4R8SA 2ERCA 3OU7A 3LECA 1RJFA 4P7FA 1XXLA 5DSTA 3ELWA 5B1SA 4EQZA 5HIKA 3P97A 3TMAA 5E8RA 3MAGA 2IBSA 2XBMA 4P7JA 2OYRA 3UA4A 3KQYA 2WA2A 2A14A 2OBFA 1Y8CA 4EMSA 3UA3A 3G8AA 5C1IA 2HV9A 3C6KA 4HGYA 5GOZA 2N47A 3EVCA 2P3OA 4K6MA 1RJEA 2O07A 3CCFA 1JG1A 2Y1WA 1T43A 3A27A 2H00A 4PINA 5LR6A 4GF5A 5DTRA 1D2HA 1YUBA 2GAFA 4HC4A 3HM2A 2PX5A 3LX6A 3OCJA 3MTIA 5CVVA 1HNNA 5E1OA 3THSA 5E8JA 4RTSA 3FPHA 2NP7A 4IV0A 5GP1A 1U2ZA 3CKKA 3EVZA 3P9KA 5T64A 4RTPA 2JG3A 3FPJA 3IHTA 2PSSA 3BWYA 2YTZA 2ZWVA 3FZGA 3M6VA 1KR5A 5EGSA 4HTFA 2NXEA 4O29A 2PX4A 4XCXA 4E31A 3O7WA 3GGDA 5K0EA 5T67A 2C7OA 4KIGA 2QM3A 3EVEA 5LQJA 3M6XA 1NE2A 1M6EX 1QYRA 4FR0A 4DCMA 5K0BA 1YFJA 4QVKA 4C04A 2QYOA 4RTQA 1D2CA 2OXTA 3KR0A 2IBTA 4ER5A 3PLAE 3SVZA 3NW9A 2G71A 3DULA 4LG1A 4PCAA 5K01A 1L3CA 5GIOE 2PY6A 2YQZA 4QVGA 3MQ2A 5GWXA 2P3QA 1NV8A 1G8AA 3B5IA 1P91A 5FULA 4E2YA 1Q0TA 5KS2A 3OPNA 2YXDA 3GNLA 2AN5A 1FP1D 3FPFA 5EMJA 1XJ5A 3NDJA 5M5BA 4QQNA 1JR4A 1XTPA 2AS0A 4PNEA 5T6BA 5BW4A 5FA8A 1B42A 3DR5A 3UJ8A 3AXTA 2O0LA 1X19A 2PT9A 3KPVA 3QOWA 5FWAA 2BM9A 2YR0A 2XYVA 2ONYA 2PLWA 3VC2A 4OA8A 2G8NA 2AOXA 5FTWA 4WVLA 3KPYA 1P1BA 3KQWA 4YMGA 5E2BA 1NW3A 2NXCA 3OFKA 3U81A 2P35A 5ICCA 2P8JA 3C6MA 5CM2Z 5DWQA 1WXXA 3K0BA 2JHAA 4GBED 1JQEA 4XUEA 1IY9A 2E5WA 3LDUA 3TPZA 4CWAA 5HOQA 4EVIA 2PKWA 3AWIA 2UYCA 2OKCA 2ORED 2PXAA 3HVHA 4PYMA 3HVJA 5KVAA 5LSAA 3Q7EA 2DPMA 2FK8A 3LCUA 4FT2A 4LWOA 5DSXA 3THRA 1SG9A 5CD1A 3I9FA 2P7IA
chains in the Genus database with same CATH superfamily
3C1AA 2YNMD 4O6VA 4H0CA 3G2QA 2XDAA 5L45A 1NPYA 2F59A 3E1GA 1Q91A 1OC4A 4RH1A 4DMFA 3A3KA 4U6NA 4L15A 2O59A 4FJ0A 1MIOB 3B9BA 4DHEA 3JY6A 4ES6A 3HCDA 1EJ6A 3K72B 4EYKA 4MPJA 4R0NA 3I0NA 3GWZA 3BTVA 3I4LA 1T36B 5IAEA 1CUWA 3NUZA 5KZMB 2D5BA 5IKEA 4F2WA 4IKPA 1NSTA 2P4UA 3KPWA 2B8JA 5D7BA 5BPHA 2O57A 5FTMA 2WVAA 1XC7A 3K1AB 1Z63A 3HP1A 1U6JA 3NVAA 1Z2AA 2FPPB 1Q7TA 1R6TA 2C03A 2CN1A 5CA1F 5FR2A 1Q7RA 3EVFA 5TF4A 4ZDKA 6CHYA 1FYFA 1LPMA 4XGKA 3KYIB 1OXXK 2H65A 3ML1A 1TVEA 4GI2A 3RRYA 1UKEA 1SR8A 1FB5A 4H0FA 3A6ZA 3ER6A 2ZRIA 1JXMA 1RD4A 2XUQA 3AIOA 4QOHA 4ZCLA 3ENNA 3HP7A 2QJRA 1Y1QA 5CCBA 1CY0A 2H4JA 4JITA 5SY9A 5DNYB 4B40A 1U3FA 1XAGA 1AZWA 2PXHA 1DV2A 2CUTA 5TE9A 3SC2A 3VPGA 2Z2XA 1HT2E 1R9NA 2AB0A 4B3TB 2Y1GA 2QB5A 3IYLW 4GGOA 1RQRA 4B6QA 1DNPA 4M89A 1ESDA 4H7IA 2A0YA 4UVIA 4YMLA 3NT4A 3UC9A 2AJ8A 4BNJA 2Z56A 1IU9A 3ZHSA 4ZFNA 3PRKE 2PXXA 1UJNA 3HCCA 5DLDA 1PFKA 3P2YA 5CVDA 1SWWA 4UBMA 1MABB 2JGNA 1RWBA 3QPBA 1D2GA 1EP1B 121PA 2Y0CA 2R2GA 2HMAA 3H5LA 1SQGA 3VYWA 3WRXC 5KJEA 3R7DA 1XZMA 1YZUA 1F0YA 3T7CA 1K98A 1WF3A 4DV0B 4LK2A 4MCIA 3P0FA 1B8OA 4XCQA 5DIFA 1QR2A 1WHSB 4ATNA 2H2IA 1V6AA 1I3NA 3R5KA 3S27A 1YASA 2H2HA 5JC1A 1QFYA 1ZC3A 2Q2OA 4UUBA 4ZYZA 4X62B 3A0RB 4HD8A 1HYQA 3HUDA 2BFNA 1CHNA 1WV0A 1U2SA 4HGZA 5K3CA 1J9GA 1OB2A 4ZXFA 4NZ9A 3MBKA 2FQQA 3QLVC 1JVBA 4K05A 5SZKB 2F4NA 2DERA 3AKCA 3WKBA 2ZI6A 4KV7A 1DIGA 3ZY6A 4ZZ2A 2GNAA 1PG2A 1RI3A 4FFNA 5FPQA 5TQ2A 4BLPA 4CU2A 4ZEMA 4BLQA 3IIJA 4M54A 2C94A 2IH5A 2F6RA 3KWFA 4L22A 3MK31 2R86A 4ZTBA 5I9NA 4BQQA 2EKQA 3S55A 3SHFA 2R0QC 1VL2A 5CGQB 2V65A 3JQAB 3MC1A 1SG6A 7ADHA 3RSZA 3WI7A 5J63A 3LOQA 3MMNA 4QTUB 3W5IA 1G5PA 5AKXA 1IXYA 2IBMA 4BTLA 3V4ZA 2MMGA 3B3QA 3JSAA 1YJ8A 2FQ1A 5J4VA 4EUEA 1TM5E 3CRVA 1C5KA 3OIUA 1E20A 1PR1A 3IEXA 1QP8A 4MGYR 4QDXA 3CVVA 1BNCA 1YRLA 2J9FA 3A3OA 1RNLA 1Q0LA 2IYRA 2Q4EA 3KZ1E 2VAMA 3ADCA 1TT5B 1M5TA 3QMVA 1Z5WA 4MAAA 1ECPA 3F96A 1N5KA 3IALA 1MPXA 1Z4KA 3TQTA 1HQKA 4LC1A 2FMTA 4F6LA 1CDOA 1I7PA 2O5RA 3NNSA 1DDOA 4LKRA 4ZMBA 1DAFA 3O9ZA 1V95A 1Z2DA 4PPQA 3RFXA 3PNQA 3T5CA 2PVSA 4WXEA 3U2QA 1ABBA 4XEHA 4RABA 3RIYA 2I2AA 3C3CA 3WLOA 1Z5UA 1QMGA 3SJAA 4BJ1A 1VL5A 1ULBA 1I6MA 5C5IA 2QG6A 2CMHA 4F9EA 1G55A 3BA1A 1R0RE 3QX9A 3RJ5A 2Z2ZA 4TMZA 1KH1A 1VCMA 2W6OA 3C8MA 1RBQA 4N6OA 1KR2A 1Q50A 3EG9A 4BNKA 4PYJA 1OXBB 3QYJA 5BSFA 2WINI 2ZRCA 2GBGA 4LPKA 2BFWA 2BM1A 4FYXA 3WISA 4TL6A 3TFQA 1JILA 5IC4A 4TSFA 1JU9A 3WJ2A 3KZXA 1GZDA 2A5FA 1Q0SA 2QSZA 1FP4A 3FRIA 4L28A 1XFDA 2Q8PA 4XWAA 4KK4A 1JSRA 3A9WA 3P52A 4BVJA 1XLTA 1U2RA 1Z0KA 1WBJB 2QDKA 4GR9A 1KDYA 1UEJA 4BO2A 3AT1A 2X42A 4LYYA 4RVHA 1UDRA 1BDJA 1D2EA 3L82B 4WOBA 4Z9BA 2ZBDA 5JFOA 4KYVA 4MW5A 3U7JA 1YQXA 2UUPA 5HIIA 5JSYA 1IJFA 1W6UA 5A06A 3P2EA 2GHIA 3TJMA 3U62A 