3DPSA

X-ray structure of the unliganded uridine phosphorylase from salmonella typhimurium in homodimeric form at 1.8a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structure of the unliganded uridine phosphorylase from salmonella typhimurium in homodimeric form at 1.8A
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 82
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dpsA00
1SD1A 4TXNA 2QDKA 1YQQA 1JDVA 1LV8A 3E0QA 5F77A 4NSNA 1RCTE 1TCVA 4D8XA 3PHBE 4OJTA 5C80A 2QPLA 4NS1A 1ZOSA 4F3CA 1JDUA 1JP7A 3K8OE 1CG6A 3FOWA 5CYGA 1M73E 1PKEA 2GUWA 2PGAA 5EPUA 1LX7A 4YO8A 1C3XA 4BN0A 3E9ZA 1V48A 4QARA 1ODIA 4TTIA 1K3FA 4LNHA 3KVRA 4L5YA 3EEIA 3UAWA 1ZL2A 1RSZA 3FUCA 5CCDA 4DA7A 4L5CA 4WKPA 4LKRA 5EUBA 1FXUA 4TTJA 4EB8A 3C74A 4G89A 4M1EA 4R2XA 2A0YA 4WKNA 1K9SA 1OTXA 4K6OA 2Q7OE 1PR1A 1Z5PA 2A8YA 4DAOA 3UAXA 3NM5A 3KVYA 1V3QE 4L5AA 3GB9A 4OF4A 4UC0A 1Y1SA 1B8NA 4GKAA 4E1VA 1JDTA 4TXJA 3FB1A 1TGVA 1ULBA 1PR2A 1Y1QA 3O6VA 1ECPA 1RFGE 1Q1GA 4F3KA 1QE5A 1PWYE 1Z38A 2AI3A 4DA6A 1CB0A 1I80A 4GLJA 4U2KA 3OZDA 4QAQA 3D1VA 3MB8A 3LBAA 4YMLA 3IEXA 4X24A 1JYSA 1SD2A 3ODGA 5CXSA 2HRDA 3F8WA 3FAZA 5B7NA 4QEZA 2IQ5A 1ULAA 2HSWA 3PNSA 3OPVA 4FFSA 1Y1TA 3UAYA 1RXSA 1Z36A 5EFOA 2ON6A 3ONVA 3INYA 3OZBA 1NC3A 2AC7A 4R2WA 4TXMA 4H1TA 3TL6A 5F73A 1RR6A 3P0FA 4TXLA 1VHWA 5CCEA 1VHJA 4M7WA 5IFKA 1ODLA 3MMSA 1VMKA 1SJ9A 2I4TA 3IOMA 1JDZA 4JWTA 5F7XA 1RXUA 1XE3A 4P54A 1VFNA 4R31A 3BL6A 1OTYA 3ENZA 1OUMA 1U1FA 4D98A 4IP0A 1RXYA 1A9SA 1K27A 1PR5A 3OOHA 2P4SA 4WKBA 4EARA 3OF3A 1RT9A 1PR6A 2OECA 1Z34A 1T8RA 4G41A 3OCCA 3SCZA 2HWUA 4OEHA 4BMXA 3P0EA 1YRYE 1A69A 4MCIA 3O4VA 4OGKA 3PHCA 5JPCA 2OC9A 4DA0A 3OOEA 1A9TA 1Z35A 3E9RA 3QPBA 4DARA 3EUEA 3FNQA 3UT6A 1RYZA 5B7PA 3NBQA 2ISCA 3DDOA 1A9RA 3DP9A 1SQ6A 1G2OA 3U40A 5K1ZA 4L0MA 5DK6A 4YNBA 2A0XA 2BSXA 1N3IA 1PW7A 3DF9A 1V4NA 3LA8A 4NY1A 2A0WA 4JP5A 1Z37A 3PNPA 3KU4A 4DABA 1Z39A 1Y1RA 1JE0A 1U1DA 3GGSA 3K8QA 4GLFA 3EUFA 2RJ3A 5CXQA 2I8AA 2QSUA 3KUKA 1TCUA 1OU4A 3KVVA 3KHSA 1Z5OA 1TGYA 1OV6A 1YBFA 5IU6A 4TYMA 4DANA 4D8YA 1U1EA 1T0UA 5FAKA 1T8SA 5F78A 1PK7A 4ECEA 4MARA 2HN9A 5I3CA 1V2HE 4F2PA 4KN5A 4PNPA 3DPSA 2QTGA 1PR0A 1YQUA 2OC4A 1YR3A 3LGSA 1PF7E 4JOSA 5B7GA 3FWPA 4TS3A 4LNAA 4D8VA 1LVUA 1ODJA 4DAEA 1Y6RA 1OVGA 4M3NA 4GMHA 4G8JA 5KB3A 4QFBA 1V41E 2AI1A 5F7JA 2H8GA 4L6IA 2QTTA 3BGSA 4LZWA 