3DOWA

Complex structure of gaba type a receptor associated protein and its binding epitope on calreticulin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
b'GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid receptor-associated protein
publication title Structural framework of the GABARAP-calreticulin interface - implications for substrate binding to endoplasmic reticulum chaperones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dowA00
4HWIB 1WGRA 2K39A 2C7HA 2GOWA 4KVGB 4HPMB 4FJZA 5L95C 5JHAA 4II2B 4BOZB 5J18A 2KVRA 1A5RA 1P98A 1RLFA 3N30A 3PSEB 4ANUA 4LCDE 3ZNGC 1P3QU 3OJ3A 2DZJA 4IW0A 3UIPB 2LRWA 4RMAA 3SU8X 2KTRB 3A4SC 3CF6E 3OJ4B 4AWJA 4DHZE 3VAWA 5IA7A 2O6VB 2NBWB 2JPHA 3VQIA 1NDDA 4JGHB 3L10B 4FN2A 4DBGA 1E7VA 3AI5A 1Q1OA 4BKTA 2LVQA 3MJWA 3VUYA 3DVGY 1XT9B 3U7DA 1WZ0A 2LGXA 5AEKB 4IWOA 3ZDTA 2K6DB 3MTNB 5C23A 1OTRB 1WMHB 3DBRI 4JIOU 2DAFA 2I1JA 4ANWA 2BF8B 1WXAA 2R2OA 1C1YB 4E71A 5LXIB 2O2VB 3LDZE 2N7DA 1E8XA 1XQQA 2C60A 3PV1A 4IM2A 3V62A 2UYZB 3TMPB 2LRUA 4W9IA 3N32A 2K8HA 3NZSA 3EC8A 4KIKA 4NJ7A 1H8CA 1E8WA 1EF1A 1OEYJ 4MH0E 4NNJB 5FR6A 2FAZA 3ML9A 3PS6A 3PRPB 3R3MA 4LDTD 4ASWC 1P0RA 1M94A 1E90A 3QC8B 2O6VA 3ZIMA 2BKFA 3A9KB 1WIAA 4KDIC 2D07B 4A3PA 1V80A 2KWCA 5DPWA 4FADA 2J0KA 1E8ZA 1SIFA 1UBQA 1ZKHA 2WX1A 4FLHA 1E8YA 4K7UA 4ANXA 4GIVA 3L54A 3ZW3A 2ZJDA 1E7UA 2MRPA 2PEAA 2L8JA 4PS7A 2EKEC 2LASA 3L16A 4IUMB 3ML8A 3QA8A 5E6NA 4F1SA 3WAOA 4J6IA 2ZPYA 2FUHB 1TTNA 1UH6A 2OOBB 3DOWA 3TL5A 4KDLB 5LXHA 2V4LA 4GOCA 4GXBA 1WGGA 2G45B 3UF8A 2DYOA 4W9GA 2LZ6A 3VUWA 5C1ZA 4DHJD 3EHVA 2BYEA 1AARA 2HD5B 3JW0X 1PQSA 1J8CA 2G4SA 2FCNA 1UGMA 2WYQA 4FULA 3A1QB 2C7NB 3VFKA 4CYEA 2XEWA 3QJZA 2N1VA 1EO6A 3VH4B 1I35A 2Z59B 1ZW7A 1WJUA 1VCBA 2N1WA 1WXVA 2FNJB 5CHWA 2AYOB 2PE6B 2WDTB 4BBNF 4BOSC 2KDBA 4GU2A 3VTWA 2JWZA 2JUOA 1V86A 5CHFA 5BO4B 3DBHI 4WJPA 3Q3FA 3VXWA 2R2QA 3NHEB 4KV2A 4B9KA 4F8CB 3GZNI 1WF9A 2MX2A 1BT0A 4A3OA 2J0JA 5J2RA 4FBJB 2DX5B 3QCAA 4MELA 2CHZA 3X0WA 4WQOB 1OGWA 3ZUNA 4PYZA 3BINA 3L08A 3PVLA 2L0TA 4MSQB 1WGDA 1NI2A 1H4RA 3PZDA 4TUUA 3PRMB 1YX6B 1GC6A 1Y8RC 4MEMA 2K8BA 3MHSD 4EZLA 4G0NB 4AJWA 4EKUA 1FXTB 3OAWA 4II3B 4EZJA 2B3AA 4B95A 2LGYA 2GBMA 4HDQA 2MW5A 4TQ0A 2BPSA 3PGEA 2JXXA 3M62B 3V6EB 2BKRB 5HKHA 3ZVVA 3ZTDA 3EECA 4GSWA 3CMMB 4PS3A 2NPTB 4KSLC 4W9JA 2D10A 3L17A 1WXSA 1WFYA 1GG3A 4XX5A 3ZDMC 4EZKA 1V2YA 4HCPB 3H9DA 4G11A 2KWVB 3M63B 2L05A 3L13A 2FCMA 4DK5A 3W1YA 2D11A 3ALBA 1TBEA 4IC7B 4EOYA 3WA0A 4P7IA 1SGHA 3SD5A 2IYDB 2Z0EB 3JSVA 4WAAA 2K25A 2XBBC 2ZNVC 1I42A 3ZRCA 2ZPNA 4KIKB 4HXDA 1LQBA 4AP4C 3ENEA 2KZRA 4HVBA 1XD3B 2KDEB 2KMAA 5IAAC 2KC1A 5J17A 2C7MB 3SDLC 3UINB 2KKCA 2KDIA 2RGFA 2AWTA 1YQBA 2KQSA 1LM8B 2W9NA 4PYUA 5L83A 1GUAB 3DVNV 5JH5C 3T8MA 2NPTA 1Q0WB 5CX3A 4HDOA 4KSKC 3ECIA 1VD2A 2MQJA 4OVUA 1R4MI 3H1UA 1MG8A 3QHTA 4DXAB 3H6NA 2KDFB 2KLCA 4URKA 3KW5B 2XK5B 2EMTA 2BWFA 2N7EA 2IO0B 2YLMA 2ZZPB 1UD7A 3R7RA 1WI0A 5G55A 3APFA 4X57B 4WJQA 4IWQA 1EF5A 2KMCA 5EDSA 2GBRA 2LXCA 5D6JB 1V6EA 4WWOA 1YX5B 2ZCCA 5DPTA 1WX7A 2MCNB 4F7ZA 4ZRJA 4AUQC 1S1QB 2DENB 2NBUA 2K8CA 1V5TA 2N4FA 3UQBA 3AULA 2YVCA 2KQ7A 1WX8A 2PJHA 3HHMA 2G3QB 3WAPA 3ZNID 3ONSA 1V49A 2ZCBA 3RD2A 3WANA 4BFRA 2N9XA 3P2BA 1F9JA 2KX0A 3PHXB 2IO2B 4MGYE 2LWPA 4NAWA 4ZRKA 4PS8A 5AZGA 2LUEA 3KYDD 3PT2B 3B0AA 3K9PB 2KFJA 4GDLB 2BGFA 2XK5A 3ZKJC 2M4NA 2PPHA 4TQ1A 2MA9B 3IBEA 2IO1B 1LXDA 2JRHA 2MP2A 1WJ6A 3RT3B 2KNBA 2QHOA 3PREA 2FIDA 4EFOA 3A9JB 4IM0A 5D2MB 2CU1A 2DYBA 2M1MA 3DDCB 1X1MA 3QWZB 2UWQA 1G6JA 2FIFA 3W1SC 3KUZA 2MBEA 2D2QA 3OLMD 3VH3B 2A4ZA 2BYVE 1LFDA 3VUXA 3WAMA 1ISNA 3ZNHB 4W9LA 1Z5SB 3I3TB 2D3GA 3AU4A 2NS5A 5CTRC 1GJZA 2ASQA 5LLIA 4M0WB 4A20A 4FHKA 4DDID 4N9F4 2CHXA 2L76A 2LXAA 1KM7A 2G4DB 4LJPB 1L7YA 2KWUB 2JT4B 4GDLA 4RM8A 5DPSA 4MGZE 4NJ6A 2L7RA 2GBKA 2IZVB 4IG7B 1V81A 3A9JA 3APCA 3CSFA 3O65B 4FHJA 2KHWB 1C3TA 1WY8A 4MJSB 3JSVB 3M3JA 1GNUA 1QZEA 4W9DA 1WE7A 3V6CB 4NQLB 4OVVA 2FCQA 3KH0A 4KZ0A 3VVWB 4LDTB 2DHZA 5KHOA 2KK8A 3GOEA 2RR9A 1YD8U 3ZO5B 2V1YA 2RD0A 4E3CA 4BVUC 1WM2A 1IYFA 3RCZA 3PRZA 4B6WA 2Y5BB 3TIXA 4FJYA 5E6OA 2C5LC 1WX9A 2LVPA 1KLVA 2MBHA 1OEYA 3A4RA 3IFWB 3HIZA 2M17A 4W9FA 4JLCA 3SHQA 2MBQA 3NY5A 3DCGA 4ICUA 4MDKE 2KXJA 2N9EB 4CHKA 2JVCA 3KUDB 3A33B 2LVOA 3QIJA 2REXA 2DAJA 2ZVOA 3AXCA 1WJ4A 2JF5A 3HM3A 3Q3JA 4IM3A 1K8RB 4BKGA 1UELA 4AOFA 4BBNC 4MJSA 2VRRB 2HTHA 3V61A 2DYMA 3LJ3A 3QK0A 3PTFC 2KJHB 1IPGA 1YIWA 1CMXB 4G3XB 1WRDB 5DPRA 4W9KA 2IBIB 2K1FA 3X23A 3RZWC 4DHJB 2EMSA 4LJOB 4NPNA 3VHTC 2MBOA 2Z0DB 5JHBA 4ANVA 1V5OA 1SE9A 1T0YA 4RM9A 2KC2A 2KD0A 1U4AA 5G2NA 3VTVA 2LGDA 3H7SA 3QAQA 2DZKA 3BY4B 4WJNA 2JZ3B 3NZUA 4MGIE 3S2AA 3W1SA 1Q5WB 3R7QA 2ZEQA 5JZEB 2ZVNA 2RPQA 1KOTA 2KJ6A 2BYFA 2L00B 3IG3A 4MGKE 1EUVB 3D32A 1WE6A 3DPDA 4TKNA 1S3SG 4NAWB 1WXMA 2KN5A 4XZ4A 1NBFC 3RUIB 2WWZA 2L3ZA 2CHWA 3EFUA 4KZCA 3RZFA 4GB9A 3C0RB 3DVGX 4GDKA 4E74A 4BKSD 4W9EA 4WWPA 1WGHA 2MP2B 2OJRA 4K7WA 4JQWC 2BWES 4K1RB 3ZRFA 3VTUA 3VDZA 1OQYA 4I6LB 5E6PA 2NVUI 3H7PB 5AZHA 4DWFA 1GC7A 1P1AA 2AL3A 4M8MA 4JL9A 1P9DU 1WR6E 2AEHA 2IY0B 4HCNB 3UQAA 3IHPC 3UGBB 2ZNVB 1E5WA 1TZ1A 2KO3A 3R66C 3WIMA 3L0WB 3K9OB 3B08A 4NQKE 5TR5A 4W9HA 3TJPA 2MSED 4ICVA 4W9CA 2KANA 1V9JA 2J7QB 2DZMA 2KTRA 2MLBA 3DVNU 2KLGA 4GN1A 5KHQA 2KX3A 2CR5A 2IY1B 2LD9A 4MSMB 2K6QA 2MWSB 1WZ3A 2KJRA 2NCNA 4HJKA 3KYCD 4FJVB 2LI5A 2LJ5A 4DDGD 3H7PA 1WMHA 1WYWB 3JYUA 4ZYNA 1RAXA 4K81A 1JRUA 2IO3B 3HK0A 4MM3A 4FA6A 2O2VA 3PLUA 5AZFA 2HJ8A 5GMVA 4ZRIA 3NS8A 2FCSA 2C9WB 4ZDVA 1WGYA 1RRBA 3DBSA 3M95A 2AL6A 2J0MA 2CKHB 3N3KB 4K7SA 4NY0A 3ZNZB 4I6PA 2HE7A 3IVFA 2GMIC 5DCNA 1ZGUB 3NOBA 2KOXA 1RFAA 1UZXB 3DQVA 2NBVB 2O6VD 3KUCB 3A9KA 3KVFB 4HK2A 3ZTCA 4CO7A 3RYTA 1R4NI 2KFKB 1IP9A 2N9PC 4AJYB 3RULA 2JY6A 3DBLI 2JZZA 3T9LA 3HM6X 3ZLZA 4XC2A 1WM3A 5D7GA 2A5UA 4GMVA 4YL8A 3JVZX 4EUTA 1D3ZA 2RSUA 4TV3A 1KJTA 2CS4A 3QQ8B 1J19A 3U8ZA 3U30A 1TGZB 3AU5A 3TCAA 2WX0A 1UBIA 1HE8A 3V60A 3WALA 4HLEA 3B1LX 3QX1A 4WWNA 4WJOA 2L0FA 2MBBB 4HPLB 3PHWB 3QARA 4M8NA 2KTFA 1YJ1A 3PLVA 4IWPA 2KFKA 2M0XA 2DZIA 3A1QA 4G50A 4GDKB 5CHVC 2I1KA 1WH3A 3CSTA 3PPAA 3TBLD 4BKSA 3APDA 1L2NA 1Z2MA 2GBNA 4DHZB 2JRIB 2GBJA 2M8SA 2NR2A 4EEWA 5D94A 1WR1A 2V3SA 4GGQA 4I6NB 3UIOB 1J0GA 1WJNA 2PE9A
chains in the Genus database with same CATH superfamily
