3DPQA

Crystal structure of the substrate binding domain of e. coli dnak in complex with a long pyrrhocoricin-derived inhibitor peptide (form b)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein dnaK
publication title Allosteric coupling between the lid and interdomain linker in DnaK revealed by inhibitor binding studies.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone, peptide binding protein
total genus 52
structure length 212
sequence length 212
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2008-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3dpqA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 3dpqA01
1DG4A 1BPRA 4EZTA 4EZNA 2QXLA 1YUWA 3DPPA 4R5JA 2QFFA 3DPQA 3T46A 4H6HA 4JWIA 7HSCA 1DKYA 4JNFA 4R5GA 3C7NB 3DQGA 4EZOA 4WV7A 3QNJA 4E81A 4FL9A 4H6IA 4JN4A 4WV5A 1CKRA 4JWCA 3N8EA 5TKYA 3T49A 4B9QA 3T47A 2KHOA 4EZWA 3DPOA 4R5LA 4JWEA 4EZYA 3C7NA 4EZQA 4EZRA 4JWDA 4PO2A 1DKZA 4F00A 3L3OM 4HYBA 4JNEA 1Q5LA 3T4AG 2WINM 4R5IA 5E84A 4EZZA 2V7YA 3DOBA 3H0XA 4R5KA 4EZVA 3D2EA 4F01A 3D2FA 2OP6A 4EZPA 3T48A 4EZXA 1U00A 4HY9A 4EZUA 3OHXM 4EZSA 2BPRA 1DKXA
chains in the Genus database with same CATH superfamily
2F1AA 3CVRA 4FZSA 3CZNA 4R5JA 3CKDA 3DQGA 2RT6A 1ZYLA 4IM0A 2F7QA 5TKYA 2YIBA 2GA9D 1DKZA 4KIKB 4M0MA 3BUPA 3VEBA 2ND0A 1QWUA 3OHXM 1DG4A 2QXLA 2ZXQA 3QE6A 3SOGA 5FLEX 3HAHA 2RAIA 3B53X 2Q13A 2MI7A 4E81A 3KAWA 4AZCB 7HSCA 3RPMA 3DYTA 4JNEA 4F01A 3ABHA 2OO2A 3EJRA 2OZNB 4AVMA 2D4CA 3SBTB 1I4TA 1OAOA 2F18A 4DYLA 2X3XA 2V7YA 2WYIA 2V0OA 4IWQA 4EZUA 3DX2A 4EZSA 2YIAA 1WDZA 4D8JA 2ELBA 1GNTA 1BPRA 2O0I1 3DPPA 1DKYA 1SU7A 2YI8A 3T49A 3O3MB 2KHOA 4PO2A 3DX3A 4JWDA 2WYHA 1Y2OA 4R5KA 2QKWA 3T48A 4KIKA 1ZWWA 4BNEA 4NQIA 3HAJA 1SUFA 4R5GA 2EFLA 3DX4A 3ZEDA 3I04A 3KDRA 4FZPA 4EZWA 3D4YA 4AZCA 1Q5LA 1OA1A 3A98A 1X04A 2GF4A 3D2FA 2OP6A 3EJPA 2RAJA 1YUWA 2QFFA 2X3VA 2Z0VA 3M3WA 1UPXA 2YL5A 3RV1A 3RV0A 4EZOA 2RAKA 2X5CA 3O3NB 2YLLA 3T47A 2OW7A 4JWEA 3FD9A 4HYBA 4I1QA 2EFKA 5E84A 3ERCC 3VEAA 1GN9A 2LXYA 