3DPPA

Crystal structure of the substrate binding domain of e. coli dnak in complex with a long pyrrhocoricin-derived inhibitor peptide (form a)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein dnaK
publication title Allosteric coupling between the lid and interdomain linker in DnaK revealed by inhibitor binding studies.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone, peptide binding protein
total genus 55
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3dppA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 3dppA01
4HYBA 3DPOA 4PO2A 2V7YA 4E81A 2QFFA 1DKYA 4EZUA 5TKYA 4F00A 3DPPA 2WINM 1CKRA 4R5IA 1U00A 4H6HA 4HY9A 5E84A 3T46A 4EZOA 4EZVA 3N8EA 7HSCA 4EZNA 3DPQA 3T4AG 1Q5LA 4FL9A 3T49A 4F01A 4EZQA 4JNFA 4EZSA 1BPRA 3DOBA 4B9QA 4EZZA 3DQGA 3H0XA 4WV7A 4H6IA 4EZPA 4R5GA 2QXLA 4JWIA 4EZYA 3C7NA 3OHXM 4JWDA 4R5KA 4JWCA 1YUWA 4JNEA 4EZTA 3C7NB 1DKZA 3QNJA 4EZXA 4R5LA 3L3OM 3D2EA 3D2FA 4WV5A 1DKXA 4JN4A 2KHOA 3T47A 2OP6A 3T48A 1DG4A 2BPRA 4EZWA 4EZRA 4JWEA 4R5JA
chains in the Genus database with same CATH superfamily
3FD9A 1SU8A 3KDRA 4KIKA 2OW6A 4AKVA 2YI9A 7HSCA 3BUPA 2GF4A 2F7RA 4I43A 3I2WA 4R5KA 1DKZA 3I01A 4AZ5A 4H8SA 3RV1A 2FICA 1DG4A 4R5JA 4G6QA 3PLTA 5TKYA 3VEAA 3QE6A 3SBSA 4AZ7A 1R34A 2OO2A 4EZNA 3LVTA 4JNFA 2YI8A 3BVWA 4H6IA 4R5GA 4EZYA 1I4DA 2X5CA 1E2UA 4WV5A 4IM3A 1WDZA 2OP6A 4EZRA 3SYVA 3OWGA 3KAWA 2JNSA 3ERCC 4UDXX 5E84A 2EFLA 4F01A 3O3OB 4AVMA 3EJQA 3M3WA 3Q84A 3CV5A 2OBLA 4AZ6A 4JN4A 2KHOA 3ER8C 1HWWA 3CZNA 4ATMA 3ZEFA 4EZUA 3DX1A 1OAOA 3T46A 2N3KA 3UITA 4B9QA 4EZZA 4WV7A 3H0XA 2X3VA 2Q12A 3LMFA 3A98A 5KBPA 2F1AA 2YIAA 2BPRA 1CKRA 4AZIA 4IWOA 2OZNB 4NSWA 2EWFA 3CKDA 4IWPA 1W9MA 4AZCA 3DDGA 3GI7A 2F7OA 5FIGA 1PS3A 2FYVA 1I4TA 2F18A 4JWCA 4JL9A 3KAVA 2Z0NA 1LQ7A 5C5BB 4WPCA 1I49A 2RT6A 4I1QA 1GNLA 2V7YA 1DKYA 2RAKA 1R5EA 3F7WA 3RPMA 4HY9A 2F7QA 4FL9A 3T49A 3DX3A 1ZWWA 2F1BA 3ZEDA 2QXLA 3EJTA 4AZBA 3DYTA 3D51A 4AZGA 3O3NB 3DX2A 2MI7A 1OA1A 2D1LA 1ZYLA 1UPXA 2EFKA 