4QASA 1Y6QA 1T8YA 5F7OA 5B7QA 4WKOA 1B8OA 4RJ2A 1RXCA 4LDNA 1JPVA 2B94A 4TS9A 3OZCA 1U1GA 1PK9A 1JE1A 1V45E 1T8WA 4DA8A 4F2WA 4YJKA 5CYFA 1NC1A 4F1WA 1U1CA 4PR3A 1A9QA 3BSFA 3NM6B 1A9PA 4TXHA 5F76A 3NM4A 1A9OA 4I2VA 3UAZA 4BMZA 1WTAA 4D9HA 1PR4A 3EMVA 3DJFA 4TTAA 2XRFA 4OY3A 3OZEA 4QATA 1Z33A 5F7ZA 1ODKA 4WKCA 1Z5NA 2AI2A 3UAVA 4OGLA 1NW4A 1JDSA 5ETJA 3T94A 1PBNA 4MCHA 1TD1A 2OXFA 4BMYA 3BJEA
chains in the Genus database with same CATH superfamily
1QVRA 2JI4A 3CUSA 3LPCA 4G1FA 2EWWA 3HDYA 3KR1A 2OD7A 1NM5C 3RC9A 5KVVA 5LQJA 1DC6A 1S3FA 1VZ2A 2O1SA 1CDDA 3EH2A 4INAA 3AERB 1VJRA 3ZDRA 3G8CA 3TBHA 2EGHA 2J3HA 4QQRA 1CZUA 1DXQA 1F4VA 3V3KA 3L18A 4G1CA 1QZ3A 1SCJA 2PZEA 3W9SA 5IC4A 1X13A 3PT9A 4DSZA 1TZJA 2NO1A 3NYIA 3HXLA 5H1YA 1GU0A 3K73O 2IYPA 2R2GA 4FZVA 4KPUA 2A9QA 3LECA 1GP2A 1RXIA 4XR4A 4HLDA 1ECCA 2E55A 4I4IA 4YLGA 3WLPA 2GFQA 4PGAA 2HU8A 5HQ3B 3ZU5A 2HJHA 1LV7A 2YZ7A 3T1VA 5C80A 1Q3TA 2QRZA 1NRXA 3D6FA 4KEAA 1UT5A 4BNHA 3T3EA 1HDGO 5ESRA 4AMGA 3UMFA 1QH0A 3O8RA 4ZZ3A 3DW3X 4OHVA 1ZW1A 3UJPA 5EJ7A 2H3HA 3PC8A 5CYGA 4QO8A 1G4HA 2JKZA 3JWJA 5T4EA 1IN1A 5FUBA 5ARCA 2B83A 1J20A 1E7MA 3U7IA 4ENQA 1PTJC 1P2SA 3DS8A 3ESDA 2CL5A 4IIHA 4Q19A 4YJGB 5BYBA 4EUKA 3IGFA 1KAMA 5IAGA 4FFVA 2JFNA 5TQ0B 1U3WA 2P6NA 2RSLA 2XUJA 3B2QA 3OZRA 1HO3A 3IB3A 4IXWA 4RA9B 5CA1A 2F9MA 3PUZA 4Z8YA 1V9CA 5IM5A 3TUJC 4E15A 4DC0A 5KIAA 3Q5GA 3ADBA 5ICSA 1U7ZA 4MS4B 2ZI5A 3T1OA 1V48A 3ZS8A 1T8PA 3RV4A 2OAEA 3UV6A 1E9AA 1T36A 2BRUC 4I81A 4RFLA 1GZ4A 1K3FA 1T5DX 2ODNA 4BX9A 3KVRA 1GPUA 3JYLA 3H11A 1MIOA 1NAIA 1PG5A 3CUWA 3VZRA 1XTPA 3NWJA 1QQTA 1UT6A 2AX4A 1XV5A 2DM6A 2I87A 3CR3C 1KF0A 1XK7A 3DEFA 3PWSA 3H8SA 4HBGA 1HZZA 2BKAA 2FWMX 2CFRA 5FHQA 3STUA 3VGJA 3IQWA 1Z9BA 1F2UB 2PQ2A 4HRXA 1MV8A 3L0SA 4MQ5A 4WJKB 1FW6A 4DA7A 1IBMB 3A1EA 2R4TA 3BH6A 2Z5GA 1TT5B 1FU7A 2FR0A 2XGGA 4EVQA 4YT4A 2XCSB 2ZE8A 1UP6A 4HZGA 1Z4IA 4MRMA 5EJ6A 5J40A 2HCBA 4CPDA 4AQ7A 4C07A 1VQ1A 2OA0A 4QD3A 3JYNA 1EFAA 3HO1A 1R0SA 4V2IA 3D2CA 3JQ9A 4RD3A 1T24A 4Q1VA 2X4LA 1U0RA 2ALJA 4GDMA 3LKDA 1IXKA 1SVMA 1LI7A 1UPTA 3ZCSA 1KQ3A 3DT8A 4WLNA 1IVYA 3RS2A 3ZV4A 3FVTA 3G23A 3R6TA 3IIJA 3KQTA 4QTZA 2IEIA 1VPVA 1V35A 1L5MA 3FGZA 3GV0A 4FZJA 4JP2A 5FOTA 2C82A 4URVR 5IWCA 1QGED 3C8HA 1KNQA 4I08A 3V7WA 2QQ0A 4BX0A 1HOTA 2VQDA 3DE2X 4LJLA 3ILVA 5C31A 3KOMA 3EVBA 4IDGA 3QHQA 1B8NA 1R0RE 