3DOUA

Crystal structure of methyltransferase involved in cell division from thermoplasma volcanicum gss1
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
181
structure length
175
Chain Sequence
QLRSRAAFKLEFLLDRYRVVRKGDAVIEIGSSPGGWTQVLNSLARKIISIDLQEMEEIAGVRFIRCDIFKETIFDDIDRALREEGIEKVDDVVSDAMAKVSGIPSRDHAVSYQIGQRVMEIAVRYLRNGGNVLLKQFQGDMTNDFIAIWRKNFSSYKISKPSSEIYIMFFGFKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Methyltransferase Involved in Cell Division from Thermoplasma Volcanicum
rcsb
source organism Thermoplasma volcanium
molecule tags Transferase
molecule keywords Ribosomal RNA large subunit methyltransferase J
total genus 64
structure length 175
sequence length 181
ec nomenclature ec 2.1.1.166: 23S rRNA (uridine(2552)-2'-O)-methyltransferase.
pdb deposition date 2008-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3douA00
3VYWA 4A6DA 3VSEA 3LL7A 3MGGA 3P97A 4IV0A 3SR4A 1L1EA 2P3LA 5F2NA 2AOTA 4OBXA 3EEOA 3E8SA 4X61A 3QOXA 4P58A 5EKXA 4DA4A 3TM4A 4F85A 4C04A 2FYTA 5EC8A 1B42A 4R05A 5EIWA 3V97A 4UOEA 3FPHA 3UJCA 1BHJA 5DX8A 3PS9A 2YXDA 4FSXA 3HVHA 5M5BA 1XDZA 3DUWA 4YV1A 5LQKA 1F3LA 1VPTA 3LPMA 4MHTA 2IH2A 3UA3A 3GWZA 4YV0A 2NP7A 3HCCA 4X1OA 3LBYA 3FTFA 5EQJB 4EQZA 1ORHA 4ER3A 2FCAA 1FJXA 1JG3A 3G8BA 3KQWA 1NBHA 2IIPA 3C3PA 1T43A 3G7UA 1D2GA 1Z3CA 4MTLA 1XDSA 3HM2A 5LSAA 2FHPA 2AOVA 4DF3A 5F2OA 2P1DA 1QAQA 3PVCA 4RX1A 5FUBA 4BLVA 4MQ4A 4C07A 2R6ZA 3GO4A 3KR2A 2ZCJA 2PXCA 3TKYA 5EHGA 1SUIA 4F86A 2PWYA 3HVJA 3KPYA 4RTLA 2QM3A 2ZBRA 3GGDA 5KS2A 1I4WA 5HEKA 1SKMA 1NT2A 3BWCA 1N7IA 1JG4A 1TW2A 2IDKA 3M6WA 4RVDA 4M7RA 4C06A 5LQAA 5GINE 2G70A 4Y2HA 5GOZA 5EGSA 2PSSA 3EVBA 2ZFUA 3GDHA 4EKGA 3MB5A 3CJQA 3OCJA 4QTTB 2P3OA 1IM8A 1EIZA 3C3YA 2HTEA 3BGIA 4ISCA 4PWYA 3HTXA 3FZGA 5D1NA 4E2ZA 4F84A 4RTNA 2HWKA 3BUSA 4KW7A 2IFTA 5FHQA 2PT6A 2PKWA 3RW9A 3V8VA 1KIAA 2JHPA 4FZVA 2PX5A 1XXLA 3P9KA 1EG2A 2IP2A 5GWXA 5C9ZA 5K0CA 3FRHA 3M4XA 4GOND 2IH5A 4JXJA 4A6EA 3KR1A 2P8JA 4KVZA 4RTMA 4ER6A 3R0QA 4HC4A 1VLMA 5JUWA 1YFLA 3IHTA 3OZRA 1X1DA 5LQUA 3HNRA 3SX0A 3SSMA 2ZBQA 3LDFA 3AY0A 3AXTA 4GBED 5DM0A 4V0QA 3DMFA 1BC5A 1M6YA 4RTSA 5CIYA 4AZTA 4ER5A 3HVKA 1G60A 1WS6A 3ER8A 1H1DA 1EJ6A 4PYNA 3DP7A 5K0NA 2PVCA 4E2WA 1RJDA 2OYRA 2AS0A 3FYCA 3GIWA 4CKBA 3LECA 2YX1A 1NW6A 2P35A 1FP1D 4P7FA 5FQOA 1L9KA 1PRYA 5DTMA 5HILA 2AN4A 4R6WA 1KXZA 3TPZA 1X1AA 4X60A 3DH0A 2FK8A 1ZHFA 4XCXA 5T67A 5CVJA 5LQRA 2G1PA 1JSXA 2PX8A 5GIPE 1YFJA 2LD4A 2ZIFA 5C0OE 3HCEA 3HP7A 2G8NA 3SMQA 5GP1A 2O0LA 4RTJA 4X41A 3PFGA 4EK9A 2HV9A 2PJDA 3EVAA 3ME5A 5C1IA 2B25A 2CKDA 1OR8A 1WZNA 2AZTA 5EHIA 4KIGA 3DLCA 3B3FA 4AUKA 3HVIA 3KQPA 1DL5A 1QYRA 2XBMA 2B2CA 4OA5A 3EMBA 3JWHA 4OBWA 2JG3A 1G6Q1 3K0BA 1FBNA 5KQSA 1XTPA 2OXTA 3TKAA 2AVNA 1JQDA 1JG1A 3P2IA 4C4AA 2DPMA 2V7EA 2HR1A 2QYOA 5EMJA 4C08A 5CVVA 4E33A 5KYGA 4QVGA 4GC9A 2G72A 3CVOA 3M6VA 3WSTA 4E31A 3CJTA 5DRYA 2AR0A 3G5LA 3KQOA 5E1OA 4Z2YA 2C7RA 1I9GA 1YB2A 3T7RA 1VP3A 1HMYA 5DWQA 1O54A 3HA5A 3JWIA 3LBFA 3OZTA 4LECA 2B78A 5K03A 1IY9A 3HA7A 5HZMA 3A7DA 3P2KA 4PYKA 7MHTA 1MJFA 4B17A 3KPJA 3GRZA 5HIMA 2GB4A 4POOA 4X63A 3FRIA 4L7VA 5F2KA 2ZBPA 3SSNA 1JQ3A 2P7HA 1V39A 3JWGA 4GC5A 3GCZA 5DSTA 2BZGA 3EVFA 4WVLA 4OA8A 3KHKA 1VE3A 2H00A 5CCXA 5DM1A 2OKCA 2IGTA 3RODA 3P9CA 4ER0A 1M0EA 5DTRA 1EJ0A 5EOVA 3GRYA 2EG5A 2P41A 3H2BA 4V0RA 5E1BA 5E8JA 5HIIA 3I9FA 3TR6A 4O29A 1R18A 1RJFA 3LX6A 2AOTB 1ZKDA 3C0KA 2CMGA 2P7IA 5EIFA 1R8XA 4FSDA 1EQAA 1KPGA 1JTEA 2XVMA 2Y1XA 5DX1A 4RTPA 3IV6A 3PX2A 5G02A 1U2ZA 5LR6A 3A27A 1KYZA 1RI2A 3IYLW 2IH4A 5FWDA 3F4KA 4KDRA 4BP3A 1AQIA 3FUUA 2ZIEA 5CD1A 3TFWA 4E32A 3UJ6A 3DXXA 3OZSA 3M6XA 1P91A 5K8VA 1YUBA 4HSGA 3RIEA 1UIRA 3LCUA 2FK7A 1P1BA 1JTFA 2I7CA 1ZG3A 1RJGA 2PY6A 2DULA 3UJDA 4EVIA 2CL5A 3LHDA 2C7PA 3MTEA 1TW3A 3CKKA 3TLJA 3ELDA 1R00A 2PWPA 5DTQA 3UBTA 1Q0TA 3EVEA 2PX4A 3TOSA 5E1DA 3DOUA 5LQNA 1RI1A 4QDKA 3E23A 3SVZA 2VZ9A 4PYJA 3KPUA 2ZLBA 3REOA 5K09A 3NWEA 4FT4A 4QVKA 5K0GA 1FP2A 4M37A 4DM3A 2C7OA 4P7KA 5EPEA 4BP1A 4KDCA 4GOOD 2IBTA 3C6KA 3B5IA 3ELUA 3LDUA 4PYOA 3T7TA 8MHTA 5JR3A 2AN5A 3FUWA 3AXSA 1R6AA 1WG8A 3C6MA 3PFHA 2OO3A 3QOWA 5ICEA 3ERCA 3P9IA 2OB1A 2PT9A 5T64A 2ZZKA 3BZBA 3FTDA 5E2AA 3BWMA 2BR5A 9MHTA 3A7EA 1AQJA 3LDGA 1KP9A 4GEKA 4RTOA 2Z6AA 5DX0A 4MWZA 2EFJA 4CXMA 4EMSA 2BM8A 2IBSA 1NW5A 3EPPA 2ONZA 5EG5A 3MHTA 4E2XA 3BKWA 3LCVB 4QPNA 3FPGA 5EKUA 3EVZA 3OE4A 5K0BA 4OQEA 2F8LA 3UFBA 1VBFA 3MQ2A 3G8AA 5DM2A 4DZRA 1XVAA 5HOQA 2PXXA 4RV9A 2GLUA 3E7PA 3MERA 3NDIA 4G56A 3PT9A 2JHAA 3R6TA 4CWAA 4FGZA 4DMGA 3B7PA 4AZSA 1G55A 4BLUA 1F38A 1D2HA 1N2XA 1M6EX 3GJYA 1L3CA 2NXJA 3HCAA 3MTIA 3I53A 3FPEA 2V74B 3GRUA 4AX8A 4M38A 4PYMA 3EGIA 5FHRA 3DXYA 4C03A 1RI5A 3NVKI 1NV8A 5K0LA 2AOWA 3MCZA 2WA2A 4M36A 4RSRA 4R6XA 2ZTHA 2ZULA 5EEHA 3TRKA 2Z6UA 4YUZA 5LQJA 2GS9A 2PLWA 3AWIA 2A14A 4GOLD 2O06A 2H11A 1KHHA 3A25A 2AN3A 4AZVA 3OE5A 4CTJA 5ICCA 3NMUF 3R3HA 4YMHA 4GUAA 3LSTA 4XUEA 1UFKA 2YQZA 1JG2A 2Y1WA 3OU2A 3O7WA 3R24A 1DCTA 1L3BA 1HNNA 4U7PB 5E8RA 5GM1A 2ZZMA 3GU3A 3Q87B 5EEGA 3CGGA 1NW7A 3GRRA 3LGAA 2N47A 4E70A 2ERCA 2BR3A 2WA1A 3DTNA 3NWBA 