3DOWA

Complex structure of gaba type a receptor associated protein and its binding epitope on calreticulin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
119
structure length
119
Chain Sequence
GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid receptor-associated protein
publication title Structural framework of the GABARAP-calreticulin interface - implications for substrate binding to endoplasmic reticulum chaperones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 33
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dowA00
1OQYA 3QK0A 2YLMA 1WMHB 3IFWB 2FNJB 1WZ3A 3M63B 4W9LA 4WJPA 3RCZA 3RULA 3ENEA 2JF5A 5JHBA 1NI2A 2MBHA 2PJHA 3H9DA 3PZDA 3HHMA 3A9JB 5IAAC 3NS8A 2XK5A 4AWJA 5JHAA 4GDLA 2KFKA 3CSTA 1E8ZA 3DVGY 2FAZA 3ZUNA 4URKA 3PREA 3PLUA 2MWSB 5D6JB 3DQVA 4AJWA 1UD7A 2WWZA 3AULA 3N30A 4LJPB 5FR6A 2ZVOA 3WANA 3DBLI 1KOTA 2KJRA 2BYFA 2LXAA 2ZEQA 4EZLA 1OEYJ 3PGEA 3VH4B 4AP4C 3AXCA 4GIVA 4JQWC 4BKTA 2K1FA 1XT9B 5BO4B 1P1AA 2AL3A 2DZIA 4G3XB 4GOCA 5KHOA 1I35A 4FADA 2GBMA 5G2NA 3H1UA 3L10B 4WJOA 3ZDTA 2KC1A 3MTNB 3NY5A 3TMPB 1TZ1A 2LUEA 4AOFA 4DDGD 4E71A 2KWVB 4EEWA 3GOEA 4WJQA 3ZW3A 3ZNHB 4TQ0A 3SU8X 3ZVVA 3A1QA 1Q5WB 4MH0E 2O6VB 5DCNA 4IM0A 1HE8A 3DBSA 2JXXA 4KV2A 3OJ3A 2ASQA 2RPQA 5DPTA 4FLHA 1V5TA 3A33B 1WXMA 1Y8RC 3ZKJC 3KUDB 4JLCA 2GOWA 3QCAA 4A3PA 4LDTB 5IA7A 2DHZA 2KVRA 3QX1A 4E74A 1ZW7A 4A3OA 4MGZE 2FCSA 4CYEA 1WH3A 1WRDB 2V4LA 2GMIC 2XK5B 2ZPNA 2KFKB 3H7PB 3V62A 3KUCB 4W9GA 3UIPB 1KM7A 3DVNV 2KD0A 3JSVA 1RFAA 3L13A 4NQKE 4HDQA 4OVUA 1WXSA 5LXHA 3NZSA 4M8NA 2L3ZA 2LXCA 4W9EA 2KDBA 3EFUA 3TJPA 2KLCA 4FULA 2AL6A 2V3SA 5AZGA 3RUIB 1LXDA 2KQ7A 2C7MB 2CHWA 4ZDVA 3ONSA 4TUUA 2K8BA 3V6CB 1WJ4A 4I6LB 4RM8A 2KMAA 2N7EA 2O2VA 1WX8A 2N9XA 4M0WB 4MELA 1S1QB 1IYFA 1GC7A 4ZRKA 2NR2A 2AYOB 4PYUA 4BVUC 3IG3A 1V9JA 3A1QB 1GG3A 2GBRA 4GGQA 3R7QA 4EZKA 2FCNA 3ML8A 1WXVA 4N9F4 2LVQA 3N32A 1LFDA 4WJNA 2DYBA 1XQQA 4MJSA 1E8XA 2XBBC 1CMXB 3WAOA 2HJ8A 1E7UA 1WJ6A 3QIJA 3CMMB 4DHZE 4DK5A 3ZNID 1SE9A 2M17A 2EMSA 2WDTB 4DDID 1E7VA 4IM3A 5E6PA 3C0RB 3PHWB 4FJZA 3U30A 3DCGA 3K9OB 4BOSC 3RZFA 2DYMA 3QARA 1UH6A 2L0FA 1RRBA 2KZRA 3L16A 4WWNA 4ZRIA 4G50A 2IO1B 4NJ7A 2CR5A 1Z5SB 2KHWB 3ZTDA 2NBUA 2L7RA 1KJTA 1V86A 5AZHA 1S3SG 2BF8B 2KKCA 4ICUA 2K39A 4F7ZA 3H6NA 1WGGA 4LDTD 3UINB 3VTWA 1EF5A 2NBWB 2KFJA 4MGIE 4RM9A 3QJZA 3QWZB 2M4NA 2KOXA 3L17A 5C23A 4GDKA 4FHJA 4FJVB 4IC7B 3PHXB 1GUAB 2D10A 2O2VB 3W1SA 4XC2A 1VD2A 1UBQA 2N9PC 2LGXA 3PTFC 2ZVNA 5EDSA 2MLBA 5AEKB 1WI0A 3V61A 1NDDA 1WF9A 4ANWA 4MGKE 2I1JA 2N1VA 5DPSA 4BKSA 4W9CA 4F8CB 2BKFA 2GBJA 1QZEA 1L2NA 2KLGA 2W9NA 4IUMB 4MEMA 4MJSB 1WY8A 2NBVB 4HJKA 3VH3B 2BYEA 2ZCBA 3W1YA 3R3MA 3ZNGC 2JY6A 4J6IA 4FA6A 2WX0A 2CKHB 4RMAA 3APFA 1YX6B 3TCAA 5DPWA 4BKGA 4CHKA 4GU2A 1H8CA 4ANUA 4DHZB 2M8SA 2K6QA 2FIDA 2LRWA 1U4AA 1P3QU 3M62B 4EUTA 3EECA 1IPGA 4FBJB 4HCPB 3VFKA 1WGDA 2NPTA 1Q1OA 3DVNU 2J7QB 4W9JA 2D07B 2JZ3B 5CHVC 3PRZA 1SIFA 4KSLC 4HXDA 1P98A 2J0MA 4XZ4A 3VHTC 1UELA 2KANA 3JVZX 4PS3A 5DPRA 2ZPYA 1Z2MA 1WJUA 2KJ6A 1E5WA 3KH0A 2N9EB 3BINA 1LQBA 4MSMB 3PPAA 2DYOA 3OLMD 3NOBA 4KVGB 1C1YB 2Z0DB 4BBNC 4AJYB 1H4RA 2BKRB 2Z59B 1UZXB 2JUOA 2KWCA 2BWFA 4K81A 1UBIA 2HE7A 2LGDA 2L0TA 3PS6A 2IYDB 2MW5A 3QA8A 2NVUI 2RD0A 5D2MB 2KXJA 2N1WA 4GDLB 4GMVA 1WJNA 2KMCA 2WX1A 3IVFA 2KO3A 2FIFA 3QAQA 4X57B 3SDLC 5E6NA 3SHQA 3T9LA 5J18A 1GJZA 2LGYA 4NJ6A 1J0GA 2HD5B 4EFOA 3QHTA 4I6NB 3VUYA 4HDOA 3ALBA 3K9PB 2KQSA 2V1YA 3WA0A 3RT3B 3B0AA 1WX7A 1EF1A 2C5LC 2NPTB 4W9HA 4PS7A 4E3CA 4XX5A 4NPNA 4KIKA 3L54A 1TBEA 5C1ZA 2MX2A 3VUWA 2AWTA 1AARA 2BYVE 4FHKA 2LZ6A 4HCNB 3WALA 2KK8A 1RAXA 4LJOB 2KTFA 4NQLB 3DVGX 1WFYA 4K1RB 5D94A 5GMVA 3UF8A 2MBBB 4II2B 1G6JA 3OAWA 2MA9B 2L00B 2LASA 2R2OA 4A20A 1WGRA 2KTRA 3VDZA 4HVBA 5LXIB 4NAWA 1X1MA 5JH5C 1OTRB 5CHWA 2DENB 3Q3FA 4KZCA 5L83A 3AU5A 1R4MI 2BGFA 4JL9A 3ZLZA 1GC6A 2DZJA 3B1LX 4TKNA 2AEHA 2LVPA 3R66C 4KDLB 1WMHA 4MSQB 5L95C 2EKEC 2NS5A 2KWUB 4K7WA 2JPHA 2C60A 2M0XA 2O6VD 4HLEA 3TBLD 4KSKC 3VXWA 3KYCD 3KYDD 3A9JA 1M94A 1JRUA 3P2BA 2KX0A 2A5UA 1OEYA 4G11A 4KDIC 3SD5A 3ZRFA 3JSVB 4ASWC 3W1SC 2KDEB 3ML9A 4W9KA 4W9FA 4AUQC 4CO7A 1V6EA 3QC8B 1XD3B 2MSED 2REXA 4KZ0A 3V6EB 5CTRC 3WAMA 4TV3A 5TR5A 4ZYNA 3B08A 4KIKB 2MBOA 4ICVA 1OGWA 1YD8U 1V5OA 3PV1A 2PPHA 1J8CA 3UGBB 2IY1B 3VAWA 2N4FA 3X23A 1GNUA 2LVOA 1A5RA 2IZVB 3RZWC 4WWPA 4LCDE 2NCNA 4F1SA 3KUZA 1BT0A 4NY0A 2CHZA 2K6DB 2YVCA 3LJ3A 3IBEA 3S2AA 3MHSD 4WAAA 2D11A 2QHOA 4IWOA 3UQAA 2DZKA 4ANVA 3ZNZB 3AI5A 4GXBA 2DAFA 1WR1A 4M8MA 1ZKHA 3WAPA 1WZ0A 2MP2A 4GB9A 1F9JA 2J0JA 3HM3A 4DHJB 2ZZPB 3DBRI 1V2YA 3PT2B 3T8MA 5J17A 4HPMB 3CSFA 3ZTCA 4GSWA 3A4SC 4BFRA 3U7DA 1YIWA 3H7PA 2JVCA 1WM3A 4JIOU 5LLIA 3NZUA 4NNJB 3R7RA 1K8RB 2FUHB 2MBQA 1E90A 3JW0X 4JGHB 4GN1A 1UGMA 2MRPA 2OJRA 3L0WB 4TQ1A 3APDA 2BWES 4GDKB 4DWFA 2MBEA 5CHFA 2KC2A 4B9KA 4HK2A 4PS8A 4EZJA 4II3B 2HTHA 4BBNF 2R2QA 1E8WA 2KX3A 3O65B 3ECIA 2RSUA 1MG8A 5AZFA 2G4DB 2JWZA 2KJHB 2FCQA 3A4RA 2KDFB 2KDIA 1ISNA 1LM8B 3M3JA 4HPLB 3CF6E 5KHQA 3DPDA 3A9KA 1EO6A 2GBNA 1WYWB 3H7SA 4FN2A 2UWQA 2RGFA 3X0WA 3BY4B 3HK0A 3Q3JA 4ANXA 2PE9A 3VQIA 3N3KB 2C7NB 3OJ4B 4DXAB 1D3ZA 2ZJDA 3AU4A 3M95A 2LD9A 2RR9A 2DZMA 3RYTA 4K7SA 5CX3A 3PRPB 2JRIB 2MP2B 4WWOA 1IP9A 2L05A 2ZNVB 4IW0A 2LRUA 1J19A 4YL8A 4EOYA 3ZIMA 1NBFC 2G45B 1ZGUB 3TL5A 1EUVB 4WQOB 2CHXA 2I1KA 3DDCB 2LJ5A 2JRHA 1V49A 4DBGA 2PEAA 4IG7B 4MDKE 2IO2B 1I42A 3DBHI 2Y5BB 3EC8A 4MM3A 2L76A 2M1MA 1VCBA 3IHPC 5HKHA 2DAJA 4FJYA 3ZRCA 1RLFA 4W9DA 4EKUA 1E8YA 1YJ1A 2G4SA 3LDZE 3UQBA 2IO3B 3WIMA 2LI5A 2CU1A 4IWPA 2LWPA 2C7HA 2EMTA 2D3GA 4DHJD 4B6WA 1P9DU 1R4NI 5J2RA 2L8JA 2DX5B 3RD2A 3KVFB 2D2QA 2J0KA 1V80A 2CS4A 4I6PA 2OOBB 1WGYA 4P7IA 3UIOB 2Z0EB 1P0RA 3A9KB 3DOWA 5E6OA 1TGZB 3ZO5B 4HWIB 2ZCCA 2KN5A 3U8ZA 2UYZB 1WIAA 4MGYE 4OVVA 1WXAA 2K8CA 4ZRJA 1WGHA 3VTUA 2K25A 3KW5B 2JZZA 2KNBA 1Q0WB 2XEWA 3EHVA 2BPSA 3HIZA 4PYZA 2G3QB 1L7YA 2VRRB 2PE6B 1WR6E 3D32A 1TTNA 2IO0B 5G55A 2MCNB 3L08A 5JZEB 2IBIB 2C9WB 3V60A 4BOZB 2A4ZA 3TIXA 2JT4B 2WYQA 3GZNI 1WE7A 1WE6A 3VVWB 4BKSD 1V81A 2K8HA 1C3TA 1YX5B 2N7DA 4IWQA 3VTVA 1KLVA 3PLVA 3PRMB 4K7UA 2GBKA 1FXTB 2B3AA 4B95A 3HM6X 3VUXA 2O6VA 3NHEB 2KTRB 2ZNVC 3APCA 4IM2A 1WM2A 2MQJA 1WX9A 1SGHA 1YQBA 3I3TB 3QQ8B 4NAWB 3ZDMC 3PSEB 4W9IA 1T0YA 3JYUA 3MJWA 3PVLA 2FCMA 1PQSA 5D7GA 4G0NB 2IY0B
chains in the Genus database with same CATH superfamily