2X3WA 2FYVA 4ILHB 3I01A 1JQKA 4FZOA 3EJTA 4ILGA 3BVTA 4JL9A 2EX3B 4MQDA 4EZQA 2FICA 2OBMA 5C5BB 3L3OM 2YL8A 1I49A 3D51A 4HY9A 3UITA 4IM3A 2C08A 4NPHA 2F7OA 3DPQA 4IWOA 2D1LA 3QNJA 2YL6A 4HR1A 2LM0A 3D52A 2N3KA 3T4AG 4R5IA 3F7WA 3QWEA 4EZXA 3ER8C 3EJUA 2Q12A 2BPRA 1I4LA 4IWPA 3T46A 4UDYX 1QX1A 3Q0KA 4H6IA 1OA0A 2YKTA 4AZ7A 3LVTA 3BUQA 4ATMA 1U00A 3LMFA 2GAFD 1O7DB 2PY6A 4EZNA 3GI7A 4HR1B 4H6HA 4E3CA 4AZBA 1CKRA 3ACOA 3B51X 5KBPA 4EZYA 4AZIA 3BLBA 3KAVA 4UDXX 4EZVA 1E1DA 1PS3A 5C5BA 2PMRA 3BUBA 4WPCA 3EJSA 3BVUA 4F00A 3LLLA 4JLCA 3ZEFA 3CV5A 1R34A 3D50A 1DKXA 4DCNC 3PLTA 3Q84A 2F7PA 3BUIA 3HAIA 3C7NA 4AZ5A 3N8EA 3D2EA 4AKVA 2EWFA 1TQTA 2F7RA 1LQ7A 3CZSA 4IW0A 3QA8A 5FIGA 4AZGA 1X03A 3DDGA 4FL9A 4JWCA 4EZRA 1R5EA 1W9MA 3B52X 3SYVA 4WPEA 3DX1A 4ILIA 3BUDA 1E2UA 3DX0A 4IM2A 3EJQA 4JWIA 2Z0OA 4JNFA 4AZ6A 3VKHA 3C7NB 1HTYA 4FM3A 1QWNA 1TQUA 3DDFA 1SU6A 3DPOA 3G9GA 4NSWA 3OK8A 2ALWA 1E9VA 1I4DA 3CAZA 3QNIA 2YLAA 2OBLA 4G6QA 1GNLA 3ER9B 4WV5A 3O3OB 2Z8YA 3BVVA 1TQVA 4B9QA 3I2WA 3SBSA 2ND1A 3H0XA 2OW6A 1TQWA 2F1BA 2YI9A 3L3PA 3BVXA 4EZTA 4AZHA 2Z0NA 1HWWA 1MJGA 3BVWA 3OWGA 1YWMA 4WV7A 4JN4A 1O7DC 4R5LA 1SU8A 2JNSA 2YIVX 1URUA 3DOBA 2WINM 4EZZA 1HXKA 4H8SA 1R33A 2NCZA 3I39X 4EZPA 2JNKA 2YL9A 4I43A 1TQSA 3D4ZA
chains in the Genus database with same CATH topology
4IWPA 4R5JA 3T46A 4UDYX 4IW0A 3QA8A 5FIGA 1SUFA 4R5GA 3DQGA 2RT6A 4FL9A 3ZEDA 4H6IA 3I04A 1ZYLA 4JWCA 3KDRA 4IM0A 1OA0A 5TKYA 4EZWA 2YIBA 4EZRA 2GA9D 1DKZA 1W9MA 3B52X 1Q5LA 4KIKB 1OA1A 4M0MA 3A98A 3VEBA 2ND0A 3D2FA 2OP6A 4ILIA 1U00A 3LMFA 3OHXM 2GAFD 1E2UA 1DG4A 4IM2A 2PY6A 2QXLA 4EZNA 1YUWA 2QFFA 3GI7A 5FLEX 4HR1B 4H6HA 4JWIA 3B53X 4E3CA 1UPXA 4JNFA 3RV1A 3VKHA 3RV0A 3C7NB 4EZOA 1CKRA 4E81A 2X5CA 3KAWA 3B51X 3O3NB 4FM3A 7HSCA 3T47A 1SU6A 3DPOA 4EZYA 4JWEA 3KAVA 3FD9A 1E9VA 4HYBA 4JNEA 4UDXX 5E84A 4EZVA 1E1DA 4F01A 3ERCC 2OBLA 4G6QA 3VEAA 1GN9A 1GNLA 3ER9B 4ILHB 3I01A 1JQKA 4ILGA 4JL9A 4WV5A 2EX3B 3O3OB 4MQDA 2Z8YA 4B9QA 4EZQA 3SBTB 1OAOA 2OBMA 3SBSA 4F00A 3L3OM 2ND1A 