3DPOA

Crystal structure of the substrate binding domain of e. coli dnak in complex with a short pyrrhocoricin-derived inhibitor peptide
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
213
structure length
213
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein dnaK
publication title Allosteric coupling between the lid and interdomain linker in DnaK revealed by inhibitor binding studies
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone, peptide binding protein
total genus 62
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3dpoA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 3dpoA01
4JNEA 4EZWA 4F00A 3DPQA 4JN4A 2KHOA 4R5GA 1Q5LA 3L3OM 1DKZA 3DPOA 1DG4A 4EZPA 3H0XA 4R5IA 4EZYA 1YUWA 4JWEA 3N8EA 3T4AG 4FL9A 5E84A 3DQGA 4JWIA 4R5KA 1BPRA 3DPPA 4EZQA 2WINM 3T49A 3T48A 4EZTA 2QXLA 4F01A 4EZRA 1DKYA 2V7YA 3T47A 4HY9A 4R5LA 4R5JA 3QNJA 4E81A 4JWDA 2OP6A 4EZOA 4EZNA 4EZZA 1DKXA 2QFFA 3DOBA 4EZVA 4WV5A 1CKRA 5TKYA 3D2FA 4H6IA 3T46A 4H6HA 4HYBA 4B9QA 4EZUA 4EZXA 4EZSA 2BPRA 7HSCA 4JNFA 3C7NA 4JWCA 3OHXM 4PO2A 4WV7A 1U00A 3D2EA 3C7NB
chains in the Genus database with same CATH superfamily
1LQ7A 2PMRA 2KHOA 2YIVX 3CZSA 2PY6A 1GN9A 5KBPA 1R33A 2EX3B 3F7WA 3EJRA 2X5CA 4R5KA 4IM2A 3T49A 2RAKA 3L3PA 3QA8A 2F7OA 2MI7A 4JWDA 2OW6A 1DKXA 3KAWA 1TQTA 3D2FA 4E3CA 3D4ZA 2YL8A 3L3OM 1DG4A 4I43A 4JL9A 3D50A 2V7YA 2YLAA 4R5LA 2OBMA 3DDGA 4WV7A 2YI9A 2JNKA 2GF4A 1R34A 3DQGA 2LM0A 4IM0A 1TQSA 3B51X 2F7PA 1PS3A 5TKYA 3BUQA 3BVTA 3Q84A 4HYBA 1HTYA 7HSCA 3ABHA 3OHXM 2BPRA 3I39X 3EJTA 3I2WA 3KDRA 3DPQA 4JN4A 2Q12A 4D8JA 2RAJA 2WYHA 4R5IA 4IM3A 4FZSA 3SOGA 1OAOA 2GA9D 2WINM 4M0MA 3RPMA 3SBTB 2FYVA 2RT6A 5FIGA 3I01A 4H8SA 2D4CA 3PLTA 3LLLA 3C7NA 1JQKA 2Z0OA 2X3XA 4F00A 3VKHA 2LXYA 1WDZA 4IWQA 4KIKA 4AZIA 1HXKA 3N8EA 4IW0A 3DDFA 2OBLA 4EZZA 3DOBA 4WV5A 3SBSA 3FD9A 1QWNA 3I04A 3H0XA 4AZ7A 2RAIA 3A98A 4IWOA 1SU7A 3C7NB 1Q5LA 2YLLA 4KIKB 4AZGA 3CVRA 3EJSA 1ZWWA 4UDYX 1OA0A 3O3NB 3ZEFA 1URUA 3RV1A 1GNTA 2EFKA 4EZOA 