3DPRC

Human rhinovirus 2 bound to a concatamer of the vldl receptor module v3
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
237
structure length
237
Chain Sequence
GLPVFITPGSGQFLTTDDFQSPCALPWYHPTKEISIPGEVKNLVEICQVDSLVPINNTDTYINSENMYSVVLQSSINAPDKIFSIRTDVASQPLATTLIGEISSYFTHWTGSLRFSFMFCGTANTTVKLLLAYTPPGIAEPTTRKDAMLGTHVIWDVGLQSTISMVVPWISASHYRNTSPGRSTSGYITCWYQTRLVIPPQTPPTARLLCFVSGCKDFCLRMARDTNLHLQSGAIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Minor group human rhinovirus-receptor interactions: geometry of multimodular attachment and basis of recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Virus
molecule keywords Protein VP1
total genus 32
structure length 237
sequence length 237
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dprC00
3TN91 2RS52 3DPRC 4GB32 4LLFA 4CDQC 3VBSB 4Q4Y2 5CFDC 4AEDC 3ZFFC 3ZFEC 1AR61 3J8F3 1RUJ3 1Z7S1 4RR3B 2RMU1 1FOD1 1PGW1 2WFF1 1VBC1 3DPRA 2XPJA 5C4WB 1AYM1 2WWSA 1QJY2 1NY71 1TMF2 2R063 4JGZB 1AYN3 4N53C 4NWVA 4SBVA 5AC91 1Z7S3 2ZTNA 5CFCC 2FZ2A 1VBB3 4JGYB 1WCDJ 4QPIA 1QJX3 1VAKA 1MEC2 1RUC2 2WZR2 1POV1 4GMP1 1OPOA 1OOPA 2R073 1ZBA2 2HWC3 1ND2C 4Y5Z0 4RS5C 3JB8A 2VQ0A 3NAPA 4PDWC 1QJU2 1QJU1 3CJIB 1ZBE3 5ABJB 3ZFGA 5C9AB 5L7OA 1K5MA 1EV13 1VBE2 1F2NA 1COV2 1H8TB 4RR3A 3VDDC 1HXS2 1D4M3 1HX6A 5C4WA 1AL23 1EAH2 2X5IC 1HRI3 1R083 1HRV2 3M8LA 2RS12 2WLPA 1RMU2 4Q4Y1 2ZAHA 1ASJ2 2RR12 2RS32 4JGYA 4GH4A 5L7OC 4RHV2 1K5MB 1V9U2 1AYN1 4RFT0 2HWD3 4JGZA 4CEYC 1RUD2 1NOVA 1OOPB 1PIV3 1VBD2 4CEYB 1D4M1 2PLV3 1AR72 3ZXAC 1VBC3 3VBUB 1RUE3 2HWB3 1FOD3 5C8CC 5ABJA 2PLV2 5L7OB 1PIV2 1HRV1 2FZ1A 1AR91 2BBVA 1BMV2 1C8NA 2RS11 1RVF2 3HAGA 1NCQC 2R071 1R092 1R091 3TN93 3NAPB 1F8VA 5BNPB 1ASJ3 2RR13 3CJIA 1DDLA 5DDJ1 2HWE1 1PO21 1ND3B 1H8TA 3VBRA 1H8TC 1BEV3 4IV1B 5D8AB 2WFF2 4Q4V2 4Q4W3 3ZFEA 3VBOA 4CDXB 2R061 4Q4V3 2IZWA 2GSYA 1VBA3 2BUKA 4CDXC 3VBUA 1PGL1 1PGL2 2MEV3 3J8F1 4Q4X3 1R093 4BCUA 2R072 1RVF3 1B35C 4CEYA 4N53B 4JGZC 1FMD1 2MEV2 2MEV1 5JZGA 5ACA1 2R041 1VBC2 1AR71 1Z7S2 2RMU2 1VBA2 1VBA1 1RUF3 1POV0 2WS91 4IV1A 4N43B 3ZFEB 5C8CB 4WM7C 1QJY3 3ZFFB 4AEDB 4FSJA 5CFDB 2RM21 1NG0A 2RS33 3S6PA 4CDQB 4FTBA 1RVF1 4Q4X1 4Q4X2 3VBRB 1RMU3 5D8AA 4WM7B 1ASJ1 2RR11 1AR62 4N43C 1CJDA 5FMOS 1ND2A 1COV3 1EV11 1NY72 3ZFFA 4WM8A 1NCQA 1BEV2 2HWB1 1FPN2 1AR73 2XBO3 1VB2A 3VDDB 1B35B 2HWF3 1VBE1 2R043 1PIV1 1X36A 1RUG3 4WM7A 2HWD2 3TN92 1C8M2 4CEWB 5ABJC 1V9U3 4EJRA 5C8CA 1QJX1 3JBG2 3JB4C 5JZGB 1RHI3 1ND2B 1AR93 1VBB2 1VBB1 5JZGC 4RHV1 1X33A 1FOD2 1AYN2 4CEWC 5A33A 1AR81 5D8AC 1RB8G 1HRI2 1R082 1NA1A 1PVC1 4JGYC 5CFDA 1AL21 5J98B 1AL0G 1D4M2 1ND3C 4CDQA 1R1A3 1RUD1 1FPN1 1RUJ2 1SMVA 1RUJ1 3VBFB 1AR63 1ZBE2 1ZBE1 2X5IA 1QJU3 5C4WC 4Q4Y3 3VDDA 1ND3A 1RHI2 1MEC3 1RUC3 2WZR3 4CEWA 4PDWA 1EAH3 3VBRC 4RS5A 1RUG2 3VBSC 1OOPC 1MQTA 5DDJ2 2R042 1PO11 2HWF2 1FPN3 1PGW2 1COV1 1RUE1 2HWB2 1RUE2 5FOJB 2PLV1 4QPIC 5A33B 1AYM3 5CFCA 1QJX2 5AC92 4RHV3 4N53A 1RMU1 2ZZQA 5BNNA 5J96B 2X5IB 3LOBA 3VBHB 2BFUS 1NA1B 5FMOL 1V9U1 1TME2 1RUG1 3JD71 2WS93 1TMF3 1RUF1 4N43A 4IV3C 3CJIC 1E57A 4PDWB 1CD3G 1PO12 2HWF1 1HXS3 4AEDA 2XBO1 4Q4W2 5ACA3 1A6CA 1VB4A 1FMD3 5BNNC 2WS92 2GH8A 1HXS1 3IDEA 5K0UC 4IV1C 2HWC1 1ZBA3 2HWC2 3JD73 2RM22 1BBT3 5CFCB 4YVSA 2HWE2 5BNPC 3NAPC 2DF7A 4WM8B 5BNNB 1NCQB 4FTSA 3JD72 4GMP0 2RM23 1MQTC 1B35A 1VBD3 4RQPA 2BPA2 2R062 1VRH1 1VRH2 1BEV1 1PVC3 4YVSC 3VBUC 2WFF3 3DPRB 3VBHA 1GFF2 3VBHC 1PO13 3FBMA 5GKAC 1K5MC 3VBOC 1OHFA 2RS51 4GB31 5A32B 1TME1 1MEC1 1RUC1 1HQNA 1IHMA 2WZR1 4NWWA 1VBE3 4IV3A 1AUYA 1EV12 1PO22 4QPIB 4CDWB 1RUI3 1AR82 3VBFA 5LK7B 1AYM2 4QPGB 1VBD1 1R1A1 1RUD3 1C8M1 4RQPB 4YVSB 5C9AC 3ZFGB 5C9AA 5K0UA 1RUH1 1RUH2 3JBG1 1AR83 5A32A 1PO23 1W39A 4RS5B 5DDJ3 1AR92 1MQTB 1QQP1 1QQP2 1BBT2 2QQPA 1BBT1 4YVWB 4CDWA 1RUH3 4Y4YA 3VBFC 1C8M3 2RS31 2RS13 4WM8C 1RHI1 4CDUA 4FTEA 2Y26A 2TBVA 4GH4C 5BNOB 1HRV3 1FMD2 1AL22 4QPGA 5ACA2 5BNOC 4GH4B 5K0UB 1RUI1 1RUI2 1R1A2 1TMF1 4YVWC 1POV3 1BMV1 2HWD1 1TME3 2RS53 4GB33 4RR3C 1NCRA 4IV3B 3ZFGC 5BNOA 4RQPC 1QQP3 5AC93 1QJZA 4QPGC 1NA1C 2BFUL 3JBG3 1ZBA1 1HRI1 1R081 3VBSA 1PVC2 4CDUC 1VRH3 4Q4V1 5BNPA 4CDWC 1M06G 1RUF2 1QJY1 2RMU3 1NCRC 2XBO2 4Q4W1 4Z92B 1NCRB 4YVWA 3VBOB 2HWE3 3J8F2 1EAH1 4CDXA 4CDUB 4GMP3
chains in the Genus database with same CATH superfamily
3R6SA 2VY0A 4JX0A 3HVDA 1OF4A 2LROA 2YGMA 2GNBA 3P1IA 4KWKA 4LLFA 4CDQC 4QWNA 4CXYA 5CFDC 2BV4A 4A45A 3ZFFC 4Q27A 5FPVA 2QQMA 3HEIA 4CCCA 2DUQA 1RUJ3 1Z7S1 3KS7A 2GC3A 5IW0A 1PGW1 2P6CA 3UETA 2BGPA 2FQPA 4OUMA 4TWTA 4UFIA 1JHJA 4AAXA 3TNPB 2Q8CA 2FDFA 4KU8A 2CGOA 3P3PA 3VHNA 2QKDA 4SLIA 3ZXEA 5FZFA 3WQ0A 2WDBA 1EUUA 1XE7A 2DCYA 3LZZA 4KG8A 4UW4A 4W6YA 4HONA 4YG3A 3DEMA 4M3CA 3ZN6A 3NWKA 1OFNA 4W6WA 5A7PA 1G8WA 3ZR5A 3K77A 4R9BA 3KZ4C 4JTOA 1PHMA 4EZ4A 4YSFA 4GJZA 1ZREA 1VAKA 4PBPA 5IWFA 2DVAA 2OUHA 3OCPA 4GWIA 4LKDA 3RJRA 1OPOA 3ZN4A 3C7HA 2R073 2VNGA 4KQ7A 1OD5A 3CMGA 3LEMA 3O0VA 1H9PA 1SACA 4PDWC 4CUBA 1QJU2 3GCWA 3R4UA 2H0VA 3CJIB 2YBPA 4LO4B 5C6CA 3ZFGA 2EIBA 3ZSJA 1C1LA 4A41A 3TEWA 1S55A 1GNYA 1TVGA 2A6VA 1ZZ9A 3AP7A 1K5MA 