3DPQA

Crystal structure of the substrate binding domain of e. coli dnak in complex with a long pyrrhocoricin-derived inhibitor peptide (form b)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein dnaK
publication title Allosteric coupling between the lid and interdomain linker in DnaK revealed by inhibitor binding studies.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone, peptide binding protein
total genus 52
structure length 212
sequence length 212
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2008-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3dpqA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 3dpqA01
3T48A 4R5JA 2KHOA 3C7NA 1CKRA 3T47A 4B9QA 3T49A 4EZUA 1Q5LA 7HSCA 1DKXA 4EZPA 4FL9A 4R5LA 4HYBA 4JWDA 4EZZA 4EZWA 4JWEA 2QFFA 3QNJA 4H6IA 2QXLA 4JN4A 4EZNA 4EZSA 1YUWA 4WV7A 3DPQA 4HY9A 4F00A 4EZVA 3T4AG 3OHXM 4R5IA 5TKYA 4EZTA 2V7YA 1DG4A 4EZYA 4EZRA 4H6HA 4E81A 3DOBA 3DPOA 5E84A 1DKZA 3D2EA 4JWCA 1BPRA 2OP6A 1U00A 4EZXA 4EZQA 4PO2A 3DPPA 3C7NB 3L3OM 4JNEA 4F01A 3T46A 3DQGA 3N8EA 4WV5A 4JNFA 2WINM 1DKYA 4EZOA 4R5KA 3H0XA 2BPRA 4R5GA 4JWIA 3D2FA
chains in the Genus database with same CATH superfamily
2F7QA 2KHOA 3D52A 2MI7A 4WPEA 2V0OA 2RT6A 3CZNA 4WPCA 4EZSA 3VKHA 1I4DA 2EWFA 3BUIA 3I01A 1SUFA 3VEAA 2X3VA 3QWEA 1E1DA 1HXKA 2YL6A 3DPPA 3GI7A 3N8EA 2X3WA 1QX1A 3LMFA 1YWMA 4R5LA 4AZHA 1YUWA 4ILGA 1SU7A 4JWCA 3VEBA 3HAJA 2Q13A 3A98A 3CAZA 4AZ7A 4IWOA 4WV5A 3Q84A 1HWWA 4R5KA 4EZOA 1JQKA 4NQIA 2EFLA 1CKRA 2Z0OA 2YIBA 3T49A 4JN4A 2OW6A 3BVXA 3DYTA 3QA8A 4KIKA 3SBTB 2C08A 1U00A 3O3OB 3CVRA 3BVUA 3EJTA 1DKYA 4EZPA 3QNJA 2YL5A 3BVTA 3DX3A 3OHXM 3ER8C 3I2WA 1HTYA 4IWPA 1R34A 2WYHA 3OK8A 2F7OA 1X03A 2RAKA 2JNKA 3C7NA 4HYBA 2O0I1 4EZWA 5C5BA 1E2UA 1MJGA 1R5EA 4HY9A 4H8SA 3OWGA 3EJRA 4HR1A 2Z8YA 1ZYLA 2OBMA 1OA0A 2Z0VA 2OBLA 4JWIA 4EZUA 4AZBA 3Q0KA 2ZXQA 4IWQA 4D8JA 2X3XA 1I49A 4WV7A 4R5IA 3DX2A 3KAVA 2RAIA 3HAHA 4AVMA 3BUBA 3B51X 4IM3A 1SU8A 1X04A 1TQWA 3G9GA 1LQ7A 4R5GA 4G6QA 4FZSA 3SBSA 3BVWA 