3QK0A 3RCZA 1TKYA 1NI2A 3H9DA 3PZDA 3HHMA 3NS8A 2XK5A 1E8ZA 3J9CA 2MWSB 2WLBA 3DQVA 2MHJA 5FR6A 3N30A 4LJPB 3WANA 3DBLI 2KJRA 2BYFA 4AP4C 3AXCA 2K1FA 1I35A 1N60A 2KAJA 3ZDTA 3NVZA 4E71A 4XGAB 3GOEA 3ZVVA 1IGDA 3SEBA 4OZAA 2O6VB 2FE8A 4BZAA 4S17A 1EU4A 2Y5CA 3A33B 2BTEA 1Y8RC 1N61A 1BXTA 2KVRA 3QX1A 3SFEB 3DBHB 4RF1A 2X38A 3H7PB 4YTNB 3DVNV 2V3SA 2CHWA 1JCKB 2BB6A 3V6CB 1WJ4A 2BB5A 2QEJC 2QIEB 3TUOA 4C00A 2N9XA 3IAM1 4M0WB 4PK1A 3PZ7A 4OHJA 4PYUA 2AYOB 1FCCC 3A1QB 1GG3A 1ZDXA 2GBRA 4IOIE 3ML8A 3T3OA 2LVQA 4MJSA 1CMXB 4JE3B 1E7UA 3AB5A 3QIJA 4WURA 3AV8A 1DOIA 3U30A 3PHWB 3DCGA 4USAA 1FM0D 2DYMA 2L0FA 1RRBA 4AS1A 2BT6A 2IO1B 1F52A 1WGKA 3KWVA 2WXGA 1Z5SB 5JXVA 3NVYA 3N20C 1DOXA 2BF8B 4RGNA 3P42A 4N58A 4LDTD 2NBWB 4MGIE 1N5WA 3L17A 5C23A 3B2GA 1F1HA 1GAQB 4FJVB 4IC7B 2ZW1A 4DXFA 2NTTA 2LGXA 3ZYYX 3NG0A 3NZ3A 5EDSA 1NDDA 4C80A 5DPSA 2I1JA 4F8CB 2BKFA 1ZXHA 3DHHC 1GOZA 4J6IA 2CKHB 3APFA 5DPWA 4CHKA 4GU2A 1H8CA 4ANUA 2LRWA 4WQMA 2KT7A 1IPGA 2N9LA 3DVNU 1MI0A 2J7QB 2D07B 5CHVC 4TMAB 5E6JA 3AEAB 5GXGB 2WXNA 2KANA 1FMAD 1Z2MA 3KH0A 4MSMB 3PPAA 1AYFA 2KACA 1I7HA 3R8BA 2Z59B 2BWFA 1KLGD 4UDUC 2W3SA 2INDC 2V0GA 3N1XC 4LNIA 2QSDA 4GDLB 2WX1A 3QAQA 3AE2B 4XDDA 5E6NA 3SHQA 2HD5B 4EFOA 4ARIA 3ALBA 1JQ4A 2C5LC 2W82A 4E3CA 4LTUA 4NPNA 1TBEA 5FKAC 5C1ZA 1VZ7A 1VZ8A 4KGSA 5T8IA 2XNAC 1FD6A 2VH2A 1RAXA 4K1RB 3UF8A 4A20A 1WGRA 2NTSA 3AE7B 1X1MA 2DENB 4KZCA 1J7BA 3AU5A 4FXCA 2LVPA 4KDLB 1ZOYB 2KQ4X 2KWUB 3GE3C 2C60A 3TBLD 4Q2JA 4KSKC 3C8YA 3KYCD 3SD5A 5MPOA 3ZRFA 3W1SC 2KDEB 1SE2A 1YJJA 1JWAD 2J52A 2H89B 4YWGG 3QC8B 2PVOD 3B9JA 4KZ0A 2CJOA 4TV3A 4XWTA 4ZYNA 2MBOA 4A55A 3BVMA 2PPHA 4PT5A 3VAWA 2IZVB 1BT0A 2CHZA 4HKQA 3MHSD 5HG2A 2K0PA 2DZKA 3IXSA 2WU2B 2DAFA 4US8A 3SFDB 4GB9A 1TS3A 2J0JA 1B9RA 2ZZPB 3BWUD 3AH7A 3T8MA 4GSWA 3U7DA 1YIWA 3W9CB 4JIOU 3PZ8A 3R7RA 4N59A 3RNAC 1TS4A 2PTLA 1UGMA 1FEHA 1IGCA 1OFFA 1C77A 4B9KA 2PIAA 4II3B 3O65B 1V1PB 3ZJVA 5AZFA 3Q8EA 4HPLB 1LM8B 1PGXA 3CF6E 3A9KA 1EO6A 3VRAB 1WYWB 2UWQA 2PE9A 3VQIA 1KTKA 1YMHE 2WDRB 1JALA 1F0ZA 2RR9A 2DBYA 3Q69A 4K7SA 4M00A 3Q8FA 4WWOA 1IP9A 2L05A 2ZNVB 1J19A 4YL8A 1NBFC 4HPPA 2CHXA 3DDCB 4C4VB 1YN3A 1RFKA 4OZCA 1WRIA 1AWDA 3AECB 3DBHI 2D3AA 1ZUD2 5HKHA 2DAJA 4FJYA 3ZRCA 1YJ1A 3UQBA 1MVKA 4BAXA 2IO3B 2CU1A 4IWPA 1QOBA 2I38A 3GP7A 2D2QA 2J0KA 2OOBB 2WXFA 5G5GA 2J42A 4ZHPA 5BMHA 1TGZB 3ZO5B 2ZCCA 2KN5A 2UYZB 1WIAA 4OVVA 3RMKC 4XWWA 5BYQA 2K25A 3U52E 2RDGA 2XEWA 4RFBA 1EWYC 1E0ZA 1TIFA 1ET9A 2R61A 3L08A 5JZEB 2C9WB 2JYTA 1MJDA 1WE6A 3VVWB 4BKSD 1V81A 2K8HA 4ARCA 1KLVA 2W54A 2PW9A 3PLVA 1XLQA 4GLSC 1XO3A 4MM3B 4RNAA 2WP9B 1VZ6A 2AX5A 2KTRB 1CQVA 2MQJA 4BVUC 1NYQA 3PSEB 3MJWA 2WNMA 1PQSA 5D7GA 2IY0B 2QCZA 4ZHOA 2BS3B 4P1BC 1CJEA 3M63B 4W9LA 4WJPA 1T5XD 3ETRA 3RULA 3A9JB 1UGJA 5JHAA 2KFKA 1E10A 2BS4B 2WWZA 1LO5D 4B0EA 3RI7C 4EZLA 3VH4B 4GIVA 3W2DA 2BVCA 5FK9C 1P1AA 2WXRA 2DZIA 1JRPA 4G3XB 3BZDB 4GOCA 4YSXB 5LNK1 4FADA 1JMLA 1QF6A 2INCC 1C78A 4WJOA 3MTNB 3NY5A 4DDGD 2LUEA 3BYYB 3HUIA 1MHXA 4OZBA 1E9MA 3SU8X 1Q5WB 4MH0E 1FNVA 4YT0B 3I5JC 1HE8A 3DBSA 2JXXA 3AEDB 2OEDA 2ASQA 5DPTA 1V5TA 1WXMA 3ZKJC 4A3PA 4JLCA 3QCAA 2XN9C 3I9V1 2DHZA 5EE3A 2H88B 4E74A 2D5GA 4A3OA 2FCSA 1WH3A 2V4LA 2XK5B 2L1AA 2LHEA 2ZPNA 3KUCB 4RGOS 3UIPB 2KD0A 3JSVA 1RFAA 1HA5A 3NZSA 3WAOA 5J18A 2QJLA 2KDBA 3EFUA 3RUIB 2KVZA 2KQ7A 1R4NB 1N62A 1SSNA 3ONSA 5D3DA 2GI9A 1QQRA 4MELA 4S0RA 1IYFA 5BYSA 1GC7A 3Q6BA 3IG3A 4YTMB 2LGSA 4N9F4 4JPSA 3TEWA 1E8XA 2WQYB 2XBBC 2HJ8A 1I4QA 2CU3A 2WXOA 4DHZE 2DLBA 4DQOC 3ZNID 4DDID 1E7VA 3RPFC 3RZFA 1UH6A 4P6VF 4ZRIA 2CR5A 1IUEA 2L7RA 1KJTA 1HQRD 5AZHA 1S3SG 1TZOA 2KKCA 4MACA 3H6NA 4NJCA 2BBCA 4GDKA 4FHJA 1VRAB 3PHXB 4XC2A 2MLBA 5AEKB 2W3RA 4BKSA 4W9CA 3RNGC 1QZEA 1L2NA 4MJSB 1WY8A 4HJKA 2ZCBA 4QAYA 3R3MA 2JY6A 4FA6A 2WX0A 4D2KA 2M8SA 3VRBB 4HCPB 1WGDA 2NPTA 1ZE3D 2LUMA 4W9JA 4IKGA 4KSLC 1P98A 4XZ4A 1EWCA 3ZJTA 3AE6B 3N9YC 1E5WA 1C76A 1L0YB 3FAHA 2DYOA 3HVZA 2Y5PA 2RPVA 2JU6X 4L1BA 4KVGB 2ONQA 2Z0DB 4BBNC 1KF6B 4AJYB 1SE4A 1JWBD 2J4XA 2KWCA 4CQNA 4K81A 2IYDB 3GB1A 2KYWA 4M01A 1JWMD 1AN8A 4KGTA 2KMCA 3IVFA 2KO3A 3T9LA 4NJ6A 1J0GA 3K9PB 2V1YA 1EF1A 2Y3AA 1T6BX 2WXPA 3KLSX 2MX2A 2AWTA 3URYA 3DWGC 1ROEA 2IGGA 4HCNB 2KK8A 1E7PB 2KTFA 3DVGX 2LEKA 4II2B 3MC0B 2R2OA 4HVBA 3LYYA 5H8YE 1OTRB 1C4PA 5L83A 4JL9A 2DZJA 4TKNA 2AEHA 2ZW0A 2JX5A 5L95C 4K7WA 2WGSA 1M94A 1JRUA 2KX0A 4G11A 1OEYA 4DXGA 4KDIC 1AW7A 1XEEA 4WAFA 3ML9A 4KKIA 2D3CA 1RWSA 2BW2A 2MSED 2REXA 3V05A 3WAMA 1R7SA 3PV1A 2IY1B 2N4FA 2LVOA 1A5RA 3KUZA 4NY0A 3LJ3A 1FCLA 1UNSA 4IWOA 3UQAA 1JROA 4ANVA 3ZNZB 1V97A 2JSVX 1SE3A 1WZ0A 2MP2A 3RNCC 3BYTB 3HM3A 2WXQA 1V2YA 3PT2B 3ZTCA 4BFRA 3H7PA 3AM9A 5LLIA 3AE4B 2WXLA 3NZUA 1K8RB 4GN1A 2MRPA 3Q3OC 3APDA 4ZYSA 2MBEA 1RM6C 2FBWB 1OQRA 3GE8C 4EZJA 2HTHA 4BBNF 1E8WA 2BQQA 1GB1A 1CK1A 3ECIA 3O13A 1L6VA 2JWZA 3M3JA 2FCQA 3A4RA 3VR8B 3UI3A 1T0SC 4FN2A 3X0WA 1Q10A 3BY4B 3HK0A 3N3KB 2C7NB 3OJ4B 1D3ZA 3RNEC 2LD9A 2DZMA 5C2TB 2JRIB 3MHZA 4WIPA 4EOYA 4WQOB 4KKJA 3IT6B 1JWUD 2LJ5A 2JRHA 4DBGA 2G1EA 2PEAA 4IG7B 3U7ZA 2WS3B 4ZOHC 2Y5BB 3EC8A 3OWEB 3B2FA 1NEKB 1VCBA 3IHPC 2JYEA 1RLFA 4EKUA 2WDQB 1E8YA 1R4MB 2WXKA 2PMVA 2N9KA 1TY2A 2D3GA 4B6WA 1R4NI 5H92C 2VZKD 2DX5B 3RD2A 1QILA 1V80A 2CS4A 3UIOB 1P0RA 1TKGA 3A9KB 3DOWA 1I4HA 5IN7A 3VTUA 1WXAA 2K8CA 2QDFA 4ZRJA 1WSPA 1MHHE 2KNBA 1Q0WB 2BPSA 4PYZA 2G3QB 1C4CA 1L7YA 1VJKA 2HJ1A 3D32A 3TIXA 1N6ZA 1WXQA 2LMCA 1YX5B 2N7DA 2QC8A 4RCOA 2LHDA 4YXDB 4B95A 3HM6X 2ZNVC 1WM2A 4NAWB 3U2SC 4W9IA 2GLSA 2QHOA 1UWMA 4G0NB 1OQYA 3DBRB 1WMHB 1PGAA 1IBXA 2JF5A 3BVZA 2MBHA 3RFZB 3CIRB 1DYQA 4GDLA 3DVGY 3ZUNA 5HFYA 2FAZA 3PREA 5D6JB 1UD7A 3AULA 1P7FA 2UU7A 1XCTL 2ZEQA 1OEYJ 3PGEA 1WWTA 4JQWC 2INNE 2GBMA 1YOVB 2ON8A 3L10B 2RDHA 4AOFA 3ZW3A 2G9HD 4TQ0A 1DGJA 1ZP0B 2QMTA 3EUB2 5DCNA 4IM0A 1TY0A 2RPQA 4FLHA 1D4BA 2L83A 2KWDA 1PYWD 2CJNA 1QKZA 5IA7A 3R2TA 1ZW7A 1XCQL 4MGZE 3NVVA 5IKCM 1V8CA 4CYEA 2GMIC 3AE3B 1XXGA 2KFKB 1KM7A 4NQKE 3TSSA 4LK0M 4M8NA 2GRIA 2L3ZA 2LXCA 2KLCA 4FULA 1I4GA 1D5ZC 1ET6A 3SR6A 1C4AA 4I6LB 4RM8A 1Y56A 3LXFA 1T0QC 2O2VA 1WX8A 1S1QB 1I4RA 4ZRKA 4EZKA 2FCNA 1WXVA 4WJNA 1LFDA 3TEZA 1FRRA 1WJ6A 4ACFA 3CMMB 2M17A 5AUKA 1KFYB 4IM3A 5E6PA 3C0RB 1VDVA 3K9OB 4OW0A 3QARA 3MC8A 4XDCA 4NJ7A 3ZTDA 3P63A 2K39A 4A8XC 1K51A 1WGGA 3VTWA 3UINB 2PVGC 4C7ZA 1EF5A 3QJZA 2M4NA 3TEYA 5IOIA 3W1SA 1UBQA 2N9PC 2JXTA 3P4RB 2GBJA 2W9NA 4MEMA 2NBVB 4KGRA 3W1YA 1HZ5A 2KMMA 4RMAA 2M19A 4C7YA 4DHZB 2K6QA 2FIDA 3AEFB 2M0AA 4L2YA 1P3QU 3EECA 3VFKA 3AE8B 2JZ3B 3PRZA 1J7AA 1FIQA 2EKIA 1L6UA 2J0MA 1STEA 1UELA 3JVZX 4PS3A 4NAMA 2KJ6A 2N9EB 1SIJA 3BINA 1JWSD 1K53A 2BKRB 4A90A 1UZXB 2HE7A 2L0TA 5EE0A 4L23A 5FR3A 2MW5A 2NVUI 1QOAA 2RD0A 2VH1A 2KXJA 2K5PA 4GMVA 4X57B 3ZXRA 1HEZE 2LGYA 4HEA1 1F2RI 3AE1B 3QHTA 2D3BA 4I6NB 4HDOA 2KQSA 3WA0A 2L32A 3RT3B 2NPTB 1N5XA 4W9HA 2X8XX 4M02A 4XX5A 3EFCA 3NS1A 4KIKA 4J3OD 2LJIA 1L0XB 1VLBA 2BYVE 1AARA 4FHKA 1XF5L 3V3XA 3WALA 1PDXA 4NQLB 1YNTE 1WFYA 5D94A 5GMVA 4HKZE 3OAWA 2LASA 3AMZA 2KTRA 3VDZA 3P4PB 1TYGB 4WWMA 3HVDA 5LXIB 5G5HA 5JH5C 4RF0A 5CHWA 3Q3FA 1R4MI 2BGFA 4HRSA 1PUTA 2WHIA 3B1LX 3R66C 1XLPA 4HLEA 2O6VD 4B0MA 3A9JA 3N1ZC 4ASWC 1D6EC 2RDBC 4W9FA 4AUQC 1D5MC 1YQ4B 5HI1A 1SJED 5CTRC 2MEKA 2IPKD 2LGIA 5TR5A 3I63C 4ICVA 1OGWA 4A9AA 1V5OA 1L4DB 1T3QA 3X23A 1GNUA 3RZWC 4WWPA 2NCNA 1GB4A 3S2AA 2RMMA 4TSSA 4WAAA 2D11A 4YSYB 2GB1A 2MJ3A 1YQ3B 5D3IB 2E3TA 3BIID 3AI5A 4GXBA 1ESFA 1KH0A 2EELA 4HJGE 1WR1A 1ZKHA 4REZA 3Q3NC 4DHJB 1NYRA 3DBRI 1FXAA 5J17A 3CSFA 2I2YA 2JVCA 2FUHB 1EM7A 1E90A 2AQ2B 2OJRA 4TQ1A 1I4PA 3FILA 1ZPSA 2BWES 1TKEA 4EE2A 2KC2A 1QT9A 1E6EB 4HK2A 3NRZA 2YEPB 1EU3A 2R2QA 2RSUA 4JWSC 1KRHA 2G4DB 1ZDVA 2KDFB 2KDIA 2J53A 3E56A 1PGBA 2GBNA 3H7SA 3DWMA 2AQ1B 2JZPA 2MJDA 2ZJDA 3AU4A 2SEBD 2DWQA 3M95A 5CX3A 2MP2B 4IW0A 2LRUA 5IP4D 2G45B 3RNBC 3TL5A 3W5VB 3AN1A 1XLOA 4MDKE 2V9HA 2IO2B 3RN9C 1C9FA 2L76A 4K3BA 5EE9A 2MH7A 1DOYA 2G4SA 3AE9B 3WIMA 3BK1A 1HTOA 2LWPA 2IJ0A 