3ID6C 4NECA 4PIPA 3ER9A 2ZVJA 2O07A 2KW5A 3BKXA 5DM4A 4ATNA 1XCJA 3FUVA 1YZHA 2QY6A 3KKZA 3HEMA 5CVDA 5EZSA 4P7JA 5FTWA 2ZW9A 3EGVA 4Y30A 1QAOA 3IEIA 2I9KA 1RJEA 2G71A 3NVMB 5EMKA 2BH2A 5K0EA 1AF7A 1XJ5A 1ZGJA 2XYRA 3EVCA 2HNKA 2ONYA 4RTQA 4FP9A 3T0IA 4HRAA 1SQGA 3K6RA 1IXKA 5HFJA 2OZVA 4KWCA 4YUVA 1JSZA 4PYIA 1ORIA 1R8YA 2YXLA 3KPWA 4HG2A 1X1BA 5IKMA 2JJQA 3DMGA 3CC8A 1BKYA 3OPNA 3GNLA 5FA5A 2VS1A 5EMMA 5MHTA 3EVGA 4YMGA 1KYWA 3DLIA 4RTRA 2FRXA 3HA3A 1D2CA 2ZWVA 4MIKA 1SUSA 4IKPA 3T7SA 1NBIA 1KR5A 4GF5A 3UA4A 1AV6A 4KRGA 3BXOA 2OB2A 4PCLA 3THRA 4HH4A 5E9WA 5GM2A 2XYQA 4EKIA 2XYVA 1XCLA 2AOXA 3G2MA 4IWNA 1QAMA 4KIFA 4LWPA 3X0DA 2GAFA 2PBFA 4RVFA 5KQRA 4DCMA 3I64A 5KVAA 3SSOA 1R74A 4QTUB 3TMAA 4HGZA 4BLWA 1O9GA 2O05A 4DQ0A 4QDJA 5U4XA 4ER7A 5HIJA 1BOOA 2OPBA 2NYUA 4YUYA 2PGXA 4IV8A 4RVGA 5E1MA 3PTAA 1Q0SA 5DLYA 1YZ3A 4PCAA 3I58A 4PONA 1QANA 1RI3A 2JH9A 4LG1A 2NNWB 4FR0A 3UJ8A 2C7QA 3DR5A 1G38A 2ORED 3KQYA 3BGDA 3FUXA 5B1SA 2ZSUA 3EVDA 2O57A 2H1RA 3FUTA 3KPVA 2GPYA 3ANXA 3O31A 2UYQA 1UWVA 3CCFA 3FTCA 2VDVE 4E2YA 1VQ1A 3P71T 3UJBA 3P2EA 2YR0A 2ZWAA 2PX2A 1PJZA 3HCBA 5K0FA 2JHCA 2OY0A 1RI4A 3A26A 1X19A 4DKJA 2NXEA 4AZWA 4CKEA 4PGHA 4YV2A 2B9EA 1KPHA 1VP9A 1WY7A 2YUIA 3ELYA 2QE6A 3B3JA 2EJUA 3KQQA 5GIOE 3DULA 1NKVA 3SXJA 4H0NA 3BGVA 1G8AA 4K6MA 4QQKA 2OBFA 5ICGA 5K01A 5D1HA 1JR4A 4PINA 4PNEA 3KQTA 2VP3A 4OQDA 3B3GA 2QRVB 3ELWA 1NW8A 1NW3A 4RYLA 3E05A 3I5UA 1NE2A 3A4TA 3G5TA 3CBGA 3B89A 2AOUB 5DPMA 3UJ9A 4DCGA 1ZGAA 3G2OA 3G88A 5BW5A 5LQCA 4FT2A 2IDJA 1INLA 1L3IA 2R3SA 2I62A 3M6UA 4RVHA 1DUSA 2YVLA 5DXAA 5ICFA 4HTFA 4FS8A 3LKZA 3FPFA 4R8RA 3KR0A 2UZ4A 3EEYA 3LCCA 5DXJA 1SVUA 2AOUA 1G8SA 1NV9A 3EMDA 5FCDA 2BM9A 5P8WA 1Y8CA 3UJAA 3U81A 3PX3A 2P40A 3CJRA 5K05A 1JQEA 4HGYA 2YTZA 3JWJA 10MHA 5ERGB 4QPPA 1X1CA 4PYQA 3THSA 2NXCA 1VL5A 2JH8A 1VIDA 3S68A 5DRTA 3BT7A 1I1NA 1ZQ9A 2GA9A 3NW9A 4BY9E 1WXXA 2Z6QA 5BXYA 3HCFA 3NDJA 2UYHA 3O4FA 3SGLA 1MHTA 1XDUA 3UWPA 2EX4A 2I6GA 2ZZNA 2XVAA 4CKCA 5FQNA 2BR4A 2UYOA 3UJ7A 5FADA 2IPXA 5CVUA 3LKDA 1P39A 2NXNA 2Q41A 4PYLA 3M70A 3M33A 5CVEA 3VC2A 4CTKA 5BP7A 3TM5A 4GQBA 1SG9A 2EJTA 5T6BA 5HIKA 5CCBA 3G89A 2PV0A 2ZIGA 3GXOA 3FTEA 1QZZA 1WXWA 5BW4A 2GH1A 4P7GA 5E2BA 3KQMA 4QQNA 4R8SA 2P3QA 5E9QA 3D2LA 3AJDA 5FULA 1SQFA 2AVDA 5FWAA 4RTKA 3SM3A 4YUXA 4PIMA 2CMHA 3OU6A 3FYDA 3BWYA 3KR9A 3TQSA 5CM2Z 5DT2A 2YXEA 3MAGA 3BWBA 4ZTBA 4PGGA 2PXAA 5H02A 3GRVA 4GOMD 2UYCA 3OFKA 2VDUE 2B3TA 3NJRA 3P9NA 3DXZA 3OFJA 4C05A 5FA8A 3R9XB 2FPOA 3FPJA 4U7TB 5EMLA 2HMYB 5EVJA 3DMHA 3ORHA 4HTFB 4OX9Y 3PLAE 3NTVA 3UZUA 5IH3A 3PB3A 3KU1A 3KQSA 4YUWA 5E9JA 3P8ZA 2VDWA 1O9HA 1KPIA 2WK1A 4E30A 2E5WA 4RWZA 2CWWA 3OU7A 3QV2A 3Q7EA 1P1CA 3VC1A 3G2PA 3KQVA 4XUDA 1FPQA 2QRVA 4XUCA 4LWOA 2NP6A 3L8DA 2ESRA 3MCTA 3HCDA 2K4MA 5DSXA 3G2QA 1EAMA 5K0JA 1YF3A 2ADMA 5CUQA 4WXHA 1N7JA 5EZQA 3EGEA 1TPYA
chains in the Genus database with same CATH superfamily
1P1FA 3VYWA 4AKHA 3VSEA 3NLLA 3MGGA 3T5AA 3D43A 2FWNA 3I4FA 4L16A 4QPZA 4QSHA 2I66A 2GUWA 1J5PA 4KXQA 1PSZA 2W6MA 1G4AE 2X19A 3EIFA 5D7NA 1GU1A 2R2GA 3IFSA 5KU1A 2GZMA 2FYTA 4MGZR 4UOEA 4R05A 3CQ9A 4EEZA 2ZIVB 4EBFA 2J0SA 2D7JA 4TZTA 1V6CA 2OCAA 5KYTA 4LCEA 4TLBA 3GP8A 3LI2A 4B0PA 1BX0A 5FUMA 5JS7A 4YC7A 3PSAA 1IAQA 2FSGA 1HG0A 3DBRB 2FUNB 4JMLA 3GT0A 1W46A 4LMRA 1E9RA 4W9RA 3AR2A 1SULA 4IG4A 1LJ8A 3UV7A 4MHOA 4AKIA 3QKIA 3FF4A 4U7GA 4EZIA 3BK7A 1A9ZA 3M4NA 3PITA 2WRZA 1NVGA 1WM1A 4CHGA 2TYSB 1GPUA 4B2PA 4DLNA 4EI8A 4IGIA 4O6VA 2D1QA 5H4HA 2JA2A 3JR7A 2E6KA 4FB4A 4IKOA 5KTRA 3F46A 4S0XA 4EJFA 4EG4A 4C06A 3MJTA 2VNAA 4C14A 3L7KA 2CLKB 4CIAA 1SVMA 2J9FA 2QRLA 1J90A 4HL6A 4CM9D 4YIHA 4Y2UA 4TL6A 1E9VA 4KJXA 2GYVA 1BH6A 2GK6A 3NB0A 2CE7A 4IXWA 5ENDA 4JOSA 4WECA 3WIVA 1IH8A 1MDBA 2VH2A 2PX6A 1YONA 4CLOB 4R1UA 2PLRA 2O8FB 4EG7A 1XXLA 4R1QA 1ZN2A 4WCVA 3IHKA 3FRHA 3GC6A 3KRTA 1JEJA 2P2GA 5JBIA 1M2EA 3KEFA 5ESXA 1STOA 1AKYA 1YI1A 2BEWB 2ZAMA 2JIDA 3I32A 3MVEA 5DBOA 1LK7A 4LV6A 4E09A 1AKRA 4ENQA 1RP1A 5DNUA 4HB0A 3WBBA 2A9QA 4HT3B 1RRMA 2JCGA 1FL9A 1TAQA 3DWGA 1ZZGA 2C20A 1PX2A 3BSSA 3HNRA 1JI3A 4HDAA 4J43A 2PGAA 2JCYA 5DM0A 2JAXA 5I4BA 1J5EB 1MO3A 2P68A 1JIJA 3CEPB 5E4TA 1FFEA 1E1LA 3HCOA 2VAVA 4CCYA 4DFDA 1MR3F 3DP7A 3PXDA 4W7HA 1GAQA 2O8CA 1HDIA 1NFRA 3BJIC 2XNCA 4BLSA 5K45A 5DBEX 4HQRA 2D5BA 1K8ZB 1QP4A 3R9KA 3ZJYA 1ZHHA 1TF2A 3LUJA 4AMUA 5CDTA 3F5MA 4AJKA 3WGIA 2F8MA 4BNXA 2WAMA 2EWWA 2RGXA 2B34A 3ZNOA 5E6UB 5B12A 3L04A 4ZOAA 1J4AA 3L5OA 3CT4A 5FNVF 5ILQA 1JIVA 5ED0A 2MSEB 2OQRA 1L5HB 4EK9A 3L6RA 1UM9B 3LT5A 1T6XA 1WQ4A 3PENA 1CQZA 2RHHA 5HMMA 3UQZA 1W4ZA 2DMRA 3GGPA 4NBSA 4P4TA 3UHOA 4JB3A 2LUOA 3VTZA 1CZHA 5I3CA 1ZRMA 1YK1A 4BX2A 4B2YA 3VPHA 1NVXQ 4RD4A 1REQA 2ZYHA 4RLFA 1EP1B 1DWUA 4J8PA 1OTXA 3AHDA 1QKIA 4LHEA 4GGMX 4IBOA 1QYXA 3TD6A 1ZINA 1BRMA 3NM6B 2BEKA 2V6IA 3TLBA 2DPGA 1A8SA 1XRNA 3H16A 3V8MA 4TMVA 5TIIA 2EFGA 4Z2YA 2GEVA 4XGQA 1KBZA 1HZZC 1Q91A 3GLTA 2XMDA 1ZVVA 1U80A 1Y9AA 3CZRA 2SCUB 5EA2A 4TV9A 1C7QA 5KYUB 1SCIA 4UFNA 4MR9B 4HDKB 4LE0A 3FCSB 1G6OA 2FPGB 3KSUA 3LBNA 3S2UA 5HZKA 4U2KA 1H2FA 1US8B 2JRCA 3K7EA 2J6IA 2P9GA 1MRSA 1R6BX 