2QFFA 1I4TA 3SYVA 3CAZA 4EZSA 3LMFA 5C5BA 4JWEA 3DX3A 1QWUA 3T48A 3T47A 3QNJA 2YL5A 3OK8A 4AZBA 1CKRA 3VEAA 3T46A 4JNFA 3ACOA 2YL9A 1DKZA 4EZPA 3ER8C 1W9MA 3T4AG 4FL9A 2V0OA 4JWIA 3O3OB 1O7DC 4EZQA 4EZRA 2GAFD 4AKVA 1Y2OA 4ILIA 2X3WA 3BVXA 4H6HA 4EZXA 2Z0VA 4JNEA 1X03A 4R5GA 3UITA 4JLCA 2QKWA 2O0I1 2ELBA 3G9GA 1BPRA 3B52X 4BNEA 3ER9B 4HY9A 2ALWA 3HAJA 2NCZA 3DX2A 4H6IA 1UPXA 2WYIA 4HR1A 4JWCA 1SU8A 3DPOA 2N3KA 2Z8YA 2OZNB 1ZYLA 2Q13A 2F18A 3BVWA 3QNIA 1DKYA 4DCNC 3B53X 4NPHA 2YKTA 1E9VA 3ERCC 2ND0A 2OW7A 2OO2A 1E1DA 3D52A 3QWEA 4EZYA 2Z0NA 3DX1A 2FICA 3DPPA 4F01A 1YWMA 3HAIA 4NSWA 4R5JA 2ZXQA 3CZNA 4ILGA 1GNLA 3EJPA 4AZCA 4EZNA 1TQVA 3EJUA 4UDXX 4B9QA 1X04A 2F1BA 2F7RA 2EWFA 4HR1B 3BUIA 4IWPA 3BVVA 1I4LA 1TQUA 1YUWA 3BUBA 3D4YA 5E84A 4WPCA 1I4DA 4AZ6A 3KAVA 3CV5A 3D51A 3EJQA 3RV0A 4E81A 4FZOA 2EFLA 3O3MB 4NQIA 3DX4A 4FZPA 1SU6A 2F7QA 1TQWA 4AVMA 1I49A 1O7DB 1R5EA 3ZEDA 1HWWA 4AZCB 3BVUA 2ND1A 3LVTA 1U00A 5C5BB 4AZ5A 3HAHA 2YL6A 4ILHB 4MQDA 4ATMA 4AZHA 2YIAA 1SUFA 4DYLA 3BLBA 4EZTA 2X3VA 2QXLA 4EZVA 2C08A 2JNSA 4WPEA 1E2UA 4FM3A 1OA1A 4PO2A 3VEBA 3QE6A 4EZWA 2YIBA 2YI8A 3OWGA 5FLEX 1QX1A 3BUPA 4I1QA 3GI7A 3BUDA 3DX0A 3Q0KA 2F1AA 2D1LA 2OP6A 4G6QA 1MJGA 3M3WA 4EZUA 3DYTA 3D2EA 3CKDA
chains in the Genus database with same CATH topology
4HR1B 4F00A 3VKHA 2KHOA 4IWPA 4IWQA 4KIKA 1DKZA 4EZPA 2YIVX 3ER8C 2PY6A 1YUWA 1GN9A 3F7WA 2EX3B 1W9MA 3T4AG 3N8EA 4FL9A 5E84A 4JWIA 2X5CA 4R5KA 3O3OB 4EZQA 4IM2A 3T49A 4EZRA 4IW0A 2GAFD 3KAVA 2OBLA 3QA8A 4ILIA 3RV0A 4E81A 4JWDA 4EZZA 1DKXA 3DOBA 4WV5A 3KAWA 3D2FA 3O3MB 4E3CA 4H6HA 4EZXA 3SBSA 4JNEA 3FD9A 4R5GA 3UITA 4JLCA 3I04A 3L3OM 1DG4A 3H0XA 1SU6A 1BPRA 4I43A 4JL9A 3B52X 2V7YA 3ZEDA 4HY9A 3ER9B 4R5LA 3A98A 2NCZA 2OBMA 4IWOA 4H6IA 1UPXA 4WV7A 4HR1A 4JWCA 2ND1A 1SU7A 1SU8A 1U00A 3C7NB 2YI9A 1Q5LA 3DPOA 2N3KA 2Z8YA 4KIKB 1ZYLA 4ILHB 4MQDA 3DQGA 2LM0A 2YIAA 1SUFA 4IM0A 4EZTA 2QXLA 3B51X 1OA0A 3O3NB 1DKYA 4UDYX 3ZEFA 3RV1A 1GNTA 4EZOA 3B53X 2QFFA 4EZVA 2JNSA 5TKYA 4NPHA 1E2UA 4FM3A 