3DPQA

Crystal structure of the substrate binding domain of e. coli dnak in complex with a long pyrrhocoricin-derived inhibitor peptide (form b)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
212
structure length
212
Chain Sequence
b'VLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein dnaK
publication title Allosteric coupling between the lid and interdomain linker in DnaK revealed by inhibitor binding studies.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone, peptide binding protein
total genus 52
structure length 212
sequence length 212
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2008-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3dpqA02
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 3dpqA01
4EZTA 4EZWA 3T46A 1DKXA 4WV5A 4H6IA 4FL9A 3D2FA 3L3OM 4EZRA 4JWIA 4F01A 4EZSA 3DPOA 4PO2A 4EZVA 4EZOA 4JWEA 4R5KA 3N8EA 2KHOA 5TKYA 1BPRA 2QXLA 4EZUA 3DOBA 1DG4A 3DPQA 4WV7A 3QNJA 4JNEA 4EZPA 3D2EA 4B9QA 3DQGA 1YUWA 3OHXM 4EZNA 4EZXA 3C7NB 4R5GA 3H0XA 4H6HA 1Q5LA 4JN4A 4R5IA 2V7YA 4E81A 4R5LA 4EZYA 2OP6A 4HY9A 1CKRA 2QFFA 4HYBA 4JWDA 4F00A 3DPPA 4JNFA 3T48A 1U00A 3T47A 3T49A 2WINM 4JWCA 3C7NA 1DKYA 5E84A 4EZQA 1DKZA 3T4AG 4EZZA 2BPRA 4R5JA 7HSCA
chains in the Genus database with same CATH superfamily
2ELBA 2D1LA 3DPOA 3DX4A 2N3KA 2ZXQA 2QXLA 1DG4A 1I4TA 2LXYA 2FYVA 4JN4A 1R33A 3UITA 4AKVA 4IM2A 3EJUA 2F7QA 3CV5A 3FD9A 4AVMA 3I01A 3M3WA 2KHOA 1BPRA 4WV7A 1SU8A 4R5GA 3EJSA 2EFKA 4EZYA 4F00A 4JNFA 3T48A 2EX3B 3VEBA 2F1AA 3T4AG 3OK8A 3T46A 3BVWA 4FZSA 4JLCA 4PO2A 3CKDA 1LQ7A 4JWEA 2RT6A 4B9QA 2YKTA 4JL9A 4IM3A 3DDGA 4IW0A 3SOGA 3F7WA 3Q0KA 3QNIA 2OO2A 2YL5A 4WV5A 3HAJA 3RV0A 4EZRA 2JNKA 4D8JA 4FZOA 4JWIA 4F01A 2YLLA 3BUBA 4EZOA 1QWUA 5TKYA 3A98A 3DOBA 3DPQA 4UDYX 2Q13A 3G9GA 3QWEA 2Z0NA 4EZXA 1E9VA 2Z8YA 4IWQA 2V7YA 4R5LA 1CKRA 1QX1A 3OWGA 4WPEA 4JWCA 4KIKB 1SU7A 4FM3A 1TQVA 3EJQA 2FICA 3I2WA 2F7OA 3GI7A 2F18A 4NQIA 3ACOA 3BVVA 4H6HA 3EJRA 2OP6A 3BUQA 5KBPA 1U00A 2JNSA 3T49A 4AZIA 1DKYA 3BUDA 3L3PA 2LM0A 