1XVIA 3H8WA 1V39A 2BGKA 3LZDA 1ANKA 1YCGA 1GAXA 1YDHA 1WF3A 1B6SA 1C2YA 3QPVA 4CM9A 3HNPA 3USCS 4N9QA 4F1KA 1G8MA 2MIIA 2Z1NA 3Q3HA 1GGKA 4YQEA 3I8XA 2XE6A 4ERNA 2FSIA 5EIHA 3OUUA 3TRHA 5ISMA 3ROKA 2HSJA 5DHAA 1F06A 3KHSA 4Q7KA 3OHMA 5I7HA 3MZ0A 3W04A 1YXMA 2P3SA 2VSFA 2Y1XA 4OI2A 2MYNA 2FI1A 3AB3A 3MUOA 2VFAA 3IV6A 4AY5A 5F7XA 2W8BB 3O73A 3ZGXA 3AG6A 4JWTA 4X8LA 1MVLA 3DZKA 5EUMA 3C6ZA 1Y3DE 3VU8A 3CX6A 2Q3CA 2CDRA 1VSQA 4E32A 2E4UA 3D2AA 1NL3A 1Z12A 4D6PA 2F1HA 4HSGA 1MORA 3DBHA 4WWHA 4LGCA 1AS0A 1DJQA 3CA8A 4EVIA 4PRLA 3PNQA 4J0EA 2Q5EA 1QORA 2FF7A 3GRKA 4GBGA 5IBPA 4TRNA 1FJHA 3HCNA 1HFKA 1HNZB 4GYYA 1ESMA 1NYLA 3QVOA 2FV8A 4KRYA 4XQCA 4C1BA 3QYPA 1J8DA 3WNQA 1UDAA 4XIJA 4ZJPA 1MW9X 2VLBA 1ZUNB 3OICA 4NYJR 1KJWA 2DWCA 1XTIA 4BP1A 1ODSA 4LTMA 3W06A 1NXPA 4R8LA 1R0CA 3LDUA 4A26A 2LE0A 2AN5A 3FUWA 1OGJA 3EDCA 2JFGA 3C6MA 4RJKA 3IBCA 3IMEA 4L0QA 3C8MA 4UUOA 3HH8A 3VTAA 2O5EA 1K7EB 2OB1A 3M4JA 3FTDA 5IJXA 1PV4A 1KTVA 1PBTA 4MRAA 4RIIA 3GMTA 3D6AA 3CUSA 1WDWB 2QT1A 3AF5A 2AT1A 3I5YA 1TKAA 1TUBA 2BKLA 5LP6A 3QVVA 2IEDA 3AP3A 3A3YA 3WGVA 1UUFA 3TECE 3E7FA 3H6KA 1EVIA 2FP3A 1B73A 4WD3A 3RK4A 4YAOA 4LA4A 3M1IA 4CF6A 2X8JA 2XUGA 4CEJA 1XLUA 1QU2A 3GZNA 2FR1A 1L4MA 3IR7A 3BPSA 1KORA 1H6DA 1E94E 1I0IA 2CUKA 1F0YA 1HUQA 4I55B 2DJ5A 5BV2P 3GBVA 5JC1A 4WZ6A 2G3YA 3P5BA 2FXVA 2ZSFA 4QVIA 3TK1A 2FGKA 2JH3A 1DT3A 3K1YA 1B0ZA 3ZS9A 4IOKA 1F8UA 2CD7A 4AZ0B 2H1CA 1F8YA 4ZHSA 2ECPA 5JRDS 4KNWA 1F2UB 1HE5A 5TS2A 1I7NA 2XMCA 3HPRA 1EQUA 2AJTA 1NV8A 1GQRA 1ZGGA 3F6SA 4LJ8A 1HQKA 5B1YA 4KREA 4G0VA 3PC8A 3IOMA 4R1NA 3FYHA 1WXFA 3ZK8A 2PZLA 3HDYA 2JAUA 4GGPA 2NO9A 5L53A 2O2ZA 4TXNA 2X5NA 3U48A 4IJ5A 1M9NA 4WLVA 3GWGA 2QN6A 4KNVA 1Z7BA 3E1GA 4B6GA 2BELA 3EQ2A 2WE8A 3GLGA 1LQTA 1Y1KE 1UFKA 5JI2E 3CLSD 3SBDA 3M4YA 3OU2A 3ZV5A 1QP8A 3Q6IA 4J0GA 2CNLA 4D9CA 5JASA 3BFXA 3D8UA 4BO9A 3AR6A 4IDDA 2AZDA 3B85A 3H4VA 5EN4A 4B8ZA 3ZWAA 4N12A 4OJMX 1M7HA 4DREA 2WA1A 3F5SA 1BHSA 1E6MA 4QNRA 1T9ZA 2VJPA 5DM4A 3IQDB 2HEIA 5FWNA 1OXBB 2JFVA 4MNTA 3C6BA 4ZHQF 1P0CA 3HEMA 1YA8A 2GPTA 5FTWA 4NNPA 4OHYA 2X4IA 2HUNA 1MB2A 1Q0HA 4LBYA 2QTNA 2G71A 2RONA 1XTUA 2HRQA 1E8MA 4LHXA 3QVTA 2GZHA 1JILA 1RQ2A 3HYSA 1CWUA 4HRAA 5TQVA 2VQSA 2IHVA 1H5UA 2P9FA 4H77A 3RVSA 3T1NA 2AYYA 1IWBB 3OFNA 5BVGA 1W8IA 4M83A 4Y9TA 1T35A 4N0MA 1EDBA 1G0OA 1WVGA 3I1FA 4TTTS 1DIGA 2CYCA 4NFSA 3X1DA 1T9KA 2A0WA 2ZK7A 3COPA 2AG5A 2ZYRA 1ZP6A 4E1BA 1UMDA 3VVBA 2W7TA 2RGEA 1O1YA 4IV5A 4MQMA 3FWZA 4NQRA 4PZ9A 3TVYA 3UPDA 3QU5A 3WR5A 2XYQA 1H0SA 1DJLA 2QG4A 3AF1A 5ALUA 1CK4A 4XR9A 3QFTA 2PJUA 4JROA 2ACKA 1YZUA 2P9ZA 4PLVA 2CUTA 1GEEA 4CNBA 4HGZA 4Q9AA 4N0PA 2BF7A 4RVUA 1D2EA 1U28C 3DMYA 1M74A 1TC1A 2C94A 3CKLA 4ONEA 2VKQA 1Y8RA 2OZEA 4NTZA 3MTQA 5JCJA 1MAAA 1X8JA 3AR7A 5SY6A 1Q0SA 2ZTSA 3CH6A 1SUBA 4U8HA 2WAOA 4PCAA 5K3BA 1FUYB 2J08A 4H1UA 2X4LA 3IUYA 3IVRA 1EGVB 5K4AA 1JX6A 5AQ1A 1Q0UA 2DBQA 5BN5A 1QP0A 4JI0B 1QG2A 4BNLA 3N2GB 4P4GA 4R1LA 3FTCA 3CCFA 4ALJA 1TAGA 2IYVA 3BH7A 3PT5A 4LDPA 3M2PA 4UUMA 3NAQA 1AKTA 3KKMA 1NFQA 1PJZA 3PGKA 4MEAA 3WLKX 2NXEA 5CK5A 4L08A 2QJRA 2VBIA 2YWEA 1TPZA 3DZDA 1PD1A 2EJUA 2ES4A 2G1KA 1IM5A 1Z6AA 3A31A 3ANYB 3BSWA 3G59A 4I08A 4L8GA 5B64A 4NH0A 1VJ1A 4OHCA 4OJNA 4F4HA 1APBA 4RZSA 1FUEA 1Z4QA 1BSVA 3DLPX 5D1HA 4GLBA 4PPFA 4KFSA 3BDAA 2SECE 1M7BA 3JQFC 4BLQA 4O1HA 3AFMA 1P9RA 2I6XA 5JMTA 4TM7A 2NVBA 3ELWA 1E1RD 4URFA 5LUAA 2CHVA 1HE1C 1QCDA 3AEKA 1Z0IA 1I4LD 2HU5A 2KB0A 3KVRA 1N32B 3F1KA 3H8SA 1YJXA 4CUKA 1E6EA 3G5TA 1Y48E 1ZC4A 3B89A 3GFSA 3C16C 3DOCA 3HE3A 4IJ6A 4M1KA 4WY2A 3I04M 5DPMA 4DCGA 1FNMA 2A5JA 2OD7A 3PGLA 2Z58A 4EA8A 1T9HA 4YP5A 4IP0A 4IQFA 3WX0A 1GADO 2D54A 4R8RA 2ZJ6A 4BN5A 4EZBA 4F2PA 4HPJB 3TX2A 4W9NC 2AOUA 4XVCA 2JI4A 3VVMA 7MDHA 1JG7A 3FWYA 1Y7IA 4PX9A 5K3SA 3MTAA 4E5MA 3IR6A 1TK9A 1KNXA 2XUPA 4OQPA 3U7QB 4QPPA 3VJKA 4LTDA 1U8AA 2ATXA 5D86A 4KE6A 1VTKA 2ZPAA 4QDXA 3E3AA 3RG2A 4EB0A 1R9GA 1XQ1A 3FAKA 4F2WA 3DOIA 5FNZA 1OKKD 1BGVA 2XUKA 1JB9A 1T9BA 3BL6A 4EUNA 1AO3A 1SUDA 5CLLA 1B93A 4KNYA 5DMXA 4C7OA 2TMYA 1GKLA 5IJWA 4A92A 4FC7A 2MINA 2O2EA 3NXSA 5AHRA 4DA7A 3TMYA 2V6GA 1ZONA 5IM5A 2X0NA 4EKNB 3HXMA 3UJ7A 4ALIA 3NC4A 3A9TA 5ARDA 1M3SA 1ST2A 3G1TA 1DNPA 1WLYA 2NXNA 4MS4B 2PMWB 1IZ8A 1IEQA 3OIYA 2DLCX 3GA0A 3R6GA 4GZ6A 5A7HA 3SHOA 4HVCA 5LD2C 1FYVA 4Q4AA 1Y3AA 2QYTA 3CZAA 4GL4A 4OGKA 1FSSA 3W3AH 4DBLE 3T5PA 1KZ4A 1U0TA 1QZZA 4DQLA 2Z8YA 1WXWA 3LA8A 3IBGA 4B6FA 5B58C 1UPUA 2OFFA 4Q19A 3ZX5A 4O3MA 4P7GA 1JS1X 3F3YA 2XW6A 4MV6A 4OHZA 3NS7A 2E5FA 3OOHA 4XWTA 3AVQA 1TYCA 1G2PA 1H42A 2DSTA 2FUG1 3F71A 3K0HA 2H1WA 4WCFA 2NU8A 5JC8A 1KAMA 1OU4A 1FU4A 1XTQA 4RTKA 1LDBA 2QG9A 3WL6A 3G2NA 4HGOA 2DQYA 2V9ZA 3I3OA 3A9VA 4KXUA 4ZREA 3WIDA 1AQ6A 3ETEA 4N5NA 2BGNA 3PA8A 4LYHA 4PFKA 4MVJF 4GX2A 4ZOLF 1SY7A 2P2LA 2PXAA 3HVRA 5AWFC 1YRHA 4KI7A 2UYCA 2BKUA 5CH3A 2PM8A 4JEIA 3JQAD 1U3UA 3P9NA 1I10A 1TM7E 1VZ3A 1FNNA 3DXZA 1D9XA 2O3UA 3R9XB 4U2CA 3AFGA 3I9V1 3NBMA 2IHTA 1SA0A 3OZIA 3UJ3X 3NTVA 3QPWA 3UZUA 1RW4A 1QPGA 3KQSA 4O0MA 1TT5B 2MYPA 2F7SA 2ZTVA 3EUFA 3J7AC 2WK1A 3UCXA 1PR4A 3UOGA 5AVYA 1X7YA 1A9YA 4NHEA 4RZIA 4LDJA 1XNHA 