2C7HA 4WH4A 5BMIA 1TS5A 4I6PA 4P7IA 2Z0EB 2ACZB 1UUPA 1UWXA 3FKYA 1WGHA 4HROA 2JZZA 3EHVA 2WXMA 1FNWA 1N63A 1BUIC 2YEPF 2VRRB 1TTNA 2IO0B 3DHGC 5G55A 1FO4A 4LNOA 3V60A 1KLUD 4BOZB 4P16A 2JT4B 2V3PA 1F2RC 4C56C 4IWQA 2QILA 3VTVA 1TJEA 4K7UA 2INPE 3Q3MC 1FXTB 3W5UB 4ITKA 2O6VA 3NHEB 4IM2A 1WX9A 1SGHA 1YQBA 3QQ8B 1T0YA 3PVLA 2HTME 2FCMA 4R3DA 3ZXVA 2YLMA 3IFWB 2FNJB 1WZ3A 3ENEA 3KQ4A 5JHBA 2PJHA 5IAAC 4AWJA 3CSTA 4URKA 3PLUA 4AJWA 2ZVOA 1KOTA 2LXAA 4BKTA 1K50A 1XT9B 5BO4B 2AL3A 5KHOA 2Z8LA 5G2NA 3GS2A 3H1UA 2KC1A 3TMPB 1TZ1A 1HZ6A 4M0WA 1SF0A 2KWVB 4EEWA 4WJQA 3ZNHB 2DNFA 4NZLB 2WXJA 3A1QA 4MH8A 4P1CC 4KV2A 3OJ3A 1D5XC 4MT5A 3T3NA 1L5PA 3KUDB 2GOWA 4LDTB 3P1MA 1IBXB 3ABVB 3Q8AA 3VR9B 2BS2B 3RNFC 1WRDB 4YTPB 4IDIA 3V62A 4W9GA 3L13A 4OVUA 4HDQA 5LXHA 1WXSA 4W9EA 3TJPA 1FFVA 5AZGA 2AL6A 1LXDA 2C7MB 3R2IA 4ZDVA 5EE1A 4TUUA 2K8BA 3CWIA 3ZQ4A 3N1YC 2KN4A 3EGRA 2KMAA 2N7EA 3ZJUA 1UF0A 2NR2A 1V9JA 4GGQA 2HDEA 3R7QA 3U4EG 1I4XA 3P4SB 2IDYA 3N32A 1LGRA 2DYBA 1XQQA 1L0VB 3GZNB 4DK5A 1SE9A 1FRDA 2EMSA 4YSZB 2WDTB 4FJZA 2WDVB 4BOSC 1M4VA 1YJIA 1FFUA 3DHIC 2KZRA 3L16A 4WWNA 1NVID 4G50A 3AEGB 2B76B 2KHWB 3NVWA 2NBUA 1V86A 3MFGA 3Q14C 4ICUA 4N6EB 4F7ZA 1MPEA 1J7CA 3BVGA 2KFJA 4RM9A 3QWZB 2KOXA 1TS2A 1GUAB 2D10A 2O2VB 4JWUC 1VD2A 1NI3A 3PTFC 2ZVNA 2NMQA 1WI0A 5AUIA 3V61A 2IGHA 2LFIA 1WF9A 4ANWA 4MGKE 2N1VA 5C3JB 3P4QB 2KLGA 3HRDD 3DBLB 4IUMB 3VH3B 1ENFA 2BYEA 5BMGA 3ZNGC 1YX6B 4BKGA 2W55A 1FXIA 1SB3C 1MG4A 1U4AA 3M62B 4EUTA 4FBJB 1Q1OA 1SIFA 2VZKB 5I4DA 4HXDA 3VHTC 1HTQA 4K3CA 5DPRA 1BMLC 2ZPYA 1WJUA 4O1NA 4ZRPA 1LQBA 1SXTA 3OLMD 3NOBA 1C1YB 1H4RA 1SJHD 2JUOA 1UBIA 2LGDA 3MP9A 3PS6A 3QA8A 3IAS1 4JX1C 1F77A 2N1WA 1WJNA 2JWUA 2FIFA 3SDLC 1K52A 4XE0A 1GJZA 1A70A 1HXYD 2TSSA 2WU5B 3VUYA 2K9XA 2M56B 1CZPA 3B0AA 1WX7A 4PS7A 3L54A 4US9A 3VUWA 4LNKA 2L52A 1QOFA 2LZ6A 2MJEA 4LJOB 3MJ5A 3EA6A 2MBBB 1G6JA 1RYJA 2K22A 2MA9B 2L00B 1MFWA 4NAWA 5TSSA 3Q2AC 5HHDG 5IO9A 2IGDA 3ZLZA 1GC6A 1WMHA 1V1OA 4MSQB 2EKEC 2NS5A 2JPHA 2M0XA 2V3NA 3VXWA 3KYDD 1TT5B 3P2BA 4RGTA 2A5UA 3JSVB 4LNNA 4W9KA 4CO7A 4RH6A 2N0SB 3E9SA 4XYCA 1V6EA 3V6EB 1XD3B 2E6XA 3Q8CA 3TEXA 3B08A 4KIKB 1SEBD 1YD8U 4RGMA 1P7EA 1J8CA 3UGBB 1V1PA 4LCDE 4F1SA 3PO0A 4ZRQA 4LNFA 2K6DB 2YVCA 3IBEA 3AE5B 3FC4A 2SAKA 4M8MA 3WAPA 1VR9A 1F9JA 1PFDA 2FUG1 1QOGA 3AEEB 4HPMB 1JW9D 2AQ3B 3A4SC 2WXIA 4C4VA 1WM3A 3IT4B 1T0RC 3LB8C 4NNJB 3Q8BA 2MBQA 3JW0X 4JGHB 1C79A 2BYTA 3L0WB 2OHFA 1ACCA 2V4IB 4GDKB 4DWFA 1ZXIA 5CHFA 4PS8A 3OG5A 3BK2A 2KX3A 1MG8A 2KJHB 5D2MB 5KHQA 1ISNA 3DPDA 2JQRB 2RGFA 1XLNA 4ANXA 3Q3JA 2ICIA 2PKOA 3AEBB 4DXAB 3NUHB 3RYTA 3PRPB 1NENB 2Q5WD 3ZIMA 1WYGA 3MC9A 1ZGUB 1EUVB 2I1KA 1V49A 1I42A 3KWLA 4MM3A 2M1MA 4A6QA 4W9DA 3FILB 3LDZE 1GPXA 2LI5A 2EMTA 1OQQA 4DHJD 1P9DU 4H2AA 5J2RA 2L8JA 3H8HA 3KVFB 2WXHA 1FPYA 1WGYA 1SBBB 5E6OA 1B1ZA 4HWIB 2K3UA 4OVZA 3U8ZA 4MGYE 3KW5B 2KDMA 1FNUA 3HIZA 2PE6B 1WR6E 4LLGM 2MCNB 2IBIB 2A4ZA 1L4ZB 2WYQA 3GZNI 1WE7A 1QLBB 3WCQA 3L4PA 3NJTA 2N7JA 3I57A 1C3TA 3PRMB 3C19A 2GBKA 1YN4A 2B3AA 5BYRA 3VUXA 3APCA 2PLPA 4KX6B 1YN5A 3ZDMC 3I3TB 2OJWA 3JYUA 4AQ7A 3TCAA 3ZGZA
chains in the Genus database with same CATH topology
1OQYA 3QK0A 2YLMA 1WMHB 3IFWB 2FNJB 1WZ3A 3M63B 4W9LA 4WJPA 3RCZA 3RULA 3ENEA 2JF5A 5JHBA 1NI2A 2MBHA 2PJHA 3H9DA 3PZDA 3HHMA 3A9JB 5IAAC 3NS8A 2XK5A 4AWJA 5JHAA 4GDLA 2KFKA 3CSTA 1E8ZA 3DVGY 2FAZA 3ZUNA 4URKA 3PREA 3PLUA 2MWSB 5D6JB 3DQVA 4AJWA 1UD7A 2WWZA 3AULA 3N30A 4LJPB 5FR6A 2ZVOA 3WANA 3DBLI 1KOTA 2KJRA 2BYFA 2LXAA 2ZEQA 4EZLA 1OEYJ 3PGEA 3VH4B 4AP4C 3AXCA 4GIVA 4JQWC 4BKTA 2K1FA 1XT9B 5BO4B 1P1AA 2AL3A 2DZIA 4G3XB 4GOCA 5KHOA 1I35A 4FADA 2GBMA 5G2NA 3H1UA 3L10B 4WJOA 3ZDTA 2KC1A 3MTNB 3NY5A 3TMPB 1TZ1A 2LUEA 4AOFA 4DDGD 4E71A 2KWVB 4EEWA 3GOEA 4WJQA 3ZW3A 3ZNHB 4TQ0A 3SU8X 3ZVVA 3A1QA 1Q5WB 4MH0E 2O6VB 5DCNA 4IM0A 1HE8A 3DBSA 2JXXA 4KV2A 3OJ3A 2ASQA 2RPQA 5DPTA 4FLHA 1V5TA 3A33B 1WXMA 1Y8RC 3ZKJC 3KUDB 4JLCA 2GOWA 3QCAA 4A3PA 4LDTB 5IA7A 2DHZA 2KVRA 3QX1A 4E74A 1ZW7A 4A3OA 4MGZE 2FCSA 4CYEA 1WH3A 1WRDB 2V4LA 2GMIC 2XK5B 2ZPNA 2KFKB 3H7PB 3V62A 3KUCB 4W9GA 3UIPB 1KM7A 3DVNV 2KD0A 3JSVA 1RFAA 3L13A 4NQKE 4HDQA 4OVUA 1WXSA 5LXHA 3NZSA 4M8NA 2L3ZA 2LXCA 4W9EA 2KDBA 3EFUA 3TJPA 2KLCA 4FULA 2AL6A 2V3SA 5AZGA 3RUIB 1LXDA 2KQ7A 2C7MB 2CHWA 4ZDVA 3ONSA 4TUUA 2K8BA 3V6CB 1WJ4A 4I6LB 4RM8A 2KMAA 2N7EA 2O2VA 1WX8A 2N9XA 4M0WB 4MELA 1S1QB 1IYFA 1GC7A 4ZRKA 2NR2A 2AYOB 4PYUA 4BVUC 3IG3A 1V9JA 3A1QB 1GG3A 2GBRA 4GGQA 3R7QA 4EZKA 2FCNA 3ML8A 1WXVA 4N9F4 2LVQA 3N32A 1LFDA 4WJNA 2DYBA 1XQQA 4MJSA 1E8XA 2XBBC 1CMXB 3WAOA 2HJ8A 1E7UA 1WJ6A 3QIJA 3CMMB 4DHZE 4DK5A 3ZNID 1SE9A 2M17A 2EMSA 2WDTB 4DDID 1E7VA 4IM3A 5E6PA 3C0RB 3PHWB 4FJZA 3U30A 3DCGA 3K9OB 4BOSC 3RZFA 2DYMA 3QARA 1UH6A 2L0FA 1RRBA 2KZRA 3L16A 4WWNA 4ZRIA 4G50A 2IO1B 4NJ7A 2CR5A 1Z5SB 2KHWB 3ZTDA 2NBUA 2L7RA 1KJTA 1V86A 5AZHA 1S3SG 2BF8B 2KKCA 4ICUA 2K39A 4F7ZA 3H6NA 1WGGA 4LDTD 3UINB 3VTWA 1EF5A 2NBWB 2KFJA 4MGIE 4RM9A 3QJZA 3QWZB 2M4NA 2KOXA 3L17A 5C23A 4GDKA 4FHJA 4FJVB 4IC7B 3PHXB 1GUAB 2D10A 2O2VB 3W1SA 4XC2A 1VD2A 1UBQA 2N9PC 2LGXA 3PTFC 2ZVNA 5EDSA 2MLBA 5AEKB 1WI0A 3V61A 1NDDA 1WF9A 4ANWA 4MGKE 2I1JA 2N1VA 5DPSA 4BKSA 4W9CA 4F8CB 2BKFA 2GBJA 1QZEA 1L2NA 2KLGA 2W9NA 4IUMB 4MEMA 4MJSB 1WY8A 2NBVB 4HJKA 3VH3B 2BYEA 2ZCBA 3W1YA 3R3MA 3ZNGC 2JY6A 4J6IA 4FA6A 2WX0A 2CKHB 4RMAA 3APFA 1YX6B 3TCAA 5DPWA 4BKGA 4CHKA 4GU2A 1H8CA 4ANUA 4DHZB 2M8SA 2K6QA 2FIDA 2LRWA 1U4AA 1P3QU 3M62B 4EUTA 3EECA 1IPGA 4FBJB 4HCPB 3VFKA 1WGDA 2NPTA 1Q1OA 3DVNU 2J7QB 4W9JA 2D07B 2JZ3B 5CHVC 3PRZA 1SIFA 4KSLC 4HXDA 1P98A 2J0MA 4XZ4A 3VHTC 1UELA 2KANA 3JVZX 4PS3A 5DPRA 2ZPYA 1Z2MA 1WJUA 2KJ6A 1E5WA 3KH0A 2N9EB 3BINA 1LQBA 4MSMB 3PPAA 2DYOA 3OLMD 3NOBA 4KVGB 1C1YB 2Z0DB 4BBNC 4AJYB 1H4RA 2BKRB 2Z59B 1UZXB 2JUOA 2KWCA 2BWFA 4K81A 1UBIA 2HE7A 2LGDA 2L0TA 3PS6A 2IYDB 2MW5A 3QA8A 2NVUI 2RD0A 5D2MB 2KXJA 2N1WA 4GDLB 4GMVA 1WJNA 2KMCA 2WX1A 3IVFA 2KO3A 2FIFA 3QAQA 4X57B 3SDLC 5E6NA 3SHQA 3T9LA 5J18A 1GJZA 2LGYA 4NJ6A 1J0GA 2HD5B 4EFOA 3QHTA 4I6NB 3VUYA 4HDOA 3ALBA 3K9PB 2KQSA 2V1YA 3WA0A 3RT3B 3B0AA 1WX7A 1EF1A 2C5LC 2NPTB 4W9HA 4PS7A 4E3CA 4XX5A 4NPNA 4KIKA 3L54A 1TBEA 5C1ZA 2MX2A 3VUWA 2AWTA 1AARA 2BYVE 4FHKA 2LZ6A 4HCNB 3WALA 2KK8A 1RAXA 4LJOB 2KTFA 4NQLB 3DVGX 1WFYA 4K1RB 5D94A 5GMVA 3UF8A 2MBBB 4II2B 1G6JA 3OAWA 2MA9B 2L00B 2LASA 2R2OA 4A20A 1WGRA 2KTRA 3VDZA 4HVBA 5LXIB 4NAWA 1X1MA 5JH5C 1OTRB 5CHWA 2DENB 3Q3FA 4KZCA 5L83A 3AU5A 1R4MI 2BGFA 4JL9A 3ZLZA 1GC6A 2DZJA 3B1LX 4TKNA 2AEHA 2LVPA 3R66C 4KDLB 1WMHA 4MSQB 5L95C 2EKEC 2NS5A 2KWUB 4K7WA 2JPHA 2C60A 2M0XA 2O6VD 4HLEA 3TBLD 4KSKC 3VXWA 3KYCD 3KYDD 3A9JA 1M94A 1JRUA 3P2BA 2KX0A 2A5UA 1OEYA 4G11A 4KDIC 3SD5A 3ZRFA 3JSVB 4ASWC 3W1SC 2KDEB 3ML9A 4W9KA 4W9FA 4AUQC 4CO7A 1V6EA 3QC8B 1XD3B 2MSED 2REXA 4KZ0A 3V6EB 5CTRC 3WAMA 4TV3A 5TR5A 4ZYNA 3B08A 4KIKB 2MBOA 4ICVA 1OGWA 1YD8U 1V5OA 3PV1A 2PPHA 1J8CA 3UGBB 2IY1B 3VAWA 2N4FA 3X23A 1GNUA 2LVOA 1A5RA 2IZVB 3RZWC 4WWPA 4LCDE 2NCNA 4F1SA 3KUZA 1BT0A 4NY0A 2CHZA 2K6DB 2YVCA 3LJ3A 3IBEA 3S2AA 3MHSD 4WAAA 2D11A 2QHOA 4IWOA 3UQAA 2DZKA 4ANVA 3ZNZB 3AI5A 4GXBA 2DAFA 1WR1A 4M8MA 1ZKHA 3WAPA 1WZ0A 2MP2A 4GB9A 