2YI8A 4KIKA 4I1QA 2F7RA 4MQDA 1R34A 3N8EA 3ER8C 1OAOA 4IM0A 2YLAA 3C7NB 4ILHB 1Q5LA 3ABHA 3CZSA 1GNTA 3B52X 3T47A 4UDXX 2YIAA 7HSCA 4AZHA 3CZNA 1E1DA 3HAIA 3DYTA 2O0I1 5FIGA 2F7PA 4AZBA 3ERCC 2Z0OA 2X3WA 4NPHA 4EZUA 3KAWA 3VKHA 3D4YA 3D50A 2QFFA 1SUFA 2OBMA 2WINM 3C7NA 3VEAA 1HXKA 4R5JA 3I39X 3BUIA 3ER9B 3SBSA 2RAJA 1PS3A 2OZNB 3D51A 4HY9A 1OA1A 3LVTA 3ZEFA 3PLTA 3BVXA 2F1BA 2ND0A 4NSWA 4R5KA 1O7DB 2WYIA 3QNJA 3LMFA 4AZGA 4BNEA 3EJTA 4G6QA 1TQTA 1JQKA 3DX1A 5E84A 2Z0VA 3KAVA 3ZEDA 3KDRA 4H6IA 2PY6A 3I04A 3D4ZA 4HR1B 2V0OA 4ATMA 3QE6A 2ND1A 4AZ6A 2RAKA 2C08A 1GN9A 2X3VA 3DQGA 3O3NB 4E81A 3O3MB 4ILIA 2D4CA 1X03A 4DCNC 1UPXA 3B53X 2Q12A 2GF4A 1MJGA 2OW7A 4HR1A 3D2EA 4IWOA 1I4DA 2MI7A 1WDZA 3DPPA 2EFLA 2YI9A 4EZTA 1TQSA 4AZ5A 4FL9A 3D2FA 3DX3A 4EZVA 3CAZA 2GAFD 1E2UA 4AZCB 1YUWA 3OHXM 1I4LA 2GA9D 2EWFA 4FZPA 4HYBA 2YL9A 1TQUA 4EZQA 4EZZA 1DKXA 2YL8A 3RPMA 1I49A 1OA0A 3O3OB 4AZCA 3DX2A 3BLBA 3BUPA 3BVTA 5C5BB 3HAHA 3CVRA 3LLLA 3Q84A 2RAIA 2YIVX 4EZNA 1TQWA 2ALWA 4M0MA 4R5IA 3EJPA 2X3XA 1DKZA 1HTYA 4WPCA 4EZWA 3DDFA 3L3OM 2OW6A 4IWPA 1ZYLA 2YL6A 1ZWWA 2WYHA 4ILGA 2NCZA 5C5BA 2OBLA 4JNEA 4EZPA 3QA8A 1R5EA 3SBTB 4JWDA 2PMRA 1X04A 4H8SA 1Y2OA 1URUA 4AZ7A 3D52A 3RV1A 2BPRA 4I43A 1GNLA 4DYLA 4EZSA 1SU6A 5FLEX 3SYVA 3DX0A 1HWWA 3BVUA 1QWNA 2QKWA 4E3CA 3H0XA 2X5CA 1YWMA 1W9MA 2YIBA 3B51X 1O7DC
chains in the Genus database with same CATH topology
2ND0A 1DKXA 3DPOA 3GI7A 4R5KA 2N3KA 2QXLA 1DG4A 3QNJA 3LMFA 1OA0A 4H6HA 4JN4A 3UITA 2OP6A 3O3OB 4G6QA 4IM2A 1U00A 2JNSA 3T49A 1JQKA 1DKYA 3FD9A 5E84A 3KAVA 3I01A 3ZEDA 3KDRA 4H6IA 2PY6A 2LM0A 3I04A 4EZZA 4HR1B 2YI8A 4KIKA 4MQDA 3N8EA 3ER8C 1OAOA 2ND1A 2KHOA 1BPRA 4IM0A 1GN9A 4WV7A 2YIVX 3DQGA 1SU8A 3O3NB 4EZNA 3C7NB 4R5GA 4ILHB 4M0MA 1Q5LA 4R5IA 4E81A 4EZYA 3O3MB 4F00A 4ILIA 4JNFA 3T48A 2EX3B 1GNTA 3B52X 3T47A 3VEBA 4UDXX 1DKZA 3T4AG 2YIAA 7HSCA 4EZWA 1E1DA 3T46A 1UPXA 3L3OM 4JLCA 3B53X 4IWPA 5FIGA 1ZYLA 4PO2A 4ILGA 4JWEA 3ERCC 1MJGA 2NCZA 4NPHA 4EZUA 2RT6A 3KAWA 3VKHA 4HR1A 2OBLA 4JNEA 4EZPA 3D2EA 3QA8A 4B9QA 