3WLSA 2FN9A 4F8EA 4MDEA 5B6PA 1ICIA 1ISRA 1HOTA 1L5YA 1UEIA 2ZDHA 4XUDA 1X8XA 2NUBA 3ED1A 3SF0A 1EP3B 3KTAA 3HYRA 3CX8A 3AG5A 4KFRA 4AYXA 4BO6A 3T7AA 4CM3A 1WLSA 4YPOA 4LRQA 3H5LA 3KKNA 4JC8A 4UUPA 1PQWA 1R6VA 2PMDA 3GY0A 2B8TA 1YFKA 3L7IA 1CEQA 4NBTA 3SR4A 4RJJA 3ZU5A 3DGFC 3ABOB 5C7YA 4GPBA 4XYBA 5BVHB 3CRVA 4QU8A 2QJOA 1MOZA 3OZDA 4P58A 3RFVA 1UZUA 1VPDA 2IXBA 4EL0A 4DR7B 1U4SA 3QNWA 1YQXA 1USVA 2V8OA 1PO7A 3P20A 4FOSA 4QIHA 4HAXA 2ZBDA 5LMCA 3BHNA 2GZ1A 3QXCA 3A3PA 2DQZA 3BRWD 4L5IA 4BN4A 1RU3A 3QKWA 3UMYA 2D06A 1PYDA 5SYAA 4HAYA 1KQFA 2NP7A 3W9SA 1UKZA 1POXA 3TDMA 3EODA 3EGOA 2WWVD 1VG0B 4Y67A 3G8BA 3NGXA 4H6PA 1VLHA 1P1HA 2ECFA 3FA2A 4NBLA 4X1IA 3BWEA 3MTBA 1CUUA 4K9QA 4UCXA 2I4RA 3DAPA 1ENZA 3KJFA 1GPDG 5EXEA 5BWOA 5MFZA 3L0OA 2XB2A 1WB4A 1U2RA 2FSPA 4XOIA 3KPYA 3MWKA 1UDCA 4D02A 4BO8A 5C80A 1WD5A 5LQAA 2IYPA 1E59A 3RC7A 2DFTA 2X5XA 6Q21A 3SKXA 3E3MA 2YQ4A 1BNCA 4RA6A 4BWGA 2Z5FA 3FG9A 4RKFA 4A0SA 2FLWA 1JHPA 4FHDA 1MB4A 2PSSA 5FNVA 1SNYA 2A5YB 2EV9A 3G2KA 4P54A 2YYZA 4BAGA 3BGIA 4X8HA 4Y6OA 4ZT2A 4M21A 1QVAA 2ZJ1A 4KU4A 2Q21A 5DEIA 3BUSA 5AKZA 3GZ4A 2FHSA 3AVTA 2OCXA 1OFIA 4B6EA 2MSCB 1F9EA 5L4NA 1C4WA 3H1PA 3PUXA 2B61A 1T0UA 2H51A 4L50A 2BCJQ 1RMTA 3PGVA 4YPFA 4B5KA 3C1OA 3FOEC 1JJBA 1W36D 4F5DA 1KP3A 4W5OA 2HFJA 2E85A 3L8MA 5C32A 1M2FA 4JI7B 3RVBA 2PL5A 1S89A 3IV9A 3K94A 5LQUA 1EKXA 2ZBQA 4F4UA 1Q1GA 3MJFA 2LCFA 5KJEA 1SBQA 5B7QA 4P3XA 2J5BA 4X44A 3PPYA 1G60A 4DABA 1H1DA 4RF3A 5J58A 1HYBA 4HFMA 1PEAA 4UZEA 3TLGA 3N8IA 3D1LA 1WF6A 3FYCA 4CU2A 1W88B 1LQ2A 3HJRA 5A03A 1YS2X 1L9KA 3UWOA 3NM5A 5K6AA 2R84A 3K31A 1MT0A 3HFJA 4R6WA 3KZMA 1NJFA 1Z47A 1LJLA 1ZLYA 1KDTA 1XA0A 3H9CA 4FDMA 4G8DA 2ZBUA 4FFBA 2JLQA 3M5WA 1HPLA 1SOWA 3KOZA 3L6CA 2RIPA 4AZ3B 5LQDA 4G0MA 1ZMRA 3C8UA 4JYBA 1GUFA 5BWLA 1JJIA 5HUHA 2W6IA 4X41A 3AU9A 4HPXB 3MOGA 2ZI9A 3C1TA 1UMCB 3FVVA 3V2HA 3M4ZA 4XB6B 3WB0A 3G8DA 2CLCX 2IE0A 1YWGO 1YGPA 3FYUA 4CLXA 4YRMA 4Z4FA 3D54D 4D8UA 3DDZX 3GVCA 1WA5A 3GBPA 3G9QA 1AQLA 2W98A 2DUNA 2RJNA 1BWPA 2V7EA 1X9HA 2GKGA 5AJTA 3WWOA 2G0NA 5DRYA 4BMOB 5C5EA 5E1OA 2VQDA 1V8BA 2C2XA 3GJ5A 1I9GA 2GJ8A 3QY9A 3EULA 2WOOA 2ZVDA 3JWIA 1P2UA 2RGCA 4FYIA 4NIMA 4LDQA 4ZC1A 5HE8A 1KC1A 1XQXA 7MHTA 1CQIA 4A3SA 2DWQA 3CLTC 5DHTA 3JQCA 1JU4A 2V4MA 3GRZA 3DEIA 3T61A 3VNQA 1WPQA 1O6BA 1Z9BA 4HXEB 5A3VA 3S4YA 4CJXA 3SSNA 5FTLA 1SIOA 2REOA 2B7CA 2ZSDA 3BB3A 3H5WA 5K3CA 3E9ZA 1ZEJA 2YY7A 3NP9A 4OP3A 1BX3A 5DTRA 1I6MA 2XXAA 4E1AA 1NF9A 2P41A 3MT8A 4L4SA 3TR6A 2X6RA 3UV3A 3JAWB 4QL3A 2XQJA 2XQIA 3D6HA 3OQVA 4JXKA 1T8RA 2IYYA 2A1UB 4KYVA 4LOKA 2FWBA 3PX2A 4NKRA 1YS6A 4JB2A 3LFUA 1SB9A 3LQ2A 1ORRA 3HR7A 3R20A 1HYGA 1SELA 4KGDA 3VR5D 3VYTB 4EAQA 4J3NA 3WMFA 2RHLA 5BPHA 3KTAB 1PFKA 4ETNA 5EUCA 1E3WA 3ESBA 1E64A 1QRTA 4MDFA 1V7QA 5BRNA 4Z0PA 2N0SA 1ECFA 1VJDA 2AD1A 2WU3A 1N6HA 4ZOCA 1RQLA 1ID1A 1T26A 3C70A 2C7PA 1YS9A 3AUUA 1L1FA 3WGMA 1YBMA 2JI6A 2QZ9A 4UVDA 3WXBA 4I3HA 3LWNA 4GPZA 1FUIA 3U60B 2PX4A 4CT5A 4I9GA 3WXMA 2C31A 3E22B 4QDKA 3DMDA 3HKCB 4Z6KA 2B2XA 3QE9Y 5TF0A 3G17A 1L5ZA 1FTGA 1ECBA 3EXG1 1MDFA 3NWEA 4YXWD 1LNQA 5LOVF 2A8YA 5K8UA 1V6AA 4J7CA 4Q4CA 1UC4B 2DXIA 3CRW1 3FKSD 1GL3A 3WKBA 3RFXA 3FMOB 4ACAA 1WQ1R 1BVRA 1GCGA 1ZNWA 2HQRA 3F8TA 2A7XA 2AXNA 3QF4B 4V2IA 5LZ5A 4F4CA 3DO5A 4HDKA 1P9LA 1ULZA 1WL8A 3QKTA 5J5VA 3TUJC 2FW9A 2SCUA 5ITWA 4RD6A 4GEKA 1IJFA 4CDMA 4URYR 4AS2A 1W4BA 4BB0A 1P1IA 3A05A 3Q7PA 4NPHA 4KOEC 1A8HA 1JH8A 1IPEA 1FSFA 4PLWA 5LD2B 1RC8A 3E9DA 1LSJA 3VHQA 4HLUA 1YQTA 1YBFA 1NF2A 2Q4RA 3STTA 4BBAA 1F51E 2DQ4A 3ADKA 1F9AA 1C3VA 3PLNA 1QVVA 2WG2A 4HWKA 4KB5A 3W1EA 3AUYA 2C4WA 2B37A 1NJ8A 4UZFA 2FW6A 2QPTA 3EK2A 1KO8A 4RV9A 1I7QB 4LSGA 2YNMA 2JHAA 2ZAYA 1FFXB 1ZGCA 2WLTA 3CTPA 1DI0A 1EFLA 4QXRA 1Z2AA 2A88A 3EGDA 4IZHA 3RRJA 1YR2A 2VZEA 5HA5A 5PNTA 1Q1QA 1L0BA 2FKAA 3A6ZA 3EDYA 1EJBA 2B92A 3L0YA 1PL7A 2Q0XA 4GI5A 5KCZA 4GRAA 4I7EA 1LF0A 4DR5B 5CDHA 3T3OA 3KSBC 2HHJA 1FTWA 3V4VB 3EVNA 4YJ2B 4FEGA 4GOLD 2WD9A 1G6KA 1DBWA 2ZWPA 4N82A 1H2RS 1KHHA 3KQKA 4FHGA 2ORYA 3UOWA 4YT4A 1U0EA 2K87A 4YPVA 2CMDA 3DG9A 1YA4A 3LD9A 2VYNA 4F06A 2ZETA 1JG2A 3OECA 4NYIQ 3TAUA 2Q6OA 3OM8A 1XU7A 5CJPA 3V1LA 4HDMB 1L3BA 4W82A 4U7PB 3X1KA 1CSEE 1E60A 3CVUA 4E5VA 1OZ0A 1G5HA 1V2HE 1JPNA 1KY2A 2RHWA 3EGCA 3ROFA 5F98A 2FEPA 1A04A 1LFAA 3K35A 2PYZA 1UBTS 3BL8A 1VHWA 1QX4A 2Z1MA 2QDXA 1Y4ZA 2VP4A 4MW0A 1T5OA 2BEVB 3U40A 2VQ6A 3AEKB 4KLRA 2PRKA 3LUCA 4IO0A 1T0BA 5JJIA 2C92A 1VKJA 4JJIA 2OILA 2MSNA 4YYZA 2BBOA 3ONEA 1ZGJA 1BIFA 4ZO4A 5IAAA 1JA0A 1PX0A 2ZRMA 5AI6A 4N8DA 1WVIA 2W48A 5ERYA 2A1UA 1E2KA 4TKLA 3UT0A 5B30A 4JVNA 1OBHA 1ORIA 2YXLA 1JKJA 1Q19A 1X1BA 4G8JA 4JA2A 1KY3A 1JLLB 3LZCA 2GASA 3EMKA 4D45A 5F3DA 1SKBA 5FA5A 3RUPA 4GXQA 1COZA 1B7GO 3CU5A 1Y5RA 4I50F 4M86A 2JIRA 1SUSA 1Z7GA 1O7JA 1YB5A 3MJSA 4GF5A 3ZXIA 1PUIA 3DEYX 3L1UA 4JR0A 4BQSA 1GDDA 3NNDA 1U5CA 2VXOA 3U4CA 1JIUA 1I7PA 3PGA1 2H7YA 2R7MA 1V9CA 4IDHA 4IVNA 5E4JA 3EQ6A 3T1YB 2A1IA 3K6JA 1KXJA 2QTHA 4TGLA 1A88A 1Y63A 1YQEA 2OXRA 4LRYA 1EXNA 4DCMA 1VLZA 1PDWA 3O93A 1TB4A 4NV0A 2ADFA 3SSOA 1I3KA 2O05A 3QLVA 1O95D 1ZH8A 3I42A 3HZRA 2WFZA 3Q11A 