1E9VA 4HYBA 4EZSA 1OA1A 3LMFA 7HSCA 4PO2A 2ND0A 3ERCC 3OHXM 2BPRA 3VEBA 3I39X 3KDRA 4EZWA 3DPQA 4JN4A 2YIBA 1E1DA 2YI8A 4D8JA 3OWGA 4R5IA 4EZYA 4IM3A 5FLEX 4JWEA 1JQKA 1OAOA 3GI7A 3DPPA 2GA9D 2WINM 3T48A 4M0MA 4F01A 3SBTB 2RT6A 5FIGA 3I01A 3T47A 4R5JA 3QNJA 2OP6A 4G6QA 4ILGA 1GNLA 4EZNA 1CKRA 1MJGA 4UDXX 3VEAA 3T46A 4B9QA 4EZUA 4JNFA 3C7NA 2EWFA 3D2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JNE A;  4EZW A;  4F00 A;  3DPQ A;  4JN4 A;  2KHO A;  4R5G A;  1Q5L A;  3L3O M;  1DKZ A;  3DPO A;  1DG4 A;  4EZP A;  3H0X A;  4R5I A;  4EZY A;  1YUW A;  4JWE A;  3N8E A;  3T4A G;  4FL9 A;  5E84 A;  3DQG A;  4JWI A;  4R5K A;  1BPR A;  3DPP A;  4EZQ A;  2WIN M;  3T49 A;  3T48 A;  4EZT A;  2QXL A;  4F01 A;  4EZR A;  1DKY A;  2V7Y A;  3T47 A;  4HY9 A;  4R5L A;  4R5J A;  3QNJ A;  4E81 A;  4JWD A;  2OP6 A;  4EZO A;  4EZN A;  4EZZ A;  1DKX A;  2QFF A;  3DOB A;  4EZV A;  4WV5 A;  1CKR A;  5TKY A;  3D2F A;  4H6I A;  3T46 A;  4H6H A;  4HYB A;  4B9Q A;  4EZU A;  4EZX A;  4EZS A;  2BPR A;  7HSC A;  4JNF A;  3C7N A;  4JWC A;  3OHX M;  4PO2 A;  4WV7 A;  1U00 A;  3D2E A;  3C7N B; 
#chains in the Genus database with same CATH topology
 1LQ7 A;  2PMR A;  2KHO A;  2YIV X;  3CZS A;  2PY6 A;  1GN9 A;  5KBP A;  1R33 A;  2EX3 B;  3F7W A;  3EJR A;  2X5C A;  4R5K A;  4IM2 A;  3T49 A;  2RAK A;  3L3P A;  3QA8 A;  2F7O A;  2MI7 A;  4JWD A;  2OW6 A;  1DKX A;  3KAW A;  1TQT A;  3D2F A;  4E3C A;  3D4Z A;  2YL8 A;  3L3O M;  1DG4 A;  4I43 A;  4JL9 A;  3D50 A;  2V7Y A;  2YLA A;  4R5L A;  2OBM A;  3DDG A;  4WV7 A;  2YI9 A;  2JNK A;  2GF4 A;  1R34 A;  3DQG A;  2LM0 A;  4IM0 A;  1TQS A;  3B51 X;  2F7P A;  1PS3 A;  5TKY A;  3BUQ A;  3BVT A;  3Q84 A;  4HYB A;  1HTY A;  7HSC A;  3ABH A;  3OHX M;  2BPR A;  3I39 X;  3EJT A;  3I2W A;  3KDR A;  3DPQ A;  4JN4 A;  2Q12 A;  4D8J A;  2RAJ A;  2WYH A;  4R5I A;  4IM3 A;  4FZS A;  3SOG A;  1OAO A;  2GA9 D;  2WIN M;  4M0M A;  3RPM A;  3SBT B;  2FYV A;  2RT6 A;  5FIG A;  3I01 A;  4H8S A;  2D4C A;  3PLT A;  3LLL A;  