4IWOA 3SBTB 4JL9A 2QFFA 4JWDA 3DPPA 4IM3A 1SUFA 4IW0A 2OBMA 2WINM 3C7NA 3F7WA 3VEAA 3RV1A 2YI9A 2BPRA 4R5JA 4I43A 4EZTA 4WV5A 1GNLA 4FL9A 3D2FA 3I39X 3RV0A 4EZRA 4D8JA 4JWIA 4F01A 4EZSA 1SU6A 5FLEX 4EZVA 4EZOA 5TKYA 3ER9B 2GAFD 3A98A 3DOBA 3SBSA 1E2UA 3DPQA 4UDYX 1YUWA 4E3CA 3OHXM 4EZXA 3H0XA 1E9VA 2Z8YA 4IWQA 2V7YA 2GA9D 2X5CA 4R5LA 4HY9A 1OA1A 2EWFA 1CKRA 4HYBA 3OWGA 3ZEFA 4JWCA 1W9MA 2YIBA 4KIKB 4EZQA 1SU7A 4FM3A 3B51X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZT A;  4EZW A;  3T46 A;  1DKX A;  4WV5 A;  4H6I A;  4FL9 A;  3D2F A;  3L3O M;  4EZR A;  4JWI A;  4F01 A;  4EZS A;  3DPO A;  4PO2 A;  4EZV A;  4EZO A;  4JWE A;  4R5K A;  3N8E A;  2KHO A;  5TKY A;  1BPR A;  2QXL A;  4EZU A;  3DOB A;  1DG4 A;  3DPQ A;  4WV7 A;  3QNJ A;  4JNE A;  4EZP A;  3D2E A;  4B9Q A;  3DQG A;  1YUW A;  3OHX M;  4EZN A;  4EZX A;  3C7N B;  4R5G A;  3H0X A;  4H6H A;  1Q5L A;  4JN4 A;  4R5I A;  2V7Y A;  4E81 A;  4R5L A;  4EZY A;  2OP6 A;  4HY9 A;  1CKR A;  2QFF A;  4HYB A;  4JWD A;  4F00 A;  3DPP A;  4JNF A;  3T48 A;  1U00 A;  3T47 A;  3T49 A;  2WIN M;  4JWC A;  3C7N A;  1DKY A;  5E84 A;  4EZQ A;  1DKZ A;  3T4A G;  4EZZ A;  2BPR A;  4R5J A;  7HSC A; 
#chains in the Genus database with same CATH topology
 2ELB A;  2D1L A;  3DPO A;  3DX4 A;  2N3K A;  2ZXQ A;  2QXL A;  1DG4 A;  1I4T A;  2LXY A;  2FYV A;  4JN4 A;  1R33 A;  3UIT A;  4AKV A;  4IM2 A;  3EJU A;  2F7Q A;  3CV5 A;  3FD9 A;  4AVM A;  3I01 A;  3M3W A;  2KHO A;  1BPR A;  4WV7 A;  1SU8 A;  4R5G A;  3EJS A;  2EFK A;  4EZY A;  4F00 A;  4JNF A;  3T48 A;  2EX3 B;  3VEB A;  2F1A A;  3T4A G;  3OK8 A;  3T46 A;  3BVW A;  4FZS A;  4JLC A;  4PO2 A;  3CKD A;  1LQ7 A;  4JWE A;  2RT6 A;  4B9Q A;  2YKT A;  4JL9 A;  4IM3 A;  3DDG A;  4IW0 A;  3SOG A;  3F7W A;  3Q0K A;  3QNI A;  2OO2 A;  2YL5 A;  4WV5 A;  3HAJ A;  3RV0 A;  4EZR A;  2JNK A;  4D8J A;  4FZO A;  4JWI A;  4F01 A;  2YLL A;  3BUB A;  4EZO A;  1QWU A;  5TKY A;  3A98 A;  3DOB A;  3DPQ A;  4UDY X;  2Q13 A;  3G9G A;  3QWE A;  2Z0N A;  4EZX A;  1E9V A;  2Z8Y