1BDMA 1C4WA 1T91A 1YWGO 4GKAA 5FA5A 3WY9A 3ZLBA 2I3AA 4Y30A 3RI3A 4FSDA 2R3SA 8ADHA 2AZMA 5L6MB 4FXPA 4PFJA 1R1DA 3DNFA 10MHA 3ZX5A 2HTFA 2Q0HA 4MWEA 1ZNYA 2VNSA 3DV2A 4BNYA 3UATA 2PHZA 5KQPA 1G18A 2VDNB 2X41A 5FWNA 1I7DA 3CKLA 1FFWA 2APJA 3DNMA 3LNTA 1MG5A 1VBKA 2WNHA 2DPLA 2WSMA 3N0XA 4RWZA 2OPHA 4ZEMA 5L7WA 1WAMA 3HUDA 1K7FB 3DTVB 2EDAA 2XGSA 3I8XA 3GF4A 2OCBA 1IHUA 2EERA 1ZWLA 3O3NB 3CSUA 4G24A 5EKSA 4A6DA 3ZDYB 4D0GA 1O0BA 4J2OA 5CFPA 2I03A 5TJ9A 3R8XA 2P2SA 2PS1A 2HUPA 3DTVD 4E5MA 5CAEA 3ZNOA 5CX1A 1VPDA 4MJ3A 1H9BA 4OI4A 4XQEA 3HYRA 4DNPA 4Q05A 2NUPA 3Q8KA 2WKWA 3PU6A 2HMTA 2M2IA 1LPSA 4LJ6A 3SBEA 1GQ2A 1V4VA 1EIZA 1SIWA 4R98A 3S2UA 5TPZA 5F3RA 2P4HX 3X1KA 2DULA 1G8PA 5FEMA 1PNQA 2XSZA 1WXDA 2GXSA 1E3LA 4FMDB 4PZZA 3UG7A 3UK0A 3WGMA 4DIDA 2FFHA 2ISQA 3AVXA 1Y1KE 4D4GA 3BXZA 3UMMA 3O26A 3AY3A 1FRZA 1RAIA 5T8KC 3VQTA 4F21A 2ZM5A 1R74A 3P0HA 3KALA 4XWOA 3R2JA 4FMCF 1YVUA 4MS4A 2X42A 4B9EA 1C2TA 1CZHA 4FR2A 1DMSA 1F0NA 2DPMA 4HQ0A 1P44A 1ZUIA 4ZOQI 4EMSA 6LDHA 5C4MA 1UKCA 1FX0B 4G4SO 3TZ6A 4QXRA 2YXEA 5ICEA 2RI1A 2ZIXA 4BFWA 4HLUA 3OQMA 1XVVA 4RQUA 2ZT5A 2PWAA 5JZOA 1W87A 4QHTA 2YICA 1FNMA 3RJ5A 1WPXA 4Z4CA 4M0UA 1Z5UA 2WHYA 3ONNA 1V5GA 5IVPA 5GOZA 3RVLA 4RHFA 3A06A 2IYLD 1KJ9A 1B73A 1L7DA 1IC6A 3O73A 4KI0A 4Q03A 4OQEA 1N1MA 2HO5A 1K86A 2Y4OA 3GCGA 2JFXA 1KR2A 2QW8A 1TT5A 1T2DA 3H5VA 3Q5DA 2G77B 3OZBA 3CY6A 2ID9A 3GN2A 4FE7A 4LE0A 1ZCAA 4YMGA 2R7MA 5FUVA 3ZQUA 2YC2C 4LY0A 3VKVA 5EIFA 1D1SA 1Q17A 2VRCA 3G88A 5J43A 5JSUA 5IT5A 1Z29A 2XNHA 3KZOA 1SOUA 1EAYA 1FRVA 1UBTS 5EZYF 3K53A 1Z3IX 2VP3A 3BWDD 1W7AA 3H4VA 2F8TA 1U7XA 1EEXB 2ZQYA 3NWOA 3WR5A 4PZ9A 1SOMA 1RAAA 3DYBA 3EXFA 1O77A 4ZMSA 3CZAA 5CM8B 4H4EA 1OLOA 4JJ4A 4PM4A 1OCEA 1RHKA 1TQ2A 4R8VA 1RJFA 4TS4A 3IEIA 3R5KA 4V0KA 4BB0A 1QIGA 4FZRA 1VYUA 1EUDA 2OGSA 3MCWA 4IHAA 5BV1A 5BUZA 2JIPA 4DRZA 1E5VA 4HX2A 1O8BA 1Q7CA 3E58A 4P7BA 1EH5A 2Z57A 5FEUA 2FH5B 2X1LA 5HZMA 1U0GA 4IJ5A 2Z83A 5A2QA 4H9GA 1FFEA 2X3UA 3HR8A 2X5KO 1E3WB 4REMA 3V8RA 1DO8A 1D3AA 3R7LA 4Q3LA 2WU4A 1BSVA 3DHEA 5TT0A 5LU9A 2JGJA 3EQ8A 3UEOA 4KNWA 4DLVA 5NULA 4OQPA 1DJMA 3JYOA 5LFAA 4CCYB 1DEKA 1WF6A 2ZE7A 5H59A 4UMEA 5JS2A 3TX6A 3UWPA 3OPQA 3TLGB 5LA6F 1T1GA 2IYYA 4E03A 4QUIA 4X93A 2W43A 1JZTA 1QK3A 4XR9A 3K05A 3VOBA 3I8OA 2AJTA 2YHBA 5LQDA 4OKSA 3KQMA 2ZGVA 3N0TA 1AGXA 1RLUA 2OHJA 4HLQB 1XMXA 