3C7N A;  1JQK A;  2Z0O A;  2X3X A;  4F00 A;  3VKH A;  2LXY A;  1WDZ A;  4IWQ A;  4KIK A;  4AZI A;  1HXK A;  3N8E A;  4IW0 A;  3DDF A;  2OBL A;  4EZZ A;  3DOB A;  4WV5 A;  3SBS A;  3FD9 A;  1QWN A;  3I04 A;  3H0X A;  4AZ7 A;  2RAI A;  3A98 A;  4IWO A;  1SU7 A;  3C7N B;  1Q5L A;  2YLL A;  4KIK B;  4AZG A;  3CVR A;  3EJS A;  1ZWW A;  4UDY X;  1OA0 A;  3O3N B;  3ZEF A;  1URU A;  3RV1 A;  1GNT A;  2EFK A;  4EZO A;  2QFF A;  1I4T A;  3SYV A;  3CAZ A;  4EZS A;  3LMF A;  5C5B A;  4JWE A;  3DX3 A;  1QWU A;  3T48 A;  3T47 A;  3QNJ A;  2YL5 A;  3OK8 A;  4AZB A;  1CKR A;  3VEA A;  3T46 A;  4JNF A;  3ACO A;  2YL9 A;  1DKZ A;  4EZP A;  3ER8 C;  1W9M A;  3T4A G;  4FL9 A;  2V0O A;  4JWI A;  3O3O B;  1O7D C;  4EZQ A;  4EZR A;  2GAF D;  4AKV A;  1Y2O A;  4ILI A;  2X3W A;  3BVX A;  4H6H A;  4EZX A;  2Z0V A;  4JNE A;  1X03 A;  4R5G A;  3UIT A;  4JLC A;  2QKW A;  2O0I 1;  2ELB A;  3G9G A;  1BPR A;  3B52 X;  4BNE A;  3ER9 B;  4HY9 A;  2ALW A;  3HAJ A;  2NCZ A;  3DX2 A;  4H6I A;  1UPX A;  2WYI A;  4HR1 A;  4JWC A;  1SU8 A;  3DPO A;  2N3K A;  2Z8Y A;  2OZN B;  1ZYL A;  2Q13 A;  2F18 A;  3BVW A;  3QNI A;  1DKY A;  4DCN C;  3B53 X;  4NPH A;  2YKT A;  1E9V A;  3ERC C;  2ND0 A;  2OW7 A;  2OO2 A;  1E1D A;  3D52 A;  3QWE A;  4EZY A;  2Z0N A;  3DX1 A;  2FIC A;  3DPP A;  4F01 A;  1YWM A;  3HAI A;  4NSW A;  4R5J A;  2ZXQ A;  3CZN A;  4ILG A;  1GNL A;  3EJP A;  4AZC A;  4EZN A;  1TQV A;  3EJU A;  4UDX X;  4B9Q A;  1X04 A;  2F1B A;  2F7R A;  2EWF A;  4HR1 B;  3BUI A;  4IWP A;  3BVV A;  1I4L A;  1TQU A;  1YUW A;  3BUB A;  3D4Y A;  5E84 A;  4WPC A;  1I4D A;  4AZ6 A;  3KAV A;  3CV5 A;  3D51 A;  3EJQ A;  3RV0 A;  4E81 A;  4FZO A;  2EFL A;  3O3M B;  4NQI A;  3DX4 A;  4FZP A;  1SU6 A;  2F7Q A;  1TQW A;  4AVM A;  1I49 A;  1O7D B;  1R5E A;  3ZED A;  1HWW A;  4AZC B;  3BVU A;  2ND1 A;  3LVT A;  1U00 A;  5C5B B;  4AZ5 A;  3HAH A;  2YL6 A;  4ILH B;  4MQD A;  4ATM A;  4AZH A;  2YIA A;  1SUF A;  4DYL A;  3BLB A;  4EZT A;  2X3V A;  2QXL A;  4EZV A;  2C08 A;  2JNS A;  4WPE A;  1E2U A;  4FM3 A;  1OA1 A;  4PO2 A;  3VEB A;  3QE6 A;  4EZW A;  2YIB A;  2YI8 A;  3OWG A;  5FLE X;  1QX1 A;  3BUP A;  4I1Q A;  3GI7 A;  3BUD A;  3DX0 A;  3Q0K A;  2F1A A;  2D1L A;  2OP6 A;  4G6Q A;  1MJG A;  3M3W A;  4EZU A;  3DYT A;  3D2E A;  3CKD A; 