3DUIA 3KV9A 3HN1A 3NNJA 1D2QA 1H8TB 5GLUA 5T52A 3H1YA 3RGBA 4HFSA 3SXWA 4AG4A 3ROUA 3BKZA 1HX6A 3PMEA 3I3EA 5C4WA 4AEMA 2WT1A 1OUSA 4QMAA 4XQDA 3GF6A 1YQ8A 3EYPA 4UF0A 4FXGB 5FMCA 2XH6A 4BJ0A 4BE3A 2RS12 2WLPA 1WBFA 3K2OA 5FLJA 3U1XA 5FP3A 4XFAA 5A3TA 3OPTA 4HKWA 4NO4A 1V6IA 4PCRA 5BNQA 1G7YA 1WKYA 3LGRA 1WMXA 2VCCA 4HVOA 4ZU4A 1UYZA 1RINA 2R16A 5JIUA 3AYDA 4AOCA 1WLTA 4JGZA 1KS5A 5KHJA 4PIZA 5LB6A 3S7EA 3LEIA 4XOGA 1NOVA 1VBD2 4ATFA 3ZXAC 5BY5A 4CP9A 4A42A 1VBC3 2C9AA 4B1LA 4DXSA 1RUE3 2XONA 1FOD3 3ZIXA 2PTMA 5C8CC 1SG3A 2AGSA 4XQ4A 5L7OB 2PLV2 2Q4SA 3I59A 4I0AA 2XLGA 1JZ2A 4HG6B 1CPMA 1HRV1 1AR91 3ZXJA 3WNLA 2VW0A 4ZONA 4Z92B 2JG9B 4GALA 2YROA 1KITA 3USUA 5JOYA 2VZOA 3OPWA 1HN1A 3O0XA 1XSQA 2BW8A 2KR2A 3TN93 5A1FA 4R9AA 2CHHA 4P14A 4DRRA 2ZGQA 1MS0A 4JQTA 3PUAA 4Q1PA 5EHDA 3RNSA 1W2OA 5CYYA 3VBRA 1BEV3 2GMPA 3WINE 5D8AB 5EJ1B 3WT3A 5I8YA 1GZWA 1CPNA 1UY4A 3PUIA 4LNVA 4W8JA 2WZEA 4G9SB 1C1FA 1WLCA 5IYYA 4XTPA 5FYZA 1F31A 2QQLA 1RIRA 3MDPA 3DCQA 3A0KA 4AHZA 3H50A 3WF1A 4CP0A 3MLJA 1W8NA 1W8OA 3OGGA 2PHXA 4URTA 4UW5A 2MPFA 2ZXQA 3ZKYA 1WA4A 4CDXC 2ARAA 2EALA 3I4IA 2VTXA 4QXKA 1PGL2 2ES3A 3ETPA 3J8F1 1JMUB 4BCUA 2IXCA 1BXHA 3I7DA 3U4SA 4K20A 2HEWF 1N3OA 1B35C 2OT7A 4HOOA 1JYCA 2YBKA 2ZGRA 5EYYA 4AFAA 4B7KA 3E5QA 5A3UA 5JSPA 2Q8OA 4CXXA 2GN7A 1UOFA 5JZGA 4IUGA 1BCXA 5ACA1 4LXLA 5HPOA 5IFPA 4YW6A 4J6GA 5GZFA 3H8RA 2J1TA 1VBA2 2D3SA 1LOFA 1VBA1 4Q8LA 3IDBB 3DGTA 4E4HA 1GR3A 4JCKA 2WS91 2VOVA 4AEJA 4AF9A 1G9FA 1DIWA 4MYEA 1O59A 3QOPA 5A7QA 3WW2A 5IK8A 2AYHA 3GJAA 2P2KA 3BTXA 4UOJA 4QQLA 1F9KA 4GWJA 4EN6B 4L2NA 2CNAA 2RS33 1FV2A 3LPFA 2BOJA 1RVF1 4JRAA 2WLQA 4CDQB 4QX8A 5LATA 4CP1A 1W6NB 3PVOA 3MI8A 3ZIWA 3AKQA 1H4HA 1XNBA 2VGDA 3RWKX 2AREA 1WMDA 5KC5A 4OHXA 1CX4A 3AMHA 5F9TA 1AR62 4Q2FA 4TLFA 1RJ8A 1S0BA 4XJUA 4MUVA 4NR1A 1UWWA 1XU2A 2QVSB 2JDHA 3PUSA 4LHSA 4YLZA 3MHZA 3FLRA 5DUWA 4BPZA 3BI3A 3QACA 3B9IA 5FAXA 1XNKA 3OJBA 3KD4A 4QGMA 4XAAA 5C3RA 3M3QA 2NYYA 3MZHA 4YW7A 2YUEA 4R8HA 1B35B 1IOAA 1AJKA 4RSUA 4HBNA 4W65A 5F5IA 2G9GA 3N9QA 3WW3A 1IQAA 4C90A 1S0DA 2WQ8A 4UFLA 2EAAA 3OY8B 2V5YA 4HANA 4CCLA 2GN3A 3K75B 4QX5A 4YZ2A 3UNPA 1V9U3 4EJRA 5C8CA 3MIEA 5DXDA 4AYUA 3VZOA 3ZYJB 3JB4C 3V0BA 1OUXA 4YARA 1GZ9A 3RWNA 4P9YA 3UKVA 4XYXA 1AR93 1SBFA 1J59A 1ULDA 2WO2A 1GZTA 4QDQA 1A3KA 1XB9A 4RHV1 2Z79A 1GZCA 4YFZA 4OUEA 3RZMA 1SLLA 4YG6A 4C8DA 4Y1XA 4CEWC 1YJLA 4K9SA 2OKXA 1SZBA 3VDCA 4AFDA 5D8AC 3I59B 1RB8G 1R082 2XJPA 2C6SA 3P6BA 1VP6A 2IWGB 1AL0G 1ENSA 3E5UA 5J98B 4Y1YA 1MPXA 1UKRA 3VKNA 3VDAA 4ES8A 2JG9A 4NMIA 4BK4A 4AEKA 2Z42A 3SKJE 1SLIA 3RPQA 4MLOA 3VBFB 1ZBE2 3NW4A 2X5IA 4P9GA 1DGRN 3ZLIA 1K3IA 4KG0A 2LM3A 1YQCA 3FZ3A 4DMIA 3I2IA 1UZ0A 5GLWA 4IEWA 3AZWA 2WZR3 4C91A 3WW4A 4CEWA 2WAAA 4D6QA 4PDWA 1SFNA 1BHGA 1MVQA 2R32A 2C26A 5HV0A 4AWDA 1D0GA 4Q0VA 4C0BA 2R042 3PURA 2HWF2 2VOKA 5IVJA 5LEKA 4ZY9A 1IS3A 2IXKA 2ZGOA 5F7UA 2NMOA 1PGW2 3NRUA 3NVCA 4FFHA 1RUE2 5LBBA 5FOJB 2DVFA 1L7LA 1LOGA 2OQ6A 4L8QA 1LODA 1H2LA 5FXVA 2SLIA 3WUDA 5IATA 2WQZC 1DGRA 3NL1A 4CU7A 1HJFA 5CFCA 5E8AA 3OB8A 4QXHA 2NM1A 3AZVA 3R05A 5AC92 2VULA 2J42A 2VZUA 1SEFA 3WNMA 3JXSA 4DEQA 2B7YA 3AMQA 4JKLA 2WT2A 4XVHA 5GLZA 3UK9A 5KHIA 1NA1B 2D3PA 4CXWA 1KGYA 4LUKA 4XJAA 3JD71 1SCSA 4LA3A 1YI9A 3ETQA 3J4UH 3VUOA 5KHKA 5C5TA 2PQSA 4MG2A 2HWF1 1HXS3 1W04A 5EJZB 1ZZ8A 4Q4W2 5DAWA 4ZXKA 4O9EA 2G9ZA 2E51A 4AI8A 4XEZA 4QU1A 5LRRA 1XE0A 5FPXA 1VAVA 3BU0A 2ZGKA 1OLQA 3LA3A 2Y6GA 5LA2A 1VB4A 1FMD3 1NLRA 3N7JA 3MV11 5CAZA 1IS5A 3OYWB 1WCQA 1ZVFA 3B3QE 5DABA 5F2SA 2X29A 4O9GA 1YEWA 2HWC2 5JXJA 4AZZA 5L36A 4DZGA 1VE0A 2RDQA 1FX5A 1W6QA 1XSRA 1V6LA 2ZGSA 1J84A 4E27A 4Z82A 3ZXLA 1OPMA 4LBJA 4XETA 5BNNB 4N9HA 1SPPA 3WDXA 4R52A 5M0TA 4ZHNA 2RM23 2JE9A 1PK6A 2ZKLA 3JD72 2CGPA 1MS8A 4HK9A 1B35A 1VBD3 5L9VA 4FAHA 4DEVA 5FY7A 4CRQA 4RQPA 2XQRA 4EV0A 1VRH1 4BQ3A 1VRH2 2P37A 2VVFA 4IEZA 4DINB 1N1VA 3O1MA 4XUTA 1IS4A 2DTWA 5F2WA 4H14A 4CCOA 3MF6A 3V0BB 1Y3TA 1LEMA 2VBPA 3I3MA 4LMFA 4YW2A 2QQVA 3VBHA 1GFF2 2HEYF 4IE7A 2DV9A 5A3WA 3VBHC 3S0MA 1OBNA 3N4MA 1F35A 3EXUA 1QU0A 4CCEA 1JUIA 2V5DA 2ZX1A 1VIWB 2W1QA 3BODA 3I2KA 5FTTC 3X29B 1QNWA 1UZYA 3RS6A 2DCTA 4AXOA 1L7RA 3RZGA 4WZFA 3EJKA 2RS51 4GB31 1JZ7A 5I0RA 1TME1 3ELNA 4LIUA 1HQNA 1XNAA 3N7KA 1LOEA 3A22A 4WVVA 4NWWA 2AC1A 1PO22 4OHWA 4QPIB 2FDIA 4CDWB 4LBQA 2AEZA 1UOGA 4UFHA 2JDKA 1C28A 3DF0A 3HD8B 3OPZA 3OBAA 3VBFA 3DN7A 4D0QA 1AX0A 1UYPA 1FXZA 1H1IA 2VNVA 3GHMA 1WD3A 3A4UA 5F3GA 3I2GA 3AYAA 1DQ2A 3V64A 4NIIA 1C8M1 1DGWA 4EN0A 2W0XA 4YVSB 5E6HA 5F39A 2J1EA 2Y0OA 2F17A 3HOBA 1WD4A 4GQ7A 5C9AC 2VQAA 2XOMA 2ZBJA 3ST7A 5A32A 1K5JA 1W9TA 1PO23 2WO1A 1W39A 1N1SA 3RI8A 4AQ2A 5FO8B 1MVEA 1AR92 1QQP2 1BBT2 3N36A 2GC1A 2P3YA 3AFGA 3CDZB 4GJYA 1EPZA 2BERA 4UBGA 4Y20A 4P02B 3W21A 2EA7A 3NKTA 4QKDA 1C8M3 4YM0A 3OD0A 3VGIA 3OGSA 3T30A 1UIKA 1QOOA 5BNOB 2XHKA 1S0EA 2JIGA 1CWPA 2EAKA 1O8SA 3RYPA 5FQ0B 5I91A 3IPVB 5JR7B 2D40A 4FPCA 4AVBA 2JDUA 5FZHA 3ZPOA 4HLTA 3BCWA 3PJYA 2B9VA 3IWZA 4QQHA 1TMF1 1H8VA 4QX0A 4QB1A 4YVWC 1BMV1 1Z0HA 2WFPA 3UKTA 5T3NA 3ES1A 2UU8A 1NCRA 3OBTA 1S2BA 3OGVA 4R9DA 1QJEA 2E9QA 