4JC4A 4NCNA 1LPBB 4B34A 1OGYA 5K6TA 1W44A 1L5WA 2GXAA 2QVXX 5JI3E 3QSYA 1VKZA 5TS3A 4X20A 4EJ6A 2JZNA 4DCMA 4DZRA 2RC6A 1RWMA 3ONWA 4O2AA 4Y7CA 4LCBA 4GSYA 4M6WB 2IV2X 2RGNA 2I34A 4CHTA 2XXJA 1R12A 1DMRA 3VYTB 3DZKA 5HIAA 1H5NA 1E3EA 4JUBA 1RYBA 4ZOAA 4FW8A 5JQGA 4QJBA 3L7MA 4IX1A 3A32A 4C2AA 1PQPA 4DQUA 5IUKC 3EODA 4YREA 2H4YA 3PQ7A 2WWHA 4O2AB 3F49S 2QMHA 2XT6A 4XCXA 3LT5A 2OBMA 1RI1A 5ALHA 4IW3B 3WICA 5KYKA 2DUJA 4TLDA 5I9BA 3BWXA 4DLYA 1FTSA 1NVWQ 3LDHA 3QZUA 5E6UB 1M8FA 4EJSA 4D9EA 3R0JA 4JB2A 2X0IA 2X0NA 4OXXA 4L8VA 5B7PA 3GFOA 4WJLA 1A9RA 1OB5A 5LWHA 1C5KA 1S2NA 2QHXA 5F5XA 3ZCVA 2FP3A 2QORA 1BCRB 1SBTA 4L0MA 4BZQA 3OZVA 3RWOA 5P8WA 1FZQA 4QL3A 9MHTA 3U4CA 2A0XA 2BSXA 4XSHA 4EKYA 1FDIA 2H5JA 3OMXA 4QNRA 1E4EB 3C7DB 3DOCA 4URFA 2NNWB 1TMKA 1ESZA 3DF9A 5CHEA 4DLWA 4AIIA 2QLTA 1Z37A 4JENA 4DA4A 1WP4A 2BGJA 4N0PA 2P9QA 2XCLA 4ZHQA 1KBZA 3B13B 4OJKA 4JI1B 1Z2PX 3FIJA 3T0FA 1AU9A 3HVHA 5D5PA 4I7EA 4M98A 3FBGA 4QGFA 3KETA 3R3YA 4CM1A 1FF9A 4U7HA 1YDGA 1BROA 3DDUA 3KQWA 2WB2A 4MW0A 3H5IA 1ODCA 1SXJB 3K4QA 1Y9AA 2GVDC 2P78A 4FCTA 4P34A 1ZCBA 3WTBA 4J94A 5D84A 4D79A 3PP8A 4LV5B 3HADA 3EIFA 1K6MA 3PFIA 3PYXA 1HDEA 4IIDA 3RV3A 4DCSA 3H2SA 4YDQA 1GRCA 4ON9A 3I2IA 2BN4A 4XH9B 5C52B 1ZP6A 3P9QA 3M33A 3Q4GA 3GCWA 1C7FA 3K6RA 4OP1A 3R9KA 3S55A 4D42A 2FPGB 1A2OA 3IHTA 3L0IB 4L9RA 1AHPA 2HJVA 4ZKDA 3AU9A 1YUBA 5KPJA 3V7FA 1O95C 2AFIA 4OIFA 1IB0A 4C4RA 4V0SA 1Z16A 3Q7SA 1N6PA 3VYUB 1YU9A 4NYIQ 2WMNB 1RPJA 3I9V6 1X9IA 3ORQA 1SBHA 4G56A 4Q21A 4DWOA 5GVSA 1B14A 1JKIA 1P74A 4ZCSA 5HM6A 5TR9A 3UK1A 3HSKA 4WOJA 5DIZA 4RA6B 3ADDA 3U9LA 1SVWA 1IM2A 3KBOA 4MAAA 2FUG1 3GT7A 4AF7A 1ZBQA 2P2CA 1ZGHA 1U98A 5BXQC 5ICGA 3FSRA 2V7WA 1XTSA 1BJKA 1VG8A 4X3OA 2NU9B 4QJIA 3NKFA 2D06A 5IRCD 5T67A 2HMVA 3OI7A 1RWBA 3LUPA 3AGQA 1BE0A 1UBOS 4B6OA 1W25A 1OH7A 2VT7A 3DONA 1KH1A 2IVZA 1VKRA 2IY8A 1GU1A 1QANA 1BVRA 4RV4A 5ALSA 3DEYX 4CT5A 2WM2A 1BZYA 2A86A 2DBZA 3MWDA 4KGXA 5BN4B 2FYTA 1X8XA 3T7IA 5DCLA 2ZYHA 3NKVA 3WRYC 2I2DA 1MP0A 4XGQA 3JVEA 4XCVA 4DAEA 2I76A 2ZETA 1OVGA 3B3GA 4LHEA 4XGNA 3SXPA 5LQNA 2H18A 3P5SA 3I0NA 5GZ6A 3L82B 1A8HA 4B7ZA 4F6CA 3O21A 2PUGA 3TS1A 2XUKA 3HY6A 1TKBA 4TMZA 2F4VB 4UNSA 1YE5A 3BTOA 4JB3A 1HZZC 4LJSA 3RHTA 5JS6A 2EGGA 3C3PA 3PFBA 2QQ5A 2BDUA 3M8KA 4MVJA 3EPLA 3DMFA 4RVUA 5FL7A 3CKYA 2A3RA 2QTTA 3DMHA 5IAOA 4AO8A 1C8BA 