1F2RC 1C4PA 2AQ1B 1R4NB 4HPMB 4A9AA 1N60A 4BOZB 2IPKD 5HG2A 3N30A 2ACZB 1KLUD 4LCDE 2DZJA 3A4SC 4GLSC 1J7CA 2NBWB 1T5XD 2JPHA 4HKQA 3DVGY 1MG4A 3MTNB 2WP9B 4JE3B 1OTRB 2I1JA 2BF8B 1C1YB 3EUB2 1SEBD 1V1PB 1XLQA 2L32A 2BB6A 3TMPB 2J4XA 3N32A 2MH7A 3EC8A 3OG5A 3W9CB 5FR6A 1DOYA 2O6VA 2K22A 3HRDD 1UBQA 3NVWA 3E56A 2QDFA 3ZW3A 2MRPA 3AEEB 4WAFA 2I2YA 2L8JA 2LASA 4IUMB 2INNE 2WXKA 3QA8A 4F1SA 2ZPYA 2FUHB 1UUPA 2L1AA 1N62A 3EHVA 1VDVA 1AARA 3FILB 4WQMA 4ARCA 2G4SA 1SF0A 4FULA 2C7NB 3QJZA 3VH4B 2Z59B 3B9JA 4PT5A 2PE6B 1WRIA 4GU2A 1FFVA 3T3NA 3DHGC 4S0RA 1FPYA 5CHFA 5BO4B 1SXTA 1WF9A 1MVKA 2JZPA 4A3OA 1C4CA 1IGDA 2DX5B 3QCAA 5E6JA 4MELA 1RFKA 4LNIA 3Q69A 1FIQA 3PVLA 1L0VB 3H8HA 2ZW0A 1QT9A 1WGDA 3PRMB 1AW7A 2K5PA 5MPOA 4MEMA 4EZLA 1B9RA 4EKUA 3DHHC 4HDQA 2GBMA 5BYQA 2G1EA 2BKRB 4CQNA 3ZTDA 3EECA 4PS3A 3Q8EA 1KTKA 4N58A 1WXSA 1GG3A 2KWVB 3L13A 1PYWD 4DK5A 3W1YA 2D11A 1TBEA 4YT0B 1XXGA 1FNWA 2IYDB 2PVOD 4HJGE 4JWUC 4HXDA 1JMLA 2KZRA 2KMAA 3GB1A 1T6BX 3RN9C 5G5GA 1FNUA 2IGHA 3SDLC 1TKYA 2KKCA 2RGFA 2KQSA 1LM8B 1QOFA 1TY2A 2EKIA 2W9NA 4US8A 5FKAC 3P4SB 4KSKC 1R4MI 2B76B 4URKA 2EMTA 2BWFA 2N7EA 2EELA 3NJTA 4IWQA 2KMCA 3AN1A 2GBRA 2LXCA 1WX7A 2MCNB 1LGRA 1K53A 4DXFA 2WXHA 5G5HA 2N4FA 3W2DA 2YVCA 4HROA 2YEPB 3AE7B 2UU7A 3RD2A 4BFRA 3PHXB 2LWPA 4P16A 4J3OD 4ZRKA 1AWDA 1RYJA 2N9KA 3PT2B 1JCKB 1WGKA 1JWUD 2JRHA 3RT3B 4NAMA 2DYBA 1L0XB 2M1MA 2N7JA 4KX6B 3W1SC 3OLMD 1JWMD 2BYVE 3VUXA 1NVID 1ISNA 1Z5SB 3I3TB 3KQ4A 3MC8A 4A20A 4DDID 2LXAA 2MJEA 2OEDA 1Q10A 2ON8A 3P4QB 1XLPA 1I4GA 4W9DA 1WE7A 4KZ0A 3KH0A 3TEZA 1MI0A 2WHIA 2KK8A 1XLNA 3ZO5B 4REZA 4ITKA 4BVUC 4L2YA 1GB1A 2Y5BB 1KRHA 1ZXHA 2H88B 1OEYA 2MBHA 3IFWB 3SHQA 3DCGA 3N1YC 4MDKE 2CU3A 2KXJA 3R8BA 2KT7A 4AS1A 4CHKA 2JVCA 3KUDB 4LNFA 3MC9A 4LNNA 1WJ4A 3HM3A 4IDIA 1C9FA 3Q3JA 4EE2A 3N1XC 1UELA 4BBNC 4P6VF 4MJSA 2VRRB 2KYWA 1L5PA 2KJHB 1T0RC 1MHHE 4G3XB 3T3OA 5DPRA 3IAS1 3ZJTA 4W9KA 2IBIB 2J53A 1ZXIA 2EMSA 2MBOA 2QILA 1T0YA 2KC2A 1YJJA 1U4AA 2PKOA 2FE8A 2LGDA 1TS2A 2JZ3B 3NZUA 3S2AA 3PZ7A 1HZ5A 5JZEB 2RPQA 1KOTA 4MGKE 2BYFA 1EUVB 1WE6A 4N59A 4TKNA 4S17A 4XZ4A 2KN5A 1F77A 2WWZA 2KWDA 4GDKA 1EWCA 3ABVB 2BWES 3AE4B 4I6LB 1KH0A 4XYCA 5IP4D 1D5MC 2KMMA 1V1OA 1YJIA 2ZNVB 1E5WA 2KO3A 2JX5A 3B08A 4NQKE 5TR5A 4W9HA 3TJPA 2GB1A 4ICVA 3RI7C 1CK1A 2KTRA 1N61A 2MLBA 1BMLC 3DVNU 2KLGA 4GN1A 2KX3A 2CR5A 2JYTA 3KYCD 2LJ5A 1L4ZB 4OW0A 2QCZA 2WXIA 3I57A 1RAXA 4OZAA 2HJ8A 3TSSA 2C9WB 1FMAD 3M95A 4NY0A 3IVFA 2GMIC 5DCNA 1N6ZA 3BK2A 2KACA 4C56C 3AM9A 3KUCB 5AUIA 3C8YA 3RYTA 3NS1A 3N1ZC 1E7PB 2JZZA 2Z8LA 2WXOA 3ETRA 4HRSA 1Y56A 1YQ3B 2X38A 4TV3A 1NI3A 1KJTA 2W55A 3QQ8B 1IUEA 4WURA 1SE2A 5LNK1 1TGZB 3IT4B 1VZ7A 1UBIA 4WWNA 3RNEC 4HPLB 3QARA 4M8NA 2J42A 1YJ1A 3PLVA 1MJDA 2KFKA 2V3PA 3AB5A 2M0XA 4C7YA 3A1QA 4G50A 4GDKB 2IGDA 3TBLD 1Z2MA 3DWGC 1EU3A 2NR2A 4EEWA 1E6EB 2V3SA 4ZRQA 3ZXRA 3LXFA 3UIOB 1WJNA 5EE0A 2PE9A 1L6UA 1RM6C 3R2TA 2K39A 2GOWA 4KVGB 3TEXA 3AE2B 5JHAA 1GPXA 1E0ZA 1RLFA 4C80A 4ANUA 3AE1B 4RMAA 2KTRB 3CF6E 5IA7A 2VZKB 3VQIA 4JGHB 4DBGA 1MHXA 3VUYA 1YOVB 1F0ZA 3U7DA 2QJLA 2K6DB 5IO9A 2DAFA 4OZBA 2INCC 1FFUA 1WXAA 2R2OA 3RNFC 4A55A 4E71A 3LDZE 2C60A 3PV1A 1MFWA 3KWLA 4KIKA 1OEYJ 4MH0E 3AEDB 3ML9A 1HA5A 1P0RA 2HDEA 1M94A 4M00A 3GP7A 2X8XX 3ZIMA 1TY0A 4A8XC 2J0KA 1SIFA 3BIID 5BMIA 1JWBD 1V8CA 4ZYSA 5FR3A 1V1PA 2ZJDA 2QEJC 4WWMA 2M19A 3DOWA 3TL5A 5LXHA 3GS2A 4GOCA 2DYOA 1P7EA 2LZ6A 3VUWA 5C1ZA 3DBRB 2BYTA 2HD5B 1PQSA 3FAHA 3A1QB 5HHDG 4DQOC 2XEWA 1EO6A 2N1WA 4HPPA 2AYOB 2WDTB 4BOSC 2KDBA 3VTWA 2JWZA 1QKZA 3Q3NC 3KLSX 1V86A 1PDXA 4WJPA 4ZRPA 1IBXA 3AECB 3GZNI 1FRDA 1XCQL 4HEA1 4WQOB 3P42A 4PYZA 3BINA 3L08A 3FILA 4N6EB 2WXRA 4AJWA 1FXTB 2LGYA 2BPSA 3PGEA 2JXXA 3ZVVA 3E9SA 5FK9C 2NPTB 2WDQB 4XX5A 1WFYA 1V2YA 2JWUA 2V0GA 1AN8A 4NZLB 3LB8C 1SGHA 3SD5A 3HVDA 2Z0EB 3JSVA 4L23A 2K25A 1I42A 4KIKB 3ENEA 1VZ6A 4C4VA 4HVBA 1XD3B 2RDHA 2WXFA 3N9YC 4RF0A 4KKIA 1HZ6A 2DBYA 2MHJA 1ZUD2 1HTQA 3T8MA 1I4RA 4HDOA 3MHZA 2MQJA 3QHTA 3MP9A 2KDFB 2INPE 1UNSA 2ZZPB 4RCOA 2YLMA 3R7RA 1WI0A 3ZRCA 5DPTA 3ZXVA 2V4IB 2WQYB 4F7ZA 4ZRJA 4C00A 4AUQC 1S1QB 2DENB 2K8CA 3TEYA 3W5UB 3P4RB 2WDRB 3AULA 2KQ7A 2PJHA 2G3QB 3WAPA 3ONSA 2WGSA 1FXIA 1V49A 1F9JA 2KX0A 3RNBC 2IO2B 4NAWA 1VRAB 3KYDD 4M01A 1IBXB 4GDLB 4A90A 4R3DA 4TQ1A 2MA9B 4UDUC 5TSSA 1WJ6A 3RMKC 2QHOA 5D2MB 2CU1A 3Q8AA 5T8IA 1I4QA 2JU6X 3QWZB 2UWQA 5D3IB 2FIFA 1T3QA 3VH3B 1ENFA 1LFDA 1PGXA 1P7FA 1XEEA 2D3GA 1GJZA 5LLIA 1V97A 4M0WB 3ZYYX 4N9F4 2RDBC 2L76A 4LLGM 1KM7A 4LJPB 2KWUB 2JT4B 3Q6BA 4YSZB 1C3TA 3JSVB 3M3JA 4MT5A 1TKEA 3U7ZA 3VVWB 5KHOA 2N0SB 3GOEA 4C4VB 1YD8U 2E3TA 2V1YA 3AEFB 1IYFA 3UI3A 4B6WA 3TIXA 1GB4A 2C5LC 2LVPA 1KLVA 3A4RA 1WWTA 5C3JB 2M17A 3Q8CA 4JLCA 3NY5A 2WXGA 1D5XC 1UGJA 2K0PA 1PUTA 2REXA 3HUIA 4K3BA 2L52A 2DYMA 2BT6A 2JXTA 4YSXB 3X23A 3RZWC 2KAJA 2Z0DB 3EA6A 2ZW1A 3BZDB 1SE9A 4RM9A 5IN7A 2KD0A 1HTOA 5BMHA 1FEHA 2BW2A 3W1SA 2TSSA 1UWXA 3DPDA 3FC4A 4NAWB 1WXMA 1VZ8A 3RUIB 2CHWA 1ET6A 4GB9A 1ZDXA 3BK1A 4E74A 3BYYB 1WGHA 3L4PA 3DWMA 4JQWC 4RGTA 3VTUA 3VDZA 3H7PB 5AZHA 4DWFA 1P1AA 2AL3A 4JL9A 1YQ4B 1WR6E 2IY0B 3IHPC 4MM3B 2WXMA 2WXJA 3AV8A 3Q8FA 4W9CA 5H92C 2J7QB 5JXVA 5KHQA 4YXDB 2LD9A 3NVZA 2K6QA 2MWSB 2NCNA 4HJKA 4FJVB 1WSPA 3Q2AC 1WMHA 3JYUA 4ZYNA 1JRUA 4FA6A 2O2VA 1ET9A 3PLUA 1MPEA 5AZFA 1QQRA 2FCSA 1WGYA 3N3KB 2CKHB 3ZNZB 4I6PA 1ZGUB 3TUOA 1F52A 2QMTA 3KVFB 2VZKD 3A9KA 4CO7A 1R4NI 1SIJA 2N9PC 1UWMA 2GRIA 1C78A 3ZLZA 1WXQA 1WM3A 2A5UA 4GMVA 3URYA 3JVZX 4NJCA 3NZ3A 4XWWA 4ZOHC 3RPFC 1J19A 3ZGZA 1FO4A 3TCAA 2WX0A 5IOIA 3B1LX 3QX1A 1FCLA 3PHWB 1EU4A 4B0MA 2KTFA 2E6XA 2PVGC 4IWPA 5CHVC 1CQVA 2I1KA 1WH3A 2J52A 3PPAA 2MJDA 4RF1A 2M8SA 1WR1A 2Y5PA 1F2RI 4OZCA 1WGRA 2G9HD 2C7HA 3AH7A 5L95C 2PLPA 3DBLB 4II2B 3LYYA 1A5RA 1TJEA 1HQRD 3C19A 1P3QU 2AX5A 3OJ3A 1JROA 3ZQ4A 2LRWA 2LMCA 3SU8X 3OJ4B 4AWJA 3MC0B 2D3AA 1NDDA 3L10B 4FN2A 2WNMA 4BKTA 2LVQA 1XT9B 1WZ0A 2LGXA 4IWOA 4RGNA 5C23A 2D3BA 1TYGB 1WMHB 4JIOU 4DXGA 2VH2A 5EE9A 4YSYB 1L6VA 2O2VB 2N7DA 4IM2A 3V62A 1NYRA 4W9IA 3AEGB 3BVGA 2K9XA 4NJ7A 3B2FA 1EF1A 1E8WA 4NNJB 2FAZA 3PS6A 3R3MA 4ASWC 1E90A 4IOIE 2BKFA 3A9KB 1WIAA 4KDIC 2D07B 4A3PA 1V80A 2KWCA 5DPWA 4FADA 1E8ZA 2ICIA 1NEKB 4LTUA 1ZKHA 2WXQA 2NMQA 4FLHA 2W3SA 5H8YE 2FUG1 4GIVA 2PEAA 2EKEC 1YNTE 3L16A 4BZAA 3ML8A 1TTNA 3NRZA 2V4LA 3UF8A 2G45B 4W9GA 4B0EA 4RGMA 2RMMA 2INDC 4DHJD 2BYEA 2FCNA 2L83A 1NENB 1UGMA 2WYQA 4CYEA 1I35A 1ZW7A 2BBCA 2GI9A 1WJUA 5CHWA 1LO5D 2DLBA 3NVYA 3Q3OC 1J7BA 4B9KA 3VXWA 2R2QA 2WXPA 3HVZA 4KV2A 2MX2A 3BYTB 3J9CA 2CHZA 4JPSA 3R2IA 3PZDA 1VLBA 1PFDA 2QSDA 4MH8A 2IGGA 1GC6A 4G0NB 2KN4A 1D6EC 2B3AA 4B95A 4EZJA 3M62B 5HKHA 4GSWA 4JX1C 4W9JA 2D10A 3L17A 1D4BA 3ZDMC 4EZKA 1ZDVA 4US9A 3M63B 2L05A 1R7SA 3ALBA 5EE1A 4EOYA 3WA0A 2QIEB 4P7IA 1XO3A 1I4HA 4A6QA 1TKGA 1J7AA 4AP4C 2KDEB 1KLGD 4P1CC 2KC1A 3P63A 1UF0A 5J17A 2C7MB 3SR6A 4OVZA 3UINB 1C4AA 2ONQA 2KDIA 1OQRA 4USAA 1FNVA 5L83A 2WXLA 2NPTA 2D5GA 4OVUA 3H6NA 3AE8B 1I4PA 2XK5B 1E9MA 2IO0B 5G55A 3APFA 4WJQA 1IGCA 1EF5A 5EDSA 2LGSA 5AUKA 2MJ3A 1QLBB 1T0SC 3EGRA 3N20C 2NBUA 1L4DB 3UQBA 3HHMA 1FXAA 1WX8A 4L1BA 3ZNID 1TIFA 3VRAB 2N9XA 3P2BA 5AZGA 2LUEA 1QF6A 2BGFA 3ZKJC 2M4NA 2PPHA 2IO1B 2MP2A 2KNBA 3PREA 3A9JB 4IM0A 1DOXA 3DDCB 1K50A 1ZP0B 4ZHPA 1G6JA 2D2QA 1R4MB 3SFEB 1ZE3D 2Y5CA 4W9LA 3AU4A 5CTRC 3I63C 2ASQA 4FHKA 3V3XA 2CHXA 1N5XA 1ROEA 1L7YA 4GDLA 1E10A 5DPSA 4NJ6A 3BWUD 2GBKA 2IZVB 4YWGG 4IG7B 1V81A 3O65B 4FHJA 1QZEA 2JQRB 4OVVA 2FCQA 2DHZA 2RR9A 2RD0A 1SBBB 1WM2A 3PRZA 4FJYA 3U4EG 1WX9A 1YN5A 4M0WA 3HIZA 1CJEA 4W9FA 3AMZA 2MBQA 1NYQA 2Y3AA 4ICUA 4C7ZA 2LVOA 3QIJA 3AXCA 1GAQB 2JF5A 4BKGA 2K3UA 2HTHA 3LJ3A 3QK0A 3O13A 1IPGA 1YIWA 3V05A 1CMXB 5GXGB 4DHJB 1SE3A 2BS4B 2GLSA 3RNGC 2R61A 3DBHB 4ANVA 1V5OA 5G2NA 3H7SA 1N5WA 4MGIE 1CZPA 1Q5WB 3R7QA 2ZEQA 4KGSA 2KJ6A 3DHIC 5BYSA 1C77A 1S3SG 1M4VA 3RZFA 1NBFC 2L3ZA 4KZCA 3C0RB 4OHJA 3AEAB 4JWSC 1C79A 4WWPA 2MP2B 2OJRA 3ZRFA 2LHEA 2M0AA 5E6PA 2NVUI 2DNFA 5EE3A 1L0YB 2BTEA 1P9DU 4HCNB 1I7HA 3UGBB 3R66C 1EWYC 3RNAC 1V9JA 1TZOA 