3KHUA 4WZBB 4JDPA 4CKBA 4DR4B 2D4HA 3Q85A 4ZT3A 5IEBA 3T7KA 1JLHA 4TROA 2NQ2C 2AFHA 4C4RA 3H5RA 3I2YX 4IZ6A 2ODTX 1P7ZA 2WAOA 1H65A 3HA5A 4MVWA 2JKYA 3AHJA 3TOZA 3KRTA 1KP9A 2VR1A 2IYWA 4Z1MA 5JH7F 1FJHA 1G3UA 2YN4A 4J0GA 4KB5A 4EX7A 1DAPA 5U1PA 3KSUA 4YNBA 5HCUA 3X2EA 2W11A 3IH5A 4IXMA 1AKRA 3A25A 3HE3A 2QSJA 5C5DA 2WSIA 2J5XA 4BV3A 2VN8A 3DBLA 1RVDA 2C5HA 2MYTA 4YJDA 3SFTA 1EFCA 3MEQA 4UVDA 5TXGA 1U3WA 1RWXA 5BQ5A 5CLFA 5AW4A 4FQ8A 3GDGA 2VT3A 4W7SA 4CV1A 2W0MA 5ICGA 1M34B 1NVKA 2DFDA 1VE6A 3UMJA 2Q1WA 3LU1A 3ZV6A 4I3FA 4I4NA 3AVVA 1CQIB 1ZZGA 2BF4A 4FFVA 4UEJA 2GKOA 3FVVA 6GPBA 5EZQA 5FNVA 4TUYF 4NMWA 5ELMA 3BWMA 3LK6A 5FOVA 3WHLA 1FFXA 2Y1XA 3DHYA 5JPIA 3QFTA 3EQ6A 5TJHA 4H6PA 1UH5A 2GTPA 4EHHA 2VBGA 4JZYA 2LD4A 1VJ0A 4L4RA 3ZWXA 1YU6A 4P0QB 1NVBA 3VPXA 3FB1A 4Y2PA 2DWOA 3UV6A 4LZZA 1H8ED 3KFXA 1E2GA 3P9CA 4FC7A 4FOTA 1EVQA 4LSGA 1PGOA 5FPSA 5KU1A 2ZUBA 4B6JA 5JT1A 1PNRA 3OX3A 1WZIA 2QJOA 3HI4A 4YJGA 4FB4A 1S3GA 1QX4A 3F7TA 1R2QA 1S7GA 3R3UA 1QZUA 2W2LA 3IPXA 3EQ7A 3DO5A 3REQA 4P3NA 3L7LA 4ER6A 5JROA 3GD5A 3B89A 3SZUA 2CYBA 2EQBA 3AHCA 3H5IA 5FBLB 4HN9A 1TKRA 4RPHA 3E53A 2DBZA 4MYUA 5BSKA 2FR0A 4MP8A 3T3HA 1ZW1A 3RS5A 3VMMA 2DZDA 3Q11A 5EP4A 1LKZA 1XTBA 2PTHA 2VJNA 1SEPA 2C4HA 1AU9A 4AQDA 1BS9A 2Q2WA 1EU1A 1M2OA 4MQLA 1VRVA 5COBA 4Z0PA 1QPBA 3RIXA 2NV2B 2I76A 4EFMA 1M10A 1JE1A 3I52A 1WV1A 1GYPA 1XXHB 1T15A 3VC1A 4TMVA 5A3VA 5KYYB 1G8YA 4KXYA 3GX1A 1N6RA 4XUCA 2PV7A 3EIEA 1JDTA 1UZMA 2JFFA 4LHXA 2WBLC 1NNI1 1AKYA 2YXBA 5EKTA 1Y33E 2EIHA 2DUNA 2GN0A 2PMFA 2FW9A 4OX9B 4XQ9A 4ENTA 3THYA 2DPYA 1N33B 2XF8A 1FY2A 3CWQA 4DA0A 2W2NA 3S5JA 5I4IA 2XUFA 5K3OA 5GY7A 3QEKA 3GFQA 4FNGA 5IUKC 2PWAA 2D5IA 3NWEA 2ARKA 1XE3A 4MR9A 3UT5A 3V34A 4QOFA 3AVTA 4RCZA 3IUPA 4HLDA 2XA9A 1N2ZA 3VKWA 1P3Y1 4MUGA 4RGYA 4QDKA 2V6IA 3IVGA 1X1CA 1YBMA 1RBYA 1U8CB 2H29A 3IDZA 4KFRA 2EFDB 2QUKA 1VSVA 2HCBA 1OXKB 2I7VA 4XPIB 2PLNA 1GTRA 1TTPB 2A9RA 3OZEA 4UM9D 1I4DD 2BDTA 3PE3A 4U7DA 5A9RA 1B8UA 1EKXA 3CB2A 4KZKA 1V1JA 1QO0D 5I7VA 3UPTA 1PV4A 3GJRA 1AF7A 2FPWA 4NSNA 2OZKA 3K0FB 4RV5A 3G1TA 3I83A 5EHNA 3F6RA 1WDMA 3A7DA 5GONA 4FGWA 2A9JA 1H6AA 4KXVA 2QX4A 4M99A 5IFKA 3H8SA 3ABOB 3HH8A 2PH7A 4G1VA 1EINA 2WG0A 4RF3A 4FS8A 3BE8A 1EWTA 4H4DA 5FUQA 4I1OA 5IZCA 1ZA2A 3MIZA 1ZVMA 1XP5A 3R7FA 4TLMB 1M8GA 4JBNA 4PBSA 3D5EA 4HAYA 2QTMA 4R2KA 2GGSA 2F4VB 1G6OA 5I5EA 1ST3A 2GD1O 1R0ZA 3NBXX 3I58A 4L50A 4L57A 3UGJA 4JYBA 4RIGA 1EX6A 2ASEA 3I6IA 1CZLA 2FPUA 3OJEA 3QM1A 4RD6A 5BSMA 3RCBA 1LF0A 4OI0A 3PJFA 1T6XA 2RJOA 4B7AA 3STHA 1A7KA 2ZRBA 1O6FA 1T6YA 1WLSA 5F2KA 4D9EA 3EZ6A 1UBCA 2WIGA 3OIDA 5K03A 3RSLA 4YYEA 1V5IA 3VZPA 3EVDA 1YCFA 3PQ2A 1KH2A 4Z3KA 4GPAA 1NTOA 5JS2A 4C0WA 3IC5A 3LXMA 3UJDA 3VBEA 2HNKA 3OE7D 3OJFA 4ZREA 2Z9BA 3T0GA 5DM60 1K27A 1N9GB 1W87A 3JQ7B 3OC0A 3OQIA 3OVMA 4R7GA 5L4NA 4HP8A 3QELB 3W6OA 2OBYA 2V9ZA 1OJLA 3G5TA 4XOUA 1U4OA 2BL4A 3BDAA 4J1TA 5PNTA 1U2PA 2FPRA 2A0XA 3RIGA 4KXNA 4E12A 2MINB 4DCCA 1J5XA 4E15A 3HCPA 3OCWA 2IOHA 1LVHA 4HLQB 4QJIA 3N2KA 1D5WA 4O4IF 4Q3KA 3WP1B 3SOPA 3OHPA 1W6RA 3TRKA 2WNHA 2C5EA 3IAS6 3Q5DA 1R15A 2H1HA 1C9JA 5FKJA 3GK3A 3U3OA 3WQSB 1U28A 3GBPA 4Y9SA 1ZI6A 4XVCA 1C3VA 4R51A 5LVAA 2OWDA 3DYVA 1U1IA 3VJLA 3DE1X 2WFMA 3PDIA 1X7HA 3ZLVA 5G4LA 5KSOA 4NS1A 2WTUA 3C6YA 2Q5EA 2D6FA 1CUEA 2J5KA 1IVSA 5EIOA 2RAVA 1VMDA 1Z2PX 2E82A 2HNBA 1KI2A 2JJ1A 3UWMA 4TYNA 1UC9A 2PUCA 4HVTA 4CIVA 4QGFA 5EQDA 5JD6A 3QVSA 3JWPA 4LV5B 4RJLA 2W2XA 3E7WA 3QHPA 2I33A 1N36B 3L1HA 4A4DA 2WTNA 3B9RA 2P9CA 2Q3MA 1E7MA 1CDEA 4O4HF 1U3DA 2Q4BA 4LOLA 3MFQA 3A27A 5GJCA 3FZQA 1KSGA 2BDUA 3DOHA 3WOHA 3KLBA 1D2HA 3PE6A 4QIHA 4HC4A 3LX6A 1E5VA 1N75A 4K8OA 3URMA 1E9RA 4X1KB 5LQDA 1G9XA 1NJ5A 3GCGA 4M55A 3O94A 2QJTA 4RTPA 3K4QA 3N8HA 2J4FA 4X20A 4UMDA 3IURA 4PG6A 2PQMA 1XNQB 3HB0A 3LPAA 1RWVA 4KE7A 4WA8A 1GPUA 1ZINA 4EW6A 2J59A 2QAGC 3GGDA 5LQJA 3F9RA 4B85A 3N07A 4MIEA 2F9FA 3GMIA 1J00A 3V1TC 2QYOA 2EWWA 2IZ6A 1BH2A 3HV0A 3HYRA 4RTQA 4RD1A 1E4VA 1VIMA 1EFKA 3NYQA 3T61A 2CXTA 3W8DA 3ZWAA 1CZOA 8OHMA 5GIOE 4BU0A 2IPOA 4LX8A 4BFWA 2IEDA 3U4QA 1JV2B 4W1QA 3A1DA 1XCGB 2GN2A 1DTSA 2PH3A 4RF2A 4DMRA 2B30A 4J43A 4ZVMA 3OPNA 5I9LA 3O4HA 3GNLA 2QX6A 3CQ9A 3PFIA 4U2CA 4WGFA 5FOQA 1ZL2A 3M9LA 4FINA 3IKVA 1OI7A 2JI4A 4MI1A 5BW4A 4V1CI 1D03A 1PN3A 1CZHA 1TJ5A 1X92A 