1E9VA 1G8SA 1XEFA 3DKRA 3RROA 3IELA 4IQFA 1H1LA 5SZKB 2QAIA 5THXA 4B32A 1F12A 3PLAE 2UVPA 3QLUA 3OUUA 3UHPA 5JFTA 4RLHA 2N47A 3D43A 4ZOLB 1PNRA 3QK7A 2PVPA 2XYQA 3RVMA 1OC4A 1J1UA 4JSRA 1UDBA 4F4CA 3D8BA 3WRXA 4AZTA 1WIWA 3M49A 1YJXA 2R6HA 5IAKA 3ZIDA 1PSZA 3FPGA 1NVBA 3HK2A 1N2XA 4JLBA 3RIMA 4EA9A 5M7EA 3WAKA 5EUMA 3UUWA 3DCJA 3ZCUA 3FRIA 4I4NA 1VB5A 2IWRA 3ZHSA 1GNLA 1VGQA 4C5BA 1RXEA 1YC5A 4KG7A 3O8OB 2FB9A 3EQ2A 3WB1A 3DFUA 3ZWNA 1N7JA 2FZ5A 2ZBPA 4ASUD 1TC1A 2GCGA 4NBRA 2FWPA 1Y6JA 3BSFA 3D6NB 1DFGA 2QG9A 3IV7A 5EKDA 4JBXA 5DYYA 1ZLYA 3TVTA 4PS1A 1LBSA 4QX6A 1WBJB 3GEDA 2PEZA 3WHKA 1R15A 2YUTA 3HDHA 2LV8A 2QMZA 3L6DA 4I2VA 1FJHA 1EBUA 1M83A 3GFBA 3IAAA 1NBEA 1QB8A 5G4KA 4IKPA 4ZEWA 1NUUA 3GRPA 5FBQB 4BMOB 2BD0A 4BO9A 2GKGA 3PPIA 2Y1CA 1L5KA 1LZKA 3A9SA 2VP9A 3OE1A 3EGOA 1ZL0A 4EUEA 4MDYA 2W48A 1FDRA 3ZH2A 3VNVA 1XUOA 1FW8A 3VSCA 4EBBA 1DAGA 1BG6A 1Q1AA 3KOUA 3L6OO 3ZDQA 4QDXA 3PDHA 1CQPA 3A4IA 1QF7A 5E6SA 4Q3OA 2WPDA 4OGLA 1JDSA 1W47A 1FTYA 2F3TA 2XVZA 1XIVA 3VX4A 1TU3A 1JXMA 3VV2A 1KJIA 4QNMA 1NZDA 1WQ3A 1VIMA 3T94A 1U2TA 2MSLA 4J4HA 5ALLA 2OXFA 1OBFO 4BFZA 2W6ZA 1E5TA 3O3MB 2PYIA 4JLPA 4MI9A 5K05A 1RAEA 1PX0A 3FGNA 2I2CA 3A2LA 4FXOA 4H15A 5DWVA 1K6IA 3U48A 2FDCA 2W2MA 5D5QA 5T57A 5AW6A 4U1RA 1VYHA 2ZJ1A 3P4XA 4YRPA 2DGDA 1WQ4A 2ZE5A 1GQYA 3GQVA 3ACCA 4A82A 4U8HA 1Y9DA 4BGDA 1EINA 1GV0A 3PPWA 1NBMD 5WRFA 2B98A 1EXWA 3FNGA 1EP3B 4GICA 4JVMA 5BWNA 1PL6A 2L2QA 3ETGA 3NEJA 2QLFA 1TM7E 2UKDA 1KDVA 4L27A 5LOVF 1WZ2A 1X7YB 2QRQA 4KTVE 1RCTE 2PU5A 4YRQA 2IDZA 3ONDA 2AK2A 2XE6A 3A6HA 3DAPA 3ES9A 1ZMOA 1YIOA 4ROSA 1L5HA 4Y6LA 2QN7A 4XIYA 2JVJA 3W2FA 5BQFA 1Z0UA 3MWKA 1L8LA 4RVSA 1CNMA 3HL0A 4IDDA 3VOTA 4JJ6A 3UJ3X 2J3MA 4Q00A 3MCZA 2BFMA 2EOAA 2YV4A 3K31A 1CVLA 1Q0QA 3LUCA 4FDAA 4N1AA 4W5HA 2YR0A 2OMEA 4U6QA 1EDEA 3WWZA 4F92B 4GSKA 4HWSA 3UANA 1KFEB 1N6RA 2BHNA 4DCPA 1UXGA 4E5KA 1QWOA 2VSXA 5LYJA 3SEAA 1GPYA 1QRDA 4QYTA 5TMBA 2M1XA 1C3XA 2AGVA 2FGKA 1VIYA 2Q27A 3E9ZA 4FN5A 4HD8A 3RSGA 4BRZA 4ZEVA 1O54A 1P39A 4CEHB 5GV8A 2F1OA 2CLEB 1YFKA 4LNHA 5IF9A 3I34X 4RF5A 3NHBA 1XCBA 3WYGA 4JMLA 3ZV5A 4MYRA 1Z13A 1ZL2A 4MITA 4BYGA 1K7XB 2BHRA 4NDNE 5DWDA 3REGA 3ZDCA 2XKKA 3ZHYA 3PD7A 4W7SA 2FEOA 3O74A 3VZSA 3L0OA 1G1MA 1DHTA 2ZRLA 4LDZA 1E8DA 5LQMA 2J7PA 4M7RA 3MXTA 2H51A 2QV7A 1QB7A 4OXQA 4QBKA 2H1VA 1ILWA 2BFPA 3EIHA 3NU1A 