2YLLA 4ILIA 2YIVX 3I39X 3CVRA 3D4ZA 3DPPA 2PMRA 2Z0VA 4KIKB 2ALWA 3N8EA 4FM3A 3ACOA 3DPQA 2X3WA 1QX1A 3DOBA 4IW0A 3G9GA 4JWIA 4JLCA 4EZTA 2WYIA 3D2FA 3BLBA 3T48A 4PO2A 3DX0A 2NCZA 4EZSA 1YWMA 3BVVA 3C7NB 1I4LA 4EZWA 1HXKA 4BNEA 1GNTA 4IWQA 2RAIA 4H6HA 3O3MB 1TQUA 1X04A 2YL9A 1Q5LA 1SU7A 3I04A 5FLEX 2PY6A 2OW7A 1GN9A 3D4YA 2YL5A 2YKTA 4FZPA 4ILGA 1MJGA 4FZSA 3SOGA 1O7DB 3BUIA 5C5BA 3QNJA 2LM0A 2Z0OA 3HAIA 3HAHA 1SUFA 1TQSA 4NQIA 3EJUA 3B51X 4R5IA 2EX3B 4AZCB 4ILHB 2O0I1 4EZQA 2WYHA 4HR1B 1YUWA 1E9VA 4IM0A 1QWNA 3DPOA 4AZHA 3B53X 4D8JA 4EZOA 3D52A 3T4AG 3Q0KA 2OBMA 3BUDA 3OHXM 2YL6A 1O7DC 2RAJA 2LXYA 1TQWA 2ZXQA 3BVXA 3DX4A 1DKXA 3T47A 2GA9D 3L3PA 4HYBA 4UDYX 2X3XA 1Y2OA 2WINM 4NPHA 4MQDA 3BUQA 4EZVA 2JNKA 1SU6A 1TQTA 2YIBA 3ABHA 3EJPA 4EZPA 3C7NA 4JWDA 4JNEA 4EZXA 3L3OM 3D2EA 3BVTA 2ND0A 3SBTB 4E81A 2QFFA 4FZOA 4E3CA 2V0OA 1JQKA 3EJSA 2YLAA 1QWUA 2GAFD 2Z8YA 3EJRA 3HAJA 1TQVA 4R5LA 2YL8A 1R33A 3DDFA 3RV0A 4DCNC 3QA8A 2D4CA 3B52X 4WPEA 3DQGA 3QNIA 3LLLA 2Q13A 2ELBA 3BUBA 1E1DA 3BVUA 3QWEA 3CAZA 4F00A 3VEBA 1U00A 3CZSA 4M0MA 1OA0A 3VKHA 4IM2A 1X03A 3OK8A 2F7PA 2C08A 1BPRA 4HR1A 4DYLA 2QKWA 1URUA 1HTYA 3D50A 3ER9B 2ND1A 4JWEA
chains in the Genus database with same CATH topology
4HYBA 4UDYX 3FD9A 2EWFA 1GNTA 1SU8A 2WINM 3KDRA 4IWQA 4IWPA 1W9MA 4NPHA 4KIKA 4MQDA 4H6HA 2YI9A 3GI7A 7HSCA 3O3MB 4EZVA 5FIGA 1Q5LA 1SU6A 1SU7A 2YIBA 3I04A 5FLEX 2PY6A 4I43A 4EZPA 3C7NA 4JWDA 4R5KA 4JWCA 4JNEA 1DKZA 4EZXA 4JL9A 3I01A 3KAVA 3L3OM 3D2EA 3RV1A 1GN9A 2RT6A 1DG4A 2ND0A 1GNLA 4R5JA 4G6QA 2V7YA 3SBTB 4E81A 2QFFA 1DKYA 5TKYA 4E3CA 1JQKA 3F7WA 3VEAA 4HY9A 3SBSA 4EZNA 4ILGA 2GAFD 1MJGA 3T49A 4FL9A 4JNFA 2YI8A 4H6IA 3ZEDA 2Z8YA 4R5GA 2QXLA 4EZYA 3QNJA 2LM0A 3O3NB 4R5LA 2X5CA 1E2UA 1OA1A 4WV5A 4IM3A 2OP6A 1ZYLA 1UPXA 4EZRA 3OWGA 3KAWA 2JNSA 4ILIA 2YIVX 3I39X 3RV0A 1SUFA 3DPPA 1CKRA 3B51X 3QA8A 4R5IA 3ERCC 2EX3B 4KIKB 4UDXX 5E84A 4FM3A 3N8EA 3B52X 3DPQA 4ILHB 4F01A 4EZQA 3DOBA 3DQGA 3O3OB 4IW0A 4JWIA 4JLCA 4HR1B 1YUWA 