1HXYD 1K51A 2LI5A 3IAM1 4P1BC 4DDGD 3H7PA 1WYWB 1WYGA 4K81A 3HK0A 4MM3A 5GMVA 3GE3C 3NS8A 4ZDVA 1RRBA 2J0MA 4K7SA 1JW9D 2HE7A 2D3CA 1PGBA 1AYFA 2KOXA 1RFAA 4AQ7A 2NBVB 4HK2A 1IP9A 3U52E 4AJYB 3RULA 3T9LA 3HM6X 3AE6B 1SB3C 5D7GA 1SE4A 4EUTA 1D3ZA 2RSUA 3AE3B 2WXNA 2KDMA 4LK0M 2YEPF 4HKZE 3U8ZA 3AU5A 4KKJA 3V60A 1HE8A 4WJOA 2L0FA 2MBBB 3CSTA 3APDA 1L2NA 2GBNA 3NUHB 3NVVA 2JRIB 4DHZB 2GBJA 4QAYA 4I6NB 1B1ZA 2PIAA 1TT5B 4HWIB 1GOZA 5HI1A 4FJZA 1K52A 2LGIA 2AQ2B 2LUMA 5J18A 2KVRA 1P98A 3PSEB 3ZNGC 3W5VB 1I4XA 2KVZA 3UIPB 4IW0A 1D5ZC 3GE8C 4DHZE 3VAWA 2O6VB 3IT6B 4KGTA 2WDVB 1JQ4A 1E7VA 3AI5A 1Q1OA 2OHFA 3MJWA 5AEKB 3ZDTA 3DBRI 4ANWA 2W54A 2CJOA 5LXIB 2NTSA 1E8XA 1XQQA 2UYZB 2HJ1A 2LRUA 2K8HA 5HFYA 1XLOA 3NZSA 1JWSD 5IKCM 1H8CA 1FM0D 4LDTD 3PRPB 1T0QC 3QC8B 5BMGA 3EFCA 2VH1A 2WX1A 4ARIA 1E8YA 2PW9A 4K7UA 4ANXA 3AE9B 3L54A 2NTTA 4YTNB 1E7UA 4PS7A 5E6NA 3WAOA 4J6IA 2OOBB 1UH6A 3ZJUA 4KDLB 4GXBA 1WGGA 2KQ4X 3BVZA 3WCQA 1FRRA 3JW0X 1J8CA 2LEKA 2V3NA 2XN9C 1YN3A 3VR8B 3VFKA 2N1VA 4Q2JA 3ZJVA 2LJIA 1VCBA 1RWSA 1SJHD 2M56B 1WXVA 2FNJB 4H2AA 4BBNF 3I5JC 3Q14C 2JUOA 3BVMA 4F8CB 3DBHI 3Q3FA 3KWVA 3NHEB 2JSVX 1BT0A 2J0JA 5J2RA 4FBJB 2CJNA 3X0WA 1OGWA 3ZUNA 2W82A 2L0TA 4MSQB 4IKGA 1NI2A 1H4RA 4TUUA 1YX6B 3SFDB 1QOAA 1Y8RC 2K8BA 3MHSD 5C2TB 3OAWA 4II3B 4XWTA 4TQ0A 2MW5A 3V6EB 3CWIA 3CMMB 2IJ0A 3B2GA 1FCCC 4KSLC 1DGJA 4HCPB 3H9DA 4G11A 2FCMA 2BQQA 4IC7B 4WAAA 2XBBC 2ZNVC 2ZPNA 1LQBA 4BAXA 5IAAC 2PTLA 1SSNA 3GZNB 2AWTA 1YQBA 3SEBA 2LHDA 4PYUA 1GUAB 3DVNV 5JH5C 1ZOYB 1Q0WB 5CX3A 3ECIA 1VD2A 3AE5B 2QC8A 5BYRA 3H1UA 1MG8A 4DXAB 1BXTA 1OFFA 2KLCA 3KW5B 1KF6B 2WS3B 1UD7A 3OWEB 4MACA 3VRBB 1VR9A 4X57B 5D6JB 2MEKA 1V6EA 1XCTL 1YX5B 2ZCCA 4WWOA 3U2SC 1V5TA 2SAKA 4XDCA 4RNAA 2ZCBA 3WANA 2SEBD 4MGYE 2I38A 4PS8A 3B0AA 3K9PB 2KFJA 2XK5A 3MJ5A 3IBEA 1LXDA 1HEZE 1QOGA 2FIDA 4XE0A 4EFOA 2BS2B 1X1MA 2JYEA 3KUZA 4M02A 2MBEA 2A4ZA 3NG0A 3WAMA 1TS3A 3ZNHB 3Q3MC 2NS5A 2PMVA 1QILA 2G4DB 3Q8BA 1STEA 4RM8A 4MGZE 2WU5B 1OQQA 2L7RA 3MFGA 2WLBA 2BVCA 3CSFA 3A9JA 3APCA 4LNOA 2KHWB 1WY8A 4MJSB 1GNUA 3V6CB 4NQLB 4D2KA 4LDTB 2RDGA 2OJWA 4E3CA 3IXSA 1DYQA 3RCZA 5E6OA 1SJED 3TEWA 2N9EB 3A33B 2DAJA 1BUIC 2ZVOA 2FBWB 2W3RA 4IM3A 1ESFA 1K8RB 4AOFA 1TS5A 3V61A 3PTFC 3VR9B 1C76A 1WRDB 2BB5A 2K1FA 2WU2B 4LJOB 4NPNA 3VHTC 5JHBA 2HTME 1JWAD 3RFZB 3VTVA 2AQ3B 3QAQA 4PK1A 2DZKA 4XDDA 3BY4B 4WJNA 4WIPA 2ZVNA 2XNAC 3PO0A 2L00B 3IG3A 3D32A 4WH4A 1ZPSA 3EFUA 3DVGX 1PGAA 1DOIA 2RPVA 1KFYB 4BKSD 4W9EA 1XF5L 4K7WA 4K1RB 1OQYA 1GC7A 4M8MA 2V9HA 3UQAA 2AEHA 1TZ1A 4ZHOA 2N9LA 3WIMA 3L0WB 4TSSA 3K9OB 1A70A 3PZ8A 4RFBA 2MSED 2KANA 2DZMA 4YTPB 2IY1B 5I4DA 4MSMB 3P4PB 1WZ3A 2KJRA 3AEBB 4KGRA 5D3DA 2Q5WD 2IO3B 3I9V1 1JRPA 1JALA 1F1HA 1QOBA 1YMHE 4ZRIA 4LNKA 1TS4A 1ACCA 4FXCA 3DBSA 2AL6A 3CIRB 3FKYA 3NOBA 4YTMB 3P1MA 1UZXB 3DQVA 1EM7A 2O6VD 3ZTCA 2KFKB 4K3CA 2JY6A 3DBLI 2DWQA 2BS3B 4RGOS 4XC2A 1N63A 4YL8A 2H89B 2CS4A 4XGAB 3U30A 1YN4A 3WALA 4HLEA 4O1NA 1FD6A 4ACFA 2DZIA 2IDYA 4BKSA 4RH6A 3RNCC 4TMAB 5D94A 2LFIA 1VJKA 4GGQA 1J0GA
chains in the Genus database with same CATH topology
4HWIB 1WGRA 2K39A 2C7HA 2GOWA 4KVGB 4HPMB 4FJZA 5L95C 5JHAA 4II2B 4BOZB 5J18A 2KVRA 1A5RA 1P98A 1RLFA 3N30A 3PSEB 4ANUA 4LCDE 3ZNGC 1P3QU 3OJ3A 2DZJA 4IW0A 3UIPB 2LRWA 4RMAA 3SU8X 2KTRB 3A4SC 3CF6E 3OJ4B 4AWJA 4DHZE 3VAWA 5IA7A 2O6VB 2NBWB 2JPHA 3VQIA 1NDDA 4JGHB 3L10B 4FN2A 4DBGA 1E7VA 3AI5A 1Q1OA 4BKTA 2LVQA 3MJWA 3VUYA 3DVGY 1XT9B 3U7DA 1WZ0A 2LGXA 5AEKB 4IWOA 3ZDTA 2K6DB 3MTNB 5C23A 1OTRB 1WMHB 3DBRI 4JIOU 2DAFA 2I1JA 4ANWA 2BF8B 1WXAA 2R2OA 1C1YB 4E71A 5LXIB 2O2VB 3LDZE 2N7DA 1E8XA 1XQQA 2C60A 3PV1A 4IM2A 3V62A 2UYZB 3TMPB 2LRUA 4W9IA 3N32A 2K8HA 3NZSA 3EC8A 4KIKA 4NJ7A 1H8CA 1E8WA 1EF1A 1OEYJ 4MH0E 4NNJB 5FR6A 2FAZA 3ML9A 3PS6A 3PRPB 3R3MA 4LDTD 4ASWC 1P0RA 1M94A 1E90A 3QC8B 2O6VA 3ZIMA 2BKFA 3A9KB 1WIAA 4KDIC 2D07B 4A3PA 1V80A 2KWCA 5DPWA 4FADA 2J0KA 1E8ZA 1SIFA 1UBQA 1ZKHA 2WX1A 4FLHA 1E8YA 4K7UA 4ANXA 4GIVA 3L54A 3ZW3A 2ZJDA 1E7UA 2MRPA 2PEAA 2L8JA 4PS7A 2EKEC 2LASA 3L16A 4IUMB 3ML8A 3QA8A 5E6NA 4F1SA 3WAOA 4J6IA 2ZPYA 2FUHB 1TTNA 1UH6A 2OOBB 3DOWA 3TL5A 4KDLB 5LXHA 2V4LA 4GOCA 4GXBA 1WGGA 2G45B 3UF8A 2DYOA 4W9GA 2LZ6A 3VUWA 5C1ZA 4DHJD 3EHVA 2BYEA 1AARA 2HD5B 3JW0X 1PQSA 1J8CA 2G4SA 2FCNA 1UGMA 2WYQA 4FULA 3A1QB 2C7NB 3VFKA 4CYEA 2XEWA 3QJZA 2N1VA 1EO6A 3VH4B 1I35A 2Z59B 1ZW7A 1WJUA 1VCBA 2N1WA 1WXVA 2FNJB 5CHWA 2AYOB 2PE6B 2WDTB 4BBNF 4BOSC 2KDBA 4GU2A 3VTWA 2JWZA 2JUOA 1V86A 5CHFA 5BO4B 3DBHI 4WJPA 3Q3FA 3VXWA 2R2QA 3NHEB 4KV2A 4B9KA 4F8CB 3GZNI 1WF9A 2MX2A 1BT0A 4A3OA 2J0JA 5J2RA 4FBJB 2DX5B 3QCAA 4MELA 2CHZA 3X0WA 4WQOB 1OGWA 3ZUNA 4PYZA 3BINA 3L08A 3PVLA 2L0TA 4MSQB 1WGDA 1NI2A 1H4RA 3PZDA 4TUUA 3PRMB 1YX6B 1GC6A 1Y8RC 4MEMA 2K8BA 3MHSD 4EZLA 4G0NB 4AJWA 4EKUA 1FXTB 3OAWA 4II3B 4EZJA 2B3AA 4B95A 2LGYA 2GBMA 4HDQA 2MW5A 4TQ0A 2BPSA 3PGEA 2JXXA 3M62B 3V6EB 2BKRB 5HKHA 3ZVVA 3ZTDA 3EECA 4GSWA 3CMMB 4PS3A 2NPTB 4KSLC 4W9JA 2D10A 3L17A 1WXSA 1WFYA 1GG3A 4XX5A 3ZDMC 4EZKA 1V2YA 4HCPB 3H9DA 4G11A 2KWVB 3M63B 2L05A 3L13A 2FCMA 4DK5A 3W1YA 2D11A 3ALBA 1TBEA 4IC7B 4EOYA 3WA0A 4P7IA 1SGHA 3SD5A 2IYDB 2Z0EB 3JSVA 4WAAA 2K25A 2XBBC 2ZNVC 1I42A 3ZRCA 2ZPNA 4KIKB 4HXDA 1LQBA 4AP4C 3ENEA 2KZRA 4HVBA 1XD3B 2KDEB 2KMAA 5IAAC 2KC1A 5J17A 2C7MB 3SDLC 3UINB 2KKCA 2KDIA 2RGFA 2AWTA 1YQBA 2KQSA 1LM8B 2W9NA 4PYUA 5L83A 1GUAB 3DVNV 5JH5C 3T8MA 2NPTA 1Q0WB 5CX3A 4HDOA 4KSKC 3ECIA 1VD2A 2MQJA 4OVUA 1R4MI 3H1UA 1MG8A 3QHTA 4DXAB 3H6NA 2KDFB 2KLCA 4URKA 3KW5B 2XK5B 2EMTA 2BWFA 2N7EA 2IO0B 2YLMA 2ZZPB 1UD7A 3R7RA 1WI0A 5G55A 3APFA 4X57B 4WJQA 4IWQA 1EF5A 2KMCA 5EDSA 2GBRA 2LXCA 5D6JB 1V6EA 4WWOA 1YX5B 2ZCCA 5DPTA 1WX7A 2MCNB 4F7ZA 4ZRJA 4AUQC 1S1QB 2DENB 2NBUA 2K8CA 1V5TA 2N4FA 3UQBA 3AULA 2YVCA 2KQ7A 1WX8A 2PJHA 3HHMA 2G3QB 3WAPA 3ZNID 3ONSA 1V49A 2ZCBA 3RD2A 3WANA 4BFRA 2N9XA 3P2BA 1F9JA 2KX0A 3PHXB 2IO2B 4MGYE 2LWPA 4NAWA 4ZRKA 4PS8A 5AZGA 2LUEA 3KYDD 3PT2B 3B0AA 3K9PB 2KFJA 4GDLB 2BGFA 2XK5A 3ZKJC 2M4NA 2PPHA 4TQ1A 2MA9B 3IBEA 2IO1B 1LXDA 2JRHA 2MP2A 1WJ6A 3RT3B 2KNBA 2QHOA 3PREA 2FIDA 4EFOA 3A9JB 4IM0A 5D2MB 2CU1A 2DYBA 2M1MA 3DDCB 1X1MA 3QWZB 2UWQA 1G6JA 2FIFA 3W1SC 3KUZA 2MBEA 2D2QA 3OLMD 3VH3B 2A4ZA 2BYVE 1LFDA 3VUXA 3WAMA 1ISNA 3ZNHB 4W9LA 1Z5SB 3I3TB 2D3GA 3AU4A 2NS5A 5CTRC 1GJZA 2ASQA 5LLIA 4M0WB 4A20A 4FHKA 4DDID 4N9F4 2CHXA 2L76A 2LXAA 1KM7A 2G4DB 4LJPB 1L7YA 2KWUB 2JT4B 4GDLA 4RM8A 5DPSA 4MGZE 4NJ6A 2L7RA 2GBKA 2IZVB 4IG7B 1V81A 3A9JA 3APCA 3CSFA 3O65B 4FHJA 2KHWB 1C3TA 1WY8A 4MJSB 3JSVB 3M3JA 1GNUA 1QZEA 4W9DA 1WE7A 3V6CB 4NQLB 4OVVA 2FCQA 3KH0A 4KZ0A 3VVWB 4LDTB 2DHZA 5KHOA 2KK8A 3GOEA 2RR9A 1YD8U 3ZO5B 2V1YA 2RD0A 4E3CA 4BVUC 1WM2A 1IYFA 3RCZA 3PRZA 4B6WA 2Y5BB 3TIXA 4FJYA 5E6OA 2C5LC 1WX9A 2LVPA 1KLVA 2MBHA 1OEYA 3A4RA 3IFWB 3HIZA 2M17A 4W9FA 4JLCA 3SHQA 2MBQA 3NY5A 3DCGA 4ICUA 4MDKE 2KXJA 2N9EB 4CHKA 2JVCA 3KUDB 3A33B 2LVOA 3QIJA 2REXA 2DAJA 2ZVOA 3AXCA 1WJ4A 2JF5A 3HM3A 3Q3JA 4IM3A 1K8RB 4BKGA 1UELA 4AOFA 4BBNC 4MJSA 2VRRB 2HTHA 3V61A 2DYMA 3LJ3A 3QK0A 3PTFC 2KJHB 1IPGA 1YIWA 1CMXB 4G3XB 1WRDB 5DPRA 4W9KA 2IBIB 2K1FA 3X23A 3RZWC 4DHJB 2EMSA 4LJOB 4NPNA 3VHTC 2MBOA 2Z0DB 