3O8NA 1OAAA 5LA6A 4BMDA 3S8EA 4FHEA 5KJCA 5JDCA 1U90A 1KVQA 2J5BA 2QVYX 3WAGA 2CMDA 3DHWC 1B16A 1JSLA 2HXSA 2JRLA 2ZDHA 3LW8A 1P1BA 4WVLA 3F0TA 2OZEA 3F1KA 2GJ8A 4FGKA 2OAEA 1PE0A 2RAUA 4HV4A 3EZGA 1CR6A 5HJ2A 1XG5A 1RMTA 3RPEA 4ZCTA 4UULA 2ZYTX 2O8NA 2WTXA 3SX4A 1Q1QA 1L5RA 3FSGA 1G7TA 4XUEA 1KJZA 5CTAA 2J67A 4L02A 1ZK3A 3QXHA 3ZI0A 1ZH6A 4ZVPA 2ZJ8A 3TW8B 2J0UA 3Q7EA 3Q9SA 4RM2A 1TC1A 1MJGM 3I9FA 3UJPA 3JWIA 5L3SA 3QK7A 2IITA 1CB7A 1JDNA 4IHQA 4LZJA 1NVTA 2RBEA 3QKWA 4GXRA 5DLPA 1U0RA 1O97C 4TV9B 3O8RA 4RS4A 1XN1A 4HMQA 2DQKA 1LRJA 2DJIA 2FSVA 4G5GA 4TZTA 1CUJA 5BRNA 1V39A 2FLVA 2PFKA 2W6PA 3IVRA 5ECGC 1FX0B 1ATZA 2G1JA 2GPAA 3KJZA 1SVMA 3OQ1A 3UJ6A 1HE4A 3ZEIA 2F3PA 3GRZA 3SC6A 5K8LA 1JDPA 4GQBA 1P5RA 1YRWA 1AUOA 1DKQA 4MTCA 4JSYA 4AU1A 4MK4A 3L8MA 1O96B 1YIAA 1JSCA 1YS4A 2AUNA 3DCYA 3LDFA 1MEEA 1MJHA 4FYPA 4G5SA 2B4AA 2QAJA 1KJ9A 4HRAA 1YT5A 4L6CA 1EFRA 2ZGVA 3O03A 4B3GA 4XVHA 4BX0A 1BIFA 2O2ZA 2YMPA 1M34E 1S89A 1F7VA 4HDRB 1SQ6A 2LDBA 5BOSB 3ELDA 4X54A 3WBJA 1CEQA 1MOZA 4FNMA 3PUZA 4KBGA 2JIZD 3IUMA 2M2IA 1L7DA 5CNIA 1Z74A 5JPCA 1Q3KA 3MERA 4O0MA 3T9EA 5CAEA 4LFAB 2IXDA 5H80A 2YMLA 1V71A 3FA2A 3WGVA 1FNCA 1N8SA 3UUFA 5K6AC 2H5EA 2QUIA 2YYAA 3NHFA 3KLNA 3W2FA 1IUNA 5EKXA 1QCDA 1W88B 2IZ7A 3WWZA 5HKKD 1ZRNA 3KTDA 4AS1A 1NBME 2YHSA 5MN6A 5AW1A 5JCPA 3NAGA 2BGUA 4WXPA 3U3JA 1XZHA 2AT1A 5KX5A 3HEMA 1VPVA 2CNNA 2R7NA 4NECA 3IIKA 4I46A 2RHWA 1IIRA 1QE0A 3FYUB 1K6EA 2FSFA 2I0FA 3IP9A 4PSDA 4EY7A 4Z2AA 3GCDA 4EHAA 4C6RA 3V2IA 2Y1CA 1M5RA 3BMQB 4A9AA 1XQVA 2CLLB 2IDMA 4AVYA 3VYVA 3VR3A 1XAIA 2V7VA 4JBHA 3LUBA 2VDNB 3NALA 1ZONA 4MUHA 4WNCA 3IQFA 3AEUB 3BKWA 4TVKA 5KVQA 1VHQA 2J3MA 3REFA 3D5QA 5CBKA 2YRXA 2ZB2A 1DG3A 5HFJA 4PRZA 1XELA 4TMKA 1J09A 3TSAA 4DV3B 4OP1A 2OQRA 2BWJA 4I4IA 4EJSA 4ZRDA 2R8XA 4D99A 5F73A 1QVZA 2D0DA 1EH5A 1C3OB 1H5NA 1UBLS 4HDSA 4BFSA 5KC8A 2BI4A 2M32A 1DTWA 2I8CA 5ITZB 4RZXA 4NMLA 4EL5A 4LOKA 2XYHA 1FJGB 4KIWA 1SQSA 1RYNA 3BIXA 1XXHE 2X0JA 3DBHA 3W77A 1P5JA 1NURA 2XWBF 4PSUA 1V41E 5EEHA 4ZU1X 2O8FB 3C24A 3V8VA 1RPZA 4D02A 4UMVA 4TYYA 3UJAA 4I50F 2GZAA 5C7OO 3MN1A 4X9XA 2WABA 1OGJA 1CZUA 4U02A 1THGA 5IYZB 2J3KA 2RC5A 2GNOA 3SHQA 2QMZA 3SYRA 1LPNA 1UQTA 2FOIA 3D81A 3B9PA 3EY4A 2V7XA 4D5EA 5M7EA 4REQB 3RU3A 3B85A 1P0MA 1XTRA 1AGRA 2RH8A 4LJKA 2B5WA 3CKLA 3IKTA 2JA2A 4L2IA 4CYMA 1BDBA 3ZWBA 1ZI8A 3OQBA 2C88A 1L4LA 1U7DA 3RVKA 3FDIA 2XB6A 3MNFA 4WEOA 3EC7A 4QATA 2QENA 2G3YA 4RTJA 1B3BA 2G1KA 3VNRA 1OI3A 4NG4A 1F3OA 3FOFC 5LQRA 2RKWA 2C4UA 4MPPA 1NF9A 1WCYA 1P6XA 2VNHA 3RUDA 2OE2A 2HGZA 8GPBA 4GR4A 1QK4A 4R54A 2ZP1A 3DV0A 1KZ6A 3K73O 3PTZA 2W00A 3RV3A 1P2UA 5EE3A 3WMWA 2D06A 2R751 4U39A 1VYVA 1K3TA 2P5SA 2QY9A 4OXNA 4D3YA 2EQ5A 1HSOA 4K9QA 1AC5A 1M6VB 3M49A 3MRSA 4JI4B 4E51A 1GZ3A 3PX2A 1FSPA 4Q93A 3NHAA 2A1TR 1YR8A 4ZV7A 3CUYA 4QUAA 1SNYA 3AESA 1Z22A 1DBRA 1G4AE 2BGIA 5E9QA 3TQFA 3KETA 1LLQA 5JEDA 3KBOA 4DDUA 3B7GA 3M5DA 4DQ0A 2EFYA 2YWCA 4N6GA 3E22B 1FVOA 1ONNA 2QZSA 3QVLA 4Q19A 2GZSA 4EYEA 4KODA 1FTYA 1JHXA 2I29A 1T5DX 3CLUD 3V1LA 4DA4A 3GP8A 3HO8A 3BIJA 4PX3A 3WKEA 4X6UA 2QJWA 3ZDEA 3PCTA 2PQ6A 4F21A 1PZFA 2I6SA 1HDZA 3PC4A 3TAUA 4PZPA 4JYZA 1C2YA 1Z6GA 2QRLA 1AK1A 1RABA 2IRWA 3ZVKA 3OEEA 1TF5A 1OX4A 1XI2A 4BVBA 2OZLB 1ZU4A 2PUDA 4MV1A 1CDDA 1EFLA 3DE2X 2B4TO 1XN4A 2VP3A 3AB8A 3GCWA 4IJ6A 4MR7B 4ENVA 5KTSA 1ZR2A 3CW8X 1R6XA 4GP6A 2HY7A 5KVVA 3ZD6A 3I39X 3LXRA 1D9XA 3QW4B 4EH1A 2RB4A 5BWNA 3S1AA 2NN3C 4ZO8A 2EYQA 3KQPA 3NATA 3KLOA 1A8IA 1A95A 1T0UA 5LMCA 1PZMA 4BO6A 2X7XA 1KPIA 1QZZA 4CR7A 1IY0A 3T4XA 2HBQA 3HKBB 3AR8A 5DW3A 2QTFA 1PIWA 4HNAA 5AK5A 1ZMBA 1RPAA 1PW5A 3IBFA 1P0PA 3ZG6A 1FSFA 4M8LA 2X9GA 4YRTA 2R6DA 3RC7A 2G82A 4M8NE 1TYZA 3ZWPA 4B8YA 2RARA 5AD1A 4C88A 4W82A 5IF9A 2HLHA 4OLAA 2CLHB 3GMDA 3OT4A 1XU7A 3PXUA 3V48A 1V8DA 4MVJE 2QIOA 3LO8A 3W8NA 2P5YA 2IS1A 5B4TA 5C32A 4Y9RA 3L4EA 1C9MA 5EAIA 4R3WA 4S3MA 3GPIA 1KPHA 3M6IA 3PSAA 3LQRA 4WESB 4YP0A 2DFKB 2IYVA 3FUUA 3KTOA 3BHMA 4HLNA 4EGFA 1A5ZA 4LQ4A 2DFPA 4EKIA 1HT3A 1CQJA 5DI3B 3VDQA 2C5LA 8ABPA 2YVAA 1B74A 1E6KA 3FAKA 1AXRA 1EAYA 3JTEA 2QP3A 4B7CA 4YV1A 2WAAA 1X39A 2HMSA 1NQVA 3T52A 2KE5A 5AH0A 3RG2A 3S2GA 4FIDA 5I7SA 1VCHA 1KHHA 2F1KA 2O0HA 5BV0A 5KU7A 1RZVA 1POXA 5B7PA 4J1SA 1HM5A 1ZEMA 1JDVA 4KO4S 4KRGA 4MINA 3C6BA 3QKSA 4WFIA 1DKPA 