4EZTA 2OBLA 3D2FA 4JN4A 1E1DA 2KHOA 3ER8C 1E9VA 3T48A 4IM0A 4PO2A 3DPOA 3ZEFA 4EZUA 3B53X 4F00A 3VEBA 1OAOA 1U00A 4D8JA 2BPRA 3T46A 4EZOA 2N3KA 2NCZA 1OA0A 4M0MA 3VKHA 4IM2A 3T4AG 4JWEA 3UITA 4EZSA 1BPRA 4B9QA 4EZZA 4WV7A 3H0XA 3LMFA 4HR1A 3A98A 3OHXM 3C7NB 1DKXA 2YIAA 3T47A 3ER9B 2GA9D 4EZWA 2ND1A 2OBMA 4IWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYB A;  3DPO A;  4PO2 A;  2V7Y A;  4E81 A;  2QFF A;  1DKY A;  4EZU A;  5TKY A;  4F00 A;  3DPP A;  2WIN M;  1CKR A;  4R5I A;  1U00 A;  4H6H A;  4HY9 A;  5E84 A;  3T46 A;  4EZO A;  4EZV A;  3N8E A;  7HSC A;  4EZN A;  3DPQ A;  3T4A G;  1Q5L A;  4FL9 A;  3T49 A;  4F01 A;  4EZQ A;  4JNF A;  4EZS A;  1BPR A;  3DOB A;  4B9Q A;  4EZZ A;  3DQG A;  3H0X A;  4WV7 A;  4H6I A;  4EZP A;  4R5G A;  2QXL A;  4JWI A;  4EZY A;  3C7N A;  3OHX M;  4JWD A;  4R5K A;  4JWC A;  1YUW A;  4JNE A;  4EZT A;  3C7N B;  1DKZ A;  3QNJ A;  4EZX A;  4R5L A;  3L3O M;  3D2E A;  3D2F A;  4WV5 A;  1DKX A;  4JN4 A;  2KHO A;  3T47 A;  2OP6 A;  3T48 A;  1DG4 A;  2BPR A;  4EZW A;  4EZR A;  4JWE A;  4R5J A; 
#chains in the Genus database with same CATH topology
 3FD9 A;  1SU8 A;  3KDR A;  4KIK A;  2OW6 A;  4AKV A;  2YI9 A;  7HSC A;  3BUP A;  2GF4 A;  2F7R A;  4I43 A;  3I2W A;  4R5K A;  1DKZ A;  3I01 A;  4AZ5 A;  4H8S A;  3RV1 A;  2FIC A;  1DG4 A;  4R5J A;  4G6Q A;  3PLT A;  5TKY A;  3VEA A;  3QE6 A;  3SBS A;  4AZ7 A;  1R34 A;  2OO2 A;  4EZN A;  3LVT A;  4JNF A;  2YI8 A;  3BVW A;  4H6I A;  4R5G A;  4EZY A;  1I4D A;  2X5C A;  1E2U A;  4WV5 A;  4IM3 A;  1WDZ A;  2OP6 A;  4EZR A;  3SYV A;  3OWG A;  3KAW A;  2JNS A;  3ERC C;  4UDX X;  5E84 A;  2EFL A;  4F01 A;  3O3O B;  4AVM A;  3EJQ A;  3M3W A;  3Q84 A;  3CV5 A;  2OBL A;  4AZ6 A;  4JN4 A;  2KHO A;  3ER8 C;  1HWW A;  3CZN A;  4ATM A;  3ZEF A;  4EZU A;  3DX1 A;  1OAO A;  3T46 A;  2N3K A;  3UIT A;  4B9Q A;  4EZZ A;  4WV7 A;  3H0X A;  2X3V A;  2Q12 A;  3LMF A;  3A98 A;  5KBP A;  2F1A A;  2YIA A;  2BPR A;  1CKR A;  4AZI A;  4IWO A;  2OZN B;  4NSW