5JHBA 4ANVA 1V5OA 1SE9A 1T0YA 4RM9A 2KC2A 2KD0A 1U4AA 5G2NA 3VTVA 2LGDA 3H7SA 3QAQA 2DZKA 3BY4B 4WJNA 2JZ3B 3NZUA 4MGIE 3S2AA 3W1SA 1Q5WB 3R7QA 2ZEQA 5JZEB 2ZVNA 2RPQA 1KOTA 2KJ6A 2BYFA 2L00B 3IG3A 4MGKE 1EUVB 3D32A 1WE6A 3DPDA 4TKNA 1S3SG 4NAWB 1WXMA 2KN5A 4XZ4A 1NBFC 3RUIB 2WWZA 2L3ZA 2CHWA 3EFUA 4KZCA 3RZFA 4GB9A 3C0RB 3DVGX 4GDKA 4E74A 4BKSD 4W9EA 4WWPA 1WGHA 2MP2B 2OJRA 4K7WA 4JQWC 2BWES 4K1RB 3ZRFA 3VTUA 3VDZA 1OQYA 4I6LB 5E6PA 2NVUI 3H7PB 5AZHA 4DWFA 1GC7A 1P1AA 2AL3A 4M8MA 4JL9A 1P9DU 1WR6E 2AEHA 2IY0B 4HCNB 3UQAA 3IHPC 3UGBB 2ZNVB 1E5WA 1TZ1A 2KO3A 3R66C 3WIMA 3L0WB 3K9OB 3B08A 4NQKE 5TR5A 4W9HA 3TJPA 2MSED 4ICVA 4W9CA 2KANA 1V9JA 2J7QB 2DZMA 2KTRA 2MLBA 3DVNU 2KLGA 4GN1A 5KHQA 2KX3A 2CR5A 2IY1B 2LD9A 4MSMB 2K6QA 2MWSB 1WZ3A 2KJRA 2NCNA 4HJKA 3KYCD 4FJVB 2LI5A 2LJ5A 4DDGD 3H7PA 1WMHA 1WYWB 3JYUA 4ZYNA 1RAXA 4K81A 1JRUA 2IO3B 3HK0A 4MM3A 4FA6A 2O2VA 3PLUA 5AZFA 2HJ8A 5GMVA 4ZRIA 3NS8A 2FCSA 2C9WB 4ZDVA 1WGYA 1RRBA 3DBSA 3M95A 2AL6A 2J0MA 2CKHB 3N3KB 4K7SA 4NY0A 3ZNZB 4I6PA 2HE7A 3IVFA 2GMIC 5DCNA 1ZGUB 3NOBA 2KOXA 1RFAA 1UZXB 3DQVA 2NBVB 2O6VD 3KUCB 3A9KA 3KVFB 4HK2A 3ZTCA 4CO7A 3RYTA 1R4NI 2KFKB 1IP9A 2N9PC 4AJYB 3RULA 2JY6A 3DBLI 2JZZA 3T9LA 3HM6X 3ZLZA 4XC2A 1WM3A 5D7GA 2A5UA 4GMVA 4YL8A 3JVZX 4EUTA 1D3ZA 2RSUA 4TV3A 1KJTA 2CS4A 3QQ8B 1J19A 3U8ZA 3U30A 1TGZB 3AU5A 3TCAA 2WX0A 1UBIA 1HE8A 3V60A 3WALA 4HLEA 3B1LX 3QX1A 4WWNA 4WJOA 2L0FA 2MBBB 4HPLB 3PHWB 3QARA 4M8NA 2KTFA 1YJ1A 3PLVA 4IWPA 2KFKA 2M0XA 2DZIA 3A1QA 4G50A 4GDKB 5CHVC 2I1KA 1WH3A 3CSTA 3PPAA 3TBLD 4BKSA 3APDA 1L2NA 1Z2MA 2GBNA 4DHZB 2JRIB 2GBJA 2M8SA 2NR2A 4EEWA 5D94A 1WR1A 2V3SA 4GGQA 4I6NB 3UIOB 1J0GA 1WJNA 2PE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWI B;  1WGR A;  2K39 A;  2C7H A;  2GOW A;  4KVG B;  4HPM B;  4FJZ A;  5L95 C;  5JHA A;  4II2 B;  4BOZ B;  5J18 A;  2KVR A;  1A5R A;  1P98 A;  1RLF A;  3N30 A;  3PSE B;  4ANU A;  4LCD E;  3ZNG C;  1P3Q U;  3OJ3 A;  2DZJ A;  4IW0 A;  3UIP B;  2LRW A;  4RMA A;  3SU8 X;  2KTR B;  3A4S C;  3CF6 E;  3OJ4 B;  4AWJ A;  4DHZ E;  3VAW A;  5IA7 A;  2O6V B;  2NBW B;  2JPH A;  3VQI A;  1NDD A;  4JGH B;  3L10 B;  4FN2 A;  4DBG A;  1E7V A;  3AI5 A;  1Q1O A;  4BKT A;  2LVQ A;  3MJW A;  3VUY A;  3DVG Y;  1XT9 B;  3U7D A;  1WZ0 A;  2LGX A;  5AEK B;  4IWO A;  3ZDT A;  2K6D B;  3MTN B;  5C23 A;  1OTR B;  1WMH B;  3DBR I;  4JIO U;  2DAF A;  2I1J A;  4ANW A;  2BF8 B;  1WXA A;  2R2O A;  1C1Y B;  4E71 A;  5LXI B;  2O2V B;  3LDZ E;  2N7D A;  1E8X A;  1XQQ A;  2C60 A;  3PV1 A;  4IM2 A;  3V62 A;  2UYZ B;  3TMP B;  2LRU A;  4W9I A;  3N32 A;  2K8H A;  3NZS A;  3EC8 A;  4KIK A;  4NJ7 A;  1H8C A;  1E8W A;  1EF1 A;  1OEY J;  4MH0 E;  4NNJ B;  5FR6 A;  2FAZ A;  3ML9 A;  3PS6 A;  3PRP B;  3R3M A;  4LDT D;  4ASW C;  1P0R A;  1M94 A;  1E90 A;  3QC8 B;  2O6V A;  3ZIM A;  2BKF A;  3A9K B;  1WIA A;  4KDI C;  2D07 B;  4A3P A;  1V80 A;  2KWC A;  5DPW A;  4FAD A;  2J0K A;  1E8Z A;  1SIF A;  1UBQ A;  1ZKH A;  2WX1 A;  4FLH A;  1E8Y A;  4K7U A;  4ANX A;  4GIV A;  3L54 A;  3ZW3 A;  2ZJD A;  1E7U A;  2MRP A;  2PEA A;  2L8J A;  4PS7 A;  2EKE C;  2LAS A;  3L16 A;  4IUM B;  3ML8 A;  3QA8 A;  5E6N A;  4F1S A;  3WAO A;  4J6I A;  2ZPY A;  2FUH B;  1TTN A;  1UH6 A;  2OOB B;  3DOW A;  3TL5 A;  4KDL B;  5LXH A;  2V4L A;  4GOC A;  4GXB A;  1WGG A;  2G45 B;  3UF8 A;  2DYO A;  4W9G A;  2LZ6 A;  3VUW A;  5C1Z A;  4DHJ D;  3EHV A;  2BYE A;  1AAR A;  2HD5 B;  3JW0 X;  1PQS A;  1J8C A;  2G4S A;  2FCN A;  1UGM A;  2WYQ A;  4FUL A;  3A1Q B;  2C7N B;  3VFK A;  4CYE A;  2XEW A;  3QJZ A;  2N1V A;  1EO6 A;  3VH4 B;  1I35 A;  2Z59 B;  1ZW7 A;  1WJU A;  1VCB A;  2N1W A;  1WXV A;  2FNJ B;  5CHW A;  2AYO B;  2PE6 B;  2WDT B;  4BBN F;  4BOS C;  2KDB A;  4GU2 A;  3VTW A;  2JWZ A;  2JUO A;  1V86 A;  5CHF A;  5BO4 B;  3DBH I;  4WJP A;  3Q3F A;  3VXW A;  2R2Q A;  3NHE B;  4KV2 A;  4B9K A;  4F8C B;  3GZN I;  1WF9 A;  2MX2 A;  1BT0 A;  4A3O A;  2J0J A;  5J2R A;  4FBJ B;  2DX5 B;  3QCA A;  4MEL A;  2CHZ A;  3X0W A;  4WQO B;  1OGW A;  3ZUN A;  4PYZ A;  3BIN A;  3L08 A;  3PVL A;  2L0T A;  4MSQ B;  1WGD A;  1NI2 A;  1H4R A;  3PZD A;  4TUU A;  3PRM B;  1YX6 B;  1GC6 A;  1Y8R C;  4MEM A;  2K8B A;  3MHS D;  4EZL A;  4G0N B;  4AJW A;  4EKU A;  1FXT B;  3OAW A;  4II3 B;  4EZJ A;  2B3A A;  4B95 A;  2LGY A;  2GBM A;  4HDQ A;  2MW5 A;  4TQ0 A;  2BPS A;  3PGE A;  2JXX A;  3M62 B;  3V6E B;  2BKR B;  5HKH A;  3ZVV A;  3ZTD A;  3EEC A;  4GSW A;  3CMM B;  4PS3 A;  2NPT B;  4KSL C;  4W9J A;  2D10 A;  3L17 A;  1WXS A;  1WFY A;  1GG3 A;  4XX5 A;  3ZDM C;  4EZK A;  1V2Y A;  4HCP B;  3H9D A;  4G11 A;  2KWV B;  3M63 B;  2L05 A;  3L13 A;  2FCM A;  4DK5 A;  3W1Y A;  2D11 A;  3ALB A;  1TBE A;  4IC7 B;  4EOY A;  3WA0 A;  4P7I A;  1SGH A;  3SD5 A;  2IYD B;  2Z0E B;  3JSV A;  4WAA A;  2K25 A;  2XBB C;  2ZNV C;  1I42 A;  3ZRC A;  2ZPN A;  4KIK B;  4HXD A;  1LQB A;  4AP4 C;  3ENE A;  2KZR A;  4HVB A;  1XD3 B;  2KDE B;  2KMA A;  5IAA C;  2KC1 A;  5J17 A;  2C7M B;  3SDL C;  3UIN B;  2KKC A;  2KDI A;  2RGF A;  2AWT A;  1YQB A;  2KQS A;  1LM8 B;  2W9N A;  4PYU A;  5L83 A;  1GUA B;  3DVN V;  5JH5 C;  3T8M A;  2NPT A;  1Q0W B;  5CX3 A;  4HDO A;  4KSK C;  3ECI A;  1VD2 A;  2MQJ A;  4OVU A;  1R4M I;  3H1U A;  1MG8 A;  3QHT A;  4DXA B;  3H6N A;  2KDF B;  2KLC A;  4URK A;  3KW5 B;  2XK5 B;  2EMT A;  2BWF A;  2N7E A;  2IO0 B;  2YLM A;  2ZZP B;  1UD7 A;  3R7R A;  1WI0 A;  5G55 A;  3APF A;  4X57 B;  4WJQ A;  4IWQ A;  1EF5 A;  2KMC A;  5EDS A;  2GBR A;  2LXC A;  5D6J B;  1V6E A;  4WWO A;  1YX5 B;  2ZCC A;  5DPT A;  1WX7 A;  2MCN B;  4F7Z A;  4ZRJ A;  4AUQ C;  1S1Q B;  2DEN B;  2NBU A;  2K8C A;  1V5T A;  2N4F A;  3UQB A;  3AUL A;  2YVC A;  2KQ7 A;  1WX8 A;  2PJH A;  3HHM A;  2G3Q B;  3WAP A;  3ZNI D;  3ONS A;  1V49 A;  2ZCB A;  3RD2 A;  3WAN A;  4BFR A;  2N9X A;  3P2B A;  1F9J A;  2KX0 A;  3PHX B;  2IO2 B;  4MGY E;  2LWP A;  4NAW A;  4ZRK A;  4PS8 A;  5AZG A;  2LUE A;  3KYD D;  3PT2 B;  3B0A A;  3K9P B;  2KFJ A;  4GDL B;  2BGF A;  2XK5 A;  3ZKJ C;  2M4N A;  2PPH A;  4TQ1 A;  2MA9 B;  3IBE A;  2IO1 B;  1LXD A;  2JRH A;  2MP2 A;  1WJ6 A;  3RT3 B;  2KNB A;  2QHO A;  3PRE A;  2FID A;  4EFO A;  3A9J B;  4IM0 A;  5D2M B;  2CU1 A;  2DYB A;  2M1M A;  3DDC B;  1X1M A;  3QWZ B;  2UWQ A;  1G6J A;  2FIF A;  3W1S C;  3KUZ A;  2MBE A;  2D2Q A;  3OLM D;  3VH3 B;  2A4Z A;  2BYV E;  1LFD A;  3VUX A;  3WAM A;  1ISN A;  3ZNH B;  4W9L A;  1Z5S B;  3I3T B;  2D3G A;  3AU4 A;  2NS5 A;  5CTR C;  1GJZ A;  2ASQ A;  5LLI A;  4M0W B;  4A20 A;  4FHK A;  4DDI D;  4N9F 4;  2CHX A;  2L76 A;  2LXA A;  1KM7 A;  2G4D B;  4LJP B;  1L7Y A;  2KWU B;  2JT4 B;  4GDL A;  4RM8 A;  5DPS A;  4MGZ E;  4NJ6 A;  2L7R A;  2GBK A;  2IZV B;  4IG7 B;  1V81 A;  3A9J A;  3APC A;  3CSF A;  3O65 B;  4FHJ A;  2KHW B;  1C3T A;  1WY8 A;  4MJS B;  3JSV B;  3M3J A;  1GNU A;  1QZE A;  4W9D A;  1WE7 A;  3V6C B;  4NQL B;  4OVV A;  2FCQ A;  3KH0 A;  4KZ0 A;  3VVW B;  4LDT B;  2DHZ A;  5KHO A;  2KK8 A;  3GOE A;  2RR9 A;  1YD8 U;  3ZO5 B;  2V1Y A;  2RD0 A;  4E3C A;  4BVU C;  1WM2 A;  1IYF A;  3RCZ A;  3PRZ A;  4B6W A;  2Y5B