2QFFA 2QXLA 3T4AG 4E81A 4NPHA 2ND1A 2F1BA 3BUDA 3DDGA 3RV0A 1E9VA 3C7NB 5FLEX 5KBPA 3EJQA 2D1LA 5C5BB 2D4CA 2X5CA 3CKDA 2PMRA 4HR1B 2NCZA 3BLBA 4AKVA 4DCNC 5E84A 3D2EA 2YLAA 3M3WA 4M0MA 2YLLA 3RPMA 2YKTA 3KAWA 1TQUA 4ILHB 7HSCA 1DKXA 4JWDA 2N3KA 4AZ5A 4EZVA 3B52X 4H6HA 3ERCC 3EJUA 4FZPA 3EJPA 4DYLA 3O3NB 2OO2A 1TQTA 2LM0A 3SYVA 4IM2A 3ZEFA 4EZXA 3SOGA 2F1AA 1OAOA 3DOBA 2F7RA 4PO2A 3LVTA 2Z0NA 4F01A 2F18A 3KDRA 3T48A 3T47A 3ACOA 3D51A 3O3MB 3ABHA 4JWEA 4KIKB 4JLCA 3PLTA 2ND0A 2GA9D 2V7YA 1O7DC 2JNSA 4AZ6A 1DKZA 1BPRA 1GN9A 3BUQA 3ZEDA 3L3PA 4JNFA 3DX1A 4BNEA 4IW0A 2WYIA 3B53X 3BVVA 4JL9A 1GNLA 1I4LA 2YI9A 3HAIA 4NSWA 3F7WA 4F00A 3I04A 5TKYA 2ALWA 4E3CA 3DDFA 4UDXX 4ILIA 4ATMA 1QWNA 4I43A 2QKWA 3D4YA 4JNEA 3QNIA 3H0XA 2PY6A 2FICA 1GNTA 2Q12A 3RV1A 2EFKA 1SU6A 4UDYX 2YL9A 3DPQA 4AZGA 1Y2OA 4EZTA 2YI8A 4FM3A 4AZCA 4AZIA 4MQDA 1URUA 3EJSA 1TQSA 2OP6A 2YIAA 3CV5A 3L3OM 3DQGA 2GAFD 1WDZA 3DX0A 2OZNB 1OA1A 2GF4A 1I4TA 4B9QA 1W9MA 3BUPA 3UITA 2OW7A 4EZYA 2YL8A 2F7PA 1PS3A 3D2FA 3I39X 4R5JA 1Q5LA 4IM0A 4H6IA 3FD9A 2ELBA 1O7DB 3D4ZA 2LXYA 1ZWWA 3DPOA 4FZOA 3LLLA 2RAJA 2YIVX 2WINM 2EX3B 2FYVA 1QWUA 4FL9A 1TQVA 4EZZA 1UPXA 4AZCB 4EZNA 4EZRA 3QE6A 3CZSA 3ER9B 5FIGA 4EZQA 3D50A 3T46A 3DX4A 4I1QA 2BPRA 1R33A 1DG4A
chains in the Genus database with same CATH topology
2KHOA 3C7NA 3KAWA 1GNTA 4ILHB 2RT6A 7HSCA 1DKXA 4HYBA 4JWDA 4EZWA 3RV1A 1E2UA 1MJGA 1SU6A 4EZSA 4UDYX 3VKHA 3DPQA 4HY9A 2N3KA 4EZVA 3B52X 2EWFA 4EZTA 2YI8A 4H6HA 3ERCC 3OWGA 3I01A 4FM3A 4MQDA 1SUFA 4HR1A 3VEAA 2Z8YA 2OP6A 1E1DA 2YIAA 3DPPA 3O3NB 1ZYLA 2OBMA 1OA0A 3GI7A 3L3OM 3DQGA 3N8EA 2GAFD 2OBLA 2LM0A 3ZEFA 4IM2A 4JWIA 4EZXA 3LMFA 1OA1A 4B9QA 4EZUA 1W9MA 4R5LA 1OAOA 4IWQA 4D8JA 1YUWA 4WV7A 4ILGA 4R5IA 3UITA 4EZYA 3DOBA 3KAVA 1SU7A 4JWCA 3VEBA 3A98A 4PO2A 3B51X 4IM3A 4IWOA 1SU8A 4F01A 4WV5A 3KDRA 4EZOA 4R5KA 1JQKA 4R5GA 3D2FA 3T48A 3I39X 4G6QA 4R5JA 1CKRA 3SBSA 2YIBA 3T47A 3T49A 1Q5LA 3O3MB 4IM0A 4JWEA 2QFFA 4H6IA 4JN4A 2QXLA 4KIKB 4JLCA 3FD9A 3T4AG 2ND0A 2GA9D 2V7YA 