3AMNA 2EF6A 5FZ1A 2VMIA 3WQBA 3ZFGC 4AI3A 3LF7A 5JLVA 1OI6A 1G6NA 2HKXA 2A5ZA 3ZN6B 3JCIA 2IVJA 1WW7A 1PNGA 3D0JA 3VKOA 2BFUL 1PZ9A 1TEIA 1ZM1A 3S5QA 5A3NA 4OZXA 4NHKA 4P08A 4FAGA 1HRI1 1PVC2 3LWCA 3MW4A 3H1MA 1WW4A 1VRH3 4Q4V1 3RZZA 4Z8BA 4IW3A 1SLAA 1GQHA 3NV4A 3SCHA 5AVPA 1OQ1A 4D6RA 4MSVA 2C1FA 4A44A 5FWJA 1NCRC 3K3NA 2ORXA 4DS0A 4B4QA 1WZXA 5FLIA 5G05L 4YFWA 3S7IA 4DRVA 4YVWA 3BIWE 1GUIA 3VBOB 5FMBA 4CU6A 1D0HA 3J8F2 3NO8A 3ILFA 4XBLA 5J7MA 3B69A 4XCBA 2PHWA 4GMP3 3ZXFA 1SPPB 3IMNA 4CUAA 2K9ZA 4TN7A 2RS52 4GB32 5IVEA 2JICA 5EQUA 4FT8A 1NQDA 2XVLA 1UKGA 3AYCA 3LFMA 4PF1A 4AEDC 4E8CA 5LASA 4IE6A 3J8F3 3I2JA 3K46A 1NYWA 4I3GA 1GOFA 1OVSA 1CZTA 3PVBB 3BTAA 2O0OA 1KEXA 1AYM1 1VAMA 2WWSA 2YV8A 3FN9A 1XQNA 4MGTA 2Q1ZB 4NOTA 2ADEA 3T0BA 3USSA 3T2TA 5FPZA 4JGZB 1AYN3 4NWVA 4C1WA 1OFSA 1XYPA 3MUZ1 2AUYA 4FO9A 5HI0A 1GV9A 2ZTNA 5A7WA 1CAXB 2E7AA 2Y6KA 4FOWA 5SV5A 4QB6A 4BZ4A 3I2HA 4JGYB 4CPBD 1FNZA 4QPIA 4QX3A 2Y33A 3ZYFA 1YJKA 5F3EA 1AXYA 3Q8BA 3WUCA 3JQWA 4JRLA 3IN9A 2ZEXA 1RUC2 2YU2A 3B02A 1POV1 5DZFA 4FPLA 5HV4A 2JDPA 3USUB 1W2TA 4NPRA 1ND2C 4Y5Z0 3U10A 3ZN5A 1G9DA 2VQ0A 1HIXA 1GQGA 1LHWA 1QJU1 3WEZA 2JG8B 4QXCA 1JW6A 5ABJB 4EROA 4FFGA 5IAXA 3HT1A 3THTA 2CAUA 3DYOA 1VBE2 1C4RA 1COV2 4RR3A 1JODA 1Y4WA 3C8XA 3VDDC 2AH2A 2VMEA 5FR3A 5IVFA 2NMNA 4IEUA 4FPHA 3FX3A 1R083 4Y20B 1HRV2 4QHZA 5F1RA 1ZA4A 5F3CA 1XXNA 2ZOEB 2EIDA 5HCBA 2BJSA 4PQQA 5F32A 4ES9A 3S57A 1L3JA 3MO4A 3AK0A 1VMHA 3HQRA 2OVUA 4K21A 5FZKA 2QQKA 5T5LA 1E5HA 5T54A 2BGCA 3RDIA 3AKSA 4MV2A 1DFQA 2JENA 5FZMA 4B1MA 3PTYA 1KDMA 2XL9A 2CYFA 5CIRA 1V9U2 5CKNA 1AYN1 4LO8A 1Y9MA 4RFT0 5FCCA 3OEBA 1RUD2 2G9FA 4YYOA 3HPNA 1OH4A 1OOPB 2ZAAA 3ZPYA 5GM0A 3WDYA 2YZ4A 2XWJB 2DBIA 1JYIA 1S0FA 3CHXA 2XHNA 3WF3A 3NQHA 3POBA 4TXWA 3GALA 2VZSA 2ORZA 2VE1A 3VD7A 4CE8A 1YQ6A 4E2SA 4LEJA 1PIV2 4P9WA 4PT6A 4M0NA 5JXHA 3D8CA 2FZ1A 4Z07A 2W95A 1JU3A 5FUNA 1HLCA 2XJQA 1BMV2 1C8NA 5F5CA 4XJZA 4XDQA 1RVF2 3NV1A 5EIYB 5IVCA 2VMHA 2R071 4CCMA 5BYNA 1A8DA 2DDUA 3NNGA 1AF9A 4EN8B 3O1SA 3NAPB 1NX9A 1JH5A 3OBRA 1QJFA 2PMWB 5FMDA 2ID4A 3VL9A 2K0GA 4QD2A 5DDJ1 3IDAA 3OOXA 5ERLA 4CSWA 1ALYA 1PO21 1F15A 2P3IA 3IT8A 5C3SA 3HNBM 2Y6JA 1SBDA 4Q4V2 5B4XA 3ZFEA 5HXVA 2WBKA 4IE4A 5J36A 3EBRA 3VBOA 3QLQA 5CEHA 2V4AA 4OI2A 1OQDA 2AEYA 2JDYA 4L92A 2AACA 3ZMOA 2Q1MA 1POQA 2XJVA 2ZEWA 1GANA 1H6XA 2QQWA 4Q4V3 3WDVA 2IZWA 5FPAA 1ZRCA 2GSYA 3DECA 4NROA 5AVAA 2DUOA 2FCTA 1QXRA 5SV8A 4MH0E 4DUWA 1QXPA 2XB6C 1FT9A 4LULA 2VXRA 3VBUA 5DUVA 1ZRIA 2JWPA 5DAVA 1PGL1 1WGPA 1DHKB 1ULPA 5I8TA 2QQNA 5LA1A 2B39A 4YW1A 1RVF3 4JHTA 3OGRA 4BMEA 5C33A 1MZFA 3UKNA 5FY4A 3CEWA 4JDNA 4GZ9A 4EZHA 1O6UA 3V0AB 4CEYA 2ADDA 4ASMB 1W0OA 4JGZC 5E89A 1REEA 2MEV2 2MEV1 4M3CE 3E6DA 3SMHA 2ZPXA 2W52A 2FMYA 4Q5OA 3ZYHA 4AVCA 1GP5A 2R041 3K4DA 4BQ4A 1ULOA 3RZLA 4FPOB 1AR71 1W2NA 5FY0A 4JDMA 5EXOA 5A7WB 5J3UA 1POV0 4ITCA 4IV1A 1YXWA 2ZX3A 4N43B 1HB1A 1B09A 1LOBA 5FDBA 5IVYA 5C7GA 3HBKA 4AEDB 5L9BA 3POJA 4FSJA 1SBEA 1UYYA 2RM21 5EP9A 4MO3M 5IAVA 2PHUA 3H1WA 1WBLA 3HJRA 3FBYA 3I2FA 2H0BA 1RMU3 3ZYGA 2PYTA 5KBFA 2KXLA 4W4ZA 2VCBA 5D1IA 2C5DA 4AFBA 4NIDA 3WOGA 1ZZCA 2CY6A 2GMEA 1JS9A 4CPBA 3B01A 5FZCA 1CJDA 2VXJA 4Y1UA 2TUNA 5FK7A 4CZSA 1DYKA 4DY5A 3CU7A 2JB8A 3H3ZA 1COV3 3U78A 1CQ9A 4ET7A 3AYEA 1U5YA 3O0WA 3OG2A 4LPLA 1S2KA 2D6MA 5FZDA 3ZFFA 4EWEA 3NSTA 4L0PA 1BQPA 3KVBA 5ANQA 2ZHLA 1BEV2 1IKQA 2HWB1 2QNKA 1XU1A 3I2DA 3KWVA 3ATGA 1VB2A 3VDDB 1CESA 3AB0A 4AE2A 1ZX5A 2HWF3 2QUOA 2RVAA 3AKPA 2QDRA 3N35A 1PIV1 5FY9A 3RMXA 3U07A 2VTXJ 1UYXA 1LGCA 1UOBA 3TN92 1IKPA 5EYXA 5ABJC 5A3PA 4EE2A 4IXLA 1GBGA 2GU9A 1OLMA 4DXTA 2GH2A 5FXXA 1D7PM 1LOFC 4ZKTB 2VZPA 4QM9A 2EVXA 1ND2B 1Y7BA 1YHFA 5JPMB 1OXCA 1VBB2 3BB6A 1VBB1 3WDWA 1VR3A 3N9OA 1WLDA 1CR7A 1AYN2 2HEVF 1HN0A 2VW2A 4BISA 5A33A 5I0SA 1RITA 4I2OA 3LOIA 1HRI2 2K2SA 1NA1A 1LESA 4GAZA 4JGYC 5CFDA 1JZ5A 1JZ3A 5DG1A 2CL2A 1Q5OA 3CLPA 1RC6A 1VRBA 2JE8A 1JOPA 5A1AA 1FPN1 5FJHA 3KGLA 1SLTA 1RUJ1 2E53A 2XJUA 1RGSA 4QT6A 4URAA 1ZBE1 1WWYA 5FK8A 4CCKA 1IS6A 1XNDA 3SCFA 3AL5A 1YFXA 1C5HA 2WN3A 2OS2A 4MGIE 3WR0A 2VU9A 4CU9A 4UT5A 1N3QA 4LJHA 1GNZA 3NJZA 4PJYA 4A7KA 4N9IA 2HJIA 4YZ5A 1EAH3 5J48A 4F8AA 3EB7A 1UY2A 4RS5A 3VBSC 1JZ4A 1OLME 1W6QB 1EP0A 2HBUA 1DQ1A 1OD3A 1OOPC 2VVDA 3WP6A 2ZMNA 3DKQA 2OW4A 4LHNA 3PVEA 1FPN3 1A34A 3H7JA 3H8UA 5LCWL 3W20A 2C4XA 1WW5A 3RI9A 4BQ5A 4PHZA 1PK6B 3FL7A 1BVVA 3OUIA 1CIWA 4YG0A 3O1UA 3ON7A 1DLCA 1FNYA 3MUY1 5JXGA 3V0AA 3WQ1A 1XRUA 1KXGA 1JI6A 3MFCA 4M00A 5KXBA 1RMU1 2ZZQA 2QZ3A 4L97A 1S0JA 5GLVA 3UJQA 1NLQA 4HVRA 3OYWA 4L9BA 3T4HB 5J96B 5KC6A 2PHDA 3TRSB 1GOHA 2P4EA 4K8FA 3VBHB 1I5PA 2ZEZA 2BFUS 3P5BA 4N8MA 5FZOB 4YRDA 4XDOA 4J1XA 3MIDA 3ZX7A 3N7MA 2W91A 2YY1A 5FKCA 2YC0A 3B93A 4N43A 4XF1A 1A78A 4DOUA 1F5FA 1CD3G 1PO12 4AEDA 4K1YA 2W08A 5A7SA 4NN0A 3LDKA 2PHTA 4QQ2A 1RXFA 2VJXA 1A6CA 3ORJA 1W6MA 2P17A 1CAWA 1URXA 3ACIA 4OFGA 3T09A 4AQSA 4IGOA 3VZJA 5IUQA 4QDRA 1J58A 2VQTA 3N9PA 5I8SA 1HXS1 1LJ7A 3WZ1A 5DZGA 2IFWA 2WSVA 4BIFA 3POWA 4IE0A 3KCYA 5CG9A 3THCA 2HWC1 2R6QA 1ZBA3 3OEAA 5GJ6A 5GZCA 3HBZA 2RM22 3JD73 1BBT3 4LUMA 1CAUA 1QEXA 