A;  2EWF A;  3CKD A;  4IWP A;  1W9M A;  4AZC A;  3DDG A;  3GI7 A;  2F7O A;  5FIG A;  1PS3 A;  2FYV A;  1I4T A;  2F18 A;  4JWC A;  4JL9 A;  3KAV A;  2Z0N A;  1LQ7 A;  5C5B B;  4WPC A;  1I49 A;  2RT6 A;  4I1Q A;  1GNL A;  2V7Y A;  1DKY A;  2RAK A;  1R5E A;  3F7W A;  3RPM A;  4HY9 A;  2F7Q A;  4FL9 A;  3T49 A;  3DX3 A;  1ZWW A;  2F1B A;  3ZED A;  2QXL A;  3EJT A;  4AZB A;  3DYT A;  3D51 A;  4AZG A;  3O3N B;  3DX2 A;  2MI7 A;  1OA1 A;  2D1L A;  1ZYL A;  1UPX A;  2EFK A;  2YLL A;  4ILI A;  2YIV X;  3I39 X;  3CVR A;  3D4Z A;  3DPP A;  2PMR A;  2Z0V A;  4KIK B;  2ALW A;  3N8E A;  4FM3 A;  3ACO A;  3DPQ A;  2X3W A;  1QX1 A;  3DOB A;  4IW0 A;  3G9G A;  4JWI A;  4JLC A;  4EZT A;  2WYI A;  3D2F A;  3BLB A;  3T48 A;  4PO2 A;  3DX0 A;  2NCZ A;  4EZS A;  1YWM A;  3BVV A;  3C7N B;  1I4L A;  4EZW A;  1HXK A;  4BNE A;  1GNT A;  4IWQ A;  2RAI A;  4H6H A;  3O3M B;  1TQU A;  1X04 A;  2YL9 A;  1Q5L A;  1SU7 A;  3I04 A;  5FLE X;  2PY6 A;  2OW7 A;  1GN9 A;  3D4Y A;  2YL5 A;  2YKT A;  4FZP A;  4ILG A;  1MJG A;  4FZS A;  3SOG A;  1O7D B;  3BUI A;  5C5B A;  3QNJ A;  2LM0 A;  2Z0O A;  3HAI A;  3HAH A;  1SUF A;  1TQS A;  4NQI A;  3EJU A;  3B51 X;  4R5I A;  2EX3 B;  4AZC B;  4ILH B;  2O0I 1;  4EZQ A;  2WYH A;  4HR1 B;  1YUW A;  1E9V A;  4IM0 A;  1QWN A;  3DPO A;  4AZH A;  3B53 X;  4D8J A;  4EZO A;  3D52 A;  3T4A G;  3Q0K A;  2OBM A;  3BUD A;  3OHX M;  2YL6 A;  1O7D C;  2RAJ A;  2LXY A;  1TQW A;  2ZXQ A;  3BVX A;  3DX4 A;  1DKX A;  3T47 A;  2GA9 D;  3L3P A;  4HYB A;  4UDY X;  2X3X A;  1Y2O A;  2WIN M;  4NPH A;  4MQD A;  3BUQ A;  4EZV A;  2JNK A;  1SU6 A;  1TQT A;  2YIB A;  3ABH A;  3EJP A;  4EZP A;  3C7N A;  4JWD A;  4JNE A;  4EZX A;  3L3O M;  3D2E A;  3BVT A;  2ND0 A;  3SBT B;  4E81 A;  2QFF A;  4FZO A;  4E3C A;  2V0O A;  1JQK A;  3EJS A;  2YLA A;  1QWU A;  2GAF D;  2Z8Y A;  3EJR A;  3HAJ A;  1TQV A;  4R5L A;  2YL8 A;  1R33 A;  3DDF A;  3RV0 A;  4DCN C;  3QA8 A;  2D4C A;  3B52 X;  4WPE A;  3DQG A;  3QNI A;  3LLL A;  2Q13 A;  2ELB A;  3BUB A;  1E1D A;  3BVU A;  3QWE A;  3CAZ A;  4F00 A;  3VEB A;  1U00 A;  3CZS A;  4M0M A;  1OA0 A;  3VKH A;  4IM2 A;  1X03 A;  3OK8 A;  2F7P A;  2C08 A;  1BPR A;  4HR1 A;  4DYL A;  2QKW A;  1URU A;  1HTY A;  3D50 A;  3ER9 B;  2ND1 A;  4JWE A; 