3H0XA 2V7YA 4JLCA 3ZEFA 4IWQA 4HY9A 4EZUA 2YI9A 3UITA 2YIAA 4EZSA 4IM3A 4D8JA 1DKXA 4NPHA 1GNTA 1BPRA 4EZTA 3DPPA 3DPQA 4IWOA 1MJGA 1DKYA 3OWGA 4WV7A 3QNJA 1SU7A 4JN4A 4HR1A 2YI8A 3T49A 3O3MB 2LM0A 2KHOA 4R5LA 1SU8A 4PO2A 3C7NA 4JWDA 2JNSA 2YIVX 3N8EA 2N3KA 2WINM 4R5IA 3T4AG 4EZZA 3DOBA 3F7WA 4R5KA 3D2EA 2NCZA 3I39X 4EZPA 2EWFA 3T48A 4EZXA 3ER8C 4I43A 4KIKA 2BPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DG4 A;  1BPR A;  4EZT A;  4EZN A;  2QXL A;  1YUW A;  3DPP A;  4R5J A;  2QFF A;  3DPQ A;  3T46 A;  4H6H A;  4JWI A;  7HSC A;  1DKY A;  4JNF A;  4R5G A;  3C7N B;  3DQG A;  4EZO A;  4WV7 A;  3QNJ A;  4E81 A;  4FL9 A;  4H6I A;  4JN4 A;  4WV5 A;  1CKR A;  4JWC A;  3N8E A;  5TKY A;  3T49 A;  4B9Q A;  3T47 A;  2KHO A;  4EZW A;  3DPO A;  4R5L A;  4JWE A;  4EZY A;  3C7N A;  4EZQ A;  4EZR A;  4JWD A;  4PO2 A;  1DKZ A;  4F00 A;  3L3O M;  4HYB A;  4JNE A;  1Q5L A;  3T4A G;  2WIN M;  4R5I A;  5E84 A;  4EZZ A;  2V7Y A;  3DOB A;  3H0X A;  4R5K A;  4EZV A;  3D2E A;  4F01 A;  3D2F A;  2OP6 A;  4EZP A;  3T48 A;  4EZX A;  1U00 A;  4HY9 A;  4EZU A;  3OHX M;  4EZS A;  2BPR A;  1DKX A; 
#chains in the Genus database with same CATH topology
 2F1A A;  3CVR A;  4FZS A;  3CZN A;  4R5J A;  3CKD A;  3DQG A;  2RT6 A;  1ZYL A;  4IM0 A;  2F7Q A;  5TKY A;  2YIB A;  2GA9 D;  1DKZ A;  4KIK B;  4M0M A;  3BUP A;  3VEB A;  2ND0 A;  1QWU A;  3OHX M;  1DG4 A;  2QXL A;  2ZXQ A;  3QE6 A;  3SOG A;  5FLE X;  3HAH A;  2RAI A;  3B53 X;  2Q13 A;  2MI7 A;  4E81 A;  3KAW A;  4AZC B;  7HSC A;  3RPM A;  3DYT A;  4JNE A;  4F01 A;  3ABH A;  2OO2 A;  3EJR A;  2OZN B;  4AVM A;  2D4C A;  3SBT B;  1I4T A;  1OAO A;  2F18 A;  4DYL A;  2X3X A;  2V7Y A;  2WYI A;  2V0O A;  4IWQ A;  4EZU A;  3DX2 A;  4EZS A;  2YIA A;  1WDZ A;  4D8J A;  2ELB A;  1GNT A;  1BPR A;  2O0I 1;  3DPP A;  1DKY A;  1SU7 A;  2YI8 A;  3T49 A;  3O3M B;  2KHO A;  4PO2 A;  3DX3 A;  4JWD A;  2WYH A;  1Y2O A;  4R5K A;  2QKW A;  3T48 A;  4KIK A;  1ZWW A;  4BNE A;  4NQI A;  3HAJ A;  1SUF A;  4R5G A;  