3SQNA 3WI7A 2OPBA 3HUEA 3GJZA 4FR5A 1BFUA 2PUFA 3RM3A 3VOBA 1JDTA 3C1AA 4M4SA 2QTRA 1XEWY 2YFYA 2UUAB 3DLHA 3ZWVA 2JCXA 3WL8A 4PONA 2XA2A 1RBYA 2FP4B 5I4CA 4M1ZA 2J3KA 1M34A 4QUJA 3SHVA 1S4MA 1KMQA 1SCKA 2CFTA 2CXQA 1UWVA 2FG7C 3I12A 1TADA 4MRNA 1K0UA 2NVOA 4H3VA 3UJBA 1UMCA 5DZSA 2ZWAA 1RWQA 4F4FA 1CY8A 2IEYA 4CKEA 2VYCA 5KHLB 4Y1RB 4HDRA 4B44A 1WSAA 3DPIA 1EINA 4GOXA 2ACVA 4N5DA 4Q4HB 3ZEIA 4DC0A 1JXAA 2AE1A 3BB4A 5F3RA 3U44B 1AMOA 2XZLA 2DQKA 3B5JA 5UKDA 1FDSA 3IDSA 2MR6A 2QVXX 3CF4A 2JZCA 4PNEA 3SQDA 2X7HA 1NF8A 3HDVA 3TCXB 4EBBA 1SU7A 2WFLA 3AFIA 1Z2PX 3B1FA 5CT9A 2YWXA 1KZYC 3SY8A 4ABTA 1T2DA 1TO6A 2WIAA 3AHIA 3H1AA 3RYHA 2XGSA 3N8DA 2H63A 1QO9A 4R5MA 1NBME 4JH0A 3HU3A 1E5LA 2HMVA 4HMOA 2OWEA 5B4VA 3BVPA 4JWKA 4XTRA 3F7TA 5ADUS 4A23A 1QTQA 1KHTA 1OFUA 5EJAA 1MJ5A 3LCCA 4ZOLA 1G66A 1G8SA 1DUVG 4NJEB 3GHHA 4ZVQA 4WASA 3LXMA 1TJYA 4RFLA 1G20A 1HE3A 3JQFA 4PC1A 4BWVA 3S5JA 4CKXA 1WXEA 1F0NA 5IAGA 5IZCC 1D1QA 1XYVA 4GPIB 3SR0A 1NBMD 4C7VA 3ICVA 3V48A 5LXTB 1JT2A 5FTNA 5I01A 4IX1A 3TQHA 5IYZF 4KI0A 4V24A 2AW5A 2XT0A 2XITA 3N70A 1M2OB 5H9VA 1W7AA 2F55A 2DKNA 3I45A 1R0WA 5TEVA 3OESA 4WNYA 3KIPA 1XDUA 2WNHA 3BAFA 3ITKA 4J7XA 1F8GA 2AH5A 2GYYA 2I6GA 3KBOA 4LX0A 5JADA 2QRNA 3NHPA 3V4SA 2IE8A 4TWJA 4ASUD 2BFBA 3L7NA 4NZZA 2UYOA 2F62A 1RQPA 1AA6A 3BJMA 2BE9A 2BL4A 5JSKA 5I7OA 2FPUA 1LX7A 5EL0A 3WGZA 2ATCA 2H0QA 3CEHA 2FX2A 1XUOA 4GQBA 1KAOA 1YCHA 1PLJA 1EP9A 2GNAA 2LXNA 1K7FB 2NADA 1WW3A 2BUCA 2QI9F 4XA8A 4RHEA 4CKCB 2IXEA 1U28A 1IY1A 2INGX 2KJQA 3FSEA 4S1TA 5CLGA 2C5GA 3IPLA 4M7OA 2P4SA 4B8YA 3FOWA 3K70B 1NYRA 3JR3A 1RNLA 4EF5A 1SQFA 1PE0A 2WVHA 3SM3A 3MWFA 1WY5A 2YWBA 4LYJA 1L7MA 1DARA 4ZIRA 4RK4A 1ZY2A 3KR9A 4JL5A 5EKSA 3RQSA 4G4JA 2YXEA 3DHWC 5DT2A 4DNOA 4FHCA 2PS9A 3PQ2A 4CCSA 2E7ZA 2ZRIA 3GRVA 1JBKA 2QEQA 3OFKA 4WXYB 1DQSA 5JCPA 2FWMX 3FN4A 2ECQA 2WI8A 3WWPA 1U98A 4U7TB 5EVJA 1OZHA 6GPBA 1OH8A 4W8GA 3DVSX 3PB3A 4YUWA 4DS3A 5E9JA 5A5EA 4G1UC 3TB6A 3T1OA 3IKTA 1FLNA 2FX5A 3AL0C 1RYHA 4M0KA 1JLMA 3WTBA 3BE6A 3BK2A 3NAZA 2OHVA 5E38A 1AZSC 5J2TF 1QIEA 4G2NA 2GBCA 1ODLA 3TTTA 1VPLA 4A91A 4Q3EA 2GCIA 2WU8A 5A06A 1JDUA 3Q1KA 1D7AA 5H82A 4KAXA 3HCDA 2JGJA 2MU1A 4FINA 4CFYA 3HUTA 1ZR2A 2Q3MA 1NULA 5CTJA 2XMRA 1TPYA 4HZIA 2OAEA 3PC7A 1BKSB 1GGNA 4GLJA 5SZIA 5C7IO 3SBOA 3WLJA 4YXFA 5J1TB 2CVQA 3DO6A 3OI7A 3OZGA 2WUGA 3ASYA 4K03A 4DA4A 1JNYA 4LJ5A 3ST7A 4ARIA 1SA0B 4EVSA 1M0TA 3WK9A 4Y30A 3FPHA 3KXKA 4N47A 1PZEA 2WU4A 1T10A 3QBJA 3R5HA 1G7TA 4KN5A 4KQMA 1C3OB 1GU7A 1TOAA 2A2ZA 4O08A 1IY0A 1OFTA 2IP1A 3I09A 5DYTA 2Y2UA 3H3FA 3IUQA 4AF7A 1LK5A 3I9OA 4RH1A 1VKRA 2PUJA 2V1XA 4Y6PA 1XELA 2C9OA 3MWEA 3CXUA 2BFCB 3MILA 2WIJA 2XX3A 4NY1A 4Z0NA 1P2FA 5JZVA 3PGXA 2PYDA 4FI3C 4CLRB 5IDQA 3ENZA 1A7JA 1I2MA 2P30A 2YXNA 3PKIA 4R2JA 3AJEA 3PI6A 4RX1A 3V1KA 2O4CA 2AXPA 4B4WA 3VTKA 2GETA 4MPRA 4F86A 4J0DA 5BN4A 3QTLA 5JAZA 2ZS7A 3LVBA 2H3EA 4UW9A 5L8VA 1KI4A 4GWGA 4S1PA 2YBEA 5KSOA 3THXB 5IF9A 4GZ5A 1L1RA 4UHKA 5I4IA 3ZIDA 5KOIA 1XLWA 3FZQA 1G16A 1M2VB 1M6HA 2OECA 3U13A 3WYAA 3QJ5A 3NAMA 1R6UA 4JB0A 1O96A 3IJ5A 1RHKA 4CKYA 4CRWB 5M7EA 4G85A 4YMWA 4TS1A 1J2EA 4D74A 3S8EA 5AVXA 3TOVA 4HZUB 5JXHA 2MINB 1XEXB 1RHMA 2PCJA 1YZLA 4UHBA 3DOHA 2Y1KA 3HU5A 4KW7A 4R9UC 2QD5A 2C9ZA 4W5HA 3EOZA 3V8VA 4M98A 4FZVA 4AQ7A 1A8PA 3EN0A 1BVUA 1DC5A 3G0GA 3O4GA 4JSTA 3IEVA 2DHEA 2HMUA 4GOND 4C0QC 1N6PA 4Q47A 5MFPA 2IH5A 1K7XB 4OFZA 4HB3A 1PTKA 3HHEA 2P8JA 4JSRA 3R0QA 4V1CI 1CEXA 1GNTA 1Z2OX 2CCKA 1KNQA 2W90A 1CUIA 3OFVA 4YP0A 4C2TA 2QJFA 1FU7A 2C3PA 3GJQA 3P9XA 1D04A 3WG9A 1WD7A 3AXTA 4CG1A 1EM8B 3DA8A 2QLTA 5CDFE 1M6YA 4DHEA 4R2WA 4AZTA 3MW8A 4KQ9A 4B43A 1EJ6A 3I9NA 3PDJA 3BC1A 1VHJA 3W5VA 5EJ8A 1XGKA 2IF2A 5FQOA 5HILA 5FBVB 5DTMA 1UF9A 2SNIE 3KOOA 3T3DA 3MNFA 4UM8B 1KH2A 3NEPX 5FOWA 3RV3A 3D8SA 4EG8A 2H0RA 1FDWA 1DUIA 4NU8X 4CEHB 3LP5A 2ETVA 1XZQA 2P78A 3RSZA 3EH2A 1SCAA 4AIIA 4FEAA 2QPAA 3L43A 3MYRA 3W8RA 2FSUA 3IQEA 3ZC3A 1FW8A 3IIJA 5FOQA 5I51A 3NJ8A 4FUQA 4ZVVA 4P9NA 1QWOA 1IB6A 2FN7A 4DZZA 2FG6C 5E6SB 5INTA 1PNOA 4UARA 1I4EB 2ZRPA 2G0TA 2DLDA 1QC5B 1T4DA 1Y8QB 4NF2A 3RK1A 1RE0A 4DLYA 3TIIA 3KEGA 4S0ZA 1JYFA 2QMHA 4L9RA 1XTPA 1H2YA 3J81k 3ZHUA 3OJFA 1JMKC 4IXMA 4Y2QA 4BMCA 1N6OA 1M5TA 1W85B 5JVDA 4HVLA 1EWQA 2SHKA 3ITEA 5DE3A 5BN4B 1XKQA 1Z08A 5AO9A 2ZM6B 1DELA 3CJTA 5BORA 3ESYA 5TMPA 3FJOA 1Z0FA 3TG2A 3E3LA 2H9YA 4LVNA 2UYGA 2YHUA 3MPOA 1YB2A 3IDQA 1UK8A 3HZHA 4HUQA 4HWSA 5HKBA 1Y9JA 3ZQJA 2JGDB 3KJZA 1U7XA 1RLOA 5JWOA 1P0IA 5K03A 4F93B 3H9GA 1E6KA 4B75A 3A6HA 4PHFA 4CQJA 2JFOA 3TQRA 2PNFA 4BYMA 3A2KA 3V34A 1PNRA 4BV3A 1Q7TA 1M1YA 4F60A 5A4FS 1KDYA 2J3IA 4EAAA 3DBRA 1EVQA 5JQGF 3TZCA 3EXFB 3FDJA 1PFWA 1RAFA 5SZJA 3IAXA 2BZGA 1Z5VA 1E8DA 3C45A 3RVQA 2Q3HA 2GCEA 2IGTA 4HCJA 4C0WA 1UQUA 4ZU1X 3TSCA 2MYUA 5IBCA 2O2YA 5JIBA 1YE5A 1MG0A 3M49A 4UHEA 1DQNA 1G8KA 3BMCA 3CT6A 3GLQA 2P7IA 1EQAA 4PNPA 3HWWA 1A5SB 4ARSA 4ZA2A 1VMAA 3A27A 2UVPB 3EXG2 2NAPA 3UAGA 2PS3A 1JAYA 3G79A 4PSUA 2FW8A 4Y1GA 1AUOA 3H19A 4FYMA 7REQA 2VTBA 4FGUA 5TX7A 3MGBA 3VR4H 2LIPA 3BGSA 3M6XA 5K8VA 1CUFA 4X3CA 4XIFA 5KNDD 3NHKA 1CZLA 2CYBA 2XKBA 2IY9A 