4Y0AA 4F5DA 3WAGA 2XQJA 1T9HA 4N48A 2H31A 4AG6A 1BD3A 4I6JA 5A7FA 1K89A 5JAMA 2VDJA 4O3FA 2AMYA 4OHFA 5F2OA 1E2DA 2WD7A 3UKOA 5AQ1A 3LVFO 2O19A 3V2UA 2F6RA 1OTXA 3GLVA 3FTDA 4A8HA 3FDJA 4BLUA 4JUDX 1CP3A 2NTJA 4DLPA 4DAOA 4BB6A 2JEYA 2WD9A 3P0IA 3M81A 4JT2A 4WOCA 2QROA 4IFBA 4KGZA 4Q4HB 5A05A 3UAXA 2X7JA 4F45A 3HJHA 5I7AA 1VJ5A 5AM0A 4ZALA 2VK2A 4ZVUA 1NP7A 5T4FA 3R6WA 5EINA 4WHMA 6REQB 4M0KA 4EJFA 5KTTA 3AYZB 3CLRD 3EIEA 1E66A 1NLUA 2Z1NA 1N6HA 3LC2O 1JDTA 5D8DA 1DFIA 3EMKA 1GFSA 5D3MA 2YJZA 4DF3A 3JR7A 5K8TA 3EDOA 4NEGA 4PZLA 1H2AS 2ONKA 8ABPA 1N6OA 1C1XB 1KZ6A 2ZAIA 4JT9A 2N75A 3TR5A 2HT1A 1TEHA 3LHFA 1PR2A 2Z6UA 3E81A 5IAEA 3PC7A 3AZPA 1NLMA 4ZOLF 4JBLA 4BLVA 4EYGA 3TECE 3HHEA 3H2ZA 3ASYA 3ZQKA 3LT0A 2VEOA 1LDGA 3MINB 3GLGE 4J4BA 1KMIY 3IERA 3RRBA 3F9IA 2OFOA 2WF8A 1Z4LA 3LXMA 4RGBA 3V9AA 3T1YB 2AC4A 1OF1A 3L0BA 4CW7A 1QJ4A 4EFLA 2IH4A 1HFKA 3VHXA 3U4DA 5E2BA 3CQ9A 4RD2A 1H85A 3S99A 4RKWA 3NAQA 5JJ5A 1EUZA 3BZUA 3RRJA 5AXBA 1AGRA 3K30A 2FW0A 2Q4BA 4GI3A 2QBYA 4JYAB 4OQXA 4YMLA 3OTQA 4BVGA 1M34B 1UMKA 2VSFA 1KYTA 1I1OA 2Q3JA 2WRZA 3QI7A 4TV8F 3RAJA 4DG8A 1A5BB 2G80A 5EMJA 3UIEA 2CFOA 1DC5A 3EXHA 3H8VA 2W70A 3WLOA 3GEMA 2XDAA 3E7WA 2RHTA 4RKQA 3NNNA 3FDXA 2ZIAA 1YS1X 3AB8A 1YUMA 1IEWA 1SVIA 1KARA 1XHLA 3BYZA 3ISVA 2VO1A 4LRWA 1XU4A 2Q49A 4TKVB 4GKVA 4HK4A 3B7WA 3OQ1A 5K4AA 1P4SA 1I2CA 1OXXK 2VS1A 3GT3A 2IPLA 4U9IS 4A5SA 2R60A 3WYCA 4ISCA 3C3MA 3RFFA 2JCBA 2R5FA 3EASA 1W36C 1YTLA 2D5IA 1TIPA 3V8PA 4A36A 4B1FA 3OICA 1V5EA 3IA7A 3IUBA 2OP0A 1JEEA 2CLIB 4F6RA 4JH0A 2C4NA 3I6BA 4O4JB 1KDTA 1AKVA 1ZUD1 2KSQA 5CPFA 4CVNA 4E94A 1T2EA 3ASVA 2OHHA 1NHGA 3LT1A 4GI2A 4TKLA 4WGGA 4DJ5X 3NOVA 1E9RA 1TMYA 4RD6A 2WTMA 3TQTA 3VR6D 1SXJC 4HB4A 4EWLA 1VA5A 2P79A 2QPTA 4LPSA 5ALZA 3C5VA 1IUPA 1IFXA 5LCXA 1OXKB 1E63A 1GDHA 2ZIUB 5CR9A 3ETDA 2Z5FA 4WW0A 1ZH2A 5DCUA 5P21A 2W4MA 5HZKA 2VJMA 1DKPA 1XCPA 1IXYA 1W1WA 3DKKA 3LC0A 3WWCA 1S4MA 1FNBA 2QLLA 3O0TA 2BC9A 2AD5A 2M32A 2PX6A 1A8UA 2ZJBA 3I28A 1CYDA 2C58A 3PEUA 4WOKA 2D2FA 2OV8A 5MN6A 3LAWA 1YZ3A 4I1SA 1GARA 4DR3B 1VXRA 2WWGA 1Z5VA 4ARUA 4FHGA 4G0ZA 2OBXA 2FWJA 3EXG2 1HNXB 3GLIB 1ZN9A 3AVOA 4HQKA 1PHRA 4CFZA 4P0PB 3UQZA 1MB3A 3P52A 3KQSA 5FPQA 1JG6A 3BJMA 2EHDA 1H05A 1KI9A 2B78A 3CUTA 3REQB 3RYHA 2JA2A 3S1AB 3D3WB 1AC5A 1TLTA 3U7EB 3AM4A 5ADVA 5I7EA 4DYHA 1U8EA 1T2AA 3CONA 3EWSA 2C7GA 