1F9JA 2J0JA 3HM3A 4DHJB 2ZZPB 3DBRI 1V2YA 3PT2B 3T8MA 5J17A 4HPMB 3CSFA 3ZTCA 4GSWA 3A4SC 4BFRA 3U7DA 1YIWA 3H7PA 2JVCA 1WM3A 4JIOU 5LLIA 3NZUA 4NNJB 3R7RA 1K8RB 2FUHB 2MBQA 1E90A 3JW0X 4JGHB 4GN1A 1UGMA 2MRPA 2OJRA 3L0WB 4TQ1A 3APDA 2BWES 4GDKB 4DWFA 2MBEA 5CHFA 2KC2A 4B9KA 4HK2A 4PS8A 4EZJA 4II3B 2HTHA 4BBNF 2R2QA 1E8WA 2KX3A 3O65B 3ECIA 2RSUA 1MG8A 5AZFA 2G4DB 2JWZA 2KJHB 2FCQA 3A4RA 2KDFB 2KDIA 1ISNA 1LM8B 3M3JA 4HPLB 3CF6E 5KHQA 3DPDA 3A9KA 1EO6A 2GBNA 1WYWB 3H7SA 4FN2A 2UWQA 2RGFA 3X0WA 3BY4B 3HK0A 3Q3JA 4ANXA 2PE9A 3VQIA 3N3KB 2C7NB 3OJ4B 4DXAB 1D3ZA 2ZJDA 3AU4A 3M95A 2LD9A 2RR9A 2DZMA 3RYTA 4K7SA 5CX3A 3PRPB 2JRIB 2MP2B 4WWOA 1IP9A 2L05A 2ZNVB 4IW0A 2LRUA 1J19A 4YL8A 4EOYA 3ZIMA 1NBFC 2G45B 1ZGUB 3TL5A 1EUVB 4WQOB 2CHXA 2I1KA 3DDCB 2LJ5A 2JRHA 1V49A 4DBGA 2PEAA 4IG7B 4MDKE 2IO2B 1I42A 3DBHI 2Y5BB 3EC8A 4MM3A 2L76A 2M1MA 1VCBA 3IHPC 5HKHA 2DAJA 4FJYA 3ZRCA 1RLFA 4W9DA 4EKUA 1E8YA 1YJ1A 2G4SA 3LDZE 3UQBA 2IO3B 3WIMA 2LI5A 2CU1A 4IWPA 2LWPA 2C7HA 2EMTA 2D3GA 4DHJD 4B6WA 1P9DU 1R4NI 5J2RA 2L8JA 2DX5B 3RD2A 3KVFB 2D2QA 2J0KA 1V80A 2CS4A 4I6PA 2OOBB 1WGYA 4P7IA 3UIOB 2Z0EB 1P0RA 3A9KB 3DOWA 5E6OA 1TGZB 3ZO5B 4HWIB 2ZCCA 2KN5A 3U8ZA 2UYZB 1WIAA 4MGYE 4OVVA 1WXAA 2K8CA 4ZRJA 1WGHA 3VTUA 2K25A 3KW5B 2JZZA 2KNBA 1Q0WB 2XEWA 3EHVA 2BPSA 3HIZA 4PYZA 2G3QB 1L7YA 2VRRB 2PE6B 1WR6E 3D32A 1TTNA 2IO0B 5G55A 2MCNB 3L08A 5JZEB 2IBIB 2C9WB 3V60A 4BOZB 2A4ZA 3TIXA 2JT4B 2WYQA 3GZNI 1WE7A 1WE6A 3VVWB 4BKSD 1V81A 2K8HA 1C3TA 1YX5B 2N7DA 4IWQA 3VTVA 1KLVA 3PLVA 3PRMB 4K7UA 2GBKA 1FXTB 2B3AA 4B95A 3HM6X 3VUXA 2O6VA 3NHEB 2KTRB 2ZNVC 3APCA 4IM2A 1WM2A 2MQJA 1WX9A 1SGHA 1YQBA 3I3TB 3QQ8B 4NAWB 3ZDMC 3PSEB 4W9IA 1T0YA 3JYUA 3MJWA 3PVLA 2FCMA 1PQSA 5D7GA 4G0NB 2IY0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQY A;  3QK0 A;  2YLM A;  1WMH B;  3IFW B;  2FNJ B;  1WZ3 A;  3M63 B;  4W9L A;  4WJP A;  3RCZ A;  3RUL A;  3ENE A;  2JF5 A;  5JHB A;  1NI2 A;  2MBH A;  2PJH A;  3H9D A;  3PZD A;  3HHM A;  3A9J B;  5IAA C;  3NS8 A;  2XK5 A;  4AWJ A;  5JHA A;  4GDL A;  2KFK A;  3CST A;  1E8Z A;  3DVG Y;  2FAZ A;  3ZUN A;  4URK A;  3PRE A;  3PLU A;  2MWS B;  5D6J B;  3DQV A;  4AJW A;  1UD7 A;  2WWZ A;  3AUL A;  3N30 A;  4LJP B;  5FR6 A;  2ZVO A;  3WAN A;  3DBL I;  1KOT A;  2KJR A;  2BYF A;  2LXA A;  2ZEQ A;  4EZL A;  1OEY J;  3PGE A;  3VH4 B;  4AP4 C;  3AXC A;  4GIV A;  4JQW C;  4BKT A;  2K1F A;  1XT9 B;  5BO4 B;  1P1A A;  2AL3 A;  2DZI A;  4G3X B;  4GOC A;  5KHO A;  1I35 A;  4FAD A;  2GBM A;  5G2N A;  3H1U A;  3L10 B;  4WJO A;  3ZDT A;  2KC1 A;  3MTN B;  3NY5 A;  3TMP B;  1TZ1 A;  2LUE A;  4AOF A;  4DDG D;  4E71 A;  2KWV B;  4EEW A;  3GOE A;  4WJQ A;  3ZW3 A;  3ZNH B;  4TQ0 A;  3SU8 X;  3ZVV A;  3A1Q A;  1Q5W B;  4MH0 E;  2O6V B;  5DCN A;  4IM0 A;  1HE8 A;  3DBS A;  2JXX A;  4KV2 A;  3OJ3 A;  2ASQ A;  2RPQ A;  5DPT A;  4FLH A;  1V5T A;  3A33 B;  1WXM A;  1Y8R C;  3ZKJ C;  3KUD B;  4JLC A;  2GOW A;  3QCA A;  4A3P A;  4LDT B;  5IA7 A;  2DHZ A;  2KVR A;  3QX1 A;  4E74 A;  1ZW7 A;  4A3O A;  4MGZ E;  2FCS A;  4CYE A;  1WH3 A;  1WRD B;  2V4L A;  2GMI C;  2XK5 B;  2ZPN A;  2KFK B;  3H7P B;  3V62 A;  3KUC B;  4W9G A;  3UIP B;  1KM7 A;  3DVN V;  2KD0 A;  3JSV A;  1RFA A;  3L13 A;  4NQK E;  4HDQ A;  4OVU A;  1WXS A;  5LXH A;  3NZS A;  4M8N A;  2L3Z A;  2LXC A;  4W9E A;  2KDB A;  3EFU A;  3TJP A;  2KLC A;  4FUL A;  2AL6 A;  2V3S A;  5AZG A;  3RUI B;  1LXD A;  2KQ7 A;  2C7M B;  2CHW A;  4ZDV A;  3ONS A;  4TUU A;  2K8B A;  3V6C B;  1WJ4 A;  4I6L B;  4RM8 A;  2KMA A;  2N7E A;  2O2V A;  1WX8 A;  2N9X A;  4M0W B;  4MEL A;  1S1Q B;  1IYF A;  1GC7 A;  4ZRK A;  2NR2 A;  2AYO B;  4PYU A;  4BVU C;  3IG3 A;  1V9J A;  3A1Q B;  1GG3 A;  2GBR A;  4GGQ A;  3R7Q A;  4EZK A;  2FCN A;  3ML8 A;  1WXV A;  4N9F 4;  2LVQ A;  3N32 A;  1LFD A;  4WJN A;  2DYB A;  1XQQ A;  4MJS A;  1E8X A;  2XBB C;  1CMX B;  3WAO A;  2HJ8 A;  1E7U A;  1WJ6 A;  3QIJ A;  3CMM B;  4DHZ E;  4DK5 A;  3ZNI D;  1SE9 A;  2M17 A;  2EMS A;  2WDT B;  4DDI D;  1E7V A;  4IM3 A;  5E6P A;  3C0R B;  3PHW B;  4FJZ A;  3U30 A;  3DCG A;  3K9O B;  4BOS C;  3RZF A;  2DYM A;  3QAR A;  1UH6 A;  2L0F A;  1RRB A;  2KZR A;  3L16 A;  4WWN A;  4ZRI A;  4G50 A;  2IO1 B;  4NJ7 A;  2CR5 A;  1Z5S B;  2KHW B;  3ZTD A;  2NBU A;  2L7R A;  1KJT A;  1V86 A;  5AZH A;  1S3S G;  2BF8 B;  2KKC A;  4ICU A;  2K39 A;  4F7Z A;  3H6N A;  1WGG A;  4LDT D;  3UIN B;  3VTW A;  1EF5 A;  2NBW B;  2KFJ A;  4MGI E;  4RM9 A;  3QJZ A;  3QWZ B;  2M4N A;  2KOX A;  3L17 A;  5C23 A;  4GDK A;  4FHJ A;  4FJV B;  4IC7 B;  3PHX B;  1GUA B;  2D10 A;  2O2V B;  3W1S A;  4XC2 A;  1VD2 A;  1UBQ A;  2N9P C;  2LGX A;  3PTF C;  2ZVN A;  5EDS A;  2MLB A;  5AEK B;  1WI0 A;  3V61 A;  1NDD A;  1WF9 A;  4ANW A;  4MGK E;  2I1J A;  2N1V A;  5DPS A;  4BKS A;  4W9C A;  4F8C B;  2BKF A;  2GBJ A;  1QZE A;  1L2N A;  2KLG A;  2W9N A;  4IUM B;  4MEM A;  4MJS B;  1WY8 A;  2NBV B;  4HJK A;  3VH3 B;  2BYE A;  2ZCB A;  3W1Y A;  3R3M A;  3ZNG C;  2JY6 A;  4J6I A;  4FA6 A;  2WX0 A;  2CKH B;  4RMA A;  3APF A;  1YX6 B;  3TCA A;  5DPW A;  4BKG A;  4CHK A;  4GU2 A;  1H8C A;  4ANU A;  4DHZ B;  2M8S A;  2K6Q A;  2FID A;  2LRW A;  1U4A A;  1P3Q U;  3M62 B;  4EUT A;  3EEC A;  1IPG A;  4FBJ B;  4HCP B;  3VFK A;  1WGD A;  2NPT A;  1Q1O A;  3DVN U;  2J7Q B;  4W9J A;  2D07 B;  2JZ3 B;  5CHV C;  3PRZ A;  1SIF A;  4KSL C;  4HXD A;  1P98 A;  2J0M A;  4XZ4 A;  3VHT C;  1UEL A;  2KAN A;  3JVZ X;  4PS3 A;  5DPR A;  2ZPY A;  1Z2M A;  1WJU A;  2KJ6 A;  1E5W A;  3KH0 A;  2N9E B;  3BIN A;  1LQB A;  4MSM B;  3PPA A;  2DYO A;  3OLM D;  3NOB A;  4KVG B;  1C1Y B;  2Z0D B;  4BBN C;  4AJY B;  1H4R A;  2BKR B;  2Z59 B;  1UZX B;  2JUO A;  2KWC A;  2BWF A;  4K81 A;  1UBI A;  2HE7 A;  2LGD A;  2L0T A;  3PS6 A;  2IYD B;  2MW5 A;  3QA8 A;  2NVU I;  2RD0 A;  5D2M B;  2KXJ A;  2N1W A;  4GDL B;  4GMV A;  1WJN A;  2KMC A;  2WX1 A;  3IVF A;  2KO3 A;  2FIF A;  3QAQ A;  4X57 B;  3SDL C;  5E6N A;  3SHQ A;  3T9L A;  5J18 A;  1GJZ A;  2LGY A;  4NJ6 A;  1J0G A;  2HD5 B;  4EFO A;  3QHT A;  4I6N B;  3VUY A;  4HDO A;  3ALB A;  3K9P B;  2KQS A;  2V1Y A;  3WA0 A;  3RT3 B;  3B0A A;  1WX7 A;  1EF1 A;  2C5L C;  2NPT B;  4W9H A;  4PS7 A;  4E3C A;  4XX5 A;  4NPN A;  4KIK A;  3L54 A;  1TBE A;  5C1Z A;  2MX2 A;  3VUW A;  2AWT A;  1AAR A;  2BYV E;  4FHK A;  2LZ6 A;  4HCN B;  3WAL A;  2KK8 A;  1RAX A;  4LJO B;  2KTF A;  4NQL B;  3DVG X;  1WFY A;  4K1R B;  5D94 A;  5GMV A;  3UF8 A;  2MBB B;  4II2 B;  1G6J A;  3OAW A;  2MA9 B;  2L00 B;  2LAS A;  2R2O A;  4A20 A;  1WGR A;  2KTR A;  3VDZ A;  4HVB A;  5LXI B;  4NAW A;  1X1M A;  5JH5 C;  1OTR B;  5CHW A;  2DEN B;  3Q3F A;  4KZC A;  5L83 A;  3AU5 A;  1R4M I;  2BGF A;  4JL9 A;  3ZLZ A;  1GC6 A;  2DZJ A;  3B1L X;  4TKN A;  2AEH A;  2LVP A;  3R66 C;  4KDL B;  1WMH A;  4MSQ B;  5L95 C;  2EKE C;  2NS5 A;  2KWU B;  4K7W A;  2JPH A;  2C60 A;  2M0X A;  2O6V D;  4HLE A;  3TBL D;  4KSK C;  3VXW A;  3KYC D;  3KYD D;  3A9J A;  1M94 A;  1JRU A;  3P2B A;  2KX0 A;  2A5U A;  1OEY A;  4G11 A;  4KDI C;  3SD5 A;  3ZRF A;  3JSV B;  4ASW C;  3W1S C;  2KDE B;  3ML9 A;  4W9K A;  4W9F A;  