#chains in the Genus database with same CATH homology
 4HR1 B;  4F00 A;  3VKH A;  2KHO A;  4IWP A;  4IWQ A;  4KIK A;  1DKZ A;  4EZP A;  2YIV X;  3ER8 C;  2PY6 A;  1YUW A;  1GN9 A;  3F7W A;  2EX3 B;  1W9M A;  3T4A G;  3N8E A;  4FL9 A;  5E84 A;  4JWI A;  2X5C A;  4R5K A;  3O3O B;  4EZQ A;  4IM2 A;  3T49 A;  4EZR A;  4IW0 A;  2GAF D;  3KAV A;  2OBL A;  3QA8 A;  4ILI A;  3RV0 A;  4E81 A;  4JWD A;  4EZZ A;  1DKX A;  3DOB A;  4WV5 A;  3KAW A;  3D2F A;  3O3M B;  4E3C A;  4H6H A;  4EZX A;  3SBS A;  4JNE A;  3FD9 A;  4R5G A;  3UIT A;  4JLC A;  3I04 A;  3L3O M;  1DG4 A;  3H0X A;  1SU6 A;  1BPR A;  4I43 A;  4JL9 A;  3B52 X;  2V7Y A;  3ZED A;  4HY9 A;  3ER9 B;  4R5L A;  3A98 A;  2NCZ A;  2OBM A;  4IWO A;  4H6I A;  1UPX A;  4WV7 A;  4HR1 A;  4JWC A;  2ND1 A;  1SU7 A;  1SU8 A;  1U00 A;  3C7N B;  2YI9 A;  1Q5L A;  3DPO A;  2N3K A;  2Z8Y A;  4KIK B;  1ZYL A;  4ILH B;  4MQD A;  3DQG A;  2LM0 A;  2YIA A;  1SUF A;  4IM0 A;  4EZT A;  2QXL A;  3B51 X;  1OA0 A;  3O3N B;  1DKY A;  4UDY X;  3ZEF A;  3RV1 A;  1GNT A;  4EZO A;  3B53 X;  2QFF A;  4EZV A;  2JNS A;  5TKY A;  4NPH A;  1E2U A;  4FM3 A;  1E9V A;  4HYB A;  4EZS A;  1OA1 A;  3LMF A;  7HSC A;  4PO2 A;  2ND0 A;  3ERC C;  3OHX M;  2BPR A;  3VEB A;  3I39 X;  3KDR A;  4EZW A;  3DPQ A;  4JN4 A;  2YIB A;  1E1D A;  2YI8 A;  4D8J A;  3OWG A;  4R5I A;  4EZY A;  4IM3 A;  5FLE X;  4JWE A;  1JQK A;  1OAO A;  3GI7 A;  3DPP A;  2GA9 D;  2WIN M;  3T48 A;  4M0M A;  4F01 A;  3SBT B;  2RT6 A;  5FIG A;  3I01 A;  3T47 A;  4R5J A;  3QNJ A;  2OP6 A;  4G6Q A;  4ILG A;  1GNL A;  4EZN A;  1CKR A;  1MJG A;  4UDX X;  3VEA A;  3T46 A;  4B9Q A;  4EZU A;  4JNF A;  3C7N A;  2EWF A;  3D2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...