2GESA 1NMQA 3AYXB 3GN2A 2PGOA 4OQNA 4Y2JA 2P2LA 4YUVA 4BNXA 1BMDA 1SUAA 2D13A 3QSYA 3NH9A 4A1OA 2Y1EA 1TYCA 3UAOA 3AHFA 4Q0MA 3X2SA 3BXOA 5DHUA 4HTFB 1HI9A 4YRQA 4ERNA 4FXPA 1RJWA 4BBPA 2R4QA 2JFXA 2YMQA 4W6QA 2XAUA 5CVEA 2X6TA 5AYVA 3AR2A 3HCWA 1S3IA 3NH6A 1EDZA 2CNDA 3WLKX 2WKPA 1JFFA 1GGHA 2UZ1B 5EYPB 2VQ3A 1SXJB 1J07A 4U0JA 3A37A 3MTJA 4FHCA 5KI6A 4P3OA 3LQ2A 1GL6A 1S96A 5LNK6 2O2EA 1I5EA 1E9EA 3SFVA 1M9NA 4FUTA 3ONNA 4C06A 1NVVQ 2KHZA 2BMEA 3JATA 2JD0A 1J97A 4TT3A 4P0TA 1NLUA 3SF0A 1Y9JA 1BWPA 2X2OA 5U9CA 1O7JA 4M7PA 2I22A 3HO6A 5DBIA 2R4TA 2FNAA 3KJXA 5AJTA 3GRYA 3HJHA 1ZGZA 5HM8A 4W4TA 1H1DA 1VL6A 3OZFA 5AKZA 1AHPA 2OOKA 3G5LA 4FYIA 4GOKA 5A6SB 3VR4H 4AUMA 5JXIA 1TU4A 5FOWA 4QEDA 4GGMX 4W5TA 2JIRA 1QGUB 3X2FA 2ZIAA 3SKYA 1YC5A 1GL9B 3OQOA 1E89A 1L4YA 3OM0A 3ZWOA 2IEYA 4F04A 1FXWA 2AHRA 4RAOA 4Z2YA 4J7CA 2QTZA 3PNSA 5EKDA 5C4IA 1D4OA 1JLLA 1ZGHA 5BO5A 5K51A 4L6AA 2AEFA 5ESXA 5KQGA 3RVJA 4PO1A 4DC9A 1IAVA 3U19A 4C4XA 5H4GA 1CUYA 3UK6A 5EZYA 3M7IA 3WC4A 3L4BA 2WJWA 1B73A 3WRWA 4BVGA 1XTVA 4RETA 3PSHA 4RJJA 1G1AA 1XHLA 4EAQA 1O5OA 1QU3A 1YVUA 3PHJA 3D1JA 1SN7A 4BNFA 1LS6A 1U1CA 4IDBA 5CEFA 4BWGA 1T0JB 1XJQA 2VUHB 5F7JA 2JFGA 1U7ZA 2D8AA 4ZQCB 3PEFA 3RS9A 3KQNA 1UMDB 1QG2A 3X1MA 1B8VA 5GJBA 1LS1A 2XHZA 1WOMA 3GT4A 5AUQA 1Y8AA 4NU5A 1M2GA 4GWKA 2HCTA 3IQZA 4HS9A 4YUWA 5HGXA 3AKDA 2ON6A 1BCRB 2X40A 4GOJA 5DGDA 2QTVA 3FKSD 1ISPA 2VUIB 3EVTA 3B70A 1UBSB 3NR2A 1F5NA 4RVFA 1U0HC 2NQTA 3KZKA 3QUSA 2HK7A 5G0VA 2WG1A 3ND6A 4FMCF 1XVUA 5JH7B 2ZS7A 2BGTA 2HTEA 4ZDIA 3DEIA 1EK6A 4DTIA 4RLQA 2P5TB 3FVWA 2BVNA 1OXVA 1DOAA 2UVPA 1IZZA 3PGVA 3K8ZA 3LC7O 4Y1FA 4JT9A 5M04A 1RJGA 1JHDA 2VIIA 4M86A 1H85A 4YT8A 3EEBA 1DCTA 4MYSA 2AV6A 1Y4SA 3L4SO 3PFBA 2YC2C 4MV8A 2W2VA 4Y2QA 3C39A 3KYDB 4X8OA 1ETUA 5IJ9A 3L5KA 1DL5A 3BZBA 4DOMA 1W19A 3TB6A 1U8TA 2GA9A 5GM2A 1O1YA 2O8DA 2PD3A 1K75A 2VK8A 3MWDA 2IE8A 1Z38A 3O38A 1DXYA 1YZTA 4R1UA 5AR1A 3QX8A 2IUFA 1KF0A 2ZS8A 3VPHA 3UW1A 3EFOB 3N87A 4BFYA 1YULA 3K09A 4AXBA 1FYDA 1ZICA 2F43B 3S99A 1GQFA 2OC9A 1UM9B 3WIBA 4YJ2A 1RQGA 4PAQA 3GRCA 1FYWA 3KOXA 3R9KA 10MHA 4EG3A 4JGBA 1XXLA 4YI5A 3ELWA 4C7MA 4MV5A 4YC7A 4OGKA 1SG0A 3MAGA 1DINA 3R7LA 4P86A 2C8LA 1Z73A 2X8JB 3EAFA 3OF5A 4OUDB 5EJ4A 1Y8CA 1NM5A 1PQWA 1R7RA 3CGWA 3K0EA 3KT0A 4JMPA 4KVAA 3RC3A 3T12A 2WFLB 1WVIA 2P11A 4BNTA 1A3CA 3WGUA 4AL4A 1GU1A 3JASB 5F1YA 4BE4A 4GD3Q 2OCBA 1G19A 4HB2A 3PXGA 4BRSA 2XNDA 4C5BA 1G20B 2N9UA 3AL2A 4C7KA 2DR2A 3M5WA 2GAFA 4D3SA 4BGIA 4CEHB 3OCJA 2C7GA 1NR5A 1EESA 2LP4Y 3QX7A 4G4GA 4L08A 2OBXA 3UF0A 4UQLA 5T64A 2Z4RA 2VJKA 3K35A 5FPPA 1ZY2A 2ZEJA 1BSVA 2D0OB 2HFJA 4IVQA 1X1EA 1QLHA 4OI2A 2PSSA 3RGWS 3UY4A 1P62B 3M6VA 4Y1RA 3TJZA 2QKYA 3WNBA 3KJNA 1CEYA 2ZYHA 4CLRA 2H2DA 4ND6A 4A7PA 3GT7A 1R0SA 1M6EX 1XZQA 1GFZA 3ROZA 2N3ZA 4GVLA 2HHJA 3HZHA 5JYBA 3COWA 3HY6A 2JHGA 1YFJA 4DLNA 4TL8A 4M1OA 2PCJA 4UM9B 1W2GA 3ADOA 4MULA 2EJVA 5JD5A 5K01A 4MVYA 1YVDA 2VDKB 3F71A 5H4HA 3JARB 5GGXA 2VO1A 2P3QA 2BGGA 2C2KA 2YUTA 4UPVA 2FQYA 2W4MA 3NNDA 3CX7A 3B5IA 4OHVA 2C58A 1XTSA 4CKWB 1JEYA 4C4TA 3JZDA 1NUTA 2ZJ7A 2WJPA 1H4VB 3DD1A 1GTZA 3PIDA 3VPFA 5IHPA 3NV9A 3EPLA 4XFKA 3BB1A 4JJ7A 1TQHA 2GD0A 2J4CA 3FBTA 1JR3A 1RMQA 3WHIA 2Q2VA 3L6DA 1E63A 3I42A 3KPVA 1IWBB 1J8VA 1ULUA 3L8ZA 4QICA 1NR1A 4G84A 5HVNA 3WLEA 1KWKA 2XXJA 2CCKA 1IPHA 4A92A 4B71A 4Z7QB 2XKKA 4D8VA 5HW0A 1N8KA 5LMZA 1P4HA 2FMUA 3GRFA 1DDIA 1GN8A 2R5FA 3F47A 4X7MA 4DMMA 2ZJ5A 2LZ0A 4FGLA 3QEAZ 2QN8A 2WTEA 5ESDA 1JX6A 3F49S 4Y18A 3UKDA 2BI8A 2WMNB 4D4IA 3KXKA 4HBZA 4EVIA 3NFRA 1Z82A 4I55F 3MOIA 1NNUA 2MIIA 5G3ZA 4ESHA 1X1RA 3EQZA 1MO5A 3AUXA 4RZIA 2V1XA 4TRJA 5B2FA 1Z0DA 3PGMA 2J6BA 3PX7A 1E98A 4QAQA 2AJCA 1K3UB 2WJJA 4ZVVA 4BZQA 2DSNA 3FNGA 2OSVA 4M1QA 1UADA 5DCWA 4QJ3A 4TTRA 3R7BA 3FOBA 3IQDB 2OM2A 3N2LA 3RU9A 3X1WA 3PFHA 3ZHUA 4U8GA 1IY1A 1LLUA 2WG2A 5L95A 2YV5A 5MN5A 1DBIA 1QH1A 4JP8A 2H0AA 3MD0A 4RY8A 4PXSA 2B20A 1MFPA 1YB4A 2J5QA 3EMVA 4LF4B 3IR7A 1WDLA 4PX9A 2R1UA 2X8LA 3SM9A 1GZHB 2XEDA 2W42A 4RWZA 4HAVA 1CG6A 5TT1A 3AM4A 4BLUA 3A36A 1WSAA 3FSJX 3JQGB 4MS4A 2M1XA 1VPDA 5KQLA 3KSAC 4WERA 3IOEA 4WCFC 4A26A 1YS9A 1V6CA 1WW8A 2Z8YA 1D6MA 3WWOA 1ZPDA 5L51A 3QI7A 4K87A 3M8KA 3RABA 2AEEA 4AMZA 1DU4A 3C7AA 5LWHA 1PBNA 3HUEA 2VSOA 3LHDA 3O4FA 1Y80A 2H06A 3FTDA 4IQ8A 2HXYA 