4AUQ C;  4CO7 A;  1V6E A;  3QC8 B;  1XD3 B;  2MSE D;  2REX A;  4KZ0 A;  3V6E B;  5CTR C;  3WAM A;  4TV3 A;  5TR5 A;  4ZYN A;  3B08 A;  4KIK B;  2MBO A;  4ICV A;  1OGW A;  1YD8 U;  1V5O A;  3PV1 A;  2PPH A;  1J8C A;  3UGB B;  2IY1 B;  3VAW A;  2N4F A;  3X23 A;  1GNU A;  2LVO A;  1A5R A;  2IZV B;  3RZW C;  4WWP A;  4LCD E;  2NCN A;  4F1S A;  3KUZ A;  1BT0 A;  4NY0 A;  2CHZ A;  2K6D B;  2YVC A;  3LJ3 A;  3IBE A;  3S2A A;  3MHS D;  4WAA A;  2D11 A;  2QHO A;  4IWO A;  3UQA A;  2DZK A;  4ANV A;  3ZNZ B;  3AI5 A;  4GXB A;  2DAF A;  1WR1 A;  4M8M A;  1ZKH A;  3WAP A;  1WZ0 A;  2MP2 A;  4GB9 A;  1F9J A;  2J0J A;  3HM3 A;  4DHJ B;  2ZZP B;  3DBR I;  1V2Y A;  3PT2 B;  3T8M A;  5J17 A;  4HPM B;  3CSF A;  3ZTC A;  4GSW A;  3A4S C;  4BFR A;  3U7D A;  1YIW A;  3H7P A;  2JVC A;  1WM3 A;  4JIO U;  5LLI A;  3NZU A;  4NNJ B;  3R7R A;  1K8R B;  2FUH B;  2MBQ A;  1E90 A;  3JW0 X;  4JGH B;  4GN1 A;  1UGM A;  2MRP A;  2OJR A;  3L0W B;  4TQ1 A;  3APD A;  2BWE S;  4GDK B;  4DWF A;  2MBE A;  5CHF A;  2KC2 A;  4B9K A;  4HK2 A;  4PS8 A;  4EZJ A;  4II3 B;  2HTH A;  4BBN F;  2R2Q A;  1E8W A;  2KX3 A;  3O65 B;  3ECI A;  2RSU A;  1MG8 A;  5AZF A;  2G4D B;  2JWZ A;  2KJH B;  2FCQ A;  3A4R A;  2KDF B;  2KDI A;  1ISN A;  1LM8 B;  3M3J A;  4HPL B;  3CF6 E;  5KHQ A;  3DPD A;  3A9K A;  1EO6 A;  2GBN A;  1WYW B;  3H7S A;  4FN2 A;  2UWQ A;  2RGF A;  3X0W A;  3BY4 B;  3HK0 A;  3Q3J A;  4ANX A;  2PE9 A;  3VQI A;  3N3K B;  2C7N B;  3OJ4 B;  4DXA B;  1D3Z A;  2ZJD A;  3AU4 A;  3M95 A;  2LD9 A;  2RR9 A;  2DZM A;  3RYT A;  4K7S A;  5CX3 A;  3PRP B;  2JRI B;  2MP2 B;  4WWO A;  1IP9 A;  2L05 A;  2ZNV B;  4IW0 A;  2LRU A;  1J19 A;  4YL8 A;  4EOY A;  3ZIM A;  1NBF C;  2G45 B;  1ZGU B;  3TL5 A;  1EUV B;  4WQO B;  2CHX A;  2I1K A;  3DDC B;  2LJ5 A;  2JRH A;  1V49 A;  4DBG A;  2PEA A;  4IG7 B;  4MDK E;  2IO2 B;  1I42 A;  3DBH I;  2Y5B B;  3EC8 A;  4MM3 A;  2L76 A;  2M1M A;  1VCB A;  3IHP C;  5HKH A;  2DAJ A;  4FJY A;  3ZRC A;  1RLF A;  4W9D A;  4EKU A;  1E8Y A;  1YJ1 A;  2G4S A;  3LDZ E;  3UQB A;  2IO3 B;  3WIM A;  2LI5 A;  2CU1 A;  4IWP A;  2LWP A;  2C7H A;  2EMT A;  2D3G A;  4DHJ D;  4B6W A;  1P9D U;  1R4N I;  5J2R A;  2L8J A;  2DX5 B;  3RD2 A;  3KVF B;  2D2Q A;  2J0K A;  1V80 A;  2CS4 A;  4I6P A;  2OOB B;  1WGY A;  4P7I A;  3UIO B;  2Z0E B;  1P0R A;  3A9K B;  3DOW A;  5E6O A;  1TGZ B;  3ZO5 B;  4HWI B;  2ZCC A;  2KN5 A;  3U8Z A;  2UYZ B;  1WIA A;  4MGY E;  4OVV A;  1WXA A;  2K8C A;  4ZRJ A;  1WGH A;  3VTU A;  2K25 A;  3KW5 B;  2JZZ A;  2KNB A;  1Q0W B;  2XEW A;  3EHV A;  2BPS A;  3HIZ A;  4PYZ A;  2G3Q B;  1L7Y A;  2VRR B;  2PE6 B;  1WR6 E;  3D32 A;  1TTN A;  2IO0 B;  5G55 A;  2MCN B;  3L08 A;  5JZE B;  2IBI B;  2C9W B;  3V60 A;  4BOZ B;  2A4Z A;  3TIX A;  2JT4 B;  2WYQ A;  3GZN I;  1WE7 A;  1WE6 A;  3VVW B;  4BKS D;  1V81 A;  2K8H A;  1C3T A;  1YX5 B;  2N7D A;  4IWQ A;  3VTV A;  1KLV A;  3PLV A;  3PRM B;  4K7U A;  2GBK A;  1FXT B;  2B3A A;  4B95 A;  3HM6 X;  3VUX A;  2O6V A;  3NHE B;  2KTR B;  2ZNV C;  3APC A;  4IM2 A;  1WM2 A;  2MQJ A;  1WX9 A;  1SGH A;  1YQB A;  3I3T B;  3QQ8 B;  4NAW B;  3ZDM C;  3PSE B;  4W9I A;  1T0Y A;  3JYU A;  3MJW A;  3PVL A;  2FCM A;  1PQS A;  5D7G A;  4G0N B;  2IY0 B; 
#chains in the Genus database with same CATH topology
 3QK0 A;  3RCZ A;  1TKY A;  1NI2 A;  3H9D A;  3PZD A;  3HHM A;  3NS8 A;  2XK5 A;  1E8Z A;  3J9C A;  2MWS B;  2WLB A;  3DQV A;  2MHJ A;  5FR6 A;  3N30 A;  4LJP B;  3WAN A;  3DBL I;  2KJR A;  2BYF A;  4AP4 C;  3AXC A;  2K1F A;  1I35 A;  1N60 A;  2KAJ A;  3ZDT A;  3NVZ A;  4E71 A;  4XGA B;  3GOE A;  3ZVV A;  1IGD A;  3SEB A;  4OZA A;  2O6V B;  2FE8 A;  4BZA A;  4S17 A;  1EU4 A;  2Y5C A;  3A33 B;  2BTE A;  1Y8R C;  1N61 A;  1BXT A;  2KVR A;  3QX1 A;  3SFE B;  3DBH B;  4RF1 A;  2X38 A;  3H7P B;  4YTN B;  3DVN V;  2V3S A;  2CHW A;  1JCK B;  2BB6 A;  3V6C B;  1WJ4 A;  2BB5 A;  2QEJ C;  2QIE B;  3TUO A;  4C00 A;  2N9X A;  3IAM 1;  4M0W B;  4PK1 A;  3PZ7 A;  4OHJ A;  4PYU A;  2AYO B;  1FCC C;  3A1Q B;  1GG3 A;  1ZDX A;  2GBR A;  4IOI E;  3ML8 A;  3T3O A;  2LVQ A;  4MJS A;  1CMX B;  4JE3 B;  1E7U A;  3AB5 A;  3QIJ A;  4WUR A;  3AV8 A;  1DOI A;  3U30 A;  3PHW B;  3DCG A;  4USA A;  1FM0 D;  2DYM A;  2L0F A;  1RRB A;  4AS1 A;  2BT6 A;  2IO1 B;  1F52 A;  1WGK A;  3KWV A;  2WXG A;  1Z5S B;  5JXV A;  3NVY A;  3N20 C;  1DOX A;  2BF8 B;  4RGN A;  3P42 A;  4N58 A;  4LDT D;  2NBW B;  4MGI E;  1N5W A;  3L17 A;  5C23 A;  3B2G A;  1F1H A;  1GAQ B;  4FJV B;  4IC7 B;  2ZW1 A;  4DXF A;  2NTT A;  2LGX A;  3ZYY X;  3NG0 A;  3NZ3 A;  5EDS A;  1NDD A;  4C80 A;  5DPS A;  2I1J A;  4F8C B;  2BKF A;  1ZXH A;  3DHH C;  1GOZ A;  4J6I A;  2CKH B;  3APF A;  5DPW A;  4CHK A;  4GU2 A;  1H8C A;  4ANU A;  2LRW A;  4WQM A;  2KT7 A;  1IPG A;  2N9L A;  3DVN U;  1MI0 A;  2J7Q B;  2D07 B;  5CHV C;  4TMA B;  5E6J A;  3AEA B;  5GXG B;  2WXN A;  2KAN A;  1FMA D;  1Z2M A;  3KH0 A;  4MSM B;  3PPA A;  1AYF A;  2KAC A;  1I7H A;  3R8B A;  2Z59 B;  2BWF A;  1KLG D;  4UDU C;  2W3S A;  2IND C;  2V0G A;  3N1X C;  4LNI A;  2QSD A;  4GDL B;  2WX1 A;  3QAQ A;  3AE2 B;  4XDD A;  5E6N A;  3SHQ A;  2HD5 B;  4EFO A;  4ARI A;  3ALB A;  1JQ4 A;  2C5L C;  2W82 A;  4E3C A;  4LTU A;  4NPN A;  1TBE A;  5FKA C;  5C1Z A;  1VZ7 A;  1VZ8 A;  4KGS A;  5T8I A;  2XNA C;  1FD6 A;  2VH2 A;  1RAX A;  4K1R B;  3UF8 A;  4A20 A;  1WGR A;  2NTS A;  3AE7 B;  1X1M A;  2DEN B;  4KZC A;  1J7B A;  3AU5 A;  4FXC A;  2LVP A;  4KDL B;  1ZOY B;  2KQ4 X;  2KWU B;  3GE3 C;  2C60 A;  3TBL D;  4Q2J A;  4KSK C;  3C8Y A;  3KYC D;  3SD5 A;  5MPO A;  3ZRF A;  3W1S C;  2KDE B;  1SE2 A;  1YJJ A;  1JWA D;  2J52 A;  2H89 B;  4YWG G;  3QC8 B;  2PVO D;  3B9J A;  4KZ0 A;  2CJO A;  4TV3 A;  4XWT A;  4ZYN A;  2MBO A;  4A55 A;  3BVM A;  2PPH A;  4PT5 A;  3VAW A;  2IZV B;  1BT0 A;  2CHZ A;  4HKQ A;  3MHS D;  5HG2 A;  2K0P A;  2DZK A;  3IXS A;  2WU2 B;  2DAF A;  4US8 A;  3SFD B;  4GB9 A;  1TS3 A;  2J0J A;  1B9R A;  2ZZP B;  3BWU D;  3AH7 A;  3T8M A;  4GSW A;  3U7D A;  1YIW A;  3W9C B;  4JIO U;  3PZ8 A;  3R7R A;  4N59 A;  3RNA C;  1TS4 A;  2PTL A;  1UGM A;  1FEH A;  1IGC A;  1OFF A;  1C77 A;  4B9K A;  2PIA A;  4II3 B;  3O65 B;  1V1P B;  3ZJV A;  5AZF A;  3Q8E A;  4HPL B;  1LM8 B;  1PGX A;  3CF6 E;  3A9K A;  1EO6 A;  3VRA B;  1WYW B;  2UWQ A;  2PE9 A;  3VQI A;  1KTK A;  1YMH E;  2WDR B;  1JAL A;  1F0Z A;  2RR9 A;  2DBY A;  3Q69 A;  4K7S A;  4M00 A;  3Q8F A;  4WWO A;  1IP9 A;  2L05 A;  2ZNV B;  1J19 A;  4YL8 A;  1NBF C;  4HPP A;  2CHX A;  3DDC B;  4C4V B;  1YN3 A;  1RFK A;  4OZC A;  1WRI A;  1AWD A;  3AEC B;  3DBH I;  2D3A A;  1ZUD 2;  5HKH A;  2DAJ A;  4FJY A;  3ZRC A;  1YJ1 A;  3UQB A;  1MVK A;  4BAX A;  2IO3 B;  2CU1 A;  4IWP A;  1QOB A;  2I38 A;  3GP7 A;  2D2Q A;  2J0K A;  2OOB B;  2WXF A;  5G5G A;  2J42 A;  4ZHP A;  5BMH A;  1TGZ B;  3ZO5 B;  2ZCC A;  2KN5 A;  2UYZ B;  1WIA A;  4OVV A;  3RMK C;  4XWW A;  5BYQ A;  2K25 A;  3U52 E;  2RDG A;  2XEW A;  4RFB A;  1EWY C;  1E0Z A;  1TIF A;  1ET9 A;  2R61 A;  3L08 A;  5JZE B;  2C9W B;  2JYT A;  1MJD A;  1WE6 A;  3VVW B;  4BKS D;  1V81 A;  2K8H A;  4ARC