3QA8A 4KIKA 4E81A 4NPHA 2JNSA 3DPOA 2ND1A 3SBTB 1DKZA 1BPRA 1GN9A 3RV0A 1U00A 3O3OB 1E9VA 3ZEDA 3C7NB 5FLEX 2YIVX 4JNFA 2WINM 2EX3B 1DKYA 4IW0A 3B53X 4JL9A 1GNLA 2YI9A 2X5CA 4EZPA 4FL9A 4EZZA 1UPXA 3QNJA 4EZNA 4HR1B 3F7WA 4F00A 2NCZA 3I04A 3OHXM 5TKYA 4E3CA 4EZRA 3ER8C 4UDXX 4IWPA 5E84A 4ILIA 3D2EA 3ER9B 5FIGA 4EZQA 4I43A 4M0MA 4JNEA 3T46A 3H0XA 2BPRA 2PY6A 1DG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T48 A;  4R5J A;  2KHO A;  3C7N A;  1CKR A;  3T47 A;  4B9Q A;  3T49 A;  4EZU A;  1Q5L A;  7HSC A;  1DKX A;  4EZP A;  4FL9 A;  4R5L A;  4HYB A;  4JWD A;  4EZZ A;  4EZW A;  4JWE A;  2QFF A;  3QNJ A;  4H6I A;  2QXL A;  4JN4 A;  4EZN A;  4EZS A;  1YUW A;  4WV7 A;  3DPQ A;  4HY9 A;  4F00 A;  4EZV A;  3T4A G;  3OHX M;  4R5I A;  5TKY A;  4EZT A;  2V7Y A;  1DG4 A;  4EZY A;  4EZR A;  4H6H A;  4E81 A;  3DOB A;  3DPO A;  5E84 A;  1DKZ A;  3D2E A;  4JWC A;  1BPR A;  2OP6 A;  1U00 A;  4EZX A;  4EZQ A;  4PO2 A;  3DPP A;  3C7N B;  3L3O M;  4JNE A;  4F01 A;  3T46 A;  3DQG A;  3N8E A;  4WV5 A;  4JNF A;  2WIN M;  1DKY A;  4EZO A;  4R5K A;  3H0X A;  2BPR A;  4R5G A;  4JWI A;  3D2F A; 
#chains in the Genus database with same CATH topology
 2F7Q A;  2KHO A;  3D52 A;  2MI7 A;  4WPE A;  2V0O A;  2RT6 A;  3CZN A;  4WPC A;  4EZS A;  3VKH A;  1I4D A;  2EWF A;  3BUI A;  3I01 A;  1SUF A;  3VEA A;  2X3V A;  3QWE A;  1E1D A;  1HXK A;  2YL6 A;  3DPP A;  3GI7 A;  3N8E A;  2X3W A;  1QX1 A;  3LMF A;  1YWM A;  4R5L A;  4AZH A;  1YUW A;  4ILG A;  1SU7 A;  4JWC A;  3VEB A;  3HAJ A;  2Q13 A;  3A98 A;  3CAZ A;  4AZ7 A;  4IWO A;  4WV5 A;  3Q84 A;  1HWW A;  4R5K A;  4EZO A;  1JQK A;  4NQI A;  2EFL A;  1CKR A;  2Z0O A;  2YIB A;  3T49 A;  4JN4 A;  2OW6 A;  3BVX A;  3DYT A;  3QA8 A;  4KIK A;  3SBT B;  2C08 A;  1U00 A;  3O3O B;  3CVR A;  3BVU A;  3EJT A;  1DKY A;  4EZP A;  3QNJ A;  2YL5 A;  3BVT A;  3DX3 A;  3OHX M;  3ER8 C;  3I2W A;  1HTY A;  4IWP A;  1R34 A;  2WYH A;  3OK8 A;  2F7O A;  1X03 A;  2RAK A;  2JNK A;  3C7N A;  4HYB A;  2O0I 1;  4EZW A;  