2VD7A 3DYPA 4YVSA 3CL1A 1MZEA 2NQYA 3O12A 1Q8SA 3CJXA 1SFPA 2DF7A 1IPJA 4XFBA 3M3OA 3LIHA 5FYCA 1UF2C 2QTWB 1MQTC 3O7OA 2CTVA 1KFXL 5JWPA 3PU3A 3WF2A 4YZ3A 2BPA2 1BJQA 2R062 4QHOA 1GOGA 4DXRA 5KXDA 2GC0A 3M3IA 5FZLA 4FQ4A 4YVSC 4LBQB 3VBUC 4K6BA 3VKFC 3WDTA 1KDKA 4RN5A 2W1UA 5FYVA 2DVGA 2WFF3 4MGSA 4HN0A 4KWUA 3DPRB 1MZ6A 2WINB 3O1OA 1JTZX 4LE3A 5GKAC 4NVPA 4A2UA 4A7YA 2J1UA 3PIGA 3VBOC 2R30A 4CUGA 3O1TA 4BLIA 2E33A 5H9QA 1DG6A 3MBWA 1QGLA 3CZJA 4Y26A 5GALA 2WKKA 5A32B 3SITA 2WZR1 1IHMA 2J1VA 2NP0A 4I01A 3IM0A 1JYTA 5JI9A 1AUYA 5JCTA 3H8XA 4QM8A 4COZA 1RUI3 2K46A 2E31A 3M1HA 3SLIA 4AHWA 5I0UA 1DYOA 1GP6A 4BLJA 4ZS3A 3U0ZA 3ITQA 5FQ0A 4Y4RA 2YGLA 3IPVA 3NKGA 3RZJA 1V6JA 4XF3A 1W0PA 3ACLA 1RXGA 3ZDVA 5C9AA 2JG8C 3K4AA 1BYHA 2PXJA 3LCPA 4X6QB 3JBG1 4GKXA 3BYWA 4Q0QA 2VOTA 3SC7X 4YGBA 3D5OA 2DURA 2QBXA 3VN4A 4RS5B 5DDJ3 2XUMA 5ANNA 4IEQA 2IVIB 4HVQA 5IVBA 2C0ZA 3I3BA 2P5BA 4GULA 4BXSV 3E97A 4YVWB 2XJRA 3MLKA 1RUH3 2PFWA 2EIEA 2JE7A 3MF9A 3SH4A 3WY6A 1W2UA 2PHFA 2VMDA 4WM8C 2RS31 4Y4YA 3VBFC 1PNFA 3UT0A 4EWDA 2XKPA 2DFCA 3WD5A 3NJYA 3KV6A 2VQUA 4H7MA 3K51A 3VD5A 3WX5A 3OUHA 4QPGA 4COUA 1FYUA 1ENXA 1DQ4A 3T4VA 5ACA2 3KHCA 5L73A 1NZCA 3WQ7A 1BVP1 4FPFA 4EN9B 5K0UB 5F37A 1RUI2 1DCSA 3RZHA 2RE9A 2WRAA 4AK3A 2WABA 4QXBA 4RA0A 3ZYPA 5A3MA 1S0CA 2O8QA 2UYBA 1VMJA 3THDA 1POV3 4WVWA 2YC2A 4A6SA 2JDAA 1EYBA 4JQRA 5FZOA 5HCAA 3LDBA 2FBEA 4XIOA 1REFA 2B5HA 4RR3C 2HBTA 4MGZE 2OX0A 2ZEYA 3C2UA 4DY3A 3ALQA 1V0AA 1XYNA 4KNCA 4IV3B 3W5MA 2WQ4A 1T6BX 2XJSA 2Q1FA 5HCFA 2NN8A 2QQIA 5AC93 1CAXA 2RV9A 2A6WA 4QPGC 2VTFA 4QX1A 1NA1C 1XBFA 2YU1A 4META 2NZ9A 2VMCA 2DVDA 2XGXA 1W6MB 1LHNA 1CAWB 3VLBB 1R081 4AL9A 1UMHA 4FPKA 4PI2A 5EV7A 1OVPA 5BNPA 5A7OA 1O3QA 3OUJA 1RUF2 4F7ZA 5LY2A 2RMU3 4M3CB 3N7LA 3N9NA 1UX6A 2ARXA 3ZM8A 1CAUB 5BXXA 2FDGA 4YW4A 2JG8A 2RDRA 2X10A 1AX2A 1LNSA 4NRPA 4IDZA 4FPEA 1XE8A 4CDXA 2IXLA 3H7YA 1W0NA 2ZGTA 3VHOA 2JD9A 1W9SA 3U14A 1M4WA 2BEOA 3CNAA 4Y22A 4CCDA 1QH6A 5C3OA 1AJOA 2VM9A 2VVEA 3WW1A 4QKFA 3WLUA 1PVXA 5FY5A 1JU4A 2ETEA 4K1ZA 2Z69A 2VOXA 3ZR6A 4PIXA 2W94A 2BGOA 1AXKA 4IERA 2RMU1 2WNUB 1FOD1 1YUDA 3POFA 3T2OA 5C71A 5J37A 5CZKA 3HT2A 5C8WA 3DPRA 3ZO0B 5IFTA 4XABA 5C4WB 4ZPIA 2F4PA 3VB9A 1QIQA 4LBOA 1PX3A 1QJY2 2IXIA 1E5RA 1NY71 1R1ZA 1TMF2 1N47A 1WCUA 2MNGA 4AVTA 4N53C 1LU2A 3VZMA 1QF3A 5AC91 3C3VA 2I45A 1Z7S3 4BOWA 1O3RA 1Y43B 5CFCC 4UI9L 5JDBA 2FZ2A 1MS9A 4BA6A 5K4LA 2IFRA 2ZJCA 1XNCA 3NV2A 4KWJA 1L7QA 5E16A 2WZ8A 4KMQA 4JAAA 3HIFA 4MZUA 2HYXA 1MEC2 4LITA 2VZ1A 4UFKA 4IETA 1W6PB 4GMP1 4XFGA 3POIA 2HWC3 4XMIA 3POYA 1VPHA 4YW5A 1G86A 3ZXGA 3NAPA 4XDPA 1LOCA 5EFUA 1CAVB 3Q8EA 5A6ZA 4OI0A 2XLAA 2GNDA 5C9AB 5FZIA 5L7OA 1LCLA 3MPBA 2XL7A 4XUPA 2E7QA 1EV13 2RJKA 3WF0A 3H0OA 5FPBA 1F2NA 1WCSA 4OHVA 1J3PA 2JB4A 3EQEA 2DCKA 4XIKA 4FI9A 4H2AA 1HXS2 3AC0A 3KGZA 4QB2A 3OF1A 3WXPA 1AL23 2D97A 1EAH2 2D6OX 1HRI3 2W2IA 2V73A 1Q8VA 1UY0A 1VLNA 1QDOA 2X5IC 3IIIA 3M8LA 4UXAA 4XFFA 2BTVC 5CISA 4Z2WA 2UY8A 2VL4A 2YG0A 1UIJA 4MOAA 4CTEA 3WVJA 5A3OA 3ACFA 1J83A 1APNA 4LKFA 1H30A 4Q4Y1 2JG9C 3AFKA 1LKNA 4FPGA 2XDVA 3I2OA 4LO6B 2ZAHA 2VNRA 1ASJ2 2L9LA 2RR12 2RS32 3KT1A 2EXKA 3WNOA 5L7OC 1WA6X 2AR6A 4FOVA 3BGAA 4L99A 4LTAA 3B9CA 5FZ8A 3B5LB 1UY3A 4RHV2 5A6QA 2R0FA 1LB2A 3UGFA 2RJ2A 4OMDA 5C5UA 2ZZJA 4CEYC 2P1BA 4XE9A 2ARCA 2IUWA 3K48A 5FRAA 4CEYB 3LFIA 4QQPA 4Y24A 1D4M1 2J1SA 3TWIA 4BQ1A 2PLV3 1AR72 4O65A 2Y60A 4I02A 3I97A 2PA7A 2BOIA 1GNHA 4AVAA 4E2GA 2WSUA 2DUPA 4Y5TA 2J1AA 3RYRA 1BKZA 1DQ5A 1ULCA 4WVZA 4LR4A 5B2GB 5JIAA 2ZA9A 4JKMA 2RS11 1HW5A 1YNAA 2GDFA 2JIJA 2ATFA 4M4RA 4C1XA 1R091 1F8VA 3DYMA 3SEPA 5BNPB 1ASJ3 2IXHA 2RR13 2W68A 4L11A 4UW6A 2KM2A 2ZGPA 4XFIA 1DDLA 3H9AA 2R1DA 4AHYA 1ND3B 2GNTA 1GLHA 1LGNA 3CZUA 2Q8EA 5CBLA 5LZ6A 1NXMA 1JBCA 1X7NA 1H8TC 4J25A 5J09A 1SFYA 2WFF2 1EPWA 4Q4W3 4LO7A 5F3IA 2BWAA 2FD8A 1T2XA 3SEEA 3KT4A 4FP2A 4P9XA 4XJWA 5LRSA 2YXSA 4CDXB 1AVBA 4PQ9A 3PTRB 2WA3A 1I6XA 4OYUA 3G7DA 2BUKA 3HWJA 3ABZA 5FZBA 1XNTA 2VPVA 3WV6A 4XXPA 3ZSLA 1OURA 1UAIA 2VG9A 4OUSA 1VMFA 2Q30A 1AXZA 1K12A 4I0BA 2G19A 5AFEA 2MEV3 3VHRA 1U5ZA 2R072 3GZEA 1D4VB 1RTVA 3FFQA 1LHOA 1O4TA 1S4CA 4NHXA 3BUCA 2ZKNA 4YZ1A 4N53B 5EZWA 1FMD1 3ME2A 4ATEA 1O7FA 1JYNA 2OYZA 1BK1A 1W06A 2JXAA 4RGAA 2BVBA 5IHRA 3CQOA 4A7ZA 1DZRA 1QHDA 4LBMA 1VBC2 1US3A 4QPWA 5J1XA 5I0DA 5LA0A 3I3DA 1Z7S2 2WAOA 1UQXA 4XF4A 5A70A 3FE5A 4COYA 4AW7A 3J7LA 3LSEA 1JOBA 4XZUG 4EWAA 3F2ZA 2P34A 5C8CB 1JOJA 1QJY3 2A6YA 3JZVA 1UPSA 1PM7A 2E26A 4HSJA 3M4FA 4KI5M 4Q1RA 3UESA 3ZFFB 5CFDB 3C7OA 3L9JT 1N1YA 2BZDA 1W6PA 4YM2A 4XURA 2QQUA 3T0AA 4Q4X1 4Q4X2 3WP5A 1DF0A 3E6CC 2PAEA 1MS3A 1SHWB 5T5JA 1UXXX 5D21A 1W8TA 2Y6LA 1HJGA 1ASJ1 2RR11 3FHIB 4HMZA 1RYYA 4S2FA 1LOAA 2PQQA 5FYMA 5EWSA 3R4SA 2N7GA 4HPKB 2B8MA 5FMOS 4DO0A 4DUXA 3WNKA 1CONA 1ND2A 1PZ8A 1GU3A 4H3WA 3UJOA 2VUJA 3PU8A 3FMGA 3C7GA 3KT7A 4LHKA 2OIIA 3D4KA 4KU7A 2YPJA 5FP9A 1NY72 2VZQA 2Z2SB 2VZTA 4JV4A 4WM8A 4XACA 2E32A 1JYVA 1PZ7A 4NIAA 4M0HA 4OMCA 3DV8A 3AP4A 2BU9A 1FPN2 2WWUA 1VBE1 4P9LA 1X36A 4MXVA 5JI7A 2D44A 3CKHA 4UWDA 3KQRA 1LHUA 1V6OA 3UGHA 4DIQA 1RUG3 4WM7A 