2MYNA 5CK5A 1ZNQO 5C8DA 1MC5A 3DLAA 3SX2A 3SYTA 3ZUPA 1IZYA 3AVPA 5HMLA 4LW8A 4EO4A 2IXDA 2ZB2A 3R41A 4JV5B 1BDBA 3RTBA 1E2KA 3WIDA 4HWKA 5BOVA 4D4JA 1ZK1A 3GRYA 2C3UA 5JISA 2NXNA 1CQZA 2JAXA 1SXPA 1S1MA 3ZEIA 1I7SB 3L7DA 1XOIA 2A5FA 3RFTA 1NRJB 1QF9A 2AG6A 4BO4A 1GPDG 2OOSA 2GEVA 5DP2A 4BWYA 2JCYA 4YAIA 2B21A 4P3XA 4G5SA 2XMSA 4OXKA 4UCWA 4D6YA 3TN7A 4Z3DA 3C5WP 1QFMA 2ZVJA 3PQ4A 2YWRA 3TH5A 4TLLB 3H9QA 2P9CA 1GUAA 5M34A 1QNLA 5KUTA 5DNYB 4L9AA 1EJBA 4FYHA 1KJZA 4PN7A 2BKLA 2Z2XA 3E22A 4LMAA 4R1SA 4MGHA 3SC2A 2I71A 4L8WB 2PGXA 4OB6A 1VL0A 2VPXA 3PVCA 2WTAA 1IATA 4FOTA 4HP8A 4A6XA 3HB1A 1N2JA 2UZ0A 3IOCA 2AOTA 4RZSA 4F46A 5LWQA 2RHLA 2IVFA 2XMZA 1KI1A 4F3RA 3ZZ0A 1RKVA 3R5XA 4WFKA 1TVCA 2Z98A 3U3ZA 1Q0SA 5ALDA 2B4YA 1NI4A 1VP3A 1YRYE 1CS0B 1A69A 4GXNA 4GG1A 2BP7B 4OQQA 3IDOA 3ER8A 1PJ4A 1GL9B 1MJNA 1B0AA 1VE3A 4QRIA 3ZWMA 3THXB 2CHVA 2OT3B 6AT1A 5HIIA 4R1MA 4DA0A 4E22A 1RJDA 3PNLA 4W99A 3QPBA 3RFXA 1EMDA 2R00A 4F5ZA 3INRA 4OX9B 3DCNA 5KCMA 1QZUA 5T4BA 2W2PA 3INNA 3QLVA 2CWDA 1F5NA 4BV9A 3L8HA 1MF7A 2EX0A 2W4IA 1X9HA 2VRBA 3DP9A 1XAJA 4KJXA 5GOTA 3BMOA 4B6FA 2VTBA 3QX3A 3LG2A 1DBVO 3U40A 3KEQA 4F7DA 3EHEA 2NAPA 4CMJA 1B00A 3WISA 1DOHA 2HLHA 2W6ID 1GQOA 1LK0A 3CH7A 4H16A 3SDZA 3NHLA 4KK4A 1FMJA 5JYBA 3V97A 3LA8A 4G0QA 2IODA 4WFIA 3NALA 1TU0A 2EFJA 4DMUB 5L4LA 4GOND 4RKFA 1EFCA 4HQ6A 2QENA 4GOMD 2Q0QA 4CL3A 2C5AA 2GLXA 3F5QA 4PYQA 4WBNB 4KRYA 1Y1RA 3PZBA 4R9RA 4DMCA 2H2FA 3EIXA 4WN9A 3D59A 4F4DA 1K9VF 2F3QA 4ZV4A 3ZTTA 3LQRA 2CFTA 4KQJA 1I8TA 5KNCD 1II0A 1MJFA 1OE0A 4C4PA 4BC0A 2JA1A 4KR6A 4EJ2A 1QIIA 3KVVA 4TM7A 3WS7A 4LYAA 1GL7A 3X44A 3FFXA 4DFDA 1JHUA 3G79A 3KAQA 1OFTA 1YBFA 2FN9A 2H4JA 3HNOA 3HV2A 4IIFA 3HCDA 2ZB8A 1L5VA 4M8SA 2UZAA 3VHXB 4RNDB 3CRW1 4RK4A 3KZKA 1T35A 2BW0A 2DT8A 1ZD9A 1YJAA 1UDXA 4I1OA 2DJ5A 3VO9A 1T3GA 1OZFA 5HS4A 2Q5JA 3NPMA 3CLUC 2IS1A 2PKQO 1BXGA 3GDFA 1YKSA 1NJGA 1L7OA 4KXWA 4HYYA 5EJ4A 2G1JA 4X0EA 3DA8A 3T0GA 3WTCA 4HQLA 4EY3A 1E3MA 4MP6A 5DLYA 5JDCA 1Z45A 2V7QA 4GRAA 5HF9A 4PO3X 1SCAA 3ZWAA 1T2FA 1YQUA 1GA6A 1Q0ZA 3IKLA 1UDRA 2V58A 3JATA 4Q3NA 5KTRA 4JOBA 3SLGA 3SDBA 1YR6A 3HCWA 3OEHA 4GAEA 5C7LO 1KYZA 5KKCA 4A2QA 4JOSA 3VC1A 2ZW9A 5C2JB 2PFSA 1EUCB 1I01A 1WEHA 1XRJA 2AQKA 5LL6P 1CRQA 4UM7A 1QFJA 1RBMA 2FGJA 4BO0A 1V11B 5DHPA 1R9JA 3JY6A 3OF2A 5HOEA 2BYTA 2ONCA 3DE5X 5J4LA 2B2CA 1PJAA 