5C5B A;  1E2U A;  1MJG A;  1R5E A;  4HY9 A;  4H8S A;  3OWG A;  3EJR A;  4HR1 A;  2Z8Y A;  1ZYL A;  2OBM A;  1OA0 A;  2Z0V A;  2OBL A;  4JWI A;  4EZU A;  4AZB A;  3Q0K A;  2ZXQ A;  4IWQ A;  4D8J A;  2X3X A;  1I49 A;  4WV7 A;  4R5I A;  3DX2 A;  3KAV A;  2RAI A;  3HAH A;  4AVM A;  3BUB A;  3B51 X;  4IM3 A;  1SU8 A;  1X04 A;  1TQW A;  3G9G A;  1LQ7 A;  4R5G A;  4G6Q A;  4FZS A;  3SBS A;  3BVW A;  2QFF A;  2QXL A;  3T4A G;  4E81 A;  4NPH A;  2ND1 A;  2F1B A;  3BUD A;  3DDG A;  3RV0 A;  1E9V A;  3C7N B;  5FLE X;  5KBP A;  3EJQ A;  2D1L A;  5C5B B;  2D4C A;  2X5C A;  3CKD A;  2PMR A;  4HR1 B;  2NCZ A;  3BLB A;  4AKV A;  4DCN C;  5E84 A;  3D2E A;  2YLA A;  3M3W A;  4M0M A;  2YLL A;  3RPM A;  2YKT A;  3KAW A;  1TQU A;  4ILH B;  7HSC A;  1DKX A;  4JWD A;  2N3K A;  4AZ5 A;  4EZV A;  3B52 X;  4H6H A;  3ERC C;  3EJU A;  4FZP A;  3EJP A;  4DYL A;  3O3N B;  2OO2 A;  1TQT A;  2LM0 A;  3SYV A;  4IM2 A;  3ZEF A;  4EZX A;  3SOG A;  2F1A A;  1OAO A;  3DOB A;  2F7R A;  4PO2 A;  3LVT A;  2Z0N A;  4F01 A;  2F18 A;  3KDR A;  3T48 A;  3T47 A;  3ACO A;  3D51 A;  3O3M B;  3ABH A;  4JWE A;  4KIK B;  4JLC A;  3PLT A;  2ND0 A;  2GA9 D;  2V7Y A;  1O7D C;  2JNS A;  4AZ6 A;  1DKZ A;  1BPR A;  1GN9 A;  3BUQ A;  3ZED A;  3L3P A;  4JNF A;  3DX1 A;  4BNE A;  4IW0 A;  2WYI A;  3B53 X;  3BVV A;  4JL9 A;  1GNL A;  1I4L A;  2YI9 A;  3HAI A;  4NSW A;  3F7W A;  4F00 A;  3I04 A;  5TKY A;  2ALW A;  4E3C A;  3DDF A;  4UDX X;  4ILI A;  4ATM A;  1QWN A;  4I43 A;  2QKW A;  3D4Y A;  4JNE A;  3QNI A;  3H0X A;  2PY6 A;  2FIC A;  1GNT A;  2Q12 A;  3RV1 A;  2EFK A;  1SU6 A;  4UDY X;  2YL9 A;  3DPQ A;  4AZG A;  1Y2O A;  4EZT A;  2YI8 A;  4FM3 A;  4AZC A;  4AZI A;  4MQD A;  1URU A;  3EJS A;  1TQS A;  2OP6 A;  2YIA A;  3CV5 A;  3L3O M;  3DQG A;  2GAF D;  1WDZ A;  3DX0 A;  2OZN B;  1OA1 A;  2GF4 A;  1I4T A;  4B9Q A;  1W9M A;  3BUP A;  3UIT A;  2OW7 A;  4EZY A;  2YL8 A;  2F7P A;  1PS3 A;  3D2F A;  3I39 X;  4R5J A;  1Q5L A;  4IM0 A;  4H6I A;  3FD9 A;  2ELB A;  1O7D B;  3D4Z A;  2LXY A;  1ZWW A;  3DPO A;  4FZO A;  3LLL A;  2RAJ A;  2YIV X;  2WIN M;  2EX3 B;  2FYV A;  1QWU A;  4FL9 A;  1TQV A;  4EZZ A;  1UPX A;  4AZC B;  4EZN A;  4EZR A;  3QE6 A;  3CZS A;  3ER9 B;  5FIG A;  4EZQ A;  3D50 A;  3T46 A;  3DX4 A;  4I1Q A;  2BPR A;  1R33 A;  1DG4 A; 