#chains in the Genus database with same CATH homology
 4HYB A;  4UDY X;  3FD9 A;  2EWF A;  1GNT A;  1SU8 A;  2WIN M;  3KDR A;  4IWQ A;  4IWP A;  1W9M A;  4NPH A;  4KIK A;  4MQD A;  4H6H A;  2YI9 A;  3GI7 A;  7HSC A;  3O3M B;  4EZV A;  5FIG A;  1Q5L A;  1SU6 A;  1SU7 A;  2YIB A;  3I04 A;  5FLE X;  2PY6 A;  4I43 A;  4EZP A;  3C7N A;  4JWD A;  4R5K A;  4JWC A;  4JNE A;  1DKZ A;  4EZX A;  4JL9 A;  3I01 A;  3KAV A;  3L3O M;  3D2E A;  3RV1 A;  1GN9 A;  2RT6 A;  1DG4 A;  2ND0 A;  1GNL A;  4R5J A;  4G6Q A;  2V7Y A;  3SBT B;  4E81 A;  2QFF A;  1DKY A;  5TKY A;  4E3C A;  1JQK A;  3F7W A;  3VEA A;  4HY9 A;  3SBS A;  4EZN A;  4ILG A;  2GAF D;  1MJG A;  3T49 A;  4FL9 A;  4JNF A;  2YI8 A;  4H6I A;  3ZED A;  2Z8Y A;  4R5G A;  2QXL A;  4EZY A;  3QNJ A;  2LM0 A;  3O3N B;  4R5L A;  2X5C A;  1E2U A;  1OA1 A;  4WV5 A;  4IM3 A;  2OP6 A;  1ZYL A;  1UPX A;  4EZR A;  3OWG A;  3KAW A;  2JNS A;  4ILI A;  2YIV X;  3I39 X;  3RV0 A;  1SUF A;  3DPP A;  1CKR A;  3B51 X;  3QA8 A;  4R5I A;  3ERC C;  2EX3 B;  4KIK B;  4UDX X;  5E84 A;  4FM3 A;  3N8E A;  3B52 X;  3DPQ A;  4ILH B;  4F01 A;  4EZQ A;  3DOB A;  3DQG A;  3O3O B;  4IW0 A;  4JWI A;  4JLC A;  4HR1 B;  1YUW A;  4EZT A;  2OBL A;  3D2F A;  4JN4 A;  1E1D A;  2KHO A;  3ER8 C;  1E9V A;  3T48 A;  4IM0 A;  4PO2 A;  3DPO A;  3ZEF A;  4EZU A;  3B53 X;  4F00 A;  3VEB A;  1OAO A;  1U00 A;  4D8J A;  2BPR A;  3T46 A;  4EZO A;  2N3K A;  2NCZ A;  1OA0 A;  4M0M A;  3VKH A;  4IM2 A;  3T4A G;  4JWE A;  3UIT A;  4EZS A;  1BPR A;  4B9Q A;  4EZZ A;  4WV7 A;  3H0X A;  3LMF A;  4HR1 A;  3A98 A;  3OHX M;  3C7N B;  1DKX A;  2YIA A;  3T47 A;  3ER9 B;  2GA9 D;  4EZW A;  2ND1 A;  2OBM A;  4IWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...