2Q4TA 2VDPB 3C3WA 4TN1A 3WLNA 3GIDA 5BN1A 2VRCD 3HCNA 3HKCA 1JQAA 3OPVA 5FBVB 3DXZA 4C2UA 3RWOA 2PS0A 3QMMA 2GXAA 5DYYA 3FOWA 1LBIA 1N9ZA 3O9MA 3ZDFA 4XLLA 3ZCRA 4ER7A 1S3FA 2WWTA 3F6YA 5DISB 2J7PA 2B25A 2VSFA 1CY4A 3K30A 4HWSA 1XRJA 4KO3S 2PDAA 2FQWA 2QN3A 3I12A 1C3XA 4MICA 2OHIA 2Q1TA 4WK0B 2ZXEA 3R6WA 4HAZA 3WKAA 1DGQA 1LC3A 2FN9A 4EG5A 5D00A 4RL6A 2NT3A 2W83A 2MSLA 1X3SA 2ZSAA 3DKPA 5AM4A 2JI6A 2X0DA 3TQIA 4C87A 4TMXA 1WZUA 2RHLA 3LBNA 1U3TA 3O0TA 4O4HB 4GKBA 4TWZA 1CTQA 1YGPA 3OMLA 4LHEA 5J3JA 1BQ3A 5A0TA 2Y0EA 3DDZX 1KH3A 3EGDA 3KOUA 4XA8A 5C3MA 3MB5A 4YP6A 2ZWAA 3EF0A 4GFDA 3R7SA 4WZ6A 4CF3A 3UMCA 4LAFA 4RHUA 1CERA 4TV8A 2IV7A 1IYZA 2P6NA 4OKSA 5CXUA 2JJQA 5AI4A 2GETA 1SXJE 3RWBA 5BV1A 3A6PC 4Q4HA 4LJ4A 1VGVA 1EFVA 4TRMA 3TR0A 3ZE2B 1Z8DA 5E9WA 3MELA 2H1IA 3CS3A 4JR0A 4NE7A 3UC5A 2ZJOA 4IV8A 4PHGA 5CCDA 1B76A 5ALSA 1ZS9A 3GLUA 4M0EA 4FMBB 3VKFA 2GBLC 4LDAA 1B23P 4RK5A 5JRJA 3PITA 2ISSD 3UYKA 1KMNA 3DV2A 1F6BA 3E3OA 2CLKB 5TV2A 4EL0A 2A30A 3DA8A 4MGZR 1ZD2P 3HR4A 2B7BA 2QLJA 5DK6A 3QY0A 2HEIA 2ZVQX 1XZGA 1WXIA 1O4VA 2IUSA 2H1SA 2Y1DA 3HJUA 3U3RA 1PR0A 2C8VA 1ZVQA 3QE3A 1AKNA 3DBRB 1YB7A 4AN1A 4ZHSA 3NONA 1LU9A 4ZT5A 5KBYA 4LY0A 1P17A 3AHHA 3HRIA 3OUZA 2VJDA 4LSWA 3S2SA 3SZ3A 2Q1YA 5ED0A 2E4WA 3QF7A 4QBFA 3A04A 3QVXA 3AETA 1T9BA 3M34A 4TS3A 2I55A 4ENUA 2CV1A 5EQJB 3L0OA 2QMHA 1DIBA 3QKIA 4R9NA 4NEHB 2AWOA 4O8ZA 4W5JA 3TZEA 2CSUA 1U99A 3AVUA 3DBOB 4YV2A 5KOHB 3ICOA 3AG5A 3OPMA 2FN3A 2PS3A 2QROA 2CXXA 4LMPA 4RIEA 2NUAA 3L8DA 2P8SA 1ONOA 2MMCA 3BQNB 3VKHA 2C4NA 1WDWB 1IQUA 1KORA 3W1VA 2QRZA 4DZTA 1UFVA 2B83A 2XB4A 1NHGA 3HVKA 3R5JA 1D2NA 3KJHA 2C59A 2QT1A 2VDUE 2YIJA 3GRKA 2HMVA 1JWAB 2NXJA 1Z4QA 4YAWA 4YX9A 2UU9B 1N1MA 5FL7D 2JCXA 1ZIPA 2LCFA 3ICCA 1U0FA 3PQ5A 3WK7A 2F17A 4E33A 4WW0A 1FUUA 1Q83A 4OGWA 2E85A 3HDQA 4M1KA 1BKDR 3GELA 3IXQA 4DVGA 4MVJG 3JZFA 1XTKA 2EYUA 1K3FA 1QGAA 4JQCA 3G0OA 4L75A 1PRYA 1Q7BA 1YVPA 4M60A 2AC7A 1ZAKA 1AKQA 2DPHA 2GCEA 5AHOA 2X9QA 4Z5XA 2B2CA 1V47A 2QZPA 2SKCA 2JARA 3DPSA 4LDZA 1N2JA 2P68A 5K09A 3FCOA 4B4DA 2FSUA 2YZMA 3HKDB 4PPYA 2BR3A 5F77A 2JD1A 1OLUA 1K8XB 4E5PA 1J1ZA 1NP6A 5BMVF 3L6UA 4P81A 1A4UA 3WMFA 5CFRA 1QIFA 5IXYA 2XCLA 2AG0A 2BOVA 2QT9A 5CFNA 1NVGA 4V02A 4RXMA 1NU8A 4N12A 4XARA 5AKIA 3DBVO 1RAGA 5EIBC 5ADWA 2YZ2A 1ZGCA 1NW6A 1QHHA 2OQ2A 2AMJA 3H1AA 1MB9A 4KGXA 4EJFA 5EHXA 3U7GA 3QWFA 4IWXA 2DR3A 3D4OA 2VF7A 2ZRQA 1Y3HA 3ZHBA 4ABTA 3KJGA 1LTQA 4Q1CA 3SF8A 5L7YA 2J30A 2VNKA 3RHZA 4URHA 4UNSA 5KB3A 3ND8A 2HUPA 2QDXA 2PZBA 3UIEA 1ZKDA 1AE1A 3ZWQA 1LH0A 1Z06A 3MJCA 1TUGA 2LTAA 4G0ZA 2LBPA 2O4UX 5ALOA 4CQMA 1ATIA 2H1VA 2P75A 3Q40A 4W8GA 4HDAA 1DAOA 1JFTA 1XRRA 3GFFA 2QU7A 1DQSA 4G26A 4NX2A 4Y30A 3BWEA 1G20E 3VR4A 3G89A 3MYRA 2M98A 3LDHA 1KRHA 1Y4UA 2DWPA 1L7PA 3A58B 4FEGA 4NAVA 4BCBA 1BGXT 4CV0A 3GJ5A 1Z2CA 1DKLA 4UHJA 4DMUB 2C5FA 1Y7LA 2VTKA 2WZBA 4YN3A 4Q24A 4Y2XA 1KP2A 1XP8A 2O5VA 3MGAA 4MSUA 3WWEA 5I45A 2IV2X 4LSZA 3Q0TA 3IDQA 4XW2A 1F38A 3REGA 1FDRA 1AGNA 1F3LA 1K7SN 1FLDA 4V0MA 5I5GA 3TQSA 4R8MA 1MG5A 3EWNA 3H9QA 3L9WA 1D0VA 1MVOA 1DJOA 1TZCA 2ZWMA 4LY6A 1VBFA 2IP4A 2VG8A 4B17A 2IGTA 4TWRA 4YCLA 3BBPA 3RUPA 5IM4F 3DEAA 1T6ZA 3GEGA 4N0QA 1C8LA 4I50B 4JVSB 5IT9A 3KR2A 1TMKA 3BD7A 4G56A 4EG1A 3DL2A 4U9HS 1ISJA 1PFYA 2QR5A 3CM0A 1FLNA 3N86A 2EQAA 3KSMA 3H3FA 1XQ9A 3FOAA 2FLWA 5EVJA 3UQZA 3LK7A 4DZRA 1BOOA 1KO7A 1GXSB 2ZRLA 2AIRA 2YJZA 4UARA 1PG5A 2QD1A 2ZSHA 3ESCA 4DNPA 3HXMA 4MCJA 5SYMA 1POWA 1V6SA 1Z18A 2ZVJA 1W0JA 2P6OA 4JENA 2FR1A 3IBYA 1EBFA 2AR7A 4RK4A 1FVFA 4X00A 1V16A 3A6FA 2X19A 4WSOA 3CINA 1BGVA 2PAFA 2PGIA 4S1VA 4JYCA 2WQ7A 2Q6KA 4LN1A 1MB2A 1T8UA 3UFXB 4ZWNA 4CL8A 4C2TA 3NGMA 4MVJH 3AF5A 2OECA 4GSYA 3F7OA 4LRUA 5I4BA 2B61A 1N92A 1NPDA 3ZK9A 1QIIA 3DL4A 4YV0A 3EK2A 2IY8A 1RS0A 3T5MA 4ZQFA 1OZ0A 3I2IA 2VJQA 5DTMA 4F56A 5HJ5A 3JSXA 2HSGA 5CA0A 5A9SB 5E6SB 4U2BA 1C29B 2VPWA 3BUSA 1FFEA 3TEJA 1LBQA 1FU7A 2F9LA 2V7GA 1FRZA 4EYQA 1SCKA 1E3TA 5BVGA 3QBTA 1QS0B 4E0BA 2XUKA 4QBHA 1CY7A 2VQEB 4FEYA 4EY5A 3B36A 1GL7A 3FI0A 1SVWA 4NLLA 4WV3A 3NOQA 3V8NA 2CCJA 4ZJYA 1FJXA 3AFOA 4WMLA 5IDVA 4R40A 3R6TA 4BNDA 4XDGA 2Q46A 1GTJ1 4OHYA 3KQVA 3VDMA 4QELA 2I65A 5AVSA 3F3SA 3SDZA 1LLDA 2QW0X 1P44A 2BFPA 1T36A 4QTXA 3A1TA 3VKVA 1UBFA 4A0GA 2VDWB 2PX2A 2B94A 3LF2A 5EWMA 1UK6A 3SR0A 