B;  3TIX A;  4FJY A;  5E6O A;  2C5L C;  1WX9 A;  2LVP A;  1KLV A;  2MBH A;  1OEY A;  3A4R A;  3IFW B;  3HIZ A;  2M17 A;  4W9F A;  4JLC A;  3SHQ A;  2MBQ A;  3NY5 A;  3DCG A;  4ICU A;  4MDK E;  2KXJ A;  2N9E B;  4CHK A;  2JVC A;  3KUD B;  3A33 B;  2LVO A;  3QIJ A;  2REX A;  2DAJ A;  2ZVO A;  3AXC A;  1WJ4 A;  2JF5 A;  3HM3 A;  3Q3J A;  4IM3 A;  1K8R B;  4BKG A;  1UEL A;  4AOF A;  4BBN C;  4MJS A;  2VRR B;  2HTH A;  3V61 A;  2DYM A;  3LJ3 A;  3QK0 A;  3PTF C;  2KJH B;  1IPG A;  1YIW A;  1CMX B;  4G3X B;  1WRD B;  5DPR A;  4W9K A;  2IBI B;  2K1F A;  3X23 A;  3RZW C;  4DHJ B;  2EMS A;  4LJO B;  4NPN A;  3VHT C;  2MBO A;  2Z0D B;  5JHB A;  4ANV A;  1V5O A;  1SE9 A;  1T0Y A;  4RM9 A;  2KC2 A;  2KD0 A;  1U4A A;  5G2N A;  3VTV A;  2LGD A;  3H7S A;  3QAQ A;  2DZK A;  3BY4 B;  4WJN A;  2JZ3 B;  3NZU A;  4MGI E;  3S2A A;  3W1S A;  1Q5W B;  3R7Q A;  2ZEQ A;  5JZE B;  2ZVN A;  2RPQ A;  1KOT A;  2KJ6 A;  2BYF A;  2L00 B;  3IG3 A;  4MGK E;  1EUV B;  3D32 A;  1WE6 A;  3DPD A;  4TKN A;  1S3S G;  4NAW B;  1WXM A;  2KN5 A;  4XZ4 A;  1NBF C;  3RUI B;  2WWZ A;  2L3Z A;  2CHW A;  3EFU A;  4KZC A;  3RZF A;  4GB9 A;  3C0R B;  3DVG X;  4GDK A;  4E74 A;  4BKS D;  4W9E A;  4WWP A;  1WGH A;  2MP2 B;  2OJR A;  4K7W A;  4JQW C;  2BWE S;  4K1R B;  3ZRF A;  3VTU A;  3VDZ A;  1OQY A;  4I6L B;  5E6P A;  2NVU I;  3H7P B;  5AZH A;  4DWF A;  1GC7 A;  1P1A A;  2AL3 A;  4M8M A;  4JL9 A;  1P9D U;  1WR6 E;  2AEH A;  2IY0 B;  4HCN B;  3UQA A;  3IHP C;  3UGB B;  2ZNV B;  1E5W A;  1TZ1 A;  2KO3 A;  3R66 C;  3WIM A;  3L0W B;  3K9O B;  3B08 A;  4NQK E;  5TR5 A;  4W9H A;  3TJP A;  2MSE D;  4ICV A;  4W9C A;  2KAN A;  1V9J A;  2J7Q B;  2DZM A;  2KTR A;  2MLB A;  3DVN U;  2KLG A;  4GN1 A;  5KHQ A;  2KX3 A;  2CR5 A;  2IY1 B;  2LD9 A;  4MSM B;  2K6Q A;  2MWS B;  1WZ3 A;  2KJR A;  2NCN A;  4HJK A;  3KYC D;  4FJV B;  2LI5 A;  2LJ5 A;  4DDG D;  3H7P A;  1WMH A;  1WYW B;  3JYU A;  4ZYN A;  1RAX A;  4K81 A;  1JRU A;  2IO3 B;  3HK0 A;  4MM3 A;  4FA6 A;  2O2V A;  3PLU A;  5AZF A;  2HJ8 A;  5GMV A;  4ZRI A;  3NS8 A;  2FCS A;  2C9W B;  4ZDV A;  1WGY A;  1RRB A;  3DBS A;  3M95 A;  2AL6 A;  2J0M A;  2CKH B;  3N3K B;  4K7S A;  4NY0 A;  3ZNZ B;  4I6P A;  2HE7 A;  3IVF A;  2GMI C;  5DCN A;  1ZGU B;  3NOB A;  2KOX A;  1RFA A;  1UZX B;  3DQV A;  2NBV B;  2O6V D;  3KUC B;  3A9K A;  3KVF B;  4HK2 A;  3ZTC A;  4CO7 A;  3RYT A;  1R4N I;  2KFK B;  1IP9 A;  2N9P C;  4AJY B;  3RUL A;  2JY6 A;  3DBL I;  2JZZ A;  3T9L A;  3HM6 X;  3ZLZ A;  4XC2 A;  1WM3 A;  5D7G A;  2A5U A;  4GMV A;  4YL8 A;  3JVZ X;  4EUT A;  1D3Z A;  2RSU A;  4TV3 A;  1KJT A;  2CS4 A;  3QQ8 B;  1J19 A;  3U8Z A;  3U30 A;  1TGZ B;  3AU5 A;  3TCA A;  2WX0 A;  1UBI A;  1HE8 A;  3V60 A;  3WAL A;  4HLE A;  3B1L X;  3QX1 A;  4WWN A;  4WJO A;  2L0F A;  2MBB B;  4HPL B;  3PHW B;  3QAR A;  4M8N A;  2KTF A;  1YJ1 A;  3PLV A;  4IWP A;  2KFK A;  2M0X A;  2DZI A;  3A1Q A;  4G50 A;  4GDK B;  5CHV C;  2I1K A;  1WH3 A;  3CST A;  3PPA A;  3TBL D;  4BKS A;  3APD A;  1L2N A;  1Z2M A;  2GBN A;  4DHZ B;  2JRI B;  2GBJ A;  2M8S A;  2NR2 A;  4EEW A;  5D94 A;  1WR1 A;  2V3S A;  4GGQ A;  4I6N B;  3UIO B;  1J0G A;  1WJN A;  2PE9 A; 
#chains in the Genus database with same CATH topology
 1F2R C;  1C4P A;  2AQ1 B;  1R4N B;  4HPM B;  4A9A A;  1N60 A;  4BOZ B;  2IPK D;  5HG2 A;  3N30 A;  2ACZ B;  1KLU D;  4LCD E;  2DZJ A;  3A4S C;  4GLS C;  1J7C A;  2NBW B;  1T5X D;  2JPH A;  4HKQ A;  3DVG Y;  1MG4 A;  3MTN B;  2WP9 B;  4JE3 B;  1OTR B;  2I1J A;  2BF8 B;  1C1Y B;  3EUB 2;  1SEB D;  1V1P B;  1XLQ A;  2L32 A;  2BB6 A;  3TMP B;  2J4X A;  3N32 A;  2MH7 A;  3EC8 A;  3OG5 A;  3W9C B;  5FR6 A;  1DOY A;  2O6V A;  2K22 A;  3HRD D;  1UBQ A;  3NVW A;  3E56 A;  2QDF A;  3ZW3 A;  2MRP A;  3AEE B;  4WAF A;  2I2Y A;  2L8J A;  2LAS A;  4IUM B;  2INN E;  2WXK A;  3QA8 A;  4F1S A;  2ZPY A;  2FUH B;  1UUP A;  2L1A A;  1N62 A;  3EHV A;  1VDV A;  1AAR A;  3FIL B;  4WQM A;  4ARC A;  2G4S A;  1SF0 A;  4FUL A;  2C7N B;  3QJZ A;  3VH4 B;  2Z59 B;  3B9J A;  4PT5 A;  2PE6 B;  1WRI A;  4GU2 A;  1FFV A;  3T3N A;  3DHG C;  4S0R A;  1FPY A;  5CHF A;  5BO4 B;  1SXT A;  1WF9 A;  1MVK A;  2JZP A;  4A3O A;  1C4C A;  1IGD A;  2DX5 B;  3QCA A;  5E6J A;  4MEL A;  1RFK A;  4LNI A;  3Q69 A;  1FIQ A;  3PVL A;  1L0V B;  3H8H A;  2ZW0 A;  1QT9 A;  1WGD A;  3PRM B;  1AW7 A;  2K5P A;  5MPO A;  4MEM A;  4EZL A;  1B9R A;  4EKU A;  3DHH C;  4HDQ A;  2GBM A;  5BYQ A;  2G1E A;  2BKR B;  4CQN A;  3ZTD A;  3EEC A;  4PS3 A;  3Q8E A;  1KTK A;  4N58 A;  1WXS A;  1GG3 A;  2KWV B;  3L13 A;  1PYW D;  4DK5 A;  3W1Y A;  2D11 A;  1TBE A;  4YT0 B;  1XXG A;  1FNW A;  2IYD B;  2PVO D;  4HJG E;  4JWU C;  4HXD A;  1JML A;  2KZR A;  2KMA A;  3GB1 A;  1T6B X;  3RN9 C;  5G5G A;  1FNU A;  2IGH A;  3SDL C;  1TKY A;  2KKC A;  2RGF A;  2KQS A;  1LM8 B;  1QOF A;  1TY2 A;  2EKI A;  2W9N A;  4US8 A;  5FKA C;  3P4S B;  4KSK C;  1R4M I;  2B76 B;  4URK A;  2EMT A;  2BWF A;  2N7E A;  2EEL A;  3NJT A;  4IWQ A;  2KMC A;  3AN1 A;  2GBR A;  2LXC A;  1WX7 A;  2MCN B;  1LGR A;  1K53 A;  4DXF A;  2WXH A;  5G5H A;  2N4F A;  3W2D A;  2YVC A;  4HRO A;  2YEP B;  3AE7 B;  2UU7 A;  3RD2 A;  4BFR A;  3PHX B;  2LWP A;  4P16 A;  4J3O D;  4ZRK A;  1AWD A;  1RYJ A;  2N9K A;  3PT2 B;  1JCK B;  1WGK A;  1JWU D;  2JRH A;  3RT3 B;  4NAM A;  2DYB A;  1L0X B;  2M1M A;  2N7J A;  4KX6 B;  3W1S C;  3OLM D;  1JWM D;  2BYV E;  3VUX A;  1NVI D;  1ISN A;  1Z5S B;  3I3T B;  3KQ4 A;  3MC8 A;  4A20 A;  4DDI D;  2LXA A;  2MJE A;  2OED A;  1Q10 A;  2ON8 A;  3P4Q B;  1XLP A;  1I4G A;  4W9D A;  1WE7 A;  4KZ0 A;  3KH0 A;  3TEZ A;  1MI0 A;  2WHI A;  2KK8 A;  1XLN A;  3ZO5 B;  4REZ A;  4ITK A;  4BVU C;  4L2Y A;  1GB1 A;  2Y5B B;  1KRH A;  1ZXH A;  2H88 B;  1OEY A;  2MBH A;  3IFW B;  3SHQ A;  3DCG A;  3N1Y C;  4MDK E;  2CU3 A;  2KXJ A;  3R8B A;  2KT7 A;  4AS1 A;  4CHK A;  2JVC A;  3KUD B;  4LNF A;  3MC9 A;  4LNN A;  1WJ4 A;  3HM3 A;  4IDI A;  1C9F A;  3Q3J A;  4EE2 A;  3N1X C;  1UEL A;  4BBN C;  4P6V F;  4MJS A;  2VRR B;  2KYW A;  1L5P A;  2KJH B;  1T0R C;  1MHH E;  4G3X B;  3T3O A;  5DPR A;  3IAS 1;  3ZJT A;  4W9K A;  2IBI B;  2J53 A;  1ZXI A;  2EMS A;  2MBO A;  2QIL A;  1T0Y A;  2KC2 A;  1YJJ A;  1U4A A;  2PKO A;  2FE8 A;  2LGD A;  1TS2 A;  2JZ3 B;  3NZU A;  3S2A A;  3PZ7 A;  1HZ5 A;  5JZE B;  2RPQ A;  1KOT A;  4MGK E;  2BYF A;  1EUV B;  1WE6 A;  4N59 A;  4TKN A;  4S17 A;  4XZ4 A;  2KN5 A;  1F77 A;  2WWZ A;  2KWD A;  4GDK A;  1EWC A;  3ABV B;  2BWE S;  3AE4 B;  4I6L B;  1KH0 A;  4XYC A;  5IP4 D;  1D5M C;  2KMM A;  1V1O A;  1YJI A;  2ZNV B;  1E5W A;  2KO3 A;  2JX5 A;  3B08 A;  4NQK E;  5TR5 A;  4W9H A;  3TJP A;  2GB1 A;  4ICV A;  3RI7 C;  1CK1 A;  2KTR A;  1N61 A;  2MLB A;  1BML C;  3DVN U;  2KLG A;  4GN1 A;  2KX3 A;  2CR5 A;  2JYT A;  3KYC D;  2LJ5 A;  1L4Z B;  4OW0 A;  2QCZ A;  2WXI A;  3I57 A;  1RAX A;  4OZA A;  2HJ8 A;  3TSS A;  2C9W B;  1FMA D;  3M95 A;  4NY0 A;  3IVF A;  2GMI C;  5DCN A;  1N6Z A;  3BK2 A;  2KAC A;  4C56 C;  3AM9 A;  3KUC B;  5AUI A;  3C8Y A;  3RYT A;  3NS1 A;  3N1Z C;  1E7P B;  2JZZ A;  2Z8L A;  2WXO