A;  1KLV A;  2W54 A;  2PW9 A;  3PLV A;  1XLQ A;  4GLS C;  1XO3 A;  4MM3 B;  4RNA A;  2WP9 B;  1VZ6 A;  2AX5 A;  2KTR B;  1CQV A;  2MQJ A;  4BVU C;  1NYQ A;  3PSE B;  3MJW A;  2WNM A;  1PQS A;  5D7G A;  2IY0 B;  2QCZ A;  4ZHO A;  2BS3 B;  4P1B C;  1CJE A;  3M63 B;  4W9L A;  4WJP A;  1T5X D;  3ETR A;  3RUL A;  3A9J B;  1UGJ A;  5JHA A;  2KFK A;  1E10 A;  2BS4 B;  2WWZ A;  1LO5 D;  4B0E A;  3RI7 C;  4EZL A;  3VH4 B;  4GIV A;  3W2D A;  2BVC A;  5FK9 C;  1P1A A;  2WXR A;  2DZI A;  1JRP A;  4G3X B;  3BZD B;  4GOC A;  4YSX B;  5LNK 1;  4FAD A;  1JML A;  1QF6 A;  2INC C;  1C78 A;  4WJO A;  3MTN B;  3NY5 A;  4DDG D;  2LUE A;  3BYY B;  3HUI A;  1MHX A;  4OZB A;  1E9M A;  3SU8 X;  1Q5W B;  4MH0 E;  1FNV A;  4YT0 B;  3I5J C;  1HE8 A;  3DBS A;  2JXX A;  3AED B;  2OED A;  2ASQ A;  5DPT A;  1V5T A;  1WXM A;  3ZKJ C;  4A3P A;  4JLC A;  3QCA A;  2XN9 C;  3I9V 1;  2DHZ A;  5EE3 A;  2H88 B;  4E74 A;  2D5G A;  4A3O A;  2FCS A;  1WH3 A;  2V4L A;  2XK5 B;  2L1A A;  2LHE A;  2ZPN A;  3KUC B;  4RGO S;  3UIP B;  2KD0 A;  3JSV A;  1RFA A;  1HA5 A;  3NZS A;  3WAO A;  5J18 A;  2QJL A;  2KDB A;  3EFU A;  3RUI B;  2KVZ A;  2KQ7 A;  1R4N B;  1N62 A;  1SSN A;  3ONS A;  5D3D A;  2GI9 A;  1QQR A;  4MEL A;  4S0R A;  1IYF A;  5BYS A;  1GC7 A;  3Q6B A;  3IG3 A;  4YTM B;  2LGS A;  4N9F 4;  4JPS A;  3TEW A;  1E8X A;  2WQY B;  2XBB C;  2HJ8 A;  1I4Q A;  2CU3 A;  2WXO A;  4DHZ E;  2DLB A;  4DQO C;  3ZNI D;  4DDI D;  1E7V A;  3RPF C;  3RZF A;  1UH6 A;  4P6V F;  4ZRI A;  2CR5 A;  1IUE A;  2L7R A;  1KJT A;  1HQR D;  5AZH A;  1S3S G;  1TZO A;  2KKC A;  4MAC A;  3H6N A;  4NJC A;  2BBC A;  4GDK A;  4FHJ A;  1VRA B;  3PHX B;  4XC2 A;  2MLB A;  5AEK B;  2W3R A;  4BKS A;  4W9C A;  3RNG C;  1QZE A;  1L2N A;  4MJS B;  1WY8 A;  4HJK A;  2ZCB A;  4QAY A;  3R3M A;  2JY6 A;  4FA6 A;  2WX0 A;  4D2K A;  2M8S A;  3VRB B;  4HCP B;  1WGD A;  2NPT A;  1ZE3 D;  2LUM A;  4W9J A;  4IKG A;  4KSL C;  1P98 A;  4XZ4 A;  1EWC A;  3ZJT A;  3AE6 B;  3N9Y C;  1E5W A;  1C76 A;  1L0Y B;  3FAH A;  2DYO A;  3HVZ A;  2Y5P A;  2RPV A;  2JU6 X;  4L1B A;  4KVG B;  2ONQ A;  2Z0D B;  4BBN C;  1KF6 B;  4AJY B;  1SE4 A;  1JWB D;  2J4X A;  2KWC A;  4CQN A;  4K81 A;  2IYD B;  3GB1 A;  2KYW A;  4M01 A;  1JWM D;  1AN8 A;  4KGT A;  2KMC A;  3IVF A;  2KO3 A;  3T9L A;  4NJ6 A;  1J0G A;  3K9P B;  2V1Y A;  1EF1 A;  2Y3A A;  1T6B X;  2WXP A;  3KLS X;  2MX2 A;  2AWT A;  3URY A;  3DWG C;  1ROE A;  2IGG A;  4HCN B;  2KK8 A;  1E7P B;  2KTF A;  3DVG X;  2LEK A;  4II2 B;  3MC0 B;  2R2O A;  4HVB A;  3LYY A;  5H8Y E;  1OTR B;  1C4P A;  5L83 A;  4JL9 A;  2DZJ A;  4TKN A;  2AEH A;  2ZW0 A;  2JX5 A;  5L95 C;  4K7W A;  2WGS A;  1M94 A;  1JRU A;  2KX0 A;  4G11 A;  1OEY A;  4DXG A;  4KDI C;  1AW7 A;  1XEE A;  4WAF A;  3ML9 A;  4KKI A;  2D3C A;  1RWS A;  2BW2 A;  2MSE D;  2REX A;  3V05 A;  3WAM A;  1R7S A;  3PV1 A;  2IY1 B;  2N4F A;  2LVO A;  1A5R A;  3KUZ A;  4NY0 A;  3LJ3 A;  1FCL A;  1UNS A;  4IWO A;  3UQA A;  1JRO A;  4ANV A;  3ZNZ B;  1V97 A;  2JSV X;  1SE3 A;  1WZ0 A;  2MP2 A;  3RNC C;  3BYT B;  3HM3 A;  2WXQ A;  1V2Y A;  3PT2 B;  3ZTC A;  4BFR A;  3H7P A;  3AM9 A;  5LLI A;  3AE4 B;  2WXL A;  3NZU A;  1K8R B;  4GN1 A;  2MRP A;  3Q3O C;  3APD A;  4ZYS A;  2MBE A;  1RM6 C;  2FBW B;  1OQR A;  3GE8 C;  4EZJ A;  2HTH A;  4BBN F;  1E8W A;  2BQQ A;  1GB1 A;  1CK1 A;  3ECI A;  3O13 A;  1L6V A;  2JWZ A;  3M3J A;  2FCQ A;  3A4R A;  3VR8 B;  3UI3 A;  1T0S C;  4FN2 A;  3X0W A;  1Q10 A;  3BY4 B;  3HK0 A;  3N3K B;  2C7N B;  3OJ4 B;  1D3Z A;  3RNE C;  2LD9 A;  2DZM A;  5C2T B;  2JRI B;  3MHZ A;  4WIP A;  4EOY A;  4WQO B;  4KKJ A;  3IT6 B;  1JWU D;  2LJ5 A;  2JRH A;  4DBG A;  2G1E A;  2PEA A;  4IG7 B;  3U7Z A;  2WS3 B;  4ZOH C;  2Y5B B;  3EC8 A;  3OWE B;  3B2F A;  1NEK B;  1VCB A;  3IHP C;  2JYE A;  1RLF A;  4EKU A;  2WDQ B;  1E8Y A;  1R4M B;  2WXK A;  2PMV A;  2N9K A;  1TY2 A;  2D3G A;  4B6W A;  1R4N I;  5H92 C;  2VZK D;  2DX5 B;  3RD2 A;  1QIL A;  1V80 A;  2CS4 A;  3UIO B;  1P0R A;  1TKG A;  3A9K B;  3DOW A;  1I4H A;  5IN7 A;  3VTU A;  1WXA A;  2K8C A;  2QDF A;  4ZRJ A;  1WSP A;  1MHH E;  2KNB A;  1Q0W B;  2BPS A;  4PYZ A;  2G3Q B;  1C4C A;  1L7Y A;  1VJK A;  2HJ1 A;  3D32 A;  3TIX A;  1N6Z A;  1WXQ A;  2LMC A;  1YX5 B;  2N7D A;  2QC8 A;  4RCO A;  2LHD A;  4YXD B;  4B95 A;  3HM6 X;  2ZNV C;  1WM2 A;  4NAW B;  3U2S C;  4W9I A;  2GLS A;  2QHO A;  1UWM A;  4G0N B;  1OQY A;  3DBR B;  1WMH B;  1PGA A;  1IBX A;  2JF5 A;  3BVZ A;  2MBH A;  3RFZ B;  3CIR B;  1DYQ A;  4GDL A;  3DVG Y;  3ZUN A;  5HFY A;  2FAZ A;  3PRE A;  5D6J B;  1UD7 A;  3AUL A;  1P7F A;  2UU7 A;  1XCT L;  2ZEQ A;  1OEY J;  3PGE A;  1WWT A;  4JQW C;  2INN E;  2GBM A;  1YOV B;  2ON8 A;  3L10 B;  2RDH A;  4AOF A;  3ZW3 A;  2G9H D;  4TQ0 A;  1DGJ A;  1ZP0 B;  2QMT A;  3EUB 2;  5DCN A;  4IM0 A;  1TY0 A;  2RPQ A;  4FLH A;  1D4B A;  2L83 A;  2KWD A;  1PYW D;  2CJN A;  1QKZ A;  5IA7 A;  3R2T A;  1ZW7 A;  1XCQ L;  4MGZ E;  3NVV A;  5IKC M;  1V8C A;  4CYE A;  2GMI C;  3AE3 B;  1XXG A;  2KFK B;  1KM7 A;  4NQK E;  3TSS A;  4LK0 M;  4M8N A;  2GRI A;  2L3Z A;  2LXC A;  2KLC A;  4FUL A;  1I4G A;  1D5Z C;  1ET6 A;  3SR6 A;  1C4A A;  4I6L B;  4RM8 A;  1Y56 A;  3LXF A;  1T0Q C;  2O2V A;  1WX8 A;  1S1Q B;  1I4R A;  4ZRK A;  4EZK A;  2FCN A;  1WXV A;  4WJN A;  1LFD A;  3TEZ A;  1FRR A;  1WJ6 A;  4ACF A;  3CMM B;  2M17 A;  5AUK A;  1KFY B;  4IM3 A;  5E6P A;  3C0R B;  1VDV A;  3K9O B;  4OW0 A;  3QAR A;  3MC8 A;  4XDC A;  4NJ7 A;  3ZTD A;  3P63 A;  2K39 A;  4A8X C;  1K51 A;  1WGG A;  3VTW A;  3UIN B;  2PVG C;  4C7Z A;  1EF5 A;  3QJZ A;  2M4N A;  3TEY A;  5IOI A;  3W1S A;  1UBQ A;  2N9P C;  2JXT A;  3P4R B;  2GBJ A;  2W9N A;  4MEM A;  2NBV B;  4KGR A;  3W1Y A;  1HZ5 A;  2KMM A;  4RMA A;  2M19 A;  4C7Y A;  4DHZ B;  2K6Q A;  2FID A;  3AEF B;  2M0A A;  4L2Y A;  1P3Q U;  3EEC A;  3VFK A;  3AE8 B;  2JZ3 B;  3PRZ A;  1J7A A;  1FIQ A;  2EKI A;  1L6U A;  2J0M A;  1STE A;  1UEL A;  3JVZ X;  4PS3 A;  4NAM A;  2KJ6 A;  2N9E B;  1SIJ A;  3BIN A;  1JWS D;  1K53 A;  2BKR B;  4A90 A;  1UZX B;  2HE7 A;  2L0T A;  5EE0 A;  4L23 A;  5FR3 A;  2MW5 A;  2NVU I;  1QOA A;  2RD0 A;  2VH1 A;  2KXJ A;  2K5P A;  4GMV A;  4X57 B;  3ZXR A;  1HEZ E;  2LGY A;  4HEA 1;  1F2R I;  3AE1 B;  3QHT A;  2D3B A;  4I6N B;  4HDO A;  2KQS A;  3WA0 A;  2L32 A;  3RT3 B;  2NPT B;  1N5X A;  4W9H A;  2X8X X;  4M02 A;  4XX5 A;  3EFC A;  3NS1 A;  4KIK A;  4J3O D;  2LJI A;  1L0X B;  1VLB A;  2BYV E;  1AAR A;  4FHK A;  1XF5 L;  3V3X A;  3WAL A;  1PDX A;  4NQL B;  1YNT E;  1WFY A;  5D94 A;  5GMV A;  4HKZ E;  3OAW A;  2LAS A;  3AMZ A;  2KTR A;  3VDZ A;  3P4P B;  1TYG B;  4WWM A;  3HVD A;  5LXI B;  5G5H A;  5JH5 C;  4RF0 A;  5CHW A;  3Q3F A;  1R4M I;  2BGF A;  4HRS A;  1PUT A;  2WHI A;  3B1L X;  3R66 C;  1XLP A;  4HLE A;  2O6V D;  4B0M A;  3A9J A;  3N1Z C;  4ASW C;  1D6E C;  2RDB C;  4W9F A;  4AUQ C;  1D5M C;  1YQ4 B;  5HI1 A;  1SJE D;  5CTR C;  2MEK A;  2IPK D;  2LGI A;  5TR5 A;  3I63 C;  4ICV A;  1OGW A;  4A9A A;  1V5O A;  1L4D B;  1T3Q A;  3X23 A;  1GNU A;  3RZW C;  4WWP A;  2NCN A;  1GB4 A;  3S2A A;  2RMM A;  4TSS