2EFL A;  3DX4 A;  3ZED A;  3I04 A;  3KDR A;  4FZP A;  4EZW A;  3D4Y A;  4AZC A;  1Q5L A;  1OA1 A;  3A98 A;  1X04 A;  2GF4 A;  3D2F A;  2OP6 A;  3EJP A;  2RAJ A;  1YUW A;  2QFF A;  2X3V A;  2Z0V A;  3M3W A;  1UPX A;  2YL5 A;  3RV1 A;  3RV0 A;  4EZO A;  2RAK A;  2X5C A;  3O3N B;  2YLL A;  3T47 A;  2OW7 A;  4JWE A;  3FD9 A;  4HYB A;  4I1Q A;  2EFK A;  5E84 A;  3ERC C;  3VEA A;  1GN9 A;  2LXY A;  2X3W A;  2FYV A;  4ILH B;  3I01 A;  1JQK A;  4FZO A;  3EJT A;  4ILG A;  3BVT A;  4JL9 A;  2EX3 B;  4MQD A;  4EZQ A;  2FIC A;  2OBM A;  5C5B B;  3L3O M;  2YL8 A;  1I49 A;  3D51 A;  4HY9 A;  3UIT A;  4IM3 A;  2C08 A;  4NPH A;  2F7O A;  3DPQ A;  4IWO A;  2D1L A;  3QNJ A;  2YL6 A;  4HR1 A;  2LM0 A;  3D52 A;  2N3K A;  3T4A G;  4R5I A;  3F7W A;  3QWE A;  4EZX A;  3ER8 C;  3EJU A;  2Q12 A;  2BPR A;  1I4L A;  4IWP A;  3T46 A;  4UDY X;  1QX1 A;  3Q0K A;  4H6I A;  1OA0 A;  2YKT A;  4AZ7 A;  3LVT A;  3BUQ A;  4ATM A;  1U00 A;  3LMF A;  2GAF D;  1O7D B;  2PY6 A;  4EZN A;  3GI7 A;  4HR1 B;  4H6H A;  4E3C A;  4AZB A;  1CKR A;  3ACO A;  3B51 X;  5KBP A;  4EZY A;  4AZI A;  3BLB A;  3KAV A;  4UDX X;  4EZV A;  1E1D A;  1PS3 A;  5C5B A;  2PMR A;  3BUB A;  4WPC A;  3EJS A;  3BVU A;  4F00 A;  3LLL A;  4JLC A;  3ZEF A;  3CV5 A;  1R34 A;  3D50 A;  1DKX A;  4DCN C;  3PLT A;  3Q84 A;  2F7P A;  3BUI A;  3HAI A;  3C7N A;  4AZ5 A;  3N8E A;  3D2E A;  4AKV A;  2EWF A;  1TQT A;  2F7R A;  1LQ7 A;  3CZS A;  4IW0 A;  3QA8 A;  5FIG A;  4AZG A;  1X03 A;  3DDG A;  4FL9 A;  4JWC A;  4EZR A;  1R5E A;  1W9M A;  3B52 X;  3SYV A;  4WPE A;  3DX1 A;  4ILI A;  3BUD A;  1E2U A;  3DX0 A;  4IM2 A;  3EJQ A;  4JWI A;  2Z0O A;  4JNF A;  4AZ6 A;  3VKH A;  3C7N B;  1HTY A;  4FM3 A;  1QWN A;  1TQU A;  3DDF A;  1SU6 A;  3DPO A;  3G9G A;  4NSW A;  3OK8 A;  2ALW A;  1E9V A;  1I4D A;  3CAZ A;  3QNI A;  2YLA A;  2OBL A;  4G6Q A;  1GNL A;  3ER9 B;  4WV5 A;  3O3O B;  2Z8Y A;  3BVV A;  1TQV A;  4B9Q A;  3I2W A;  3SBS A;  2ND1 A;  3H0X A;  2OW6 A;  1TQW A;  2F1B A;  2YI9 A;  3L3P A;  3BVX A;  4EZT A;  4AZH A;  2Z0N A;  1HWW A;  1MJG A;  3BVW A;  3OWG A;  1YWM A;  4WV7 A;  4JN4 A;  1O7D C;  4R5L A;  1SU8 A;  2JNS A;  2YIV X;  1URU A;  3DOB A;  2WIN M;  4EZZ A;  1HXK A;  4H8S A;  1R33 A;  2NCZ A;  3I39 X;  4EZP A;  2JNK A;  2YL9 A;  4I43 A;  1TQS A;  3D4Z A; 