2P5UA 2I4MA 5G0WA 3WK5A 4LNHA 4E7OA 5AIAA 3IDAA 1U6KA 3RS3A 5FD8A 4Z4GA 3S29A 4BGEA 3O3CA 4O02B 3PD7A 2YHAA 4V0SA 3O5AA 3TNJA 3FWHA 3R3ZA 3EVTA 2YY6A 4Y2GA 2OCGA 2ZRHA 2F1KA 2GRJA 4NOLA 4Q05A 2CVHA 3NHYA 4QOIA 3H05A 4IHKA 3I9KA 4KLZA 4N0DA 1IMOA 1D5WA 5TT0A 2CFRA 2VH5R 1E99A 4E5NA 3D02A 3FMIA 4CODB 4XYMA 3B5IA 1H6CA 3AETA 2CHQA 3T7TA 1H2BA 1MEJA 4CTMA 4K5QA 1AKQA 4L22A 3HLTA 3N0WA 5E2AA 1QGED 3K2IA 2EJWA 3QUQA 9MHTA 2AZXA 1W2GA 2V3CC 3VKGA 2W2KB 3K73O 1GCUA 3K2EA 3QVMA 1Z6GA 4LQLA 3ENVA 4B3GA 5B57C 2XT9A 1E7WA 1JHVA 2XNDA 3G2HA 2NUPB 4TXJA 4IVPA 2BIFA 1KYXA 3BHMA 3FLEA 5F5LA 5J2UA 1Z4IA 1NVKA 1H3FA 8ADHA 5J43A 4OK6A 4U9HS 1H94A 5T3UA 1S8AA 2REXB 4UM5A 1ZD8A 4WNCA 4W5QA 3ETLA 1O0CA 1LLQA 1PD0A 1B3BA 1R4ZA 2BEUB 4HMQA 4RA6B 2JFPA 2RSLA 4LW8A 4DXHA 1N9GB 2HF7A 1LGYA 4O25A 5JNRA 2CV1A 4PLFA 2J32A 3R6TA 4XGNA 1EFPA 5BNIA 3B7PA 5EGNA 1AIPA 1P61B 2NWQA 4AZSA 2DH6A 3EPJA 1R27A 1D2HA 4EF6A 1V8OA 1DXOA 5CW1A 5FTJA 1VRCA 5A9SB 3NH6A 4KMMA 4NYIR 1GQFA 4OM8A 3URMA 4CM4B 3UPUA 3NVKI 1IN1A 1P44A 1ZWKA 1DPFA 5IASA 3V1TC 3SNKA 4TM8A 3GAMA 3I4LA 1TF7A 4A2QA 1T2NA 3N87A 4KWTA 1XTJA 5ALNA 4LF4B 4RQAA 1ELOA 1PG0A 1ZJ6A 2O06A 5J5CA 1JLHA 2I2CA 1I2CA 1BG6A 1T3HA 2ZT6A 5L6LB 3A25A 2GTIA 2OHFA 4NEQA 1A8UA 1Y1TA 4IIEA 1AJEA 1KZ6A 1DEAA 3NHJA 2X2FA 2CBXA 1V11B 2KBEA 4ICIA 4KQKA 2XWJI 3WYCA 5JI3E 1SR8A 1N92A 5B1DA 3E3OA 3ER6A 4XQGA 3MS2A 4JLVA 5BWBA 4FBGA 1CUXA 5EEGA 2OV2A 1NW7A 1U0HC 3IX7A 3K5IA 5CLFA 4E70A 1WXHA 3KUUA 3SDBA 2A5GA 5BQPA 3NIGB 4IILA 2WZCA 2RC6A 4ATNA 4EO4A 2Y1CA 4CYMA 1X3LA 1GTL1 1JR6A 1ZOIA 5I48A 2ZT8A 1KE2A 1BDJA 3S7TA 2DFKB 1XALA 1V4BA 4ZOEA 2QBYA 1KRXA 2C2KA 3IQHX 4ZZIA 3O3MB 4UUQA 4C7XA 4H2DA 4GMFA 1AS3A 1IHPA 2WSSA 1VXOA 3DDWA 4BBJA 5C3MA 2O2DA 6REQB 5M34A 5E0OA 4KWCA 1UXJA 2ZAOA 4LZJA 1J8YF 1R8YA 2FFJA 1K7SN 3E58A 2HK7A 1QHXA 4WDRA 2ZVPX 2DEUA 1C8LA 4JZKA 4YAFA 1V1RB 1TM3E 3DE2X 4NULA 3A9UA 3O94A 5L9AA 1WVMA 1TK2A 1KH1A 3G1UA 4Y3UA 4CR8A 1NBIA 5KWIA 2QTBA 2AG1A 1KVRA 3MMZA 4OGLA 4O0LA 4C1NA 1Y89A 2OHJA 3MFYA 4M9QA 2FN8A 4L27A 3QA3E 2I29A 1YQUA 1TU4A 4QWWA 1PQYA 3HBMA 4ENUA 4CXMA 4KH1A 1X14A 2DTEA 2BP7A 4ZVPA 3RD5A 1O9GA 4BLWA 4EA7A 3NV7A 4XWAA 4HNHA 4ZOBA 5HIJA 2DF8A 2NYUA 1DE0A 2R1ZA 2B2NA 3I73A 1II9A 2H5IA 2VF4X 1AX9A 3L8YA 4I9HA 4X7BA 1XFAA 2ON6A 4TZ6A 1V96A 3QYFA 4H7FA 2J3JA 3OD1A 4Q3DA 3HXKA 4RGVA 3BCRA 1LSSA 4O2BF 3R23A 1FB5A 3GN2A 4FR0A 4Q4AB 1F17A 1YHYA 5IDVA 4JI5B 3BD7A 4C3ZA 1G38A 1R88A 1H69A 4MLDA 3U2QA 3W4KA 2RD2A 1REQB 2AN1A 2VDOB 1TNDA 5CA0B 2QTVB 2OP1A 3NVAA 3RBXA 4C7BA 3PFBA 4KXLA 1PTJC 4B79A 4FN4A 3ES9A 3OT5A 4YXWA 3Q9UA 1CJUC 3LLCA 3OF3A 3PXGA 4HWPA 4E7PA 2X0FA 4XM2A 5DYIA 2P91A 4HLQB 3UUEA 4MUYA 1IJBA 1ND5A 3TJRA 1U81A 2G36A 2VAWA 2Y93A 3A36A 4M9CA 3LHKA 3RTCA 4BVBA 4C7OB 2B69A 3H0EA 2P6MA 1KKUA 3RR2A 2FSVA 4ETWA 3PSHA 2DFPA 3QMPA 2YC2C 3WMGA 4DAOA 4DR4B 2V4ZA 3AL3A 3CY6A 2YWHA 1A76A 1E1MA 4M9XA 2REQB 1HL3A 3P2OA 3A1TA 2I7TA 1KEEA 1DKUA 4NI5A 3UV6A 1GUAA 4WTOA 4XYGA 4XQ0A 1CULC 2H4WA 2G5CA 4N65A 3PFFA 4EG3A 1XG5A 2AEFA 5C2JB 2R3SA 2QTTA 1U65A 4PXAA 3S27A 2EHJA 2P2CA 4HTFA 3LKZA 1NVAA 5SY4A 4D82A 2VJKA 4ZGBA 3HYCA 2VC2B 2YUTA 5DXJA 1C9NA 2UZ4A 3MJCA 5E7IA 3D0RA 3IUMA 1ESDA 3W5HA 3QY0A 4ZRMA 4HEA1 1H2WA 4IJMA 2VF2A 2CXSA 5SV2A 1D6SA 2JEYA 1BDBA 1SWWA 1WX1A 5FPSA 3ZDFA 2O0JA 3QXGA 4BCBA 1X1CA 1I24A 2I4IA 1O57A 1HDZA 4CN9A 3JZDA 4LDRA 1PGNA 2J5QA 2CDAA 4BE7B 1Z0AA 3PE6A 4M0UA 6PFKA 1ZSVA 3NTLA 4KR3A 5BXYA 4ZO8A 2AR7A 1EDOA 5J2TA 1N1EA 2Y9PB 4REQB 3S2YA 3TFQA 3JALB 4CG0A 5BYJA 4D4LA 1M7GA 3PQ3A 4U3JA 3W5UA 1TEZA 1E9SA 2RKBA 4JLMA 4Q66C 2I78A 2DE0X 1CJKC 4U5QA 5HMLA 1FVOA 2QA5A 3TIFA 1NXWA 1R15A 3HVUA 1C80A 1YU9A 3E82A 4JX8A 4FFSA 3R8CA 4PYLA 4MZDA 3H99A 4D42A 3UPTA 2C2YA 1Y5MA 1FTSA 1RMQA 2HSGA 1HFEL 1NLZA 1SG9A 1PGQA 4QFMA 1WUJS 4YMIA 1CJCA 3D3NA 1UC5B 4MWOA 4OO3A 2IHKA 1EE9A 3OTQA 3K70C 1E5DA 3JALA 4GO1A 4B7XA 1HLDA 5HXAA 1KDVA 1W0KD 4IHQA 4PG8A 4DCPA 4JVLA 2QTLA 3KQMA 4R8SA 5F1OA 4BC0A 1UFRA 3O4HA 4KXWA 1QP7A 1TA0A 1OOEA 1EXMA 2OGWA 5KKCA 2ZQZA 3K0SA 3RSOA 1C1DB 3FCEA 5D5PA 3IEPA 2VPPA 2M1XA 4R2KA 5CM2Z 1NZFA 2B98A 2V7BA 2FTKE 4N3GA 3BWBA 5KHAA 4MKGA 5AJYA 5PGMA 1X8LA 1RPTA 2FQYA 2JBWA 2Q50A 4N1AA 3D2CA 4TV8B 5KHOC 5HQTA 4TT3A 2C2HA 3VR3A 4BLRA 4ZVLA 3NWJA 4HTFB 3FOFC 4PHGA 4RD0A 5IU6A 1ZWLA 1VDZA 1X7XB 2VTDA 4J91A 1QMGA 2FR8C 2HYDA 3FNIA 1IN7A 2Z2JA 4PQYA 5E3IA 3AEZA 1EWVA 1C4KA 2HMSA 1DCMA 4EI7A 1P1CA 4U39A 4AICA 5GAJA 3CNOA 1K4MA 4GPAA 4TL9A 4R3WA 4YV7A 3NFRA 2NU9B 3ZZMA 4KRFA 3WLTA 1CTQA 4MI3A 4O8ZA 4ECAA 1DBSA 3AEYA 4DQUA 4Q9JA 5L3QA 3C7CB 3ZV6A 2FSHA 2ZP1A 2J0EA 5AUPB 4FOOA 1E2JA 4IV0A 4JLNA 1SHKA 2B36A 1NUUA 1L8OA 4NESA 1SC3A 5IP5A 4ENWA 3HB5X 3WL7A 4DMFA 1FRQA 1YACA 3JQ7A 4CMHA 5KTTA 1CV2A 5KOHB 3X2FA 4S05A 4EATA 1NYQA 2BCEA 1GTG1 4RORA 2WJPA 1JTVA 3FSJX 1DBQA 1GQQA 3UQYS 3UJCA 3LY9A 4TMXA 3WDKA 5FBZA 4XWOA 4JX9A 2WU0A 3NORA 3IOYA 1KH3A 7AT1A 1NU6A 1Z8DA 5EE0A 1S1MA 4HGNA 2Q29A 1EWYA 2QD4A 4HP8A 5I45A 5JSUA 2Q2VA 5EQJB 3RVKA 3K9CA 3B9RA 1PWZA 3IILA 2QHXA 3WFZA 2X0IA 1CR2A 2C77A 1T43A 1SHUX 1V6SA 1D2GA 1WWKA 3P5SA 1GDHA 4HXYA 4MV3A 2B8NA 1P7VA 3VV2A 