2HWD2 4CEWB 1C8M2 3WG3A 4D8MA 3T1MA 4YGDA 1LR5A 1QJX1 2UYAA 5FP7A 1DP0A 1TQ5A 2YBSA 3APBA 2OXBA 4HXCA 4IEOA 1RHI3 3VV1A 2XWBB 1WMFA 5FPUA 5JR2A 1QNYA 1W6NA 3AVSA 1V70A 4LOTA 1X33A 4K8RB 2YMZA 2ILMA 2O14A 3OTFA 4XTMA 2P3KA 4HSLA 1AR81 5A6YA 4NUBA 5JSOA 1S2EA 4D7SA 1JYXA 1AL21 4MHUA 1D4M2 5APAA 1ND3C 4N7UA 4XUOA 2W9XA 3IKWA 2RJLA 1P8JA 1DQ0A 1R1A3 1X8MA 3M70A 4LK6A 4LO5B 4IESA 4MHRA 2ZCWA 3VD9A 1RUJ2 5DAXA 3KV4A 2FDHA 1RJ7A 1F4HA 4TTGA 1AR63 4OQ8A 4DNYA 4Y5SA 5LY1A 5C4WC 4UFMA 4FVVA 2Y8KA 5FOBB 3S5AA 2FCVA 1ND3A 4AHXA 1KJLA 4QDSA 4EQVA 3OY8A 3IBMA 1O3SA 3QH7A 4Y3OA 1RUC3 3ZDSA 3HNMA 1C3HA 4P9JA 3LAGA 4O7XA 2D6NA 1KS4A 1U5IA 2AENA 2YFUA 3AP9A 3MIGA 3GXUA 4KBZA 5DMYA 4DQAA 4XCAA 2FCUA 1D2SA 1Q8PA 1MQTA 4JVAA 5DDJ2 4IL7A 2GALA 4F83A 2J22A 1PMHX 1HB3A 1COV1 2WR9A 2RHPA 2QZ2A 4XFCA 2PLV1 4ISRA 1ACCA 1WUVA 3AXEA 4AGVA 3A7QA 4AVVA 3BPZA 5T5PA 5IK7A 2XMLA 5DZEA 4IE5A 2J1RA 3TEYA 4JTNA 2CGNA 4XAEA 1QJX2 4FFIA 4GWNA 1NLSA 4N53A 1NAEA 4RHV3 3J7NA 4LKSA 5BNNA 4D6SA 1DU3D 2X5IB 1US2A 4S2DA 3WCRA 2P3JA 3ASIA 1DGWX 4S2HA 1LECA 3AJZA 4YW3A 1V00A 1YO8A 3ILNA 4AGRA 4AI9A 1V9U1 1TME2 3IAPA 3N9MA 4IEPA 4XBQA 3C7EA 4XW3A 4WBBA 1OSGA 2ZHKA 4IEYA 3CJIC 4IV3C 5CADA 1UOJA 4FOQA 4HL0A 3WG1A 3MW3A 4PDWB 3O5SA 4FTBA 2QQOA 2XBO1 4WV8A 2ZABA 3J26N 3T08A 3UGGA 1GKBA 5T5OA 2PELA 1I9RA 5ACA3 1XJAA 1NKGA 2D5HA 4OHYA 4FCAA 3MW2A 2CDOA 1S0IA 1UY1A 1H2NA 1OQEA 2WJSA 5GLTA 3RG0A 5CG8A 5F8PA 5IK4A 2VECA 4Y1VA 4BDVB 3SH5A 5AFBA 2GH8A 5C3QA 3IDEA 5K0UC 2VH9A 4NHYA 3SH3A 1FAYA 3MEPA 3OGJA 2W3JA 4RFRB 3TAYA 2X8KA 4QKNA 2ET7A 2P6HA 5CFCB 4EYUA 2JEMA 4M01A 3E5XA 3M7AA 4BXFA 1V6NA 3AZZA 1MS5A 1SQ4A 1XYOA 2GP3A 4DFSA 1W8UA 3POGA 4KBBA 5BNPC 5FP8A 4WM8B 4YPJA 5JOZA 1ZZ6A 1QOTA 2YYOA 4GMP0 4HZFA 3I8TA 5GZDA 4NHMA 4BWOA 4QKBA 3ES4A 1DYPA 2W46A 3GGLA 4A6OA 4XXAA 1PVC3 2WWJA 3DXUA 5FYHA 1OC1A 3MV01 3ACHA 3TNQA 2PHRA 4COVA 5JMCA 3OSDA 3SCGA 3L2HA 1UU4A 2A1XA 4LBKA 1PO13 2JJ6A 1YQ5A 3Q9OA 2VZ3A 3GDBA 4LHLA 2CU5A 4X6RB 4BQ2A 5KR7A 3TEZA 2D7FA 1UZVA 1OHFA 2RDSA 2ZX2A 3N9LA 3M3EA 3U11A 3ZVXA 2FMDA 2BVVA 3FLPA 4MGKE 2R49A 3NJVA 1TNFA 3LA7A 3O14A 3EO6A 1MEC1 4GD4A 5EPAA 1Y9GA 2QE3A 3F95A 4XHXA 5BUVA 4NIHA 2B45X 3CF6E 1LEDA 3QD6A 4IV3A 3RVHA 1EV12 1ZRFA 1V6MA 1AR82 4IGQA 2Y0IA 4M4PA 3SKVA 3ACGA 3O1VA 2UWAA 3QCWA 2VO5A 1AYM2 4CU8A 1R64A 3MIBA 4QPGB 3UV9A 2W1WA 1RUD3 4ORFA 4TLGA 4W6XA 5FO9B 4RQPB 3AZYA 4MX3A 5JVVA 3BPSA 5FJKA 5K0UA 3ECQA 3ZMNA 1RUH1 2D6LX 3TYJA 2NLRA 1AR83 4CVUA 1H2KA 2A70A 4LKEA 4CCJA 1GWLA 1UZWA 2WC2A 4PLOA 3P3NA 3BU7A 5IT6A 1YFUA 3BOWA 2DCZA 5CA6A 2X09A 2WT0A 1MQTB 1EUTA 3AMPA 2QQPA 1BBT1 5FYIA 3TB0A 4NIGA 1OH3A 5FZEA 3U4XA 2OUJA 4N90A 1HQLA 1UO9A 4LOSA 2W87A 5A80A 3J7MA 3WSOA 2V4VA 5A7NA 2DCJA 2GMMA 1HRV3 1ZZ7A 5I0TA 1YLLA 2DU1A 3T2QA 2VCMA 3LA2A 3AM2A 5E1RA 3KV5A 1TG7A 3KF3A 3VHPA 5FZGA 4CYDA 4E4ZA 3T0DA 4LBLA 4BMBA 1N3PA 4HKOA 2ZGLA 4GH4B 5A1LA 1AZDA 1PM4A 2ZMKA 3NJXA 4PF5A 2XUEA 4QX7A 4OVEA 3URFA 1OT5A 2O1QA 4QGNA 4Y33A 4E9KA 5K9YA 2BRTA 3RFRA 1UXZA 2A3YA 1SLBA 1FATA 4ARYA 2HWD1 4UYBA 3KM5A 3ZOIA 2D93A 1DQ6A 2D6KA 2F4LA 1BK0A 2WNUC 3EHKA 4G4FA 5DPNA 3MIHA 3W59A 1W8FA 5LBCA 1TNRA 3FHAA 3JQXA 4XMAA 4B3NA 5IVVA 3B94A 4O61A 3KVAA 1QJZA 3K4ZA 1ENRA 3PHMA 4AQTA 4WVMB 4ASLA 2AZ5A 3ZYBA 3LKJA 1VJ2A 2DVBA 1IGOA 3JBG3 1ZBA1 3PNAA 1I3HA 4Y22B 1O5LA 4XUQA 2ZACA 1ODMA 3HR9A 2F6BA 3T1LA 2G1MA 2JDNA 2B9UA 5FO7B 4TYSA 1QJY1 2A6ZA 2EXIA 2ET1A 3A0NA 1LGBA 2XBO2 2WNUA 1QMJA 1JHNA 2XLFA 3HMYA 3I54A 3L2YA 3NNFA 3POEA 2DYCA 4I3PA 3WG4A 2XJTA 1YFYA 4FXKB 4AGGA 4QHBA 5BV6A 4NE9A 2Q8DA 2EIGA 4I09A 2VW1A 4MVTA 2WUHA 4CDUB 5H9PA 2WYSA 2D98A 5LK5A 2WNOA 5FY8A 3TN91 3AVRA 1IG3A 3DPRC 1HB2A 1MS4A 2ZGUA 2W92A 1GYKA 3VBSB 4Q4Y2 1W9WA 4GWMA 4P00B 1KFUL 2UY9A 1W3XA 4LE4A 1ZNPA 5CVRA 2LALA 2Y6HA 5FUIA 2Y34A 1AR61 3ZFEC 2D5FA 2DFBA 3R0RA 3TBDA 4QGLA 3D82A 4RR3B 1IZ3A 5DAPA 4BQXA 3VDBA 2WFF1 5FZ0A 5KXCA 1VBC1 4M3CF 2XPJA 2ZGNA 2XR4A 1T6GC 4OCTA 4CA9A 5DUXA 1W6OB 3D0SA 1OA3A 3VZKA 2YB7A 3VZNA 2R063 1CAVA 5JPNB 1WMEA 2BNNA 3MYXA 4SBVA 4B4PA 4GKYA 2OQ7A 1VBB3 2QFEA 1RUOA 3KLSA 4JHZA 1GQPA 4BQYA 2Q0AA 4XUNA 1WCDJ 1ODNA 1W90A 5IK5A 2WNVA 3LEKA 4MXWB 1GSLA 1UU5A 4NJ4A 4Q26A 1QJX3 2A73B 1H1AA 2WZR2 5FZAA 1G9CA 3NV3A 2VCAA 5FFOC 2DTYA 4D94A 2EXJA 1OOPA 1ZBA2 2A7AA 3GNEA 2UURA 4RS5C 1UL9A 1W8WA 3KCXA 3MICA 4DPNA 3JB8A 5KXEA 4S2GA 5FZ7A 3NNMA 4D7YA 5C70A 4NRQA 3RQ0A 3AJYA 1ZBE3 1O8PA 2JKXA 2FDJA 1QXJA 4AFCA 2VUDA 5LW9A 4TZDA 1ZRDA 3ZSMA 1H0BA 4KWLA 4JZRA 5HBAA 2WYFA 4RGKA 2VMFA 1D4M3 2ERFA 5FZ6A 1GMMA 2RG4A 4YM1A 5DG2A 2OZ6A 2Y38A 1MS1A 3HNYM 4E4DX 1QY4A 1UZZA 3WG2A 4NPMA 4Q0PA 3PLQA 3LEGA 2WA4A 3WP3A 3WF4A 4ZZ8A 1YC61 4AR2A 1RMU2 1I5ZA 3VKLA 4ASKA 2ZGMA 1C5IA 5K7PA 3INAA 3RJ2X 1NZIA 1SCRA 3VKMA 4C0HA 1CJPA 3KQ4B 1HB4A 1PK6C 2V09A 1Q3EA 4JGYA 4BH9A 1LHVA 4GH4A 3H3LA 2GP5A 5FREA 3LD8A 5FIXA 4UFJA 1K5MB 4YWAA 1JZ8A 3JU9A 4PLMA 3IZOA 4YZ4A 2HWD3 1LTEA 1YCIA 3O1PA 4BB3A 4COWA 2VUAA 1H9WA 4BM8A 4GA9A 1J1LA 1PIV3 1UCXA 2E63A 3ZXDA 4LLOA 1GWKA 2TEPA 3VBUB 2HWB3 3I3QA 2LUWA 4CUCA 1GWMA 3Q8CA 5ABJA 2D6PA 1ZZBA 5CKQA 5FWEA 1FV3A 1IG0A 2SBAA 1STMA 4XF0A 1G9BA 