3MWGA 3K1AA 5BXQC 2I03A 2ATXA 2A58A 4RZ2A 1IN6A 4L51A 1UWVA 4OB8A 1UP7A 1ZCZA 2WFZA 5AQ1A 2VZ9A 3KHSA 4XVRA 5J1TB 4DW8A 3NLLA 1P4GA 3IT1A 2F3QA 1LCIA 2HHCA 5FYQA 1L4EA 2F64A 1GTL1 4UHKA 2HHHB 5AICA 5ALTA 5HWSA 1K7EB 1ACLA 4KPFC 2QTBA 3ZJ4A 2RAFA 4DIKA 1R1DA 3GZJA 2PH5A 3JVDA 4GSKA 4EI8A 2W93A 3O8OB 4X7BA 3HA3A 3ED5A 3UATA 4QGSA 4AM8A 2Y71A 5K0SA 1E1YA 1X74A 2Y4OA 4OXYA 4FOOA 3GLKA 1T4DA 4I1IA 4ASUD 3WQBA 3NM6B 5LBTA 4DLUA 4FW9A 4ICIA 3RS0A 4KH0A 2A9VA 3UMSA 1NT4A 4PLGA 3RO7A 1KK1A 2ENUA 2HW8A 2ZYGA 4AXXA 3H9CA 2YWFA 5JISA 1HETA 1XJCA 3PK0A 1JG2A 4M9CA 4C4SA 4L8FA 1VOTA 3ANSA 3MCVA 4HDOB 5IH7A 4GKVA 4J07A 4NI5A 1MABA 1YC2A 4HNTA 3D2CA 1QVRA 3I9V1 1QRAA 2COKA 4DREA 4ZPXA 3T0FA 2YS7A 1S2LA 4QRDA 3MCUA 4QPJC 2WTAA 3AUYA 3D6FA 3AJEA 2FA9A 1EX7A 3DKRA 1WO8A 4GX0A 3T1YB 4NONA 4D25A 4YY3B 3B60A 2CXUA 3G02A 1UBTS 4F72A 3K0AA 5LLTA 1WHSA 2IYZA 2XHEA 2FFBA 1IXRC 3CTPA 5F12A 4CV3A 3LRTA 4EMSA 1WEHA 1N2SA 2O3UA 1P60A 1IJBA 2YZGA 3A28A 4ZARA 1T9DA 1ZU5A 1Z7GA 3SOZA 1BWQA 2H9YA 2Z5FA 1HXHA 4Q4JA 4A8JB 3CZRA 2RJ3A 3BSWA 4MKRA 4PR0A 1IMJA 1SULA 3Q3HA 4DBVO 5BSWA 5JMWA 1JXOA 3UWKA 5EHQA 1E0DA 3D64A 2VRNA 1GD1O 4ZQHA 2XUHA 2CUNA 3T5DA 3EC2A 1R4ZA 3FPHA 4IYJA 4J4TA 1FX1A 1PZXA 3KDAA 1IHYA 4UNRA 4DVJA 4NFLA 1SXQA 1FE8A 4UNNA 3KDPA 4B2PA 4IHKA 4K1XA 4L3WA 4E09A 1D4AA 1O6GA 1MGPA 1HOTA 5EP3A 3JQAA 3EAGA 4K0KB 1O57A 1LA2A 1OTHA 2JBAA 4FDVA 1M0TA 4YK7A 5CG2A 5JXJA 3L7BA 1B0UA 1ODFA 4YMUA 1XZEA 5BQPA 5EJ9A 1GNRA 3UOAB 4H31A 2NTYC 3IOCA 4IFIA 2XE6A 1KI9A 3HR8A 3HLYA 2QX9A 2PBRA 2WQ6A 3FKJA 2W6IA 3MQFA 4YROA 4L9WA 1NJ2A 2GFQA 1SCIA 3MQ2A 1TT5A 1RLUA 4DN6A 3K15A 3DOOA 4V0KA 2BMAA 3WLPA 3UK2A 1MP0A 4F9GA 4ZEVA 4R1SA 3AVXA 3K5HA 3OZBA 4PYRA 2G80A 4ZVNA 1DQYA 1W2HA 3ROKA 3Q2KA 1KJWA 5F52A 3DHEA 2HADA 2HJ9A 3PCRB 2IY9A 1VYUA 3CA8A 4QTZA 3ZDDA 5DK4A 4JV5B 3E1KA 3DDSA 1YZNA 4YB8A 2QWXA 4ALJA 1JHZA 4ZI3A 4HI0E 4HVAA 4HX5A 4N8EA 4B5KA 1YB1A 4UQPA 4UZSA 1DDGA 5JZ9A 4IMJB 3QWIA 3DXFA 3L1UA 3WZLA 4AJHA 1B0AA 1EGHA 2Z98A 1H9BA 3FNBA 3L7IA 2P8JA 4U2KA 2GFHA 5DNVA 5JU6A 1A50B 3KJFA 4MWSA 5T4FA 4CMBA 4X1YB 2KJQA 4JKYA 4U7HA 5TPZD 1E1MA 1NUUA 3AHDA 3HZRA 3HVHA 3ZD9A 2O9JA 3F9IA 1JBEA 1ZJJA 4DPLA 4RJTA 1A8PA 3AEZA 2Z4TA 2FRVA 5DHSA 2HCFA 2RHRA 2P7IA 1V1MA 4TWIA 5E1BA 3HXPA 1XF1A 3ZS8A 2AOUB 4RK1A 3VYSB 2HD4A 5E9AA 2FXVA 2JLSA 1THMA 3VPAA 4GX5A 4YAOA 4AO6A 4PPFA 2AR9A 2QI9C 4QO7A 3CE9A 1ECBA 4QJ5A 4FZ5A 4L7QA 3IB6A 4X8HA 3HLTA 4QQRA 4WZBA 1RAHA 2DCUA 2MHCA 2RGAA 2XQFA 3LWNA 4Q18A 4U3JB 2W5UA 1I7QB 3GY0A 4MUEA 2REOA 2J32A 3DL0A 4B3CA 1P2DA 1SUWA 2DKOA 3GLGB 4HN2A 3RVQA 3ESYA 3AKYA 2ZVPX 3HSKA 1OBOA 3C41J 1RYZA 3RJ9A 4G89A 4F9TA 2COEA 3NC4A 4OU5A 5J5VA 2WHRA 1OILA 2G4LA 2VXBA 3FE2A 3KKEA 3A26A 2R11A 4IIJF 3QUBA 3V8QA 1CJUC 1Y3DE 3U4DA 3V32A 2V9PA 4JOQA 4BMPB 2ZIGA 2C1XA 2D1YA 2VXOA 1YR6A 2W8BA 2WOJA 1I3LA 2PRSA 1D5CA 2EJUA 3C6ZA 1NOKA 3MLBA 2AK3A 3NHSA 4LOHA 5C9ZA 3FROA 5JANA 3X1XA 1VJRA 3R8FA 1NN1A 1X7YA 2R6GA 2GCIA 4X7PA 3CLKA 1NYRA 1KKUA 4TLCA 2HA2A 1CQIA 1QSGA 3I2GA 3PF8A 4NY1A 3ASYA 4B8WA 1JHYA 1H3FA 3E0XA 1I7NA 1VI2A 5ESWA 4LGYA 2A0FA 1TZBA 3FPKA 1YDHA 2BPOA 3OHSX 1Q6ZA 2VHYA 3I3OA 1ZFNA 3ORSA 2FWAA 3ON5A 3PXBA 4OAPA 4RZSA 4G9EA 5LCXA 4EB6B 4ZYXA 5A5GA 3BXHA 1E4OA 4KVZA 3V2UA 1GZ5A 3NDPA 4IUCS 2EKDA 2PFGA 5BQXA 3RFFA 1DXOA 3WBKA 2VHXA 3GEHA 3QVTA 4TMWA 4W5OA 4L4UA 1KTIA 3KX2A 3IXMA 3WV4A 2C4MA 2J0VA 4TYQA 1KU6A 2HRCA 4JJFA 5HYVA 3HK2A 4BO1A 2ZPTX 2OXFA 2XMGA 4RKYA 1IUPA 1E7WA 1SXHA 4Q4AB 3I04M 1OLXB 2QM7A 4Z0HO 2BEWB 1UIRA 2Q3BA 4FR5A 4KCGA 2R8RA 4BTVA 1E5QA 1P1JA 2D74A 2JFPA 4BE7B 1ZHFA 4Z99A 5KWJA 1WD7A 1OCEA 1MAVA 3IUNA 2GYVA 1ZL0A 2PZKA 1IEWA 1WCWA 1XTQA 3EUAA 3LLUA 3NUGA 3OFJA 4H7HA 4OHUA 4B3XA 3NWPA 1RM3A 5J2TA 1JU3A 1GWNA 3FMFA 221PA 3KE8A 3LE8A 3V33A 3CUUA 1JNXX 2QR2A 2BCGY 1KPGA 2FSPA 1I6LA 1V48A 2NO1A 3HABA 4KVGA 4P31A 4U7JA 3S4YA 5J58A 1TFUA 3BSSA 1GCAA 1JG7A 1XZBA 3MZ0A 4G5QA 1LPAB 1XRSB 4JELA 3OE1A 1TU3A 3KE9A 1NF8A 3PQDA 4EDHA 2BKEA 1MAHA 2CYAA 1USUA 4ZP1A 1CUHA 2GCOA 2RAPA 2D2FA 2YWJA 3WAKA 2A1TS 3L6EA 5KYYA 3ZZNA 1E3JA 2XSZA 1U04A 3PYMA 1UJCA 4MLDA 3IAM1 3IGFA 3A8TA 2ZWIA 2HSZA 2GMWA 2L0XA 5JY1A 4LNHA 3WGKA 4JB0A 2FX2A 2W6JA 3K8YA 5AHKA 5FWDA 4HGNA 2XWQA 4Z0NA 5IAJA 4AC9A 5LQUA 1T1RA 2ZSJA 1Z5OA 3TTVA 3E8SA 5B6PA 3G7NA 4YJFA 4EYGA 