A;  4IWQ A;  2V7Y A;  4R5L A;  1CKR A;  1QX1 A;  3OWG A;  4WPE A;  4JWC A;  4KIK B;  1SU7 A;  4FM3 A;  1TQV A;  3EJQ A;  2FIC A;  3I2W A;  2F7O A;  3GI7 A;  2F18 A;  4NQI A;  3ACO A;  3BVV A;  4H6H A;  3EJR A;  2OP6 A;  3BUQ A;  5KBP A;  1U00 A;  2JNS A;  3T49 A;  4AZI A;  1DKY A;  3BUD A;  3L3P A;  2LM0 A;  2YI8 A;  4KIK A;  4I1Q A;  2F7R A;  4MQD A;  1R34 A;  3N8E A;  3ER8 C;  1OAO A;  4IM0 A;  2YLA A;  3C7N B;  4ILH B;  1Q5L A;  3ABH A;  3CZS A;  1GNT A;  3B52 X;  3T47 A;  4UDX X;  2YIA A;  7HSC A;  4AZH A;  3CZN A;  1E1D A;  3HAI A;  3DYT A;  2O0I 1;  5FIG A;  2F7P A;  4AZB A;  3ERC C;  2Z0O A;  2X3W A;  4NPH A;  4EZU A;  3KAW A;  3VKH A;  3D4Y A;  3D50 A;  2QFF A;  1SUF A;  2OBM A;  2WIN M;  3C7N A;  3VEA A;  1HXK A;  4R5J A;  3I39 X;  3BUI A;  3ER9 B;  3SBS A;  2RAJ A;  1PS3 A;  2OZN B;  3D51 A;  4HY9 A;  1OA1 A;  3LVT A;  3ZEF A;  3PLT A;  3BVX A;  2F1B A;  2ND0 A;  4NSW A;  4R5K A;  1O7D B;  2WYI A;  3QNJ A;  3LMF A;  4AZG A;  4BNE A;  3EJT A;  4G6Q A;  1TQT A;  1JQK A;  3DX1 A;  5E84 A;  2Z0V A;  3KAV A;  3ZED A;  3KDR A;  4H6I A;  2PY6 A;  3I04 A;  3D4Z A;  4HR1 B;  2V0O A;  4ATM A;  3QE6 A;  2ND1 A;  4AZ6 A;  2RAK A;  2C08 A;  1GN9 A;  2X3V A;  3DQG A;  3O3N B;  4E81 A;  3O3M B;  4ILI A;  2D4C A;  1X03 A;  4DCN C;  1UPX A;  3B53 X;  2Q12 A;  2GF4 A;  1MJG A;  2OW7 A;  4HR1 A;  3D2E A;  4IWO A;  1I4D A;  2MI7 A;  1WDZ A;  3DPP A;  2EFL A;  2YI9 A;  4EZT A;  1TQS A;  4AZ5 A;  4FL9 A;  3D2F A;  3DX3 A;  4EZV A;  3CAZ A;  2GAF D;  1E2U A;  4AZC B;  1YUW A;  3OHX M;  1I4L A;  2GA9 D;  2EWF A;  4FZP A;  4HYB A;  2YL9 A;  1TQU A;  4EZQ A;  4EZZ A;  1DKX A;  2YL8 A;  3RPM A;  1I49 A;  1OA0 A;  3O3O B;  4AZC A;  3DX2 A;  3BLB A;  3BUP A;  3BVT A;  5C5B B;  3HAH A;  3CVR A;  3LLL A;  3Q84 A;  2RAI A;  2YIV X;  4EZN A;  1TQW A;  2ALW A;  4M0M A;  4R5I A;  3EJP A;  2X3X A;  1DKZ A;  1HTY A;  4WPC A;  4EZW A;  3DDF A;  3L3O M;  2OW6 A;  4IWP A;  1ZYL A;  2YL6 A;  1ZWW A;  2WYH A;  4ILG A;  2NCZ A;  5C5B A;  2OBL A;  4JNE A;  4EZP A;  