3BIEA 1JN2P 3KMHA 4FFFA 4WVMA 2BBVA 3G6JB 4AFMA 3HAGA 1NCQC 2WIIB 4B29A 1R092 4IEXA 2JX9A 2Q5TA 1GICA 2XG3A 3LPGA 4YGCA 5C3PA 1W2AX 3CJIA 3VD4A 2CDPA 4XFHA 1ZA7A 1HV0A 3H8OA 2HWE1 3PDQA 3D3AA 4ZU7A 3W5NA 2PHLA 1H8TA 1HQWA 2JD4A 3DKWA 2MHFA 2HLEA 1W05A 4IV1B 2B42B 3V56A 1H1MA 2E7TA 4P5HA 5FLHA 1G9AA 2D43A 4Q0SA 4B4RA 4NAMA 4Q0UA 4HK8A 1HDKA 4B8EA 1JZ6A 1SLCA 2Y6FA 4U2AA 1J3RA 2ENRA 3GZTB 3PIJA 1F4AA 2YHJA 3LIGA 4HPKA 2R061 2JDMA 4OZOA 3MPPG 5DAQA 4ZZ5A 5JOWA 5FZ3A 5HCHA 3AX4A 1VBA3 4DUVA 2FDKA 2ZS6B 4F3JA 2VNOA 3Q8AA 2WL1A 2JDZA 1TE1B 3LQCA 3VZLA 3LDRA 4PBOA 2VAUA 3GBWA 3RMYA 2DBNA 4BU2A 4OI4A 1R093 3LSDA 4Q4X3 4NAOA 2W47A 4BQWA 4LT5A 1YQ2A 3M2MA 2ZHNA 4YNIA 2BP6A 1MACA 4R4ZA 4RD7A 3DXTA 4MGYE 5IJRA 2DU0A 3N3HA 1PMIA 2WO7A 2BBAA 1W6OA 4KL1A 4U36A 3AP5A 5G04L 1H6YA 3U37A 4ONUA 5LA9A 1LRHA 1H4GA 2R0HA 2JECA 2RMU2 2FHRA 4CCNA 5FKBA 4XQWA 5JXIA 1RUF3 1JXNA 1MZ5A 3IAQA 4AAPA 5F6LB 4NPLA 4NRMA 4XZPA 4WM7C 3ZFEB 2WNVB 4MXWA 2EXHA 2OZJA 2HYKA 1IPKA 2QJVA 1OKQA 4R4XA 1NG0A 1NT0A 3S6PA 5FYUA 5FV3A 5GZGA 2XVKA 4QQOA 4V1PA 5FXZA 1OKOA 4RL7A 3VBRB 2NPIA 1V6KA 1OLRA 1W03A 2BQPA 4FBFA 5D8AA 4WM7B 1GZWB 4N43C 1QWRA 3KF5A 2W5FA 1CX1A 5FYBA 5EJ3A 2ZX4A 3MGUA 4BHPA 3FHQA 3Q8FA 3ZSEA 1KD7A 3GM8A 2WZPP 4K7JA 4V2WA 1EV11 1LULA 2I07B 1UMZA 3B00A 4AI1A 4AI0A 2I74A 4INDA 1NCQA 2VBBA 1IQDC 2XQXA 3DL3A 1AR73 2XBO3 3W58A 3WDUA 3GYDA 2R7EB 3RZKA 2R043 4GIQA 4AQ6A 4BK5A 1W28A 3BN6A 1PX4A 3FUQA 2YDEA 5H9SA 2E6VA 3H42B 5ISLA 1W9YA 5LBFA 1BLZA 2LW8A 1XC6A 2WO3A 1GP4A 3B7MA 3JBG2 4Q8KA 2DWRA 5JZGB 3BTZA 5FY1A 1YI7A 5JMOA 2QQJA 1UX7A 2YFZA 4I0WB 3AXDA 3AKTA 5CU1A 1W8HA 1RUNA 2G4IA 4KGGA 3SQOA 5JZGC 3BVCA 4AVSA 1FOD2 3JUUA 2XVGA 1YFWA 5FYYA 2C9KA 3UYJA 4B7EA 4XHBA 2OPKA 4D69A 5K8SA 1PVC1 5DUUA 5TSWA 1JYWA 2J7MA 3WNXA 3SHRA 4ZS2A 1X50A 1U5XA 1Y9QA 4CDQA 3ZXKA 3SNMA 1YIPA 1CZVA 1RUD1 4QU2A 2R1BA 1U0AA 2LRPA 2KD7A 4FPJA 4LBNA 3SISA 4N7IA 1SMVA 2BWCA 3BTYA 5FP4A 1QDCA 4KH9A 4LA2A 4PIYA 1KJRA 2Z5WA 3FUOA 4MGQA 4IGPA 1QJU3 2UWBA 4LORA 4Q4Y3 4K3UA 3WHTA 3MFAA 3VDDA 3QH6A 4MADA 4RYDA 4XJ8A 3BALA 5F6KA 1ULEA 4BIOA 1A8MA 1RHI2 1LENA 1MEC3 4X8PA 3O1RA 4Q29A 1UN1A 1PGSA 4RGGA 2CWSA 5FPLA 3VBRC 3WNNA 2YC4A 1RUG2 1E5SA 5CB7A 3W9AA 5JUVA 2PN5A 2ARBA 2CSGA 2IXJA 1CVNA 3C7FA 1PO11 5KHGA 1OA2A 3PUHA 1RUE1 2HWB2 2WNVC 4OHZA 2VC9A 3H3UA 4XF9A 1Q56A 3CBNA 5FBZA 4QPIC 3HQXA 1F5JA 4WZCA 5A33B 5FUPA 3NNLA 1AYM3 2QDNA 1WLWA 1HV1A 1HKDA 3KHBA 1VALA 3THPA 3EMRA 5DQ0A 3IMMA 2BDRA 1QKQA 3FWEA 1LU1A 2A3XA 1K42A 1UNBA 3LOBA 1FI2A 1ST8A 4QPYA 4XC9A 2CWMA 3ZYIB 5FMOL 5JAXA 3VD3A 3U75A 3RSJA 1RL3A 4OQ9A 5H9RA 4V2VA 5E88A 4UBHA 1RUG1 2VMGA 1TMF3 2WS93 3ENRA 4OI1A 1RUF1 1E57A 2O8OA 1JUHA 4D7TA 1O3TA 1O5UA 4IEVA 3WP4A 3E1F1 3LB9A 3QBQA 4LQRA 2TNFA 3R4DB 5A6XA 2LS6A 5L19A 1O4YA 5DN2A 1Q43A 4UW3A 5BPXA 5LBEA 3HN3A 4D3WA 5BNNC 1UPIA 1ZYBA 4G3YC 4ZXEA 2WS92 3HQUA 3AZXA 2ZHMA 5KHHA 1QOSA 3WNPA 5L9RA 3WHUA 2B4KA 3GZUC 3FFZA 4JDOA 2OA2A 4IV1C 4P9IA 3WCSA 1NE6A 4H7LA 1YYNA 3FC0A 3POSA 4XILA 5HXMA 1AHSA 2ZX0A 1W3VA 2VZRA 1WW6A 1NE4A 1QH7A 1AX1A 1LAJA 4HN1A 1H2MA 3AP6A 2HWE2 1Q8OA 1NXD1 3NAPC 4YGEA 2VUCA 2GAUA 5F5QA 1NCQB 2UWCA 4KGQA 4FTSA 3TOJA 1UD1A 1SDDB 1X82A 4A3ZA 3GCXA 1S0GA 3OD4A 2JKBA 4CP2A 1ENQA 1NUKA 3FLTA 3PUQA 2CV6A 1BEV1 2A75A 3AL6A 4YM3A 4HETA 1O91A 4K40A 2A3WA 3GHNA 5D2AA 4IQPA 4NHLA 1ULFA 5JOXA 4ISQA 1Q8QA 4LBQD 3ZKUA 3IB3A 2BNMA 3PMSA 3I49A 3FBMA 1REDA 1TZOA 1UW8A 1K5MC 1ONAA 1X8EA 4FP3A 1CGPA 1CZSA 2H6BA 2XKOA 1DGLA 2C24A 5CKMA 4LIVA 4TSVA 2BNOA 2X05A 3T3YA 4JC1A 4I30A 2H6CA 1RUC1 4LK7A 4XJ9A 3RYKA 5FBJA 1X9TA 2VZVA 3AKRA 3IDCB 1ZRRA 4HKLA 4Z1VA 2VBDA 5LWBA 1VBE3 3TEXA 3CO2A 2YPDA 1I1EA 3M3CA 4OLLA 2B46X 4DB5A 5LK7B 4ZU5A 5T55A 4DXZA 2I2SA 4EN7B 1XOYA 1CIYA 2ZMLA 1MR5A 4FOYA 1VBD1 2Z4FA 1R1A1 1CN1A 4X8NA 4E8DA 3CIHA 2X53S 2Y64A 3RRDA 4UAPA 3ZFGB 1RUH2 2PAKA 4PI0A 2VOWA 3LE0A 1WCKA 4H55A 4ARXA 1QQP1 2V72A 5KWRA 3IIAA 4XBNA 2PAMA 4CDWA 2EICA 4AI2A 2A6XA 4UF0B 4CDUA 2RS13 3VL8A 1RHI1 4E2QA 4Z2AA 2Y26A 5I93A 2TBVA 4FTEA 1Z78A 2BYVE 1SDWA 1W99A 4GH4C 3A23A 1FMD2 1AL22 1OA4A 4QX2A 3MIFA 3BOPA 1IPSA 1K45A 1UU6A 2VR4A 3A21A 1J3QA 4A4AA 1DZQA 1OF3A 3PVNA 1RUI1 5BNOC 1U12A 4PLNA 1DZTA 4FQZA 3PJQA 1O4ZA 5FYSA 1R1A2 2D3RA 5A3LA 3ZSKA 1YWKA 3K3OA 1TME3 4P5YA 3KB5A 2IC1A 1W8ZA 3KSCA 4FPYA 2RS53 2WN2A 4GB33 5F5AA 5LEJA 4CP9B 1KRIA 4JKKA 1S1AA 2W1SA 3KCCA 3OBZA 5JSRA 3ZYRA 1N1TA 4QAWA 3GJBA 4GXLA 5GZEA 5T50A 1W9FA 4RQPC 4BYYA 5FZ9A 2OPWA 4J1WA 5BNOA 1QQP3 3J7HA 2CAVA 4OULA 1YRZA 3ILRA 3T2PA 3D6EA 1X9PA 2HH9A 3GBGA 1C57A 4HT1T 1J1TA 5FZ4A 4CDUC 3E6BA 5CNAA 1OMIA 3GZAA 2GZWA 4W50A 3VBSA 1UMIA 2A71A 2LTNA 2W39A 3FJSA 3S30A 4CDWC 3MLLA 3UL2A 1M06G 1KQRA 5B4NA 2GC2A 3PL0A 1PMJX 3NMBA 2KA3A 1ULGA 1DBNA 2QCSB 4Q4W1 1YIFA 2WNEA 1NCRB 4E4SA 1E5IA 4XPVA 4R9CA 2RDNA 1NQJA 3GBFA 3AMMA 4Y1ZA 1EY2A 3J9SA 5FYTA 5FXWA 2HWE3 1XPWA 1EAH1 4A3XA 2XXZA 1BZWA 1DLLA 3V65A 2GNMA
chains in the Genus database with same CATH topology