2TMDA 2B98A 4M2LA 4YT4A 3HYLA 1DBQA 4IAOA 3A6HA 4RA6A 1PJAA 4G8JA 4Q3CA 1K1EA 4WOCA 3NC1C 1GFWA 3HSYA 4G1BA 2JGJA 4EYSA 1YA6A 1SBCA 2CE2X 2Q7XA 2VWPA 5D01A 4ND3A 2QSYA 2H4ZA 3O8DA 1MIHA 3C6QA 1VCOA 4M1YA 1V3TA 1OFIA 2FWBA 5KJFA 1SZDA 4IUDS 4NQRA 4QDOA 4Y9DA 3OZXA 1QTNA 2B1JA 1M67A 2AG8A 3ZIUA 1GPAA 1M2NA 1R6UA 2FUNB 1ADCA 3QXXA 5FA5A 4FU0A 1S9HA 2EBHX 1L1FA 5BUQA 5BVHB 1QIMA 3WGHA 1SA0A 5FUWA 1YQ9A 3CVOA 4AIIA 2I7TA 3K0FA 3QENA 4EFNA 4ZQEA 1QAQA 4YRSA 1XHFA 1L5NA 3UMFA 1EM6A 1IG0A 2A35A 4UAGA 3HB4X 4D8XA 1A96A 2ZRMA 5B6IA 3M1LA 5D86A 1GADO 2DU8A 3WRYA 3DFFA 2C3UA 5IJWA 1J8QA 3ICEA 5FP0A 3W79A 3ILVA 1P4JA 1Q1AA 1ZWLA 1IEQA 3ER8A 1UXIA 4RMJA 2XCIA 4UNPA 3CZ5A 4ND1A 3VR2A 4BMYA 2O3TA 2NW6A 4YJ3F 1N0HA 1Y34E 1OAKA 2BFAA 4UKDA 5BSEA 3QLUA 2GN6A 4OK3A 3F5MA 2QN9A 2RI1A 4KQ6A 2YL2A 4OK6A 4R69A 2OAP1 3SHWA 4DLYA 1G42A 5IJXA 2OLEA 2VYCA 3M4NA 3OG9A 5CDGA 3HA2A 4FCTA 1GT91 3MWLA 3M0EA 2HUNA 2PA3A 1L6IA 2XI4A 3ICWA 1XDBA 3JYPA 4FONA 2UAGA 3MGGA 1PL8A 3F5FA 4I5DA 1TZKA 2I54A 3D8BA 3E3MA 4CI0B 5JDIA 2R47A 5AK0A 1N9GA 1YQTA 4RLFA 2C2WA 3EG5A 4EGQA 1MG0A 4DLSA 2Q5OA 3DMNA 1QCCA 1C1XB 2YBEA 1M2KA 1WWKA 1TK3A 1US8B 3CNEA 2C8KA 2W2OA 1M7GA 2G0AA 3UZUA 1N2CA 1FTGA 1SUPA 1RRVA 2MINA 4PGAA 3DAFA 2ST1A 5CT9A 5A02A 2QLBA 3E7XA 5DI9A 4BLOA 3H18A 1RFLA 1YOVB 4FQ5A 2XGMA 3QFCA 3GQBB 4XXHA 3KOYA 1FS6A 1AK2A 4F9FA 1JSZA 2ALJA 5CYOA 2VF4X 3R77A 4R8VA 3SE0A 4UBJA 1HL3A 1EE2A 1EVJA 1O97D 5C7IO 3WL6A 5EIXA 2FDCA 3INNA 2P4EA 2I7CA 4Q5IA 3SZGA 2ZW9A 2NO5A 3OOHA 2O7SA 2PT6A 4C0HA 4ZK2A 2EFJA 4PYOA 5F3RA 1HZZA 4PW0A 1W8IA 1X13A 4ZALA 2G9QA 1GQRA 1H42A 1TUIA 1VIYA 2FF5A 3FBWA 4GBGA 5BNWA 1RKVA 4UOQA 3WIEA 1L0BA 5EXEA 3NWJA 4FEAA 4LV6A 5ERXA 4YRLA 5E7IA 3SYLA 1Z6TA 3VZDA 5K8VA 2WT8A 1SHUX 3IQHX 5AVQA 1IOVA 4B31A 5FD8A 2FF7A 3BD9A 3CKYA 3R09A 4PC3A 1XA0A 3TEFA 3F5QA 4CKZA 5HZGA 1DC6A 4X1KA 1JG4A 4KQMA 2VHVA 4LTNA 4PZ0A 3KB6A 3OT5A 1FFGA 1DEHA 2IPNA 3D4LA 4ZVSA 2Z09A 3CSDA 3RKUA 3V2HA 1NBHA 4JLKA 4QXMA 1FSZA 3VU0A 3TNJA 3ZWKA 4HPJB 3COSA 1QDLB 3SWWA 4X65B 3SXJA 4EK9A 3A1EA 1KDOA 4JC5A 3I1IA 3MM4A 3T35A 1LWOA 3TTWA 3C5WP 3DB1A 2CFIA 2GEFA 5KSPA 4ARZB 7REQB 1E9CA 3H1EA 4DUYB 3VDXA 4RAQA 3L0ZA 1IBRA 5FJJA 4AP5A 5BUCA 1U0GA 1WZNA 3C7DB 3EXHB 3T7RA 4JQZA 3KALA 2WU1A 4RK7A 3FMGA 2ZQZA 3ZLJA 3SAJA 2WUEA 4JJAA 2X41A 4LA4A 1G7SA 1UPXA 3STXA 5I48A 1P4RA 3IPCA 5JVDA 4H27A 5JNUA 1G5TA 1RLOA 2WSBA 4DIOA 5GZ1A 2HDOA 3CRNA 3D1LA 5BR1A 1H5QA 2FH5B 2ZQYA 4ITRC 4AYXA 2DQYA 3G2PA 2C9YA 1YUNA 1A4XA 4F1JA 2EG5A 3RAGA 1GGKA 1KQNA 1WEKA 2FE1A 4D56A 1L4HA 1O0SA 3I8SA 3LVQE 4RFLA 5DX0A 3RYCB 1XALA 3WWYA 5B1YA 4AKSA 3RROA 3AM3A 1PJ3A 2O2GA 4EX6A 3IODA 5LIRA 5C1OA 1U8AA 5KTMA 3L4JA 5BSVA 2NZ2A 4BNIA 3A9RA 3IP6A 3NIDB 3ZY3A 4BRWA 2H0QA 4DV7B 3FOCA 2R66A 2GPBA 4KR6A 3FNEA 3U3KA 4JBGA 1T1IA 1JHVA 1P19A 2I34A 3KOOA 4BKPA 4B44A 2GAIA 5IXSA 2JW5A 1BGWA 4HQFA 4H7JA 4JBLA 3A9CA 1GR0A 3VV2A 2C7BA 2UYHA 2OB1A 4TTSA 4KYTA 3QLJA 3A1WA 3TRFA 2IW3A 1IULA 2NUTA 3NT2A 2QUJA 3BKXA 2VQSA 4GU5A 5HK8A 4B47A 3GT3A 3RJZA 4EVSA 4KXQA 3UB3A 1KYVA 1T4BA 1VKZA 2ZB3A 4IX1A 3VHXB 1FX0A 3NDRA 2GZ3A 4LF5B 4TQ9A 5IN5A 2YFHA 1JFLA 4DRYA 4IRUB 1ZNXA 2PV0A 4KHZA 4MUIA 5IT4A 1BZYA 3L8HA 1KDZA 1FRFS 3PJRA 4UCXA 4CNQA 1ODIA 2G0TA 1CF4A 3HDYA 4ZEOA 2X2EA 4GPTA 1PFWA 1IXKA 2ZOSA 3UEOA 1WB4A 4MV0A 1YZ3A 1P18A 1XDGA 3RTAA 2QD3A 3WA6A 1NX9A 2D5CA 2YHBA 2GEUA 3GRUA 3GJSA 5DGIA 1T24A 3LKBA 3O9VA 1GRNA 1IK6A 1FMCA 1OBCA 1WMSA 2WHEA 1P2SA 2FPSA 3CF4G 2XQIA 3BH7A 4BZPA 4R01A 5CCEA 4DRXB 3TBHA 2ZG6A 3X1ZA 1MHPA 1GA4A 3K6SB 2FPKA 1OYVA 4Q4CA 3BWDD 3HBJA 3LNTA 1BEZA 5U4XA 4DUGA 4EIWA 5AT1A 1BEUB 4ZZ3A 3RSCA 1WJGA 2Y6UA 2IEGA 2JZNA 3NFYA 3SQLA 2ZI5A 4GECA 5ITVA 2G0NA 4BMXA 3IP7A 3RREA 1FS5A 2AUMA 5I47A 3V8MA 3OJLA 1EYZA 1U28C 1ACMA 1U63A 2YRWA 4E88A 4KKXB 3TR6A 4ALMA 1AOXA 4ZYYA 1P8JA 1KO1A 3SZRA 2BTQA 3NP9A 2C9OA 1TNDA 1ZGJA 3R1IA 2WM3A 4QDJA 3ZNOA 1YKFA 3M6MD 1W88A 5B3JA 4W5RA 5DTJA 1GAJA 2ZJ2A 4LDQA 1MJGA 2ZB4A 2ZSBA 1T5TA 1CETA 2GN8A 2IZZA 4RM3A 3SQOA 3LUJA 4TXHA 1JMYA 3MOSA 2AG1A 3PXAA 3QMWA 4LJ6A 2HI0A 3CNHA 1E3WA 5EXPA 1PWHA 3ETLA 2W9XA 3AVPA 5FBKA 1A82A 1CNFA 4H18A 4B35A 4BX3A 3BMQA 5U4QA 4ZMRA 3AL3A 2QJFA 2QPLA 3RSQA 3PHCA 1OXMA 1ST2A 3JZMA 1NULA 5CRIA 4R1MA 4R8SA 1P1KA 2B8WA 4Q1DA 2ZRKA 3AEUA 3IPAA 1UM8A 1CULC 4HQ0A 