A;  3ETR A;  4HRS A;  1Y56 A;  1YQ3 B;  2X38 A;  4TV3 A;  1NI3 A;  1KJT A;  2W55 A;  3QQ8 B;  1IUE A;  4WUR A;  1SE2 A;  5LNK 1;  1TGZ B;  3IT4 B;  1VZ7 A;  1UBI A;  4WWN A;  3RNE C;  4HPL B;  3QAR A;  4M8N A;  2J42 A;  1YJ1 A;  3PLV A;  1MJD A;  2KFK A;  2V3P A;  3AB5 A;  2M0X A;  4C7Y A;  3A1Q A;  4G50 A;  4GDK B;  2IGD A;  3TBL D;  1Z2M A;  3DWG C;  1EU3 A;  2NR2 A;  4EEW A;  1E6E B;  2V3S A;  4ZRQ A;  3ZXR A;  3LXF A;  3UIO B;  1WJN A;  5EE0 A;  2PE9 A;  1L6U A;  1RM6 C;  3R2T A;  2K39 A;  2GOW A;  4KVG B;  3TEX A;  3AE2 B;  5JHA A;  1GPX A;  1E0Z A;  1RLF A;  4C80 A;  4ANU A;  3AE1 B;  4RMA A;  2KTR B;  3CF6 E;  5IA7 A;  2VZK B;  3VQI A;  4JGH B;  4DBG A;  1MHX A;  3VUY A;  1YOV B;  1F0Z A;  3U7D A;  2QJL A;  2K6D B;  5IO9 A;  2DAF A;  4OZB A;  2INC C;  1FFU A;  1WXA A;  2R2O A;  3RNF C;  4A55 A;  4E71 A;  3LDZ E;  2C60 A;  3PV1 A;  1MFW A;  3KWL A;  4KIK A;  1OEY J;  4MH0 E;  3AED B;  3ML9 A;  1HA5 A;  1P0R A;  2HDE A;  1M94 A;  4M00 A;  3GP7 A;  2X8X X;  3ZIM A;  1TY0 A;  4A8X C;  2J0K A;  1SIF A;  3BII D;  5BMI A;  1JWB D;  1V8C A;  4ZYS A;  5FR3 A;  1V1P A;  2ZJD A;  2QEJ C;  4WWM A;  2M19 A;  3DOW A;  3TL5 A;  5LXH A;  3GS2 A;  4GOC A;  2DYO A;  1P7E A;  2LZ6 A;  3VUW A;  5C1Z A;  3DBR B;  2BYT A;  2HD5 B;  1PQS A;  3FAH A;  3A1Q B;  5HHD G;  4DQO C;  2XEW A;  1EO6 A;  2N1W A;  4HPP A;  2AYO B;  2WDT B;  4BOS C;  2KDB A;  3VTW A;  2JWZ A;  1QKZ A;  3Q3N C;  3KLS X;  1V86 A;  1PDX A;  4WJP A;  4ZRP A;  1IBX A;  3AEC B;  3GZN I;  1FRD A;  1XCQ L;  4HEA 1;  4WQO B;  3P42 A;  4PYZ A;  3BIN A;  3L08 A;  3FIL A;  4N6E B;  2WXR A;  4AJW A;  1FXT B;  2LGY A;  2BPS A;  3PGE A;  2JXX A;  3ZVV A;  3E9S A;  5FK9 C;  2NPT B;  2WDQ B;  4XX5 A;  1WFY A;  1V2Y A;  2JWU A;  2V0G A;  1AN8 A;  4NZL B;  3LB8 C;  1SGH A;  3SD5 A;  3HVD A;  2Z0E B;  3JSV A;  4L23 A;  2K25 A;  1I42 A;  4KIK B;  3ENE A;  1VZ6 A;  4C4V A;  4HVB A;  1XD3 B;  2RDH A;  2WXF A;  3N9Y C;  4RF0 A;  4KKI A;  1HZ6 A;  2DBY A;  2MHJ A;  1ZUD 2;  1HTQ A;  3T8M A;  1I4R A;  4HDO A;  3MHZ A;  2MQJ A;  3QHT A;  3MP9 A;  2KDF B;  2INP E;  1UNS A;  2ZZP B;  4RCO A;  2YLM A;  3R7R A;  1WI0 A;  3ZRC A;  5DPT A;  3ZXV A;  2V4I B;  2WQY B;  4F7Z A;  4ZRJ A;  4C00 A;  4AUQ C;  1S1Q B;  2DEN B;  2K8C A;  3TEY A;  3W5U B;  3P4R B;  2WDR B;  3AUL A;  2KQ7 A;  2PJH A;  2G3Q B;  3WAP A;  3ONS A;  2WGS A;  1FXI A;  1V49 A;  1F9J A;  2KX0 A;  3RNB C;  2IO2 B;  4NAW A;  1VRA B;  3KYD D;  4M01 A;  1IBX B;  4GDL B;  4A90 A;  4R3D A;  4TQ1 A;  2MA9 B;  4UDU C;  5TSS A;  1WJ6 A;  3RMK C;  2QHO A;  5D2M B;  2CU1 A;  3Q8A A;  5T8I A;  1I4Q A;  2JU6 X;  3QWZ B;  2UWQ A;  5D3I B;  2FIF A;  1T3Q A;  3VH3 B;  1ENF A;  1LFD A;  1PGX A;  1P7F A;  1XEE A;  2D3G A;  1GJZ A;  5LLI A;  1V97 A;  4M0W B;  3ZYY X;  4N9F 4;  2RDB C;  2L76 A;  4LLG M;  1KM7 A;  4LJP B;  2KWU B;  2JT4 B;  3Q6B A;  4YSZ B;  1C3T A;  3JSV B;  3M3J A;  4MT5 A;  1TKE A;  3U7Z A;  3VVW B;  5KHO A;  2N0S B;  3GOE A;  4C4V B;  1YD8 U;  2E3T A;  2V1Y A;  3AEF B;  1IYF A;  3UI3 A;  4B6W A;  3TIX A;  1GB4 A;  2C5L C;  2LVP A;  1KLV A;  3A4R A;  1WWT A;  5C3J B;  2M17 A;  3Q8C A;  4JLC A;  3NY5 A;  2WXG A;  1D5X C;  1UGJ A;  2K0P A;  1PUT A;  2REX A;  3HUI A;  4K3B A;  2L52 A;  2DYM A;  2BT6 A;  2JXT A;  4YSX B;  3X23 A;  3RZW C;  2KAJ A;  2Z0D B;  3EA6 A;  2ZW1 A;  3BZD B;  1SE9 A;  4RM9 A;  5IN7 A;  2KD0 A;  1HTO A;  5BMH A;  1FEH A;  2BW2 A;  3W1S A;  2TSS A;  1UWX A;  3DPD A;  3FC4 A;  4NAW B;  1WXM A;  1VZ8 A;  3RUI B;  2CHW A;  1ET6 A;  4GB9 A;  1ZDX A;  3BK1 A;  4E74 A;  3BYY B;  1WGH A;  3L4P A;  3DWM A;  4JQW C;  4RGT A;  3VTU A;  3VDZ A;  3H7P B;  5AZH A;  4DWF A;  1P1A A;  2AL3 A;  4JL9 A;  1YQ4 B;  1WR6 E;  2IY0 B;  3IHP C;  4MM3 B;  2WXM A;  2WXJ A;  3AV8 A;  3Q8F A;  4W9C A;  5H92 C;  2J7Q B;  5JXV A;  5KHQ A;  4YXD B;  2LD9 A;  3NVZ A;  2K6Q A;  2MWS B;  2NCN A;  4HJK A;  4FJV B;  1WSP A;  3Q2A C;  1WMH A;  3JYU A;  4ZYN A;  1JRU A;  4FA6 A;  2O2V A;  1ET9 A;  3PLU A;  1MPE A;  5AZF A;  1QQR A;  2FCS A;  1WGY A;  3N3K B;  2CKH B;  3ZNZ B;  4I6P A;  1ZGU B;  3TUO A;  1F52 A;  2QMT A;  3KVF B;  2VZK D;  3A9K A;  4CO7 A;  1R4N I;  1SIJ A;  2N9P C;  1UWM A;  2GRI A;  1C78 A;  3ZLZ A;  1WXQ A;  1WM3 A;  2A5U A;  4GMV A;  3URY A;  3JVZ X;  4NJC A;  3NZ3 A;  4XWW A;  4ZOH C;  3RPF C;  1J19 A;  3ZGZ A;  1FO4 A;  3TCA A;  2WX0 A;  5IOI A;  3B1L X;  3QX1 A;  1FCL A;  3PHW B;  1EU4 A;  4B0M A;  2KTF A;  2E6X A;  2PVG C;  4IWP A;  5CHV C;  1CQV A;  2I1K A;  1WH3 A;  2J52 A;  3PPA A;  2MJD A;  4RF1 A;  2M8S A;  1WR1 A;  2Y5P A;  1F2R I;  4OZC A;  1WGR A;  2G9H D;  2C7H A;  3AH7 A;  5L95 C;  2PLP A;  3DBL B;  4II2 B;  3LYY A;  1A5R A;  1TJE A;  1HQR D;  3C19 A;  1P3Q U;  2AX5 A;  3OJ3 A;  1JRO A;  3ZQ4 A;  2LRW A;  2LMC A;  3SU8 X;  3OJ4 B;  4AWJ A;  3MC0 B;  2D3A A;  1NDD A;  3L10 B;  4FN2 A;  2WNM A;  4BKT A;  2LVQ A;  1XT9 B;  1WZ0 A;  2LGX A;  4IWO A;  4RGN A;  5C23 A;  2D3B A;  1TYG B;  1WMH B;  4JIO U;  4DXG A;  2VH2 A;  5EE9 A;  4YSY B;  1L6V A;  2O2V B;  2N7D A;  4IM2 A;  3V62 A;  1NYR A;  4W9I A;  3AEG B;  3BVG A;  2K9X A;  4NJ7 A;  3B2F A;  1EF1 A;  1E8W A;  4NNJ B;  2FAZ A;  3PS6 A;  3R3M A;  4ASW C;  1E90 A;  4IOI E;  2BKF A;  3A9K B;  1WIA A;  4KDI C;  2D07 B;  4A3P A;  1V80 A;  2KWC A;  5DPW A;  4FAD A;  1E8Z A;  2ICI A;  1NEK B;  4LTU A;  1ZKH A;  2WXQ A;  2NMQ A;  4FLH A;  2W3S A;  5H8Y E;  2FUG 1;  4GIV A;  2PEA A;  2EKE C;  1YNT E;  3L16 A;  4BZA A;  3ML8 A;  1TTN A;  3NRZ A;  2V4L A;  3UF8 A;  2G45 B;  4W9G A;  4B0E A;  4RGM A;  2RMM A;  2IND C;  4DHJ D;  2BYE A;  2FCN A;  2L83 A;  1NEN B;  1UGM A;  2WYQ A;  4CYE A;  1I35 A;  1ZW7 A;  2BBC A;  2GI9 A;  1WJU A;  5CHW A;  1LO5 D;  2DLB A;  3NVY A;  3Q3O C;  1J7B A;  4B9K A;  3VXW A;  2R2Q A;  2WXP A;  3HVZ A;  4KV2 A;  2MX2 A;  3BYT B;  3J9C A;  2CHZ A;  4JPS A;  3R2I A;  3PZD A;  1VLB A;  1PFD A;  2QSD A;  4MH8 A;  2IGG A;  1GC6 A;  4G0N B;  2KN4 A;  1D6E C;  2B3A A;  4B95 A;  4EZJ A;  3M62 B;  5HKH A;  4GSW A;  4JX1 C;  4W9J A;  2D10 A;  3L17 A;  1D4B A;  3ZDM C;  4EZK A;  1ZDV A;  4US9 A;  3M63 B;  2L05 A;  1R7S A;  3ALB A;  5EE1 A;  4EOY A;  3WA0 A;  2QIE B;  4P7I A;  1XO3 A;  1I4H A;  4A6Q A;  1TKG A;  1J7A A;  4AP4 C;  2KDE B;  1KLG D;  4P1C C;  2KC1 A;  3P63 A;  1UF0 A;  5J17 A;  2C7M B;  3SR6 A;  4OVZ A;  3UIN B;  1C4A A;  2ONQ A;  2KDI A;  1OQR A;  4USA A;  1FNV A;  5L83 A;  2WXL A;  2NPT A;  2D5G A;  4OVU A;  3H6N A;  3AE8 B;  1I4P A;  2XK5 B;  1E9M A;  2IO0 B;  5G55 A;  3APF A;  4WJQ A;  1IGC A;  1EF5 A;  5EDS A;  2LGS A;  5AUK A;  2MJ3 A;  1QLB B;  1T0S C;  3EGR A;  3N20 C;  2NBU A;  1L4D B;  3UQB A;  3HHM A;  1FXA A;  1WX8 A;  4L1B A;  3ZNI D;  1TIF A;  3VRA B;  2N9X A;  3P2B A;  5AZG A;  2LUE A;  1QF6 A;  2BGF A;  3ZKJ C;  2M4N A;  2PPH A;  2IO1 B;  2MP2 A;  2KNB A;  3PRE A;  3A9J B;  4IM0 A;  1DOX A;  3DDC B;  1K50 A;  1ZP0 B;  4ZHP A;  1G6J A;  2D2Q A;  1R4M B;  3SFE B;  1ZE3 D;  2Y5C A;  4W9L A;  3AU4 A;  5CTR C;  3I63 C;  2ASQ A;  4FHK A;  3V3X A;  2CHX A;  1N5X A;  1ROE A;  1L7Y A;  4GDL A;  