#chains in the Genus database with same CATH homology
 4IWP A;  4R5J A;  3T46 A;  4UDY X;  4IW0 A;  3QA8 A;  5FIG A;  1SUF A;  4R5G A;  3DQG A;  2RT6 A;  4FL9 A;  3ZED A;  4H6I A;  3I04 A;  1ZYL A;  4JWC A;  3KDR A;  4IM0 A;  1OA0 A;  5TKY A;  4EZW A;  2YIB A;  4EZR A;  2GA9 D;  1DKZ A;  1W9M A;  3B52 X;  1Q5L A;  4KIK B;  1OA1 A;  4M0M A;  3A98 A;  3VEB A;  2ND0 A;  3D2F A;  2OP6 A;  4ILI A;  1U00 A;  3LMF A;  3OHX M;  2GAF D;  1E2U A;  1DG4 A;  4IM2 A;  2PY6 A;  2QXL A;  4EZN A;  1YUW A;  2QFF A;  3GI7 A;  5FLE X;  4HR1 B;  4H6H A;  4JWI A;  3B53 X;  4E3C A;  1UPX A;  4JNF A;  3RV1 A;  3VKH A;  3RV0 A;  3C7N B;  4EZO A;  1CKR A;  4E81 A;  2X5C A;  3KAW A;  3B51 X;  3O3N B;  4FM3 A;  7HSC A;  3T47 A;  1SU6 A;  3DPO A;  4EZY A;  4JWE A;  3KAV A;  3FD9 A;  1E9V A;  4HYB A;  4JNE A;  4UDX X;  5E84 A;  4EZV A;  1E1D A;  4F01 A;  3ERC C;  2OBL A;  4G6Q A;  3VEA A;  1GN9 A;  1GNL A;  3ER9 B;  4ILH B;  3I01 A;  1JQK A;  4ILG A;  4JL9 A;  4WV5 A;  2EX3 B;  3O3O B;  4MQD A;  2Z8Y A;  4B9Q A;  4EZQ A;  3SBT B;  1OAO A;  2OBM A;  3SBS A;  4F00 A;  3L3O M;  2ND1 A;  3H0X A;  2V7Y A;  4JLC A;  3ZEF A;  4IWQ A;  4HY9 A;  4EZU A;  2YI9 A;  3UIT A;  2YIA A;  4EZS A;  4IM3 A;  4D8J A;  1DKX A;  4NPH A;  1GNT A;  1BPR A;  4EZT A;  3DPP A;  3DPQ A;  4IWO A;  1MJG A;  1DKY A;  3OWG A;  4WV7 A;  3QNJ A;  1SU7 A;  4JN4 A;  4HR1 A;  2YI8 A;  3T49 A;  3O3M B;  2LM0 A;  2KHO A;  4R5L A;  1SU8 A;  4PO2 A;  3C7N A;  4JWD A;  2JNS A;  2YIV X;  3N8E A;  2N3K A;  2WIN M;  4R5I A;  3T4A G;  4EZZ A;  3DOB A;  3F7W A;  4R5K A;  3D2E A;  2NCZ A;  3I39 X;  4EZP A;  2EWF A;  3T48 A;  4EZX A;  3ER8 C;  4I43 A;  4KIK A;  2BPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...