3NWPA 3NEJA 4ZEMA 2JGFA 1CZKA 1MIOB 3B1WA 1E1QD 3QLTA 4GXTA 3R3YA 3TJZA 1T2UA 3L1VA 4JSYA 2MCFA 4E5SA 4F72A 4HUTA 2ZCJA 3VDXA 4JYAB 3VMFA 3PC3A 1KS9A 2C5EA 4RK6A 4QOSA 2QMYA 4J29A 5ELMA 4GKJB 4G0NA 4BX0A 3RSGA 1NT2A 3EFOB 5LA6B 1CE8A 1PUXA 1TUEA 3DC2A 2CXNA 3SZLA 4C87A 4DLAA 1DXYA 1GIAA 5EWLA 5IRCD 4N8SA 1W4AA 3LC7O 3N07A 3A6FA 2JJYA 5GVRA 2VSXA 1OXVA 2FPPB 1T4MA 2P3OA 4DNFA 4L4YA 4YMVA 4DV2B 1NUSA 4BB6A 4PWYA 1LRJA 3HTXA 1GTJ1 3PGMA 1MN6A 4XX1A 2IFTA 4BAZA 1E9BA 3ULKA 4BNIA 5A0FA 3WWDA 4AJNA 4S12A 1QH1A 3P9KA 1BS9A 2PLFA 2JKYA 1XRQA 4RVNA 4J4HA 3ROQA 1A9OA 1SCNE 3LQFA 1Z4LA 4WPGA 5DI3A 3R3VA 3VGJA 2ZRKA 3D0OA 5IM4F 1OBVA 1S8FA 1Y42X 4IJWA 5L3ZA 4X6XA 4DA0A 5LLTA 4I4TF 5D7BA 3Q72A 3NYIA 3WL3A 3AKCA 1TMKA 1J1UA 1J25A 1UXOA 1JEOA 2ODQA 3L4BC 7ADHA 3PHBE 4OAQA 2GAOA 4TWZA 2C2MA 2NXWA 1EX7A 3O9VA 3B2NA 2W4QA 5DP1A 3N8GA 3QWAA 2YMPA 5IXSA 3PCRB 4QU0A 2BSQA 5LZ4A 2HAEA 2JL1A 3KEQA 4A8PA 1B6RA 1PR0A 5I9BA 5JQGA 4DSAA 5IZ4A 5DWVA 2P35A 1R37A 2FSSA 2Z3VA 2IPOA 4FLEA 2YZMA 3FW1A 4OCZA 4RUKA 5FDFA 1X1AA 5CB4A 1LNSA 1YRYE 3IVMA 2KHZA 1GN9A 4EFDA 1K9SA 1V5EA 2W8BA 4P38A 2H4YA 4O4JF 2ODAA 1JQBA 3LK7A 1ZD1A 3V8PA 3C5CA 5G1NA 4JBNA 1NPTO 3MWDA 1L5MA 1SVIA 3LQ1A 5KSWB 1MQ8B 4WXMA 1HE2A 1OR8A 3DAYA 4ZEXA 5MN5A 3CURA 3KAKA 4FCCA 5A6SA 2JJ1D 2DWPA 3B3FA 3KQPA 1L4NA 2D0DA 3OX3A 4O3FA 3HXTA 3EEQA 4XUGB 2XBMA 4H6WA 3OUZA 3BWVA 3UW1A 2EGGA 2BEUA 1UP4A 5KAMA 3FKJA 4F8JA 3DHYA 2CSUA 5MF6A 2QYHA 4MW4A 521PA 1W87A 4POAA 3WNBA 5F33A 5HFNA 3DE3X 3TI7A 4E33A 3ROXA 3KKKA 2ZUVA 3EG5A 4QGHA 4BQRA 3GPBA 3UFXA 1D9ZA 1ZI8A 2OHOA 2W2KA 5DWQA 3O21A 3OT1B 4IWYA 3N53A 4GP7A 1D4FA 3ABZA 2EQ5A 3A7DA 2QZ4A 2E4WA 2G7ZA 4BECA 3RYCB 2A9KA 3GLSA 3RSSA 4F5ZA 3KPJA 1N1DA 3VKVA 3HGMA 2HJVA 5EPOA 2QP4A 5HKKA 4I1RA 3FRIA 4UBKA 2ZBPA 5CEJA 1KMNA 2GN6A 1BWRA 4S35A 3EVFA 4YJ3A 3TCNA 1W25A 3IE2A 4C4OA 5DM1A 1M0EA 1CLEA 5FWYB 4HGPA 2YMQA 4NWIA 2IZOA 3G3EA 3UAZA 5BOSB 2D1SA 3GRYA 4HEQA 2DGDA 1XRSB 3L7LA 1BE1A 3JQ7B 4DV0B 3K72B 2CEAA 1YJBA 1XRRA 2IH4A 2WPDD 4LC1A 3V3TA 1E9EA 3C43A 3KTDA 3M6FA 1SZDA 1PP4A 4WKOA 4XSVA 3M89A 4BATA 3TG8A 2Q5CA 4PC3A 3FNBA 4CUJA 3HJFA 2PZBA 2R68A 5C35A 2FR0A 1KJ9A 1SKYB 4MW6A 1DC8A 5BR4A 3HWRA 1L4FA 3M1YA 4XFDA 4BAUA 1E2PA 1P1BA 5FI1B 3FY4A 2J33A 1NBWB 2NQ2C 4LRTB 5G0VA 4ZVSA 1U2GC 2DB3A 1JVNA 1QMPA 2PY6A 1S5PA 1FJXA 3GLUA 5CG1A 5EXTA 3NOQA 4KR7A 4DG8A 1OFUX 3COSA 4QTXA 2OC9A 2JAHA 2NZYA 3OY2A 3UG7A 1Z74A 5LQNA 1EH5A 1E3EA 3EBOA 2P65A 4D5EA 4PNZA 2IUSA 1GPBA 1UBUS 2CLIB 3M9LA 2JCSA 2R0QC 1G21E 5KDDA 1U0SY 1J20A 1YS7A 2BH9A 3SFTA 2A92A 5FV7A 2MSWA 2GNOA 5LQSA 3AVVA 1OYYA 2CY0A 1DKMA 1VGVA 2HRRA 2IBTA 1NAHA 3H4MA 2WFAA 2GLXA 4R1PA 1IHXA 1CP3A 1ZAKA 3PFHA 1F14A 4E22A 3JQGA 1U0RA 1C1DA 1M0WA 1Z5UA 2PH1A 1NOIA 3EXIA 2I0FA 2VPQA 4FZ3A 3BWMA 3OOSA 4LZNA 4ND7A 4PFSA 3UATA 1E5VA 5AW5A 3OJLA 4M49A 3A9CA 3BXZA 4MLPA 4OB6A 2HQBA 3BQNB 4H7DA 3PUKA 4RVCA 3CWCA 5DX0A 2Y99A 3RKSA 4EMSA 3S40A 2Q1XA 3T7JA 5ES3A 1XMQB 4IINA 2N1BA 3DZIA 3Q41A 4TVKA 4MVWA 1R8JA 3G8YA 5JY1A 3L4KA 2GCOB 5KYXA 3ICOA 3TD9A 3R7WB 2ZI3A 4B80A 1RLJA 5JD6A 2IZ6A 2CBGA 2EQBA 4G37A 1QC5A 3E7PA 2VP9A 1D1TA 5HM6A 3D6JA 4MYRA 1KK0A 5GGYA 1O6GA 1VCMA 3WL4A 4DN6A 4ZTZB 1NXSA 1TGVA 4I8XA 2XMBA 3GJYA 1E6UA 2H18A 1I33A 1YC2A 3C4JA 3I53A 2AQKA 4L95C 4DSOA 1SEPA 1A0OA 1HLPA 1QOQB 2GPBA 3QNMA 4JU9A 3H0CA 3VNSA 5CCEA 2R6FA 5FHRA 1LWOA 3BMQA 4WY5A 3T95A 4D8TA 2HHHB 2GKSA 4AJEA 4FWIB 2ZM5A 1PZGA 3H04A 2G9NA 1YR1A 1VMEA 1J8FA 2FW7A 3RTGA 4EEXA 4V2UA 4UXHA 1Z4OA 2VHYA 1UAAA 1FMFA 2UKDA 2NV0A 3O0TA 1I2AA 4PPQA 4ZQHA 3ENKA 4KJZA 5CT6A 4BGUA 1WMEA 1ESZA 3OPXA 4UULA 3QLUC 4IHJA 5J63A 4G97A 1RRPA 1GRVA 3ND8A 4EQ6A 4BGIA 2OCBA 1KWGA 2W6QA 5IC6A 2CUNA 4AUNA 4ND8B 1PJ2A 4II3A 2R1TA 1QPBA 2WD8A 1K8XB 3BIOA 1U2TA 4JYPA 5F77A 4ZVTA 1F8FA 4BTEA 3AEQA 4K9PA 4OI1A 4JS0A 1RDFA 3JD3A 5I7VA 1RWWA 1DGQA 3PL1A 5CDUA 3V3KA 2R8ZA 3L84A 4M8LA 1Y6GA 3KEMA 1BXGB 1MHPA 2ZVJA 4QU9A 3M8KA 2KWIA 4MAAA 4QD3A 1FJGB 2ILVA 5K9ZA 1DAFA 1JL3A 3BMNA 2R4TA 1R8SA 3K0CA 1CP2A 1UZLA 4EB3A 1XRPA 4OQMA 1SIWA 1SBIA 3K92A 3LC0A 4NQZA 3VMMA 1ULSA 2JFBA 1K98A 121PA 3NVMB 3BMOA 2JLRA 1J1IA 2F3QA 4AMBA 3B1JA 3B1ZA 5JV5A 4QGAA 1XBTA 2EBWA 1R0XA 3HWX1 4Z9BA 1BJKA 1XD9A 4DLUA 4YIKA 1PEKE 1XCBA 1JIKA 4QU5A 3VHXA 1MABB 2E3JA 2Z83A 4BVJA 1YB6A 3IJPA 3QM1A 4HH0A 4CZ2A 4FIDA 4JCOA 2GPAA 4CM8B 1UT6A 3UWKA 2C0CA 5KVSA 5T7BA 2O8DB 4ITVA 1RXVA 1CQJA 3OEYA 3Q0EA 1KDOA 3EIHA 5JMOA 1KR5A 4V39A 1KQOA 1XF9A 2JAWA 2QVGA 3K9HA 3C5EA 1GCOA 5HDBB 5KVCA 5KWEA 2BFFA 1SFRA 4HDNA 5E9WA 1IZYA 2RH4A 1NN3A 3IPXA 1DRUA 2C1EA 4YRBA 4KIFA 2I34A 3GEIA 5FBHA 2J1LA 2C95A 1WCIA 1ATIA 1G21A 3KLPX 2IHJA 3ZDDA 1ZCBA 4DQ0A 1MU0A 3D2BA 3RU2A 4CLRA 3GPLA 1GG5A 3G23A 1UC9A 3MA0A 4HH3C 1RCUA 5CM9C 4JB8A 4GG1A 4EJSA 1G291 4LHWA 3WZLA 1QB7A 4TUYA 4TKMA 4BQPA 5CAEA 5CM8B 5DLYA 4IZIA 5DI9A 5ALTA 3WIEA 4FWBA 3OQHA 1COWD 2XYPA 2PANA 2EBUA 4G1CA 3VJRA 3QE2A 5ECGC 1G8YA 5HM8A 2GD1O 3GAAA 5DF1A 1EFCA 2DY1A 5DN6A 3VNAA 4AJ1A 2ZJ8A 4Z9AA 4AO8A 1DIOB 1C9MA 1DKRA 2PLAA 3ASUA 4KUHA 4GPEA 3N8HA 3KDPA 4X20A 5FL3A 2OPHA 4BVGA 4E11A 4N41A 1VHQA 3OTWA 4BEBA 1E1CB 1O8CA 