A;  4WAA A;  2D11 A;  4YSY B;  2GB1 A;  2MJ3 A;  1YQ3 B;  5D3I B;  2E3T A;  3BII D;  3AI5 A;  4GXB A;  1ESF A;  1KH0 A;  2EEL A;  4HJG E;  1WR1 A;  1ZKH A;  4REZ A;  3Q3N C;  4DHJ B;  1NYR A;  3DBR I;  1FXA A;  5J17 A;  3CSF A;  2I2Y A;  2JVC A;  2FUH B;  1EM7 A;  1E90 A;  2AQ2 B;  2OJR A;  4TQ1 A;  1I4P A;  3FIL A;  1ZPS A;  2BWE S;  1TKE A;  4EE2 A;  2KC2 A;  1QT9 A;  1E6E B;  4HK2 A;  3NRZ A;  2YEP B;  1EU3 A;  2R2Q A;  2RSU A;  4JWS C;  1KRH A;  2G4D B;  1ZDV A;  2KDF B;  2KDI A;  2J53 A;  3E56 A;  1PGB A;  2GBN A;  3H7S A;  3DWM A;  2AQ1 B;  2JZP A;  2MJD A;  2ZJD A;  3AU4 A;  2SEB D;  2DWQ A;  3M95 A;  5CX3 A;  2MP2 B;  4IW0 A;  2LRU A;  5IP4 D;  2G45 B;  3RNB C;  3TL5 A;  3W5V B;  3AN1 A;  1XLO A;  4MDK E;  2V9H A;  2IO2 B;  3RN9 C;  1C9F A;  2L76 A;  4K3B A;  5EE9 A;  2MH7 A;  1DOY A;  2G4S A;  3AE9 B;  3WIM A;  3BK1 A;  1HTO A;  2LWP A;  2IJ0 A;  2C7H A;  4WH4 A;  5BMI A;  1TS5 A;  4I6P A;  4P7I A;  2Z0E B;  2ACZ B;  1UUP A;  1UWX A;  3FKY A;  1WGH A;  4HRO A;  2JZZ A;  3EHV A;  2WXM A;  1FNW A;  1N63 A;  1BUI C;  2YEP F;  2VRR B;  1TTN A;  2IO0 B;  3DHG C;  5G55 A;  1FO4 A;  4LNO A;  3V60 A;  1KLU D;  4BOZ B;  4P16 A;  2JT4 B;  2V3P A;  1F2R C;  4C56 C;  4IWQ A;  2QIL A;  3VTV A;  1TJE A;  4K7U A;  2INP E;  3Q3M C;  1FXT B;  3W5U B;  4ITK A;  2O6V A;  3NHE B;  4IM2 A;  1WX9 A;  1SGH A;  1YQB A;  3QQ8 B;  1T0Y A;  3PVL A;  2HTM E;  2FCM A;  4R3D A;  3ZXV A;  2YLM A;  3IFW B;  2FNJ B;  1WZ3 A;  3ENE A;  3KQ4 A;  5JHB A;  2PJH A;  5IAA C;  4AWJ A;  3CST A;  4URK A;  3PLU A;  4AJW A;  2ZVO A;  1KOT A;  2LXA A;  4BKT A;  1K50 A;  1XT9 B;  5BO4 B;  2AL3 A;  5KHO A;  2Z8L A;  5G2N A;  3GS2 A;  3H1U A;  2KC1 A;  3TMP B;  1TZ1 A;  1HZ6 A;  4M0W A;  1SF0 A;  2KWV B;  4EEW A;  4WJQ A;  3ZNH B;  2DNF A;  4NZL B;  2WXJ A;  3A1Q A;  4MH8 A;  4P1C C;  4KV2 A;  3OJ3 A;  1D5X C;  4MT5 A;  3T3N A;  1L5P A;  3KUD B;  2GOW A;  4LDT B;  3P1M A;  1IBX B;  3ABV B;  3Q8A A;  3VR9 B;  2BS2 B;  3RNF C;  1WRD B;  4YTP B;  4IDI A;  3V62 A;  4W9G A;  3L13 A;  4OVU A;  4HDQ A;  5LXH A;  1WXS A;  4W9E A;  3TJP A;  1FFV A;  5AZG A;  2AL6 A;  1LXD A;  2C7M B;  3R2I A;  4ZDV A;  5EE1 A;  4TUU A;  2K8B A;  3CWI A;  3ZQ4 A;  3N1Y C;  2KN4 A;  3EGR A;  2KMA A;  2N7E A;  3ZJU A;  1UF0 A;  2NR2 A;  1V9J A;  4GGQ A;  2HDE A;  3R7Q A;  3U4E G;  1I4X A;  3P4S B;  2IDY A;  3N32 A;  1LGR A;  2DYB A;  1XQQ A;  1L0V B;  3GZN B;  4DK5 A;  1SE9 A;  1FRD A;  2EMS A;  4YSZ B;  2WDT B;  4FJZ A;  2WDV B;  4BOS C;  1M4V A;  1YJI A;  1FFU A;  3DHI C;  2KZR A;  3L16 A;  4WWN A;  1NVI D;  4G50 A;  3AEG B;  2B76 B;  2KHW B;  3NVW A;  2NBU A;  1V86 A;  3MFG A;  3Q14 C;  4ICU A;  4N6E B;  4F7Z A;  1MPE A;  1J7C A;  3BVG A;  2KFJ A;  4RM9 A;  3QWZ B;  2KOX A;  1TS2 A;  1GUA B;  2D10 A;  2O2V B;  4JWU C;  1VD2 A;  1NI3 A;  3PTF C;  2ZVN A;  2NMQ A;  1WI0 A;  5AUI A;  3V61 A;  2IGH A;  2LFI A;  1WF9 A;  4ANW A;  4MGK E;  2N1V A;  5C3J B;  3P4Q B;  2KLG A;  3HRD D;  3DBL B;  4IUM B;  3VH3 B;  1ENF A;  2BYE A;  5BMG A;  3ZNG C;  1YX6 B;  4BKG A;  2W55 A;  1FXI A;  1SB3 C;  1MG4 A;  1U4A A;  3M62 B;  4EUT A;  4FBJ B;  1Q1O A;  1SIF A;  2VZK B;  5I4D A;  4HXD A;  3VHT C;  1HTQ A;  4K3C A;  5DPR A;  1BML C;  2ZPY A;  1WJU A;  4O1N A;  4ZRP A;  1LQB A;  1SXT A;  3OLM D;  3NOB A;  1C1Y B;  1H4R A;  1SJH D;  2JUO A;  1UBI A;  2LGD A;  3MP9 A;  3PS6 A;  3QA8 A;  3IAS 1;  4JX1 C;  1F77 A;  2N1W A;  1WJN A;  2JWU A;  2FIF A;  3SDL C;  1K52 A;  4XE0 A;  1GJZ A;  1A70 A;  1HXY D;  2TSS A;  2WU5 B;  3VUY A;  2K9X A;  2M56 B;  1CZP A;  3B0A A;  1WX7 A;  4PS7 A;  3L54 A;  4US9 A;  3VUW A;  4LNK A;  2L52 A;  1QOF A;  2LZ6 A;  2MJE A;  4LJO B;  3MJ5 A;  3EA6 A;  2MBB B;  1G6J A;  1RYJ A;  2K22 A;  2MA9 B;  2L00 B;  1MFW A;  4NAW A;  5TSS A;  3Q2A C;  5HHD G;  5IO9 A;  2IGD A;  3ZLZ A;  1GC6 A;  1WMH A;  1V1O A;  4MSQ B;  2EKE C;  2NS5 A;  2JPH A;  2M0X A;  2V3N A;  3VXW A;  3KYD D;  1TT5 B;  3P2B A;  4RGT A;  2A5U A;  3JSV B;  4LNN A;  4W9K A;  4CO7 A;  4RH6 A;  2N0S B;  3E9S A;  4XYC A;  1V6E A;  3V6E B;  1XD3 B;  2E6X A;  3Q8C A;  3TEX A;  3B08 A;  4KIK B;  1SEB D;  1YD8 U;  4RGM A;  1P7E A;  1J8C A;  3UGB B;  1V1P A;  4LCD E;  4F1S A;  3PO0 A;  4ZRQ A;  4LNF A;  2K6D B;  2YVC A;  3IBE A;  3AE5 B;  3FC4 A;  2SAK A;  4M8M A;  3WAP A;  1VR9 A;  1F9J A;  1PFD A;  2FUG 1;  1QOG A;  3AEE B;  4HPM B;  1JW9 D;  2AQ3 B;  3A4S C;  2WXI A;  4C4V A;  1WM3 A;  3IT4 B;  1T0R C;  3LB8 C;  4NNJ B;  3Q8B A;  2MBQ A;  3JW0 X;  4JGH B;  1C79 A;  2BYT A;  3L0W B;  2OHF A;  1ACC A;  2V4I B;  4GDK B;  4DWF A;  1ZXI A;  5CHF A;  4PS8 A;  3OG5 A;  3BK2 A;  2KX3 A;  1MG8 A;  2KJH B;  5D2M B;  5KHQ A;  1ISN A;  3DPD A;  2JQR B;  2RGF A;  1XLN A;  4ANX A;  3Q3J A;  2ICI A;  2PKO A;  3AEB B;  4DXA B;  3NUH B;  3RYT A;  3PRP B;  1NEN B;  2Q5W D;  3ZIM A;  1WYG A;  3MC9 A;  1ZGU B;  1EUV B;  2I1K A;  1V49 A;  1I42 A;  3KWL A;  4MM3 A;  2M1M A;  4A6Q A;  4W9D A;  3FIL B;  3LDZ E;  1GPX A;  2LI5 A;  2EMT A;  1OQQ A;  4DHJ D;  1P9D U;  4H2A A;  5J2R A;  2L8J A;  3H8H A;  3KVF B;  2WXH A;  1FPY A;  1WGY A;  1SBB B;  5E6O A;  1B1Z A;  4HWI B;  2K3U A;  4OVZ A;  3U8Z A;  4MGY E;  3KW5 B;  2KDM A;  1FNU A;  3HIZ A;  2PE6 B;  1WR6 E;  4LLG M;  2MCN B;  2IBI B;  2A4Z A;  1L4Z B;  2WYQ A;  3GZN I;  1WE7 A;  1QLB B;  3WCQ A;  3L4P A;  3NJT A;  2N7J A;  3I57 A;  1C3T A;  3PRM B;  3C19 A;  2GBK A;  1YN4 A;  2B3A A;  5BYR A;  3VUX A;  3APC A;  2PLP A;  4KX6 B;  1YN5 A;  3ZDM C;  3I3T B;  2OJW A;  3JYU A;  4AQ7 A;  3TCA A;  3ZGZ A; 
#chains in the Genus database with same CATH homology
 1OQY A;  3QK0 A;  2YLM A;  1WMH B;  3IFW B;  2FNJ B;  1WZ3 A;  3M63 B;  4W9L A;  4WJP A;  3RCZ A;  3RUL A;  3ENE A;  2JF5 A;  5JHB A;  1NI2 A;  2MBH A;  2PJH A;  3H9D A;  3PZD A;  3HHM A;  3A9J B;  5IAA C;  3NS8 A;  2XK5 A;  4AWJ A;  5JHA A;  4GDL A;  2KFK A;  3CST A;  1E8Z A;  3DVG Y;  2FAZ A;  3ZUN A;  4URK A;  3PRE A;  3PLU A;  2MWS B;  5D6J B;  3DQV A;  4AJW A;  1UD7 A;  2WWZ A;  3AUL A;  3N30 A;  4LJP B;  5FR6 A;  2ZVO A;  3WAN A;  3DBL I;  1KOT A;  2KJR A;  2BYF A;  2LXA A;  2ZEQ A;  4EZL A;  1OEY J;  3PGE A;  3VH4 B;  4AP4 C;  3AXC A;  4GIV A;  4JQW C;  4BKT A;  2K1F A;  1XT9 B;  5BO4 B;  1P1A A;  2AL3 A;  2DZI A;  4G3X B;  4GOC A;  5KHO A;  1I35 A;  4FAD A;  2GBM A;  5G2N A;  3H1U A;  3L10 B;  4WJO A;  3ZDT A;  2KC1 A;  3MTN B;  3NY5 A;  3TMP B;  1TZ1 A;  2LUE A;  4AOF A;  4DDG D;  4E71 A;  2KWV B;  4EEW A;  3GOE A;  4WJQ A;  3ZW3 A;  3ZNH B;  4TQ0 A;  3SU8 X;  3ZVV A;  3A1Q A;  1Q5W B;  4MH0 E;  2O6V B;  5DCN A;  4IM0 A;  1HE8 A;  3DBS A;  2JXX A;  4KV2 A;  3OJ3 A;  2ASQ A;  2RPQ A;  5DPT A;  4FLH A;  1V5T A;  3A33 B;  1WXM A;  1Y8R C;  3ZKJ C;  3KUD B;  4JLC A;  2GOW A;  3QCA A;  4A3P A;  4LDT B;  5IA7 A;  2DHZ A;  2KVR A;  3QX1 A;  4E74 A;  1ZW7 A;  4A3O A;  4MGZ E;  2FCS A;  4CYE A;  1WH3 A;  1WRD B;  2V4L A;  2GMI C;  2XK5 B;  2ZPN A;  2KFK B;  3H7P B;  3V62 A;  3KUC B;  4W9G A;  3UIP B;  1KM7 A;  3DVN V;  2KD0 A;  3JSV A;  1RFA A;  3L13 A;  4NQK E;  4HDQ A;  4OVU A;  1WXS A;  5LXH A;  3NZS A;  