#chains in the Genus database with same CATH homology
 2KHO A;  3C7N A;  3KAW A;  1GNT A;  4ILH B;  2RT6 A;  7HSC A;  1DKX A;  4HYB A;  4JWD A;  4EZW A;  3RV1 A;  1E2U A;  1MJG A;  1SU6 A;  4EZS A;  4UDY X;  3VKH A;  3DPQ A;  4HY9 A;  2N3K A;  4EZV A;  3B52 X;  2EWF A;  4EZT A;  2YI8 A;  4H6H A;  3ERC C;  3OWG A;  3I01 A;  4FM3 A;  4MQD A;  1SUF A;  4HR1 A;  3VEA A;  2Z8Y A;  2OP6 A;  1E1D A;  2YIA A;  3DPP A;  3O3N B;  1ZYL A;  2OBM A;  1OA0 A;  3GI7 A;  3L3O M;  3DQG A;  3N8E A;  2GAF D;  2OBL A;  2LM0 A;  3ZEF A;  4IM2 A;  4JWI A;  4EZX A;  3LMF A;  1OA1 A;  4B9Q A;  4EZU A;  1W9M A;  4R5L A;  1OAO A;  4IWQ A;  4D8J A;  1YUW A;  4WV7 A;  4ILG A;  4R5I A;  3UIT A;  4EZY A;  3DOB A;  3KAV A;  1SU7 A;  4JWC A;  3VEB A;  3A98 A;  4PO2 A;  3B51 X;  4IM3 A;  4IWO A;  1SU8 A;  4F01 A;  4WV5 A;  3KDR A;  4EZO A;  4R5K A;  1JQK A;  4R5G A;  3D2F A;  3T48 A;  3I39 X;  4G6Q A;  4R5J A;  1CKR A;  3SBS A;  2YIB A;  3T47 A;  3T49 A;  1Q5L A;  3O3M B;  4IM0 A;  4JWE A;  2QFF A;  4H6I A;  4JN4 A;  2QXL A;  4KIK B;  4JLC A;  3FD9 A;  3T4A G;  2ND0 A;  2GA9 D;  2V7Y A;  3QA8 A;  4KIK A;  4E81 A;  4NPH A;  2JNS A;  3DPO A;  2ND1 A;  3SBT B;  1DKZ A;  1BPR A;  1GN9 A;  3RV0 A;  1U00 A;  3O3O B;  1E9V A;  3ZED A;  3C7N B;  5FLE X;  2YIV X;  4JNF A;  2WIN M;  2EX3 B;  1DKY A;  4IW0 A;  3B53 X;  4JL9 A;  1GNL A;  2YI9 A;  2X5C A;  4EZP A;  4FL9 A;  4EZZ A;  1UPX A;  3QNJ A;  4EZN A;  4HR1 B;  3F7W A;  4F00 A;  2NCZ A;  3I04 A;  3OHX M;  5TKY A;  4E3C A;  4EZR A;  3ER8 C;  4UDX X;  4IWP A;  5E84 A;  4ILI A;  3D2E A;  3ER9 B;  5FIG A;  4EZQ A;  4I43 A;  4M0M A;  4JNE A;  3T46 A;  3H0X A;  2BPR A;  2PY6 A;  1DG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...