3R6SA 2VY0A 2YGMA 2GNBA 4KWKA 4LLFA 4CDQC 5CFDC 3ZFFC 4Q27A 2DUQA 1RUJ3 1Z7S1 3KS7A 2GC3A 1PGW1 2FQPA 4OUMA 4TWTA 3TNPB 4KU8A 2CGOA 3P3PA 3VHNA 2QKDA 4SLIA 3ZXEA 3WQ0A 1XE7A 2DCYA 3LZZA 4KG8A 4UW4A 4W6YA 4YG3A 4M3CA 3ZN6A 3NWKA 1OFNA 4W6WA 1G8WA 4R9BA 3KZ4C 4JTOA 1PHMA 4YSFA 1ZREA 1VAKA 4PBPA 2DVAA 2OUHA 3OCPA 3RJRA 1OPOA 3ZN4A 2R073 2VNGA 4KQ7A 1OD5A 3O0VA 1H9PA 1SACA 4PDWC 1QJU2 3R4UA 2H0VA 3CJIB 4LO4B 5C6CA 3ZFGA 3ZSJA 1C1LA 1S55A 2A6VA 3AP7A 1ZZ9A 4XZPA 1K5MA 3DUIA 5GLUA 3HN1A 1D2QA 1H8TB 5T52A 3SXWA 3H1YA 4AG4A 4HFSA 3ROUA 1HX6A 3PMEA 4AEMA 5C4WA 2WT1A 4QMAA 4XQDA 3GF6A 4FXGB 2XH6A 4BE3A 2RS12 2WLPA 1WBFA 5FLJA 4XFAA 4HKWA 4NO4A 1V6IA 4PCRA 5BNQA 1G7YA 3LGRA 4HVOA 4ZU4A 1RINA 2R16A 5JIUA 3AYDA 1WLTA 4JGZA 1KS5A 5KHJA 4PIZA 3S7EA 4XOGA 1NOVA 1VBD2 4ATFA 3ZXAC 5BY5A 1VBC3 2C9AA 1RUE3 3ZIXA 1FOD3 2PTMA 5C8CC 2AGSA 4XQ4A 5L7OB 2PLV2 2Q4SA 3I59A 4I0AA 2XLGA 1CPMA 1HRV1 1AR91 3ZXJA 2VW0A 2JG9B 4GALA 2YROA 1KITA 3USUA 5JOYA 3O0XA 2BW8A 3TN93 4R9AA 4P14A 4DRRA 2ZGQA 1MS0A 4Q1PA 3RNSA 3VBRA 1BEV3 2GMPA 3WINE 5D8AB 5I8YA 3WT3A 1GZWA 1CPNA 4LNVA 4G9SB 1C1FA 1WLCA 4XTPA 1F31A 3MDPA 1RIRA 3A0KA 4AHZA 3H50A 4CP0A 3MLJA 3OGGA 2PHXA 4URTA 4UW5A 2MPFA 1WA4A 4CDXC 2EALA 3I4IA 1PGL2 4QXKA 2ES3A 3J8F1 4BCUA 2IXCA 1BXHA 3I7DA 4K20A 2HEWF 1N3OA 1B35C 1JYCA 2ZGRA 5EYYA 4AFAA 4B7KA 3E5QA 5JSPA 2Q8OA 2GN7A 5JZGA 1BCXA 5ACA1 4J6GA 5GZFA 1VBA2 2D3SA 1LOFA 1VBA1 4Q8LA 3IDBB 3DGTA 1GR3A 4JCKA 2WS91 2VOVA 4AEJA 4AF9A 1G9FA 1DIWA 4MYEA 3WW2A 3QOPA 5IK8A 2AYHA 2P2KA 4QQLA 1F9KA 4EN6B 4L2NA 2CNAA 2RS33 1FV2A 4JRAA 4CDQB 1RVF1 4CP1A 2WLQA 4DNYA 4FTBA 1W6NB 3PVOA 3MI8A 3ZIWA 3AKQA 1H4HA 1XNBA 2VGDA 2AREA 1WMDA 5KC5A 4OHXA 1CX4A 3AMHA 5F9TA 1AR62 4Q2FA 4TLFA 1RJ8A 1S0BA 4XJUA 4MUVA 4NR1A 1XU2A 2QVSB 4YLZA 3FLRA 5DUWA 4BPZA 3QACA 3B9IA 5FAXA 1XNKA 3OJBA 3KD4A 4QGMA 3M3QA 2NYYA 3MZHA 2YUEA 4R8HA 1B35B 1IOAA 1AJKA 4RSUA 4HBNA 4W65A 3WW3A 2G9GA 4C90A 4DS0A 1IQAA 1S0DA 2EAAA 3OY8B 2V5YA 4HANA 2GN3A 4QX5A 4YZ2A 1V9U3 4EJRA 5C8CA 3MIEA 5DXDA 4AYUA 3VZOA 3ZYJB 3JB4C 3V0BA 4YARA 1GZ9A 3RWNA 4P9YA 3UKVA 4XYXA 1AR93 1SBFA 1J59A 1ULDA 1A3KA 4RHV1 2Z79A 1GZCA 4YFZA 1SLLA 4YG6A 4Y1XA 4CEWC 1YJLA 4K9SA 4AFDA 5D8AC 3I59B 1RB8G 1R082 2XJPA 5J98B 1VP6A 2IWGB 1AL0G 1ENSA 3E5UA 4ES8A 4Y1YA 1UKRA 3VKNA 2JG9A 4AEKA 2Z42A 1SLIA 3RPQA 4MLOA 3VBFB 1ZBE2 3NW4A 2X5IA 4P9GA 1DGRN 4KG0A 2LM3A 3FZ3A 4DMIA 5GLWA 4IEWA 3AZWA 2WZR3 4C91A 3WW4A 4CEWA 4PDWA 1SFNA 1MVQA 2R32A 4AWDA 1D0GA 4Q0VA 4C0BA 2R042 2HWF2 2VOKA 5LEKA 1IS3A 2IXKA 2ZGOA 2NMOA 1PGW2 3NVCA 5FOJB 1RUE2 2DVFA 1LOGA 4L8QA 1LODA 1H2LA 2SLIA 3WUDA 2WQZC 1DGRA 3NL1A 5CFCA 5E8AA 2NM1A 3AZVA 3R05A 5AC92 2VULA 1SEFA 2B7YA 3AMQA 2WT2A 5GLZA 3UK9A 5KHIA 1NA1B 2D3PA 4LUKA 4XJAA 3JD71 1SCSA 4LA3A 1YI9A 3ETQA 3J4UH 3VUOA 5KHKA 2HWF1 1HXS3 1ZZ8A 4Q4W2 4ZXKA 4O9EA 2E51A 4AI8A 4XEZA 5LRRA 5FPXA 1VAVA 2ZGKA 1OLQA 3LA3A 5CAZA 1VB4A 1FMD3 1NLRA 3N7JA 1IS5A 3OYWB 1ZVFA 3B3QE 2X29A 4O9GA 2HWC2 5L36A 4DZGA 1FX5A 1W6QA 1V6LA 2ZGSA 4E27A 4Z82A 3ZXLA 1OPMA 4LBJA 4XETA 5BNNB 4N9HA 3WDXA 4R52A 2RM23 2ZKLA 2JE9A 1PK6A 3JD72 2CGPA 1MS8A 4HK9A 1B35A 1VBD3 4FAHA 4CRQA 4RQPA 4EV0A 1VRH1 1VRH2 2P37A 2VVFA 4IEZA 4DINB 1N1VA 1IS4A 2DTWA 4H14A 3MF6A 3V0BB 1Y3TA 1LEMA 4YW2A 3VBHA 1GFF2 2HEYF 2DV9A 3VBHC 3S0MA 3N4MA 3EXUA 1QU0A 1JUIA 2ZX1A 5JOXA 1VIWB 3BODA 5FTTC 3X29B 1QNWA 1UZYA 3RS6A 2DCTA 4AXOA 4WZFA 3EJKA 2RS51 4GB31 5I0RA 1TME1 3ELNA 1HQNA 3N7KA 1LOEA 4WVVA 4NWWA 1PO22 4OHWA 4QPIB 4CDWB 4LBQA 1C28A 3DF0A 3HD8B 3OPZA 3VBFA 3DN7A 1AX0A 1FXZA 1H1IA 3GHMA 1WD3A 3A4UA 3AYAA 1DQ2A 3V64A 1C8M1 1DGWA 4EN0A 2W0XA 4YVSB 5C9AC 2Y0OA 4GQ7A 1WD4A 2VQAA 2ZBJA 3ST7A 5A32A 1PO23 1W39A 1N1SA 3RI8A 4AQ2A 5FO8B 1MVEA 1AR92 1QQP2 1BBT2 3N36A 2GC1A 4UBGA 3AFGA 4Y20A 1EPZA 2EA7A 3NKTA 1C8M3 4YM0A 3OD0A 3VGIA 1UIKA 1QOOA 5BNOB 2XHKA 1S0EA 2EAKA 3RYPA 5FQ0B 5I91A 3IPVB 5JR7B 2D40A 4FPCA 4AVBA 4HLTA 3BCWA 3PJYA 4QQHA 3IWZA 1TMF1 1H8VA 4YVWC 1BMV1 1Z0HA 2WFPA 3UKTA 5T3NA 3ES1A 2UU8A 1NCRA 3OBTA 1S2BA 4R9DA 2E9QA 3AMNA 2EF6A 3ZFGC 2VMIA 4AI3A 5JLVA 1OI6A 1G6NA 2HKXA 2A5ZA 3ZN6B 3JCIA 1WW7A 1PNGA 3D0JA 3VKOA 2BFUL 1PZ9A 1TEIA 1ZM1A 4OZXA 4NHKA 4FAGA 1HRI1 1PVC2 3LWCA 3MW4A 3H1MA 1WW4A 1VRH3 4Q4V1 3RZZA 4Z8BA 1SLAA 1GQHA 3NV4A 3SCHA 5AVPA 1OQ1A 4MSVA 2C1FA 1NCRC 4B4QA 5FLIA 4YFWA 3S7IA 4DRVA 4YVWA 3BIWE 3VBOB 1D0HA 3J8F2 3NO8A 3ILFA 5J7MA 3B69A 2PHWA 4GMP3 3ZXFA 3IMNA 2K9ZA 2RS52 4GB32 2JICA 4FT8A 1NQDA 2XVLA 1UKGA 3AYCA 4AEDC 3J8F3 4I3GA 1NYWA 3PVBB 3BTAA 2O0OA 1AYM1 1VAMA 2WWSA 2YV8A 1XQNA 2Q1ZB 4NOTA 3USSA 3T2TA 5FPZA 4JGZB 1AYN3 4NWVA 4C1WA 1OFSA 1XYPA 2AUYA 4FO9A 5HI0A 1GV9A 2ZTNA 1CAXB 2E7AA 5SV5A 4FOWA 4BZ4A 4JGYB 1FNZA 4QPIA 1YJKA 1AXYA 3WUCA 3JQWA 4JRLA 3IN9A 5DZFA 1RUC2 3B02A 1POV1 4FPLA 3USUB 4NPRA 1ND2C 4Y5Z0 3U10A 3ZN5A 1G9DA 2VQ0A 1HIXA 1GQGA 1LHWA 1QJU1 2JG8B 1JW6A 5ABJB 3HT1A 3THTA 2CAUA 1VBE2 1C4RA 1COV2 4RR3A 3VDDC 2AH2A 2NMNA 4IEUA 4FPHA 3FX3A 1R083 4Y20B 1HRV2 5F1RA 1ZA4A 1XXNA 2ZOEB 5HCBA 4ES9A 1L3JA 3AK0A 2OVUA 4K21A 5T5LA 5T54A 2BGCA 3RDIA 3AKSA 4MV2A 1DFQA 2JENA 3PTYA 1KDMA 2XL9A 2CYFA 5CIRA 1V9U2 1AYN1 4LO8A 4RFT0 5FCCA 1RUD2 2G9FA 4YYOA 1OOPB 2ZAAA 3ZPYA 5GM0A 3WDYA 2YZ4A 2XWJB 1JYIA 1S0FA 3GALA 4E2SA 4LEJA 1PIV2 4P9WA 4M0NA 3D8CA 