4M8N A;  2L3Z A;  2LXC A;  4W9E A;  2KDB A;  3EFU A;  3TJP A;  2KLC A;  4FUL A;  2AL6 A;  2V3S A;  5AZG A;  3RUI B;  1LXD A;  2KQ7 A;  2C7M B;  2CHW A;  4ZDV A;  3ONS A;  4TUU A;  2K8B A;  3V6C B;  1WJ4 A;  4I6L B;  4RM8 A;  2KMA A;  2N7E A;  2O2V A;  1WX8 A;  2N9X A;  4M0W B;  4MEL A;  1S1Q B;  1IYF A;  1GC7 A;  4ZRK A;  2NR2 A;  2AYO B;  4PYU A;  4BVU C;  3IG3 A;  1V9J A;  3A1Q B;  1GG3 A;  2GBR A;  4GGQ A;  3R7Q A;  4EZK A;  2FCN A;  3ML8 A;  1WXV A;  4N9F 4;  2LVQ A;  3N32 A;  1LFD A;  4WJN A;  2DYB A;  1XQQ A;  4MJS A;  1E8X A;  2XBB C;  1CMX B;  3WAO A;  2HJ8 A;  1E7U A;  1WJ6 A;  3QIJ A;  3CMM B;  4DHZ E;  4DK5 A;  3ZNI D;  1SE9 A;  2M17 A;  2EMS A;  2WDT B;  4DDI D;  1E7V A;  4IM3 A;  5E6P A;  3C0R B;  3PHW B;  4FJZ A;  3U30 A;  3DCG A;  3K9O B;  4BOS C;  3RZF A;  2DYM A;  3QAR A;  1UH6 A;  2L0F A;  1RRB A;  2KZR A;  3L16 A;  4WWN A;  4ZRI A;  4G50 A;  2IO1 B;  4NJ7 A;  2CR5 A;  1Z5S B;  2KHW B;  3ZTD A;  2NBU A;  2L7R A;  1KJT A;  1V86 A;  5AZH A;  1S3S G;  2BF8 B;  2KKC A;  4ICU A;  2K39 A;  4F7Z A;  3H6N A;  1WGG A;  4LDT D;  3UIN B;  3VTW A;  1EF5 A;  2NBW B;  2KFJ A;  4MGI E;  4RM9 A;  3QJZ A;  3QWZ B;  2M4N A;  2KOX A;  3L17 A;  5C23 A;  4GDK A;  4FHJ A;  4FJV B;  4IC7 B;  3PHX B;  1GUA B;  2D10 A;  2O2V B;  3W1S A;  4XC2 A;  1VD2 A;  1UBQ A;  2N9P C;  2LGX A;  3PTF C;  2ZVN A;  5EDS A;  2MLB A;  5AEK B;  1WI0 A;  3V61 A;  1NDD A;  1WF9 A;  4ANW A;  4MGK E;  2I1J A;  2N1V A;  5DPS A;  4BKS A;  4W9C A;  4F8C B;  2BKF A;  2GBJ A;  1QZE A;  1L2N A;  2KLG A;  2W9N A;  4IUM B;  4MEM A;  4MJS B;  1WY8 A;  2NBV B;  4HJK A;  3VH3 B;  2BYE A;  2ZCB A;  3W1Y A;  3R3M A;  3ZNG C;  2JY6 A;  4J6I A;  4FA6 A;  2WX0 A;  2CKH B;  4RMA A;  3APF A;  1YX6 B;  3TCA A;  5DPW A;  4BKG A;  4CHK A;  4GU2 A;  1H8C A;  4ANU A;  4DHZ B;  2M8S A;  2K6Q A;  2FID A;  2LRW A;  1U4A A;  1P3Q U;  3M62 B;  4EUT A;  3EEC A;  1IPG A;  4FBJ B;  4HCP B;  3VFK A;  1WGD A;  2NPT A;  1Q1O A;  3DVN U;  2J7Q B;  4W9J A;  2D07 B;  2JZ3 B;  5CHV C;  3PRZ A;  1SIF A;  4KSL C;  4HXD A;  1P98 A;  2J0M A;  4XZ4 A;  3VHT C;  1UEL A;  2KAN A;  3JVZ X;  4PS3 A;  5DPR A;  2ZPY A;  1Z2M A;  1WJU A;  2KJ6 A;  1E5W A;  3KH0 A;  2N9E B;  3BIN A;  1LQB A;  4MSM B;  3PPA A;  2DYO A;  3OLM D;  3NOB A;  4KVG B;  1C1Y B;  2Z0D B;  4BBN C;  4AJY B;  1H4R A;  2BKR B;  2Z59 B;  1UZX B;  2JUO A;  2KWC A;  2BWF A;  4K81 A;  1UBI A;  2HE7 A;  2LGD A;  2L0T A;  3PS6 A;  2IYD B;  2MW5 A;  3QA8 A;  2NVU I;  2RD0 A;  5D2M B;  2KXJ A;  2N1W A;  4GDL B;  4GMV A;  1WJN A;  2KMC A;  2WX1 A;  3IVF A;  2KO3 A;  2FIF A;  3QAQ A;  4X57 B;  3SDL C;  5E6N A;  3SHQ A;  3T9L A;  5J18 A;  1GJZ A;  2LGY A;  4NJ6 A;  1J0G A;  2HD5 B;  4EFO A;  3QHT A;  4I6N B;  3VUY A;  4HDO A;  3ALB A;  3K9P B;  2KQS A;  2V1Y A;  3WA0 A;  3RT3 B;  3B0A A;  1WX7 A;  1EF1 A;  2C5L C;  2NPT B;  4W9H A;  4PS7 A;  4E3C A;  4XX5 A;  4NPN A;  4KIK A;  3L54 A;  1TBE A;  5C1Z A;  2MX2 A;  3VUW A;  2AWT A;  1AAR A;  2BYV E;  4FHK A;  2LZ6 A;  4HCN B;  3WAL A;  2KK8 A;  1RAX A;  4LJO B;  2KTF A;  4NQL B;  3DVG X;  1WFY A;  4K1R B;  5D94 A;  5GMV A;  3UF8 A;  2MBB B;  4II2 B;  1G6J A;  3OAW A;  2MA9 B;  2L00 B;  2LAS A;  2R2O A;  4A20 A;  1WGR A;  2KTR A;  3VDZ A;  4HVB A;  5LXI B;  4NAW A;  1X1M A;  5JH5 C;  1OTR B;  5CHW A;  2DEN B;  3Q3F A;  4KZC A;  5L83 A;  3AU5 A;  1R4M I;  2BGF A;  4JL9 A;  3ZLZ A;  1GC6 A;  2DZJ A;  3B1L X;  4TKN A;  2AEH A;  2LVP A;  3R66 C;  4KDL B;  1WMH A;  4MSQ B;  5L95 C;  2EKE C;  2NS5 A;  2KWU B;  4K7W A;  2JPH A;  2C60 A;  2M0X A;  2O6V D;  4HLE A;  3TBL D;  4KSK C;  3VXW A;  3KYC D;  3KYD D;  3A9J A;  1M94 A;  1JRU A;  3P2B A;  2KX0 A;  2A5U A;  1OEY A;  4G11 A;  4KDI C;  3SD5 A;  3ZRF A;  3JSV B;  4ASW C;  3W1S C;  2KDE B;  3ML9 A;  4W9K A;  4W9F A;  4AUQ C;  4CO7 A;  1V6E A;  3QC8 B;  1XD3 B;  2MSE D;  2REX A;  4KZ0 A;  3V6E B;  5CTR C;  3WAM A;  4TV3 A;  5TR5 A;  4ZYN A;  3B08 A;  4KIK B;  2MBO A;  4ICV A;  1OGW A;  1YD8 U;  1V5O A;  3PV1 A;  2PPH A;  1J8C A;  3UGB B;  2IY1 B;  3VAW A;  2N4F A;  3X23 A;  1GNU A;  2LVO A;  1A5R A;  2IZV B;  3RZW C;  4WWP A;  4LCD E;  2NCN A;  4F1S A;  3KUZ A;  1BT0 A;  4NY0 A;  2CHZ A;  2K6D B;  2YVC A;  3LJ3 A;  3IBE A;  3S2A A;  3MHS D;  4WAA A;  2D11 A;  2QHO A;  4IWO A;  3UQA A;  2DZK A;  4ANV A;  3ZNZ B;  3AI5 A;  4GXB A;  2DAF A;  1WR1 A;  4M8M A;  1ZKH A;  3WAP A;  1WZ0 A;  2MP2 A;  4GB9 A;  1F9J A;  2J0J A;  3HM3 A;  4DHJ B;  2ZZP B;  3DBR I;  1V2Y A;  3PT2 B;  3T8M A;  5J17 A;  4HPM B;  3CSF A;  3ZTC A;  4GSW A;  3A4S C;  4BFR A;  3U7D A;  1YIW A;  3H7P A;  2JVC A;  1WM3 A;  4JIO U;  5LLI A;  3NZU A;  4NNJ B;  3R7R A;  1K8R B;  2FUH B;  2MBQ A;  1E90 A;  3JW0 X;  4JGH B;  4GN1 A;  1UGM A;  2MRP A;  2OJR A;  3L0W B;  4TQ1 A;  3APD A;  2BWE S;  4GDK B;  4DWF A;  2MBE A;  5CHF A;  2KC2 A;  4B9K A;  4HK2 A;  4PS8 A;  4EZJ A;  4II3 B;  2HTH A;  4BBN F;  2R2Q A;  1E8W A;  2KX3 A;  3O65 B;  3ECI A;  2RSU A;  1MG8 A;  5AZF A;  2G4D B;  2JWZ A;  2KJH B;  2FCQ A;  3A4R A;  2KDF B;  2KDI A;  1ISN A;  1LM8 B;  3M3J A;  4HPL B;  3CF6 E;  5KHQ A;  3DPD A;  3A9K A;  1EO6 A;  2GBN A;  1WYW B;  3H7S A;  4FN2 A;  2UWQ A;  2RGF A;  3X0W A;  3BY4 B;  3HK0 A;  3Q3J A;  4ANX A;  2PE9 A;  3VQI A;  3N3K B;  2C7N B;  3OJ4 B;  4DXA B;  1D3Z A;  2ZJD A;  3AU4 A;  3M95 A;  2LD9 A;  2RR9 A;  2DZM A;  3RYT A;  4K7S A;  5CX3 A;  3PRP B;  2JRI B;  2MP2 B;  4WWO A;  1IP9 A;  2L05 A;  2ZNV B;  4IW0 A;  2LRU A;  1J19 A;  4YL8 A;  4EOY A;  3ZIM A;  1NBF C;  2G45 B;  1ZGU B;  3TL5 A;  1EUV B;  4WQO B;  2CHX A;  2I1K A;  3DDC B;  2LJ5 A;  2JRH A;  1V49 A;  4DBG A;  2PEA A;  4IG7 B;  4MDK E;  2IO2 B;  1I42 A;  3DBH I;  2Y5B B;  3EC8 A;  4MM3 A;  2L76 A;  2M1M A;  1VCB A;  3IHP C;  5HKH A;  2DAJ A;  4FJY A;  3ZRC A;  1RLF A;  4W9D A;  4EKU A;  1E8Y A;  1YJ1 A;  2G4S A;  3LDZ E;  3UQB A;  2IO3 B;  3WIM A;  2LI5 A;  2CU1 A;  4IWP A;  2LWP A;  2C7H A;  2EMT A;  2D3G A;  4DHJ D;  4B6W A;  1P9D U;  1R4N I;  5J2R A;  2L8J A;  2DX5 B;  3RD2 A;  3KVF B;  2D2Q A;  2J0K A;  1V80 A;  2CS4 A;  4I6P A;  2OOB B;  1WGY A;  4P7I A;  3UIO B;  2Z0E B;  1P0R A;  3A9K B;  3DOW A;  5E6O A;  1TGZ B;  3ZO5 B;  4HWI B;  2ZCC A;  2KN5 A;  3U8Z A;  2UYZ B;  1WIA A;  4MGY E;  4OVV A;  1WXA A;  2K8C A;  4ZRJ A;  1WGH A;  3VTU A;  2K25 A;  3KW5 B;  2JZZ A;  2KNB A;  1Q0W B;  2XEW A;  3EHV A;  2BPS A;  3HIZ A;  4PYZ A;  2G3Q B;  1L7Y A;  2VRR B;  2PE6 B;  1WR6 E;  3D32 A;  1TTN A;  2IO0 B;  5G55 A;  2MCN B;  3L08 A;  5JZE B;  2IBI B;  2C9W B;  3V60 A;  4BOZ B;  2A4Z A;  3TIX A;  2JT4 B;  2WYQ A;  3GZN I;  1WE7 A;  1WE6 A;  3VVW B;  4BKS D;  1V81 A;  2K8H A;  1C3T A;  1YX5 B;  2N7D A;  4IWQ A;  3VTV A;  1KLV A;  3PLV A;  3PRM B;  4K7U A;  2GBK A;  1FXT B;  2B3A A;  4B95 A;  3HM6 X;  3VUX A;  2O6V A;  3NHE B;  2KTR B;  2ZNV C;  3APC A;  4IM2 A;  1WM2 A;  2MQJ A;  1WX9 A;  1SGH A;  1YQB A;  3I3T B;  3QQ8 B;  4NAW B;  3ZDM C;  3PSE B;  4W9I A;  1T0Y A;  3JYU A;  3MJW A;  3PVL A;  2FCM A;  1PQS A;  5D7G A;  4G0N B;  2IY0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...