2ZJ5A 4IJUA 5IK2A 3G9ZA 2IOFA 3C3EA 5BO5A 4YV2A 3CEJA 4PQRA 2P9BA 3NKFA 3P2JA 3DJYA 1KDRA 2XMPA 3A14A 3PG5A 2E49A 1FP6A 4P6VF 2GD2A 3D4PA 3C7AA 1PNVA 2BJVA 3IEXA 3LKBA 3PJDA 3GGSA 2EGHA 1G9TA 2DHQA 2DFVA 1SCUB 3C7DB 3ZQ4A 3ZZTA 2PR2A 3ANSA 1XI2A 4JT4A 1MTZA 1O4WA 2QBYB 5JZOA 4KQHA 1V3UA 1RAAA 2KE5A 3PIIA 4GKBA 3ZCQA 1ARZA 2WTAA 5FBQB 3IP9A 1ZITA 3GELA 1LC3A 3SPXA 3X1YA 1L7NA 5ALSA 2I99A 4ZT6A 3WY9A 3AEUB 3N59A 1V1MB 5T6MA 2F2TA 3A4TA 2CSXA 2HU8A 1OI2A 2VR1A 1JZTA 2CZGA 4K6OA 4COOA 2FZ5A 2WT8A 5ENVA 3EIEA 4YCNA 3KU4A 5ICFA 3BEOA 3BTOA 4D57A 1GR0A 5GINE 3HUFA 3QXXA 3D3WB 4JLJA 3G2JA 2YHSA 3DWIA 4C5BA 5BT9A 4O1MA 3A37A 1XZNA 5I9IA 3N5CA 4BRZA 4MCJA 4NJOA 1N57A 3T6KA 3G0BA 3U81A 5C1DA 2HK8A 3TPCA 1OD6A 2BKVA 2GILA 2J3HA 3CG0A 1Q0RA 4YRZA 4HGYA 1GTMA 4GAEA 3G1WA 1GSOA 3RADC 1VIDA 1EBBA 4B4OA 1SZCA 1MJGM 1ZQ9A 1I1NA 1R9NA 3UGTA 5IJAA 5C37A 1NTRA 1EK1A 1SD5A 4QDUA 2X4GA 4BY9E 4DMMA 1BWQA 1V43A 3Q3GE 2OLJA 1VHLA 2V3WA 5HKOA 1J07A 2OGUA 5IBQA 3TQOA 3FNFA 3N1UA 1CXZA 1P72A 4O5AA 4QG7A 3N86A 2BZSA 3ZD9A 4BTLA 4TKVA 5ALFA 4YRDA 1ISPA 2WJZB 1EK6A 5KIAA 2HHAA 1R1DA 2E37A 3TB4A 3TGPA 1V2GA 8ATCA 1L7BA 4KYIB 1BYUA 5IJ0A 3ISTA 5KQLA 4HNRA 2XSZA 3AM3A 4I4NA 2FMKA 2AEJA 2WHQA 4Z4EA 2Z2XA 1DO2A 4Q4LA 3T94A 3W7BA 1QHYA 1VFPA 2WT4A 3VISA 1G5PA 5BW4A 2PAAA 3ZW8A 1OV6A 2PUTA 4HFNA 1N5KA 2B9VA 2BMFA 1K4KA 1U4NA 3R3SA 4F6RA 1ZMBA 4M2LA 1EUQA 5IABA 1J24A 4PIMA 821PA 2YN2A 3FYDA 2X5OA 5LXTA 2MHCA 3KG2A 4YR7A 1QH9A 4KO2S 4BP8A 1O2DA 1MTOA 2VTKA 1KP2A 3C4QA 5BW6B 1JU3A 2OZLA 5BQ3A 2EBFX 1U0GA 4UFOA 3U4QB 2W37A 1B6GA 4DCVA 3PUIA 3O8BA 2ZSKA 1CQJB 2FPOA 1BX1A 1MNAA 4LBVA 4D9GA 1OCEA 1H93A 3DQPA 2C82A 3QUTA 4RK0A 2LBPA 1IWPB 1K6MA 3K30A 2V7XA 1U9IA 1TIPA 1DIHA 1CUBA 1TCCA 3BS4A 3N2LA 4MVJE 3A0UA 2HMWA 4L4RA 1HDXA 2IY7A 4OSPA 1DIBA 1L4KA 1QLJA 4DVJA 5DNCA 4J94A 1BA2A 4DQXA 4E4YA 1FPQA 4HR7A 4HNGA 3WFIA 1E2BA 3L8DA 2OBMA 1Z5PA 3RC1A 1P81A 3UKDA 4Y1EA 1IOLA 4B45A 5CA0F 2UVPA 3BBLA 3DEJA 2CE2X 4A6DA 4EP1A 3EPLA 4KWHA 3ILHA 2DHDA 2JIOA 2LTAA 5JYBA 3D7SA 2QZJA 4E0BA 3LCJA 4CKEB 2BGGA 3CLRC 4OBXA 1TJPB 1HRKA 2O7RA 2YJ3A 3EMVA 3F5DA 3SS9X 5L3SA 2BHTA 2F3RA 1XZLA 3LSYA 2JLYA 4R2MA 5J5AA 4WACA 5DX8A 4X00A 3H0KA 4OMCA 2F8TA 3QQ5A 2JLXA 2JFZA 4F6CA 1LX6A 4LGYA 4DR1B 2VHQA 4Z4IA 3CVXA 1OVMA 4ZYVA 1M1YB 1B14A 5ALOA 3HEBA 1XZAA 2BI7A 5AYVA 3V46A 1WB5A 2P67A 1C8BA 1ORHA 3OHPA 5IBRA 4ER3A 4L57A 4LJ7A 4YJGA 1P18A 4EIWA 2ANBA 5IVDA 4Y8VA 1JBQA 4C30A 4OEHA 4RHFA 4XR4A 1TKBA 1ZUWA 421PA 4EDFA 1YGYA 2ODBA 4JQYA 3I2FA 3TQTA 2VAXA 3D8BA 4KWIA 2QN3A 1L5FA 5E0KB 1O6FA 1SUIA 4GPTA 3CLUD 4KSCA 4TSKA 3I6BA 1JZSA 4AO7A 1D6NA 3BWCA 2I3DA 4RHCA 1TE2A 1UWLA 5IJZA 3BEDA 3L41A 1RXUA 1NDUA 4R4JA 5DCYA 1JGTA 5HF8A 2AI2A 5EGSA 2ZUDA 5A02A 5I47A 4LCBA 4PSVA 1XHFA 3F9IA 2VHCA 3FIJA 3E3NA 1D07A 3M6LA 3OLZA 3R5TA 4MVJI 3WNDA 3H17A 3LUGA 4MGHA 3LC2O 2BONA 3OZUA 1GAWA 3TNFA 4R54A 5TPZD 4W7IA 1KIAA 2VT6A 2B1RA 2Y3IA 1WOYA 2GHIA 3DR3A 3ODGA 4MOWA 2PL3A 3AK4A 1YDMA 3T3HA 4C7MA 5HUQA 2JFUA 1N6KA 4JXJA 4MJ3A 4ENPA 1DO0A 5I7SA 3LXUX 2KLBA 1E58A 3TTYA 2UZ1A 4OSOA 4U6SA 1IUOA 1OX5A 3A0RB 1C3JA 1X1DA 3HK2A 1TI7A 2I9PA 2J6HA 2K2WA 1NMZA 1P5JA 1WV1A 2Z5VA 3BSFA 4XFKA 4GBED 4FS3A 3MWJA 4R1MA 1Y33E 2VUUA 3ETGA 3ZLVA 2NVUB 3IPCA 1KFKB 1EXWA 3GNTA 3INYA 2Q45A 4E2WA 3FLAA 4WK4B 4WHMA 3RVOA 1UKEA 1N77A 2RC5A 3HJBA 4L4UA 3GIWA 1GO2A 5G41A 4DIEA 5A3JA 4RS3A 5LYJF 2XOXA 1CY2A 4P7FA 1QHGA 4UBOA 1CQPA 3MLBA 4X62B 4FFVA 2NVWA 1P33A 2CJXA 3TPZA 3UMSA 1KZ7B 2FMUA 3LPLA 3ZZNA 1LFDB 1V7ZA 2FPSA 1NQOA 1Q3HA 1RS0A 4U9UA 1L5SA 2F8SA 2E6UX 2CC2A 4RVSA 2EF0A 3SMQA 3I9LA 4HNQA 1RJ9B 1W59A 1FTYA 1WDMA 2BUAA 2RBKA 2YYYA 1DT5A 2PJDA 2ZCUA 4FYXA 4IFIA 5ALKA 5C1IA 3WISA 1JHXA 2JGRA 2ZI7A 3KWFA 5D2CA 4BRWA 2Q6TA 3O82A 2Q9CA 1QYRA 4DUYB 3ESCA 5B3LA 5AVJA 4WL0A 4F12A 4TQUS 3F3MA 1L5LA 1VXRA 3AJAA 4TXMA 1YOVB 4E3ZA 3DKVA 2AVNA 4XYEA 5BSMA 3PU6A 3ZE8A 5LNK6 2YY5A 3C48A 2W93A 4KE8A 1BJTA 4D79A 5CFPA 1SXQA 3ZE0B 1QIKA 1UJNA 2XYHA 1QUFA 2EYQA 2G1JA 3C1UA 3EWSA 1K5GA 3GCGA 4RD3A 3WNCA 3CXRA 1KAGA 4HNAB 3T7RA 1W30A 1MO5A 1M6NA 3DS8A 4IHAA 2X2EA 2X9NA 5AQEA 4E12A 1PCXA 1U8CB 2PUWA 4E88A 4PYKA 1OAAA 3BN3A 1Y5NA 2VQ3A 3F90A 1N1GA 2EWMA 2GB4A 3B70A 3L06A 2CNBA 3KYCA 1OWNA 2P62A 4L7VA 4UDXX 4C29A 4UEKA 4BEWA 1BGXT 4YAGA 2ZI4A 2V7QD 3U4MA 3GCZA 4MUGA 2GWHA 2NZVG 3N2IA 5CCXA 2QM0A 1HTWA 1E7RA 2XOKD 3RHSA 1T29A 3E84A 2IDMA 3HJTA 5A6SB 1YMUA 1B0PA 2KX7A 2UUPA 3IHLA 4IWXA 4ZAZA 4X45A 4EYQA 2JZOA 3OQOA 3W2FA 4EYSA 3LX6A 1O95C 3A1DA 2AC4A 3A28A 4WH0A 4XGKA 1J2YA 1RPNA 3TR5A 4ZXPA 4D0RA 5L7TA 3IPAA 2ZR0A 5HZHA 1QFYA 3GF4A 4WZAB 3ZU6A 5JZMA 4RHXA 1U63A 1C8VB 1ZD9A 3F4KA 5TS3A 2H2GA 2BBWA 2W2LD 5KREA 4PLPA 2ZRCA 2OXCA 3KSRA 4E03A 2XB6A 4Z0HO 5JAMA 3OURA 5CXXA 1KO4A 3V5NA 1LEHA 3DTVA 1Z18A 2CL5A 1QCYA 4HAOA 5ICMA 5JQGB 2RG7A 3O90A 3OX1A 1HE8B 4C20A 4DA6A 1PR1A 4YCCA 1N5RA 4E14A 3E81A 3G0OA 2H31A 4HPWA 4N7MA 2QOEA 5KUTA 1DC7A 4IDQA 1AQNA 5IN5A 3RYCA 1XKLA 2OENG 3RRNA 2XUDA 1TQHA 1PJRA 4Q39A 3AHJA 1WAMA 4NP6A 8AT1A 4MKXA 4WDQA 3T7IA 3UMCA 4RQUA 4LXIA 5GJCA 2OZKA 1DAGA 4FTWA 5CBKA 2QAGB 3LT4A 3TLKA 1RRKA 3U9T<