2FZ1A 4Z07A 1BMV2 1HLCA 2XJQA 1C8NA 4XJZA 4XDQA 1RVF2 3NV1A 2VMHA 2R071 5BYNA 1A8DA 4EN8B 1AF9A 3NAPB 1JH5A 3OBRA 3VL9A 2K0GA 4QD2A 5DDJ1 1ALYA 1PO21 3IT8A 2P3IA 1SBDA 4Q4V2 3ZFEA 5HXVA 5J36A 3EBRA 3VBOA 3QLQA 4OI2A 1OQDA 4L92A 3ZMOA 2Q1MA 2XJVA 1GANA 3WDVA 4Q4V3 2IZWA 1ZRCA 2GSYA 5AVAA 2DUOA 1QXRA 5SV8A 4MH0E 1QXPA 2XB6C 1FT9A 4LULA 2VXRA 3VBUA 5DUVA 1PGL1 1WGPA 1DHKB 5I8TA 2B39A 4YW1A 1RVF3 4BMEA 5C33A 1MZFA 3UKNA 3V0AB 3CEWA 4JDNA 4CEYA 4ASMB 1W0OA 4JGZC 5E89A 1REEA 2MEV2 2MEV1 4M3CE 3E6DA 3SMHA 2ZPXA 2W52A 2FMYA 4AVCA 2R041 4FPOB 1AR71 5J3UA 4JDMA 5EXOA 1POV0 4ITCA 4IV1A 1YXWA 2ZX3A 4N43B 1B09A 1LOBA 5FDBA 4AEDB 4FSJA 1SBEA 2RM21 2PHUA 3H1WA 1WBLA 3FBYA 2H0BA 1RMU3 3ZYGA 2PYTA 5KBFA 2KXLA 5D1IA 2C5DA 4AFBA 3WOGA 1ZZCA 2CY6A 2GMEA 3B01A 1CJDA 4Y1UA 2TUNA 4CZSA 1DYKA 4DY5A 3CU7A 3H3ZA 1COV3 1CQ9A 3AYEA 1U5YA 3O0WA 3ZFFA 4EWEA 1S2KA 2D6MA 3NSTA 1BQPA 2ZHLA 1BEV2 1IKQA 2HWB1 2QNKA 1XU1A 3I2DA 3ATGA 1VB2A 3VDDB 1CESA 3AB0A 4AE2A 1ZX5A 2HWF3 2QUOA 3AKPA 2QDRA 3N35A 1PIV1 3U07A 3RMXA 1LGCA 3TN92 1IKPA 5EYXA 5ABJC 4IXLA 1GBGA 2GU9A 2GH2A 1LOFC 4ZKTB 4QM9A 1ND2B 2EVXA 1Y7BA 1YHFA 5JPMB 1VBB2 3BB6A 1VBB1 3WDWA 1VR3A 1WLDA 1CR7A 1AYN2 2HEVF 2VW2A 5A33A 5I0SA 1RITA 4I2OA 3LOIA 1HRI2 2K2SA 1NA1A 1LESA 4JGYC 5CFDA 5DG1A 2CL2A 1Q5OA 3CLPA 1RC6A 1FPN1 3KGLA 2XJUA 1SLTA 1RUJ1 2E53A 1RGSA 4QT6A 1ZBE1 1IS6A 1XNDA 3SCFA 1YFXA 1C5HA 4MGIE 3WR0A 2VU9A 1N3QA 1GNZA 3NJZA 4PJYA 4A7KA 4N9IA 2HJIA 4YZ5A 1EAH3 5J48A 4F8AA 4RS5A 3VBSC 1W6QB 1EP0A 1DQ1A 1OOPC 2VVDA 3WP6A 2ZMNA 2OW4A 4LHNA 3PVEA 1FPN3 3H7JA 3H8UA 3RI9A 1WW5A 1PK6B 1BVVA 1CIWA 4YG0A 1FNYA 3V0AA 3WQ1A 1XRUA 1KXGA 3MFCA 4M00A 5KXBA 1RMU1 2ZZQA 2QZ3A 4L97A 1S0JA 5GLVA 3UJQA 4L9BA 4HVRA 3OYWA 5J96B 5KC6A 2PHDA 3TRSB 4K8FA 3VBHB 2BFUS 4YRDA 4J1XA 3MIDA 3ZX7A 3N7MA 2YY1A 2YC0A 3B93A 4N43A 4XF1A 1A78A 4DOUA 1F5FA 1CD3G 1PO12 4AEDA 4K1YA 2W08A 4NN0A 2PHTA 4QQ2A 1A6CA 1W6MA 2P17A 1CAWA 1URXA 4OFGA 4AQSA 3VZJA 5IUQA 1J58A 5I8SA 1HXS1 1LJ7A 3WZ1A 5DZGA 2IFWA 2WSVA 4BIFA 3POWA 5CG9A 3KCYA 2HWC1 2R6QA 1ZBA3 5GJ6A 5GZCA 3HBZA 2RM22 3JD73 1BBT3 4LUMA 1CAUA 4YVSA 3CL1A 1MZEA 2NQYA 3O12A 1Q8SA 3CJXA 2DF7A 1IPJA 4XFBA 3M3OA 1UF2C 1MQTC 3O7OA 2CTVA 1KFXL 5JWPA 4YZ3A 2BPA2 1BJQA 2R062 5KXDA 2GC0A 3M3IA 4FQ4A 4YVSC 4LBQB 3VBUC 4K6BA 3VKFC 3WDTA 1KDKA 2DVGA 2WFF3 4HN0A 3DPRB 1MZ6A 2WINB 1JTZX 4LE3A 5GKAC 4NVPA 4A2UA 4A7YA 3VBOC 2R30A 4BLIA 5H9QA 1DG6A 1QGLA 4Y26A 5GALA 5A32B 2WKKA 3SITA 2WZR1 1IHMA 2NP0A 4I01A 3IM0A 5JI9A 1AUYA 5JCTA 4QM8A 4COZA 1RUI3 3SLIA 3M1HA 4AHWA 5I0UA 4BLJA 3U0ZA 5FQ0A 2YGLA 3IPVA 3NKGA 1V6JA 4XF3A 1W0PA 3ACLA 5C9AA 2JG8C 1BYHA 3LCPA 4X6QB 3JBG1 4GKXA 4Q0QA 4YGBA 3D5OA 2DURA 3VN4A 4RS5B 5DDJ3 2XUMA 4IEQA 4HVQA 2C0ZA 4GULA 3E97A 4YVWB 2XJRA 3MLKA 1RUH3 2PFWA 3SH4A 2JE7A 3MF9A 3WY6A 1W2UA 2PHFA 4Y4YA 4WM8C 2RS31 3VBFC 4EWDA 1PNFA 2XKPA 2DFCA 3WD5A 4H7MA 3K51A 3WX5A 4COUA 4QPGA 1FYUA 1ENXA 1DQ4A 5ACA2 5L73A 1NZCA 3WQ7A 1BVP1 4FPFA 4EN9B 5K0UB 1RUI2 2RE9A 4AK3A 4RA0A 3ZYPA 5A3MA 1S0CA 2O8QA 2UYBA 1POV3 4WVWA 4JQRA 1EYBA 5HCAA 2FBEA 4XIOA 1REFA 2B5HA 4RR3C 4MGZE 3C2UA 4DY3A 3ALQA 1XYNA 4KNCA 4IV3B 2WQ4A 2XJSA 5HCFA 2NN8A 5AC93 1CAXA 2A6WA 4QPGC 1NA1C 4META 2NZ9A 2DVDA 2XGXA 1W6MB 1LHNA 1CAWB 3VLBB 1R081 4FPKA 5EV7A 5BNPA 1O3QA 1RUF2 4F7ZA 2RMU3 4M3CB 3N7LA 1UX6A 2ARXA 1CAUB 5BXXA 4YW4A 2JG8A 1AX2A 4FPEA 1XE8A 4CDXA 2IXLA 3H7YA 2ZGTA 3VHOA 1M4WA 2BEOA 3CNAA 4Y22A 1QH6A 1AJOA 3WW1A 2VVEA 3WLUA 1PVXA 2ETEA 4K1ZA 2Z69A 2VOXA 4PIXA 1AXKA 4IERA 2RMU1 2WNUB 1FOD1 1YUDA 5J37A 3HT2A 5C8WA 3DPRA 3ZO0B 5C4WB 2F4PA 4LBOA 1QJY2 2IXIA 1NY71 1R1ZA 1TMF2 1N47A 2MNGA 4AVTA 4N53C 1LU2A 3VZMA 1QF3A 5AC91 3C3VA 2I45A 1Z7S3 4BOWA 1O3RA 1Y43B 5CFCC 5JDBA 2FZ2A 1MS9A 4BA6A 2IFRA 2ZJCA 1XNCA 3NV2A 4KWJA 5E16A 4JAAA 3HIFA 4MZUA 1MEC2 4IETA 1W6PB 4GMP1 4XFGA 2HWC3 4XMIA 3POYA 4YW5A 1G86A 3ZXGA 3NAPA 1LOCA 5EFUA 1CAVB 4OI0A 2XLAA 2GNDA 5C9AB 5L7OA 1LCLA 3MPBA 2XL7A 2E7QA 1EV13 2RJKA 3H0OA 1F2NA 1WCSA 4OHVA 1J3PA 3EQEA 2DCKA 4XIKA 1HXS2 3KGZA 3WXPA 3OF1A 1AL23 2D97A 1EAH2 2D6OX 1HRI3 2X5IC 2V73A 1Q8VA 1VLNA 4UXAA 1QDOA 3M8LA 4XFFA 2BTVC 4Z2WA 2UY8A 4CTEA 1UIJA 3WVJA 1APNA 1H30A 4Q4Y1 2JG9C 3AFKA 1LKNA 4FPGA 4LO6B 2ZAHA 2VNRA 1ASJ2 2RR12 2RS32 3KT1A 2EXKA 5L7OC 2AR6A 4FOVA 4L99A 4LTAA 3B9CA 3B5LB 4RHV2 2R0FA 1LB2A 2ZZJA 4CEYC 4XE9A 3K48A 5FRAA 4CEYB 4QQPA 4Y24A 3TWIA 1D4M1 4BQ1A 2PLV3 1AR72 4I02A 2PA7A 1GNHA 4AVAA 4E2GA 2WSUA 2DUPA 1BKZA 1DQ5A 1ULCA 4WVZA 4LR4A 5B2GB 5JIAA 2ZA9A 2RS11 1HW5A 1YNAA 2GDFA 2ATFA 4C1XA 1R091 1F8VA 5BNPB 1ASJ3 2IXHA 2RR13 2W68A 4L11A 4UW6A 2KM2A 2ZGPA 4XFIA 1DDLA 3H9AA 2R1DA 4AHYA 1ND3B 2GNTA 1GLHA 1LGNA 5CBLA 1NXMA 1JBCA 1X7NA 1H8TC 5J09A 1SFYA 2WFF2 1EPWA 4Q4W3 4LO7A 2BWAA 3KT4A 4FP2A 4P9XA 4XJWA 5LRSA 2YXSA 4CDXB 1AVBA 4PQ9A 2WA3A 1I6XA 3G7DA 2BUKA 3HWJA 3ZSLA 3WV6A 2VPVA 4XXPA 1UAIA 2VG9A 4OUSA 2Q30A 1AXZA 4I0BA 5AFEA 2MEV3 3VHRA 1U5ZA 2R072 1D4VB 1RTVA 3FFQA 1LHOA 1O4TA 2ZKNA 4YZ1A 4N53B 5EZWA 1FMD1 3ME2A 4ATEA 1O7FA 2OYZA 1BK1A 2JXAA 4RGAA 2BVBA 4A7ZA 1DZRA 1QHDA 4LBMA 1VBC2 1Z7S2 4XF4A 3FE5A 4COYA 4AW7A 3LSEA 4EWAA 2P34A