3QA8 A;  1R5E A;  3SBT B;  4JWD A;  2PMR A;  1X04 A;  4H8S A;  1Y2O A;  1URU A;  4AZ7 A;  3D52 A;  3RV1 A;  2BPR A;  4I43 A;  1GNL A;  4DYL A;  4EZS A;  1SU6 A;  5FLE X;  3SYV A;  3DX0 A;  1HWW A;  3BVU A;  1QWN A;  2QKW A;  4E3C A;  3H0X A;  2X5C A;  1YWM A;  1W9M A;  2YIB A;  3B51 X;  1O7D C; 
#chains in the Genus database with same CATH homology
 2ND0 A;  1DKX A;  3DPO A;  3GI7 A;  4R5K A;  2N3K A;  2QXL A;  1DG4 A;  3QNJ A;  3LMF A;  1OA0 A;  4H6H A;  4JN4 A;  3UIT A;  2OP6 A;  3O3O B;  4G6Q A;  4IM2 A;  1U00 A;  2JNS A;  3T49 A;  1JQK A;  1DKY A;  3FD9 A;  5E84 A;  3KAV A;  3I01 A;  3ZED A;  3KDR A;  4H6I A;  2PY6 A;  2LM0 A;  3I04 A;  4EZZ A;  4HR1 B;  2YI8 A;  4KIK A;  4MQD A;  3N8E A;  3ER8 C;  1OAO A;  2ND1 A;  2KHO A;  1BPR A;  4IM0 A;  1GN9 A;  4WV7 A;  2YIV X;  3DQG A;  1SU8 A;  3O3N B;  4EZN A;  3C7N B;  4R5G A;  4ILH B;  4M0M A;  1Q5L A;  4R5I A;  4E81 A;  4EZY A;  3O3M B;  4F00 A;  4ILI A;  4JNF A;  3T48 A;  2EX3 B;  1GNT A;  3B52 X;  3T47 A;  3VEB A;  4UDX X;  1DKZ A;  3T4A G;  2YIA A;  7HSC A;  4EZW A;  1E1D A;  3T46 A;  1UPX A;  3L3O M;  4JLC A;  3B53 X;  4IWP A;  5FIG A;  1ZYL A;  4PO2 A;  4ILG A;  4JWE A;  3ERC C;  1MJG A;  2NCZ A;  4NPH A;  4EZU A;  2RT6 A;  3KAW A;  3VKH A;  4HR1 A;  2OBL A;  4JNE A;  4EZP A;  3D2E A;  3QA8 A;  4B9Q A;  4IWO A;  3SBT B;  4JL9 A;  2QFF A;  4JWD A;  3DPP A;  4IM3 A;  1SUF A;  4IW0 A;  2OBM A;  2WIN M;  3C7N A;  3F7W A;  3VEA A;  3RV1 A;  2YI9 A;  2BPR A;  4R5J A;  4I43 A;  4EZT A;  4WV5 A;  1GNL A;  4FL9 A;  3D2F A;  3I39 X;  3RV0 A;  4EZR A;  4D8J A;  4JWI A;  4F01 A;  4EZS A;  1SU6 A;  5FLE X;  4EZV A;  4EZO A;  5TKY A;  3ER9 B;  2GAF D;  3A98 A;  3DOB A;  3SBS A;  1E2U A;  3DPQ A;  4UDY X;  1YUW A;  4E3C A;  3OHX M;  4EZX A;  3H0X A;  1E9V A;  2Z8Y A;  4IWQ A;  2V7Y A;  2GA9 D;  2X5C A;  4R5L A;  4HY9 A;  1OA1 A;  2EWF A;  1CKR A;  4HYB A;  3OWG A;  3ZEF A;  4JWC A;  1W9M A;  2YIB A;  4KIK B;  4EZQ A;  1SU7 A;  4FM3 A;  3B51 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...