1E10 A;  5DPS A;  4NJ6 A;  3BWU D;  2GBK A;  2IZV B;  4YWG G;  4IG7 B;  1V81 A;  3O65 B;  4FHJ A;  1QZE A;  2JQR B;  4OVV A;  2FCQ A;  2DHZ A;  2RR9 A;  2RD0 A;  1SBB B;  1WM2 A;  3PRZ A;  4FJY A;  3U4E G;  1WX9 A;  1YN5 A;  4M0W A;  3HIZ A;  1CJE A;  4W9F A;  3AMZ A;  2MBQ A;  1NYQ A;  2Y3A A;  4ICU A;  4C7Z A;  2LVO A;  3QIJ A;  3AXC A;  1GAQ B;  2JF5 A;  4BKG A;  2K3U A;  2HTH A;  3LJ3 A;  3QK0 A;  3O13 A;  1IPG A;  1YIW A;  3V05 A;  1CMX B;  5GXG B;  4DHJ B;  1SE3 A;  2BS4 B;  2GLS A;  3RNG C;  2R61 A;  3DBH B;  4ANV A;  1V5O A;  5G2N A;  3H7S A;  1N5W A;  4MGI E;  1CZP A;  1Q5W B;  3R7Q A;  2ZEQ A;  4KGS A;  2KJ6 A;  3DHI C;  5BYS A;  1C77 A;  1S3S G;  1M4V A;  3RZF A;  1NBF C;  2L3Z A;  4KZC A;  3C0R B;  4OHJ A;  3AEA B;  4JWS C;  1C79 A;  4WWP A;  2MP2 B;  2OJR A;  3ZRF A;  2LHE A;  2M0A A;  5E6P A;  2NVU I;  2DNF A;  5EE3 A;  1L0Y B;  2BTE A;  1P9D U;  4HCN B;  1I7H A;  3UGB B;  3R66 C;  1EWY C;  3RNA C;  1V9J A;  1TZO A;  1HXY D;  1K51 A;  2LI5 A;  3IAM 1;  4P1B C;  4DDG D;  3H7P A;  1WYW B;  1WYG A;  4K81 A;  3HK0 A;  4MM3 A;  5GMV A;  3GE3 C;  3NS8 A;  4ZDV A;  1RRB A;  2J0M A;  4K7S A;  1JW9 D;  2HE7 A;  2D3C A;  1PGB A;  1AYF A;  2KOX A;  1RFA A;  4AQ7 A;  2NBV B;  4HK2 A;  1IP9 A;  3U52 E;  4AJY B;  3RUL A;  3T9L A;  3HM6 X;  3AE6 B;  1SB3 C;  5D7G A;  1SE4 A;  4EUT A;  1D3Z A;  2RSU A;  3AE3 B;  2WXN A;  2KDM A;  4LK0 M;  2YEP F;  4HKZ E;  3U8Z A;  3AU5 A;  4KKJ A;  3V60 A;  1HE8 A;  4WJO A;  2L0F A;  2MBB B;  3CST A;  3APD A;  1L2N A;  2GBN A;  3NUH B;  3NVV A;  2JRI B;  4DHZ B;  2GBJ A;  4QAY A;  4I6N B;  1B1Z A;  2PIA A;  1TT5 B;  4HWI B;  1GOZ A;  5HI1 A;  4FJZ A;  1K52 A;  2LGI A;  2AQ2 B;  2LUM A;  5J18 A;  2KVR A;  1P98 A;  3PSE B;  3ZNG C;  3W5V B;  1I4X A;  2KVZ A;  3UIP B;  4IW0 A;  1D5Z C;  3GE8 C;  4DHZ E;  3VAW A;  2O6V B;  3IT6 B;  4KGT A;  2WDV B;  1JQ4 A;  1E7V A;  3AI5 A;  1Q1O A;  2OHF A;  3MJW A;  5AEK B;  3ZDT A;  3DBR I;  4ANW A;  2W54 A;  2CJO A;  5LXI B;  2NTS A;  1E8X A;  1XQQ A;  2UYZ B;  2HJ1 A;  2LRU A;  2K8H A;  5HFY A;  1XLO A;  3NZS A;  1JWS D;  5IKC M;  1H8C A;  1FM0 D;  4LDT D;  3PRP B;  1T0Q C;  3QC8 B;  5BMG A;  3EFC A;  2VH1 A;  2WX1 A;  4ARI A;  1E8Y A;  2PW9 A;  4K7U A;  4ANX A;  3AE9 B;  3L54 A;  2NTT A;  4YTN B;  1E7U A;  4PS7 A;  5E6N A;  3WAO A;  4J6I A;  2OOB B;  1UH6 A;  3ZJU A;  4KDL B;  4GXB A;  1WGG A;  2KQ4 X;  3BVZ A;  3WCQ A;  1FRR A;  3JW0 X;  1J8C A;  2LEK A;  2V3N A;  2XN9 C;  1YN3 A;  3VR8 B;  3VFK A;  2N1V A;  4Q2J A;  3ZJV A;  2LJI A;  1VCB A;  1RWS A;  1SJH D;  2M56 B;  1WXV A;  2FNJ B;  4H2A A;  4BBN F;  3I5J C;  3Q14 C;  2JUO A;  3BVM A;  4F8C B;  3DBH I;  3Q3F A;  3KWV A;  3NHE B;  2JSV X;  1BT0 A;  2J0J A;  5J2R A;  4FBJ B;  2CJN A;  3X0W A;  1OGW A;  3ZUN A;  2W82 A;  2L0T A;  4MSQ B;  4IKG A;  1NI2 A;  1H4R A;  4TUU A;  1YX6 B;  3SFD B;  1QOA A;  1Y8R C;  2K8B A;  3MHS D;  5C2T B;  3OAW A;  4II3 B;  4XWT A;  4TQ0 A;  2MW5 A;  3V6E B;  3CWI A;  3CMM B;  2IJ0 A;  3B2G A;  1FCC C;  4KSL C;  1DGJ A;  4HCP B;  3H9D A;  4G11 A;  2FCM A;  2BQQ A;  4IC7 B;  4WAA A;  2XBB C;  2ZNV C;  2ZPN A;  1LQB A;  4BAX A;  5IAA C;  2PTL A;  1SSN A;  3GZN B;  2AWT A;  1YQB A;  3SEB A;  2LHD A;  4PYU A;  1GUA B;  3DVN V;  5JH5 C;  1ZOY B;  1Q0W B;  5CX3 A;  3ECI A;  1VD2 A;  3AE5 B;  2QC8 A;  5BYR A;  3H1U A;  1MG8 A;  4DXA B;  1BXT A;  1OFF A;  2KLC A;  3KW5 B;  1KF6 B;  2WS3 B;  1UD7 A;  3OWE B;  4MAC A;  3VRB B;  1VR9 A;  4X57 B;  5D6J B;  2MEK A;  1V6E A;  1XCT L;  1YX5 B;  2ZCC A;  4WWO A;  3U2S C;  1V5T A;  2SAK A;  4XDC A;  4RNA A;  2ZCB A;  3WAN A;  2SEB D;  4MGY E;  2I38 A;  4PS8 A;  3B0A A;  3K9P B;  2KFJ A;  2XK5 A;  3MJ5 A;  3IBE A;  1LXD A;  1HEZ E;  1QOG A;  2FID A;  4XE0 A;  4EFO A;  2BS2 B;  1X1M A;  2JYE A;  3KUZ A;  4M02 A;  2MBE A;  2A4Z A;  3NG0 A;  3WAM A;  1TS3 A;  3ZNH B;  3Q3M C;  2NS5 A;  2PMV A;  1QIL A;  2G4D B;  3Q8B A;  1STE A;  4RM8 A;  4MGZ E;  2WU5 B;  1OQQ A;  2L7R A;  3MFG A;  2WLB A;  2BVC A;  3CSF A;  3A9J A;  3APC A;  4LNO A;  2KHW B;  1WY8 A;  4MJS B;  1GNU A;  3V6C B;  4NQL B;  4D2K A;  4LDT B;  2RDG A;  2OJW A;  4E3C A;  3IXS A;  1DYQ A;  3RCZ A;  5E6O A;  1SJE D;  3TEW A;  2N9E B;  3A33 B;  2DAJ A;  1BUI C;  2ZVO A;  2FBW B;  2W3R A;  4IM3 A;  1ESF A;  1K8R B;  4AOF A;  1TS5 A;  3V61 A;  3PTF C;  3VR9 B;  1C76 A;  1WRD B;  2BB5 A;  2K1F A;  2WU2 B;  4LJO B;  4NPN A;  3VHT C;  5JHB A;  2HTM E;  1JWA D;  3RFZ B;  3VTV A;  2AQ3 B;  3QAQ A;  4PK1 A;  2DZK A;  4XDD A;  3BY4 B;  4WJN A;  4WIP A;  2ZVN A;  2XNA C;  3PO0 A;  2L00 B;  3IG3 A;  3D32 A;  4WH4 A;  1ZPS A;  3EFU A;  3DVG X;  1PGA A;  1DOI A;  2RPV A;  1KFY B;  4BKS D;  4W9E A;  1XF5 L;  4K7W A;  4K1R B;  1OQY A;  1GC7 A;  4M8M A;  2V9H A;  3UQA A;  2AEH A;  1TZ1 A;  4ZHO A;  2N9L A;  3WIM A;  3L0W B;  4TSS A;  3K9O B;  1A70 A;  3PZ8 A;  4RFB A;  2MSE D;  2KAN A;  2DZM A;  4YTP B;  2IY1 B;  5I4D A;  4MSM B;  3P4P B;  1WZ3 A;  2KJR A;  3AEB B;  4KGR A;  5D3D A;  2Q5W D;  2IO3 B;  3I9V 1;  1JRP A;  1JAL A;  1F1H A;  1QOB A;  1YMH E;  4ZRI A;  4LNK A;  1TS4 A;  1ACC A;  4FXC A;  3DBS A;  2AL6 A;  3CIR B;  3FKY A;  3NOB A;  4YTM B;  3P1M A;  1UZX B;  3DQV A;  1EM7 A;  2O6V D;  3ZTC A;  2KFK B;  4K3C A;  2JY6 A;  3DBL I;  2DWQ A;  2BS3 B;  4RGO S;  4XC2 A;  1N63 A;  4YL8 A;  2H89 B;  2CS4 A;  4XGA B;  3U30 A;  1YN4 A;  3WAL A;  4HLE A;  4O1N A;  1FD6 A;  4ACF A;  2DZI A;  2IDY A;  4BKS A;  4RH6 A;  3RNC C;  4TMA B;  5D94 A;  2LFI A;  1VJK A;  4GGQ A;  1J0G A; 
#chains in the Genus database with same CATH homology
 4HWI B;  1WGR A;  2K39 A;  2C7H A;  2GOW A;  4KVG B;  4HPM B;  4FJZ A;  5L95 C;  5JHA A;  4II2 B;  4BOZ B;  5J18 A;  2KVR A;  1A5R A;  1P98 A;  1RLF A;  3N30 A;  3PSE B;  4ANU A;  4LCD E;  3ZNG C;  1P3Q U;  3OJ3 A;  2DZJ A;  4IW0 A;  3UIP B;  2LRW A;  4RMA A;  3SU8 X;  2KTR B;  3A4S C;  3CF6 E;  3OJ4 B;  4AWJ A;  4DHZ E;  3VAW A;  5IA7 A;  2O6V B;  2NBW B;  2JPH A;  3VQI A;  1NDD A;  4JGH B;  3L10 B;  4FN2 A;  4DBG A;  1E7V A;  3AI5 A;  1Q1O A;  4BKT A;  2LVQ A;  3MJW A;  3VUY A;  3DVG Y;  1XT9 B;  3U7D A;  1WZ0 A;  2LGX A;  5AEK B;  4IWO A;  3ZDT A;  2K6D B;  3MTN B;  5C23 A;  1OTR B;  1WMH B;  3DBR I;  4JIO U;  2DAF A;  2I1J A;  4ANW A;  2BF8 B;  1WXA A;  2R2O A;  1C1Y B;  4E71 A;  5LXI B;  2O2V B;  3LDZ E;  2N7D A;  1E8X A;  1XQQ A;  2C60 A;  3PV1 A;  4IM2 A;  3V62 A;  2UYZ B;  3TMP B;  2LRU A;  4W9I A;  3N32 A;  2K8H A;  3NZS A;  3EC8 A;  4KIK A;  4NJ7 A;  1H8C A;  1E8W A;  1EF1 A;  1OEY J;  4MH0 E;  4NNJ B;  5FR6 A;  2FAZ A;  3ML9 A;  3PS6 A;  3PRP B;  3R3M A;  4LDT D;  4ASW C;  1P0R A;  1M94 A;  1E90 A;  3QC8 B;  2O6V A;  3ZIM A;  2BKF A;  3A9K B;  1WIA A;  4KDI C;  2D07 B;  4A3P A;  1V80 A;  2KWC A;  5DPW A;  4FAD A;  2J0K A;  1E8Z A;  1SIF A;  1UBQ A;  1ZKH A;  2WX1 A;  4FLH A;  1E8Y A;  4K7U A;  4ANX A;  4GIV A;  3L54 A;  3ZW3 A;  2ZJD A;  1E7U A;  2MRP A;  2PEA A;  2L8J A;  4PS7 A;  2EKE C;  2LAS A;  3L16 A;  4IUM B;  3ML8 A;  3QA8 A;  5E6N A;  4F1S A;  3WAO A;  4J6I A;  2ZPY A;  2FUH B;  1TTN A;  1UH6 A;  