4Q9DA 3OUTA 4DILA 3GVHA 1L5FA 5JAIA 2OG2A 4JN6B 4PLZA 3KJQA 1I13A 3N7AA 5C1IA 3TDNA 1Z6YA 3DGEC 4IX9A 3VR6D 3BJZA 1ZM4A 1NW4A 3CF6R 4IDNA 1QM5A 3QA3E 4IIEA 4KRXA 5J4LA 3WGMA 2CBXA 4JXZA 1YUBA 1JA0A 4FLFA 2C2GA 2OT3B 3DAYA 1L8OA 4G0XA 1SK8A 4Y6QA 3RYIA 3THSA 4AT1A 4EO9A 1RXWA 2CL0X 1JI0A 1TZ2A 2JGLA 4ZAZA 3S2ZA 5KSWB 3CKKA 1GUAA 3P9KA 2PUEA 4U6SA 5T3YA 4B6FA 4MRVA 4P3KA 3C3MA 2NXEA 4PFKA 1VB5A 1MTOA 3ZY5A 1R0WA 4KDEA 2QMUA 2VPQA 2XRMA 4LHSA 1L9XA 1USWA 2H5IA 4KIGA 4JXKA 5LXTF 5ILOA 1EUYA 3UB2A 5K1ZA 1SUDA 1O6ZA 3OFVA 4FI3C 3TAHA 1OW3B 1LNZA 4M0DA 4REQA 1I3MA 2YBDA 4BRZA 3J80A 2OXTA 3KR0A 4O2BF 2WMYA 4WJKB 4ER5A 4Q4DA 2BGWA 3HFGA 1OYYA 4AWXA 1VLJA 2QD2A 1KGSA 1PLJA 2J9RA 1ITZA 1O8CA 2V7BA 2PY6A 3GFVA 4O2RA 5JDCC 5A3SA 1YE3A 2RGEA 4AY5A 3O92A 2Q6IA 3C16C 2GZ1A 4YAUA 3TRDA 5KMGB 1CJCA 3OZUA 4D9FA 5AK3A 1WMAA 1YS2X 4JC4A 1NY5A 1QIKA 3ACBA 5EI5A 5ELXA 1VFPA 1EJ2A 2AN1A 2ODEA 3PVZA 4BMNA 1RPTA 3N76A 4EBBA 3D0RA 3RRXA 5KNDA 3BOSA 4RKFA 1R0BA 2XV1A 4H9GA 3TOXA 2KB0A 3QRWA 4U9IS 4GOXA 5F4ZA 3GNTA 5HFAA 2ZBFA 1ELOA 3B3AA 4JB3A 2C31A 5HKLA 1Y1SA 1WQ1R 3H8WA 1M6VA 5LDHA 1ESEA 2GPTA 1OBVA 4GX1A 4R8KA 1VBKA 5HF5A 3N7TA 2B8NA 2OHGA 1XTZA 2WKWA 3WX0A 5AVJA 3RK4A 1GNPA 3C6MA 4KSCA 1LTKA 3ZVNA 5LL6P 4IQGA 3ADDA 4IOJA 4PCUA 4Z9AA 3R5XA 3LGXA 1E7RA 1JB1A 4JLOA 1E2KA 1XMSA 1M5UA 2Q1XA 3E22A 4NIMA 4BKMA 5KNCA 2I4NA 2ZYRA 4EPWA 3V1KA 4RKEA 2ANCA 3EBPA 2BEKA 3VH3A 1CQPA 3ROQA 4W9NC 3TKLA 1Y3CE 1EZZA 3N5KA 1BE6A 4AF6A 2J6IA 3QU5A 1ZD8A 4GI1A 3G2OA 4L9SA 3HZZA 1QGOA 1VLHA 4INOA 2ADOA 3URKA 3NVMB 4O4LF 4QJBA 2CKMA 1M83A 1BFKA 2F1OA 2OZLA 5FXMA 3WBBA 2IW1A 1T1GA 2AXNA 4B4UA 4AWBA 4S1TA 4W5HA 2JFQA 3RH0A 1QQ6A 1U0NA 2FGJA 4II7A 4ZI7A 4XYGA 3PTAA 1A0OA 1KZ9A 1KO5A 1N77A 2CXQA 5AESA 1RQ2A 2CJWB 3EZNA 4LY3A 3DWEX 2ZAYA 1P9NA 5CW1A 3GPCA 1WY5A 2QQFA 1VPLA 1Y6QA 2D1FA 1E96A 3C4QA 3MJHA 3ROGA 2ZR8A 4MQ4A 1NP7A 4N7JA 4RTKA 1WUTA 4RORA 4HS4A 5AXAA 2WT9A 1JGTA 1WG8A 4XZ3A 1OY1A 3FKQA 1TM4E 2J7KA 5A9TA 1OGIA 1ZM7A 2HF7A 1DEXA 4QHTA 4TN5A 3ACCA 3AERA 4KK3A 4LXUA 2HA5A 2XZTA 2NNWB 2ECKA 2G70A 3PTLA 1CZRA 3ETNA 4XVQA 4F4HA 2VSNA 4DXHA 1OFUA 1HURA 2O2JA 4C76A 4XUGB 3QJ5A 1E6CA 3G2KA 2GJ9A 2FZVA 2ZDQA 3AFMA 3KP1A 3EPHA 1KDVA 4KHPB 2NMVA 3JWJA 4UEQA 2ZRPA 3IILA 4BV9A 4JLPA 4EHNA 2PGLA 2D1SA 3VPSA 2EXXA 4R2WA 5AQEA 2I4OA 4WESA 5G1OA 1TVCA 4L16A 4AQYB 1H6BA 4URFA 3ZJ5A 1HT1E 1FP6A 2BR5A 2OV3A 1U9IA 5B1DA 4N8DA 5DXFA 1Z6AA 1OC2A 1UAYA 2CVQA 4MGEA 8LDHA 1FRNA 1PX2A 1W4BA 2BFDA 4PLYA 3HADA 2PIDA 3GR6A 4BBZA 2Q9CA 3P8ZA 1MQ9A 2F3RA 4ARIA 3VGJA 2PZMA 3DLCA 4DR1B 3VUEA 3A3YA 1OVGA 1F06A 3E8MA 2NU8B 2FN8A 2IZ5A 1VG8A 4RDHA 3WIDA 1NUPA 2OR3A 4RY0A 1T5BA 1ZP6A 3K5WA 3RT9A 1XEFA 1RCTE 3W5SA 5IDXA 3PA8A 1R4AA 2W4IA 3KELA 1V11B 4HEA6 4WUVA 2BZ0A 2O4CA 3C1TA 4KWTA 4WL0A 2ADMA 3IMEA 3TM4A 1JDSA 1XTTA 4AD8A 4UTXA 3GRAA 3KDSE 4QDUA 5HIJA 4AWAA 4NHEA 1J2EA 4I8DA 4M7RA 3GOHA 4P92A 4JL6A 4OBXA 3WV5A 3C3AA 4BGDA 4QL3A 1HDEA 1KVUA 2UZ1A 1ZWKA 4CGYA 1WHTB 4DM3A 1MC1A 2O8BB 1WOYA 4BFCA 3UM9A 2ZWOA 3D8UA 4E70A 1FDWA 1GG9A 3WWPA 2C8JA 4HGPA 1OUMA 5F1OA 3EXG2 1VE1A 2CDAA 1T2NA 2J09A 3FMPB 3HXLA 3BL6A 4HCJA 4OG2A 4CMEC 4F12A 1G5FA 5LLSA 2E37A 1JZTA 4E4RA 5CITA 1ODKA 5EZ6B 1XPOA 4J6FA 3NQ41 1T4CB 1KYWA 4R6WA 1NKVA 1WZ2A 1X77A 1QU2A 2WHXA 3LZDA 4NBUA 1Z4OA 5A6SA 1VB3A 4TKLA 4DJJA 1T8YA 2XDYA 2AXEA 4IEFB 1PL0A 1RM4A 3BH6A 3MJVA 1QGUA 5IPFA 5K05A 1UWCA 4RS3A 4J9UE 1U1DA 1PGPA 3P9SA 4FFBB 1NBEA 3OKCA 4BNLA 1Z47A 4WOKA 1QIEA 2E48A 1TRHA 1T91A 3ZE9A 1NN3A 1QG0A 3QPAA 1KAOA 1OZFA 3EB9A 4WXYB 3DAOA 3DT8A 1WAMA 4WLFA 3KO8A 4AECA 3EEIA 5DCYA 5FAKA 2IBTA 1NW8A 1SKYB 1TTQB 1A8UA 3ONVA 4LXYA 1PJRA 1JPNA 4ERXA 2PYIA 3HNOA 3ZHYA 4R83A 3SE7A 1QONA 3BBLA 4CPDA 3IEPA 3N2GB 3JAKB 2TS1A 3WB9A 5B7NA 3KJIA 1XEXB 2H17A 1NHWA 4E14A 2Z8XA 3CZMA 4KN5A 2C00A 4I3GA 4DIEA 1NQ5A 1ZZEA 1M0WA 1P6QA 5D3ZA 2XVYA 4N9WA 3THOA 1G21E 4FBLA 4H35A 4EFKA 1BU8A 2WIKA 2EHDA 3QTBA 3VHLB 3ZV5A 4YPVA 2P62A 2F9MA 5FLKA 5HP4A 1DZIA 3B7PA 3PENA 4ZTZB 1BCRA 4R9SA 4UCQA 1VSUA 3O4RA 4XD7D 4Q6WA 5H3HA 4I8XA 1E3SA 4X0EA 4JEMA 5L6MB 4Z53A 2ODNA 1T8PA 3EGIA 4C7JA 3GXOA 4KH1A 1KJQA 5KWIA 1JDJA 1YRQA 3T9DA 3AZOA 3A1NA 5A5EA 4AKTA 5J4KA 1LSSA 4OCZA 3HG7A 3LUFA 3ROMA 5CB4F 1C80A 4PYQA 4CXMA 2VF5X 2Y76A 4G4IA 4QYXA 5T4BA 1VCIA 4U9UA 1Y98A 3FG9A