2OOB B;  3DOW A;  3TL5 A;  4KDL B;  5LXH A;  2V4L A;  4GOC A;  4GXB A;  1WGG A;  2G45 B;  3UF8 A;  2DYO A;  4W9G A;  2LZ6 A;  3VUW A;  5C1Z A;  4DHJ D;  3EHV A;  2BYE A;  1AAR A;  2HD5 B;  3JW0 X;  1PQS A;  1J8C A;  2G4S A;  2FCN A;  1UGM A;  2WYQ A;  4FUL A;  3A1Q B;  2C7N B;  3VFK A;  4CYE A;  2XEW A;  3QJZ A;  2N1V A;  1EO6 A;  3VH4 B;  1I35 A;  2Z59 B;  1ZW7 A;  1WJU A;  1VCB A;  2N1W A;  1WXV A;  2FNJ B;  5CHW A;  2AYO B;  2PE6 B;  2WDT B;  4BBN F;  4BOS C;  2KDB A;  4GU2 A;  3VTW A;  2JWZ A;  2JUO A;  1V86 A;  5CHF A;  5BO4 B;  3DBH I;  4WJP A;  3Q3F A;  3VXW A;  2R2Q A;  3NHE B;  4KV2 A;  4B9K A;  4F8C B;  3GZN I;  1WF9 A;  2MX2 A;  1BT0 A;  4A3O A;  2J0J A;  5J2R A;  4FBJ B;  2DX5 B;  3QCA A;  4MEL A;  2CHZ A;  3X0W A;  4WQO B;  1OGW A;  3ZUN A;  4PYZ A;  3BIN A;  3L08 A;  3PVL A;  2L0T A;  4MSQ B;  1WGD A;  1NI2 A;  1H4R A;  3PZD A;  4TUU A;  3PRM B;  1YX6 B;  1GC6 A;  1Y8R C;  4MEM A;  2K8B A;  3MHS D;  4EZL A;  4G0N B;  4AJW A;  4EKU A;  1FXT B;  3OAW A;  4II3 B;  4EZJ A;  2B3A A;  4B95 A;  2LGY A;  2GBM A;  4HDQ A;  2MW5 A;  4TQ0 A;  2BPS A;  3PGE A;  2JXX A;  3M62 B;  3V6E B;  2BKR B;  5HKH A;  3ZVV A;  3ZTD A;  3EEC A;  4GSW A;  3CMM B;  4PS3 A;  2NPT B;  4KSL C;  4W9J A;  2D10 A;  3L17 A;  1WXS A;  1WFY A;  1GG3 A;  4XX5 A;  3ZDM C;  4EZK A;  1V2Y A;  4HCP B;  3H9D A;  4G11 A;  2KWV B;  3M63 B;  2L05 A;  3L13 A;  2FCM A;  4DK5 A;  3W1Y A;  2D11 A;  3ALB A;  1TBE A;  4IC7 B;  4EOY A;  3WA0 A;  4P7I A;  1SGH A;  3SD5 A;  2IYD B;  2Z0E B;  3JSV A;  4WAA A;  2K25 A;  2XBB C;  2ZNV C;  1I42 A;  3ZRC A;  2ZPN A;  4KIK B;  4HXD A;  1LQB A;  4AP4 C;  3ENE A;  2KZR A;  4HVB A;  1XD3 B;  2KDE B;  2KMA A;  5IAA C;  2KC1 A;  5J17 A;  2C7M B;  3SDL C;  3UIN B;  2KKC A;  2KDI A;  2RGF A;  2AWT A;  1YQB A;  2KQS A;  1LM8 B;  2W9N A;  4PYU A;  5L83 A;  1GUA B;  3DVN V;  5JH5 C;  3T8M A;  2NPT A;  1Q0W B;  5CX3 A;  4HDO A;  4KSK C;  3ECI A;  1VD2 A;  2MQJ A;  4OVU A;  1R4M I;  3H1U A;  1MG8 A;  3QHT A;  4DXA B;  3H6N A;  2KDF B;  2KLC A;  4URK A;  3KW5 B;  2XK5 B;  2EMT A;  2BWF A;  2N7E A;  2IO0 B;  2YLM A;  2ZZP B;  1UD7 A;  3R7R A;  1WI0 A;  5G55 A;  3APF A;  4X57 B;  4WJQ A;  4IWQ A;  1EF5 A;  2KMC A;  5EDS A;  2GBR A;  2LXC A;  5D6J B;  1V6E A;  4WWO A;  1YX5 B;  2ZCC A;  5DPT A;  1WX7 A;  2MCN B;  4F7Z A;  4ZRJ A;  4AUQ C;  1S1Q B;  2DEN B;  2NBU A;  2K8C A;  1V5T A;  2N4F A;  3UQB A;  3AUL A;  2YVC A;  2KQ7 A;  1WX8 A;  2PJH A;  3HHM A;  2G3Q B;  3WAP A;  3ZNI D;  3ONS A;  1V49 A;  2ZCB A;  3RD2 A;  3WAN A;  4BFR A;  2N9X A;  3P2B A;  1F9J A;  2KX0 A;  3PHX B;  2IO2 B;  4MGY E;  2LWP A;  4NAW A;  4ZRK A;  4PS8 A;  5AZG A;  2LUE A;  3KYD D;  3PT2 B;  3B0A A;  3K9P B;  2KFJ A;  4GDL B;  2BGF A;  2XK5 A;  3ZKJ C;  2M4N A;  2PPH A;  4TQ1 A;  2MA9 B;  3IBE A;  2IO1 B;  1LXD A;  2JRH A;  2MP2 A;  1WJ6 A;  3RT3 B;  2KNB A;  2QHO A;  3PRE A;  2FID A;  4EFO A;  3A9J B;  4IM0 A;  5D2M B;  2CU1 A;  2DYB A;  2M1M A;  3DDC B;  1X1M A;  3QWZ B;  2UWQ A;  1G6J A;  2FIF A;  3W1S C;  3KUZ A;  2MBE A;  2D2Q A;  3OLM D;  3VH3 B;  2A4Z A;  2BYV E;  1LFD A;  3VUX A;  3WAM A;  1ISN A;  3ZNH B;  4W9L A;  1Z5S B;  3I3T B;  2D3G A;  3AU4 A;  2NS5 A;  5CTR C;  1GJZ A;  2ASQ A;  5LLI A;  4M0W B;  4A20 A;  4FHK A;  4DDI D;  4N9F 4;  2CHX A;  2L76 A;  2LXA A;  1KM7 A;  2G4D B;  4LJP B;  1L7Y A;  2KWU B;  2JT4 B;  4GDL A;  4RM8 A;  5DPS A;  4MGZ E;  4NJ6 A;  2L7R A;  2GBK A;  2IZV B;  4IG7 B;  1V81 A;  3A9J A;  3APC A;  3CSF A;  3O65 B;  4FHJ A;  2KHW B;  1C3T A;  1WY8 A;  4MJS B;  3JSV B;  3M3J A;  1GNU A;  1QZE A;  4W9D A;  1WE7 A;  3V6C B;  4NQL B;  4OVV A;  2FCQ A;  3KH0 A;  4KZ0 A;  3VVW B;  4LDT B;  2DHZ A;  5KHO A;  2KK8 A;  3GOE A;  2RR9 A;  1YD8 U;  3ZO5 B;  2V1Y A;  2RD0 A;  4E3C A;  4BVU C;  1WM2 A;  1IYF A;  3RCZ A;  3PRZ A;  4B6W A;  2Y5B B;  3TIX A;  4FJY A;  5E6O A;  2C5L C;  1WX9 A;  2LVP A;  1KLV A;  2MBH A;  1OEY A;  3A4R A;  3IFW B;  3HIZ A;  2M17 A;  4W9F A;  4JLC A;  3SHQ A;  2MBQ A;  3NY5 A;  3DCG A;  4ICU A;  4MDK E;  2KXJ A;  2N9E B;  4CHK A;  2JVC A;  3KUD B;  3A33 B;  2LVO A;  3QIJ A;  2REX A;  2DAJ A;  2ZVO A;  3AXC A;  1WJ4 A;  2JF5 A;  3HM3 A;  3Q3J A;  4IM3 A;  1K8R B;  4BKG A;  1UEL A;  4AOF A;  4BBN C;  4MJS A;  2VRR B;  2HTH A;  3V61 A;  2DYM A;  3LJ3 A;  3QK0 A;  3PTF C;  2KJH B;  1IPG A;  1YIW A;  1CMX B;  4G3X B;  1WRD B;  5DPR A;  4W9K A;  2IBI B;  2K1F A;  3X23 A;  3RZW C;  4DHJ B;  2EMS A;  4LJO B;  4NPN A;  3VHT C;  2MBO A;  2Z0D B;  5JHB A;  4ANV A;  1V5O A;  1SE9 A;  1T0Y A;  4RM9 A;  2KC2 A;  2KD0 A;  1U4A A;  5G2N A;  3VTV A;  2LGD A;  3H7S A;  3QAQ A;  2DZK A;  3BY4 B;  4WJN A;  2JZ3 B;  3NZU A;  4MGI E;  3S2A A;  3W1S A;  1Q5W B;  3R7Q A;  2ZEQ A;  5JZE B;  2ZVN A;  2RPQ A;  1KOT A;  2KJ6 A;  2BYF A;  2L00 B;  3IG3 A;  4MGK E;  1EUV B;  3D32 A;  1WE6 A;  3DPD A;  4TKN A;  1S3S G;  4NAW B;  1WXM A;  2KN5 A;  4XZ4 A;  1NBF C;  3RUI B;  2WWZ A;  2L3Z A;  2CHW A;  3EFU A;  4KZC A;  3RZF A;  4GB9 A;  3C0R B;  3DVG X;  4GDK A;  4E74 A;  4BKS D;  4W9E A;  4WWP A;  1WGH A;  2MP2 B;  2OJR A;  4K7W A;  4JQW C;  2BWE S;  4K1R B;  3ZRF A;  3VTU A;  3VDZ A;  1OQY A;  4I6L B;  5E6P A;  2NVU I;  3H7P B;  5AZH A;  4DWF A;  1GC7 A;  1P1A A;  2AL3 A;  4M8M A;  4JL9 A;  1P9D U;  1WR6 E;  2AEH A;  2IY0 B;  4HCN B;  3UQA A;  3IHP C;  3UGB B;  2ZNV B;  1E5W A;  1TZ1 A;  2KO3 A;  3R66 C;  3WIM A;  3L0W B;  3K9O B;  3B08 A;  4NQK E;  5TR5 A;  4W9H A;  3TJP A;  2MSE D;  4ICV A;  4W9C A;  2KAN A;  1V9J A;  2J7Q B;  2DZM A;  2KTR A;  2MLB A;  3DVN U;  2KLG A;  4GN1 A;  5KHQ A;  2KX3 A;  2CR5 A;  2IY1 B;  2LD9 A;  4MSM B;  2K6Q A;  2MWS B;  1WZ3 A;  2KJR A;  2NCN A;  4HJK A;  3KYC D;  4FJV B;  2LI5 A;  2LJ5 A;  4DDG D;  3H7P A;  1WMH A;  1WYW B;  3JYU A;  4ZYN A;  1RAX A;  4K81 A;  1JRU A;  2IO3 B;  3HK0 A;  4MM3 A;  4FA6 A;  2O2V A;  3PLU A;  5AZF A;  2HJ8 A;  5GMV A;  4ZRI A;  3NS8 A;  2FCS A;  2C9W B;  4ZDV A;  1WGY A;  1RRB A;  3DBS A;  3M95 A;  2AL6 A;  2J0M A;  2CKH B;  3N3K B;  4K7S A;  4NY0 A;  3ZNZ B;  4I6P A;  2HE7 A;  3IVF A;  2GMI C;  5DCN A;  1ZGU B;  3NOB A;  2KOX A;  1RFA A;  1UZX B;  3DQV A;  2NBV B;  2O6V D;  3KUC B;  3A9K A;  3KVF B;  4HK2 A;  3ZTC A;  4CO7 A;  3RYT A;  1R4N I;  2KFK B;  1IP9 A;  2N9P C;  4AJY B;  3RUL A;  2JY6 A;  3DBL I;  2JZZ A;  3T9L A;  3HM6 X;  3ZLZ A;  4XC2 A;  1WM3 A;  5D7G A;  2A5U A;  4GMV A;  4YL8 A;  3JVZ X;  4EUT A;  1D3Z A;  2RSU A;  4TV3 A;  1KJT A;  2CS4 A;  3QQ8 B;  1J19 A;  3U8Z A;  3U30 A;  1TGZ B;  3AU5 A;  3TCA A;  2WX0 A;  1UBI A;  1HE8 A;  3V60 A;  3WAL A;  4HLE A;  3B1L X;  3QX1 A;  4WWN A;  4WJO A;  2L0F A;  2MBB B;  4HPL B;  3PHW B;  3QAR A;  4M8N A;  2KTF A;  1YJ1 A;  3PLV A;  4IWP A;  2KFK A;  2M0X A;  2DZI A;  3A1Q A;  4G50 A;  4GDK B;  5CHV C;  2I1K A;  1WH3 A;  3CST A;  3PPA A;  3TBL D;  4BKS A;  3APD A;  1L2N A;  1Z2M A;  2GBN A;  4DHZ B;  2JRI B;  2GBJ A;  2M8S A;  2NR2 A;  4EEW A;  5D94 A;  1WR1 A;  2V3S A;  4GGQ A;  4I6N B;  3UIO B;  1J0G A;  1WJN A;  2PE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...