4LZZA 4AIRA 3V32A 4NJEB 2ATXA 3T1QA 3QOFA 4KYTA 2QVLA 3MIZA 5JAQA 5JNUA 1CJSA 4Q47A 4XRGA 3NDBB 1JR6A 1DZ3A 2COEA 3MLEA 4MAFA 1TQ6A 3QBVA 4X44A 1UWLA 2BFEB 2JBAB 2XB2A 3BDIA 2G17A 4G09A 3NC0C 4R0NA 4YAJA 3LW8A 1EFDN 4WWHA 1DG1G 1WE2A 3ZK7A 2ASVA 4UPVA 3S28A 2CNBA 2REXB 5ALQA 2BHLA 1J33A 3HGQA 5K0BA 4C4AA 3COYA 3E23A 4UAVA 4EPRA 4TWRA 2V97A 3SC4A 4ZGBA 2RBGA 1U7TA 4Q3DA 3SS9X 4RAQA 4NAHA 1QRAA 1NOIA 4K81B 1SUIA 3B6IA 1NW8A 1NQVA 3QEMA 1RC0A 1O96A 4X90A 2VHCA 2B1RA 3ND6A 1IY0A 3NH6A 5JJLA 4R9VA 5LD2B 3RNOA 1G2IA 2YRWA 4M99A 4EECA 1NURA 1PSDA 4M1SA 1JQBA 3AL2A 1OI2A 1PDWA 4XB1A 4NCJA 4RC9A 1Z26A 1NBME 2QLBA 5DM1A 4BNIA 3D4IA 3TRIA 4UOEA 5K8LA 2B5WA 2IZOA 1FFAA 3F4LA 4Z86A 4EVSA 2DWUA 2PUFA 1KK3A 1S3SA 4DYVA 5KWIA 2ZR8A 1KETA 3NT4A 2PN1A 3P2YA 3BHIA 5EHGA 2E6KA 2NZJA 1ORIA 4F1WA 1WV1A 1J24A 3BTUA 1GSIA 2BY4A 2XHZA 4ZQEA 3IAUA 4KLRA 1P75A 4NU8X 1HLDA 1UBCA 3L92A 2WWFA 3CX7A 3VUEA 5CFLA 5ALNA 4RD1A 2MTBA 1Y7LA 3D4LA 3OF5A 3BHJA 1DDGA 3FWHA 4GVXA 5IN4A 2ZRNA 1Q0LA 1NMEA 4KX5A 2P7HA 4L8LA 5EIOA 1XTJA 2H7CA 2YFYA 3EMVA 1O03A 2QE7D 2VDWA 2OHIA 2ZS9A 3C3KA 1VDMA 1EUCA 3CSSA 3DKIA 1K0UA 4XJXA 2QP9X 4CQJA 5EZYB 1YA4A 3ST7A 4LXHA 3E05A 1V6CA 4F4FA 2X9QA 4P36A 5JCJD 3ELWA 1HDIA 4HB0A 4YAGA 5ELXA 4FGWA 1YB6A 3OZAA 4UTPA 3UAVA 4RHXA 1E2LA 1JEYB 2YZGA 2I67A 1U2EA 2C1EA 2ZRGA 3CR8A 4FILA 1Q0HA 3CLRC 5AP9A 4C4TA 3SMQA 5CBPB 4OM7A 2H1LA 5AW8A 5FPHA 3BKXA 1D4AA 3NC4A 1GZSA 2NN3C 2R6JA 4XVQA 1AKRA 4HL6A 1FJ2A 2V6MA 1XWIA 3U09A 1VLHA 1YRHA 4PINA 2YXNA 2YZKA 3SM9A 4B6EA 4BBZA 4CKYA 1CETA 1TADA 4EEKA 1I32A 3Q98A 2LD4A 2CJWB 3G2KA 4C05A 1R10A 1W85A 1TI7A 4MUGA 2J9FB 4HVAA 5F77A 4JI6B 1SVUA 4WFJA 3W8RA 2C5BA 5KHOC 1BCSA 3ZU6A 1AHIA 1XROA 4P0TA 5KYTA 1JTEA 3N86A 3G5MA 2EW1A 4JR2A 4HXEB 3PHBE 3OT5A 5LJIA 1QV7A 1OTHA 5C53B 2QN3A 2C5EA 4O2BB 1E7RA 1PZMA 1X1RA 5B1EA 4LSMA 5EAIA 1YRBA 1VE7A 1G5RA 3DGEC 3F6PA 4GR9A 3VPGA 5CDTA 2ZYUX 3AW8A 1F8GA 5JNSA 5KAMA 1ZOSA 1T10A 3IXQA 5EC8A 4K8RB 1JDUA 5SZJA 4AJIA 3RQSA 4Z5XA 5BV8A 2F17A 3V7NA 4A0SA 5FH9A 1MFZA 2VJNA 4ZEXA 5CVCA 4G9GA 3Q5EA 3IDAA 4FWTA 2JRLA 3G5AA 4BDSA 2XMBA 1XZDA 4ALLA 5ALEA 4ND2A 1PZNA 4R0VA 2PGAA 4IR7A 2ZWPA 2PPLA 4EY5A 1BU5A 5DYWA 1FJXA 5BSMA 4MHTA 2O06A 1DC3A 1U9CA 5HFAA 4JLAA 2XGOA 2REBA 1E61A 2BIFA 1MGOA 1FCJA 1RHUA 1X7HA 2I2BA 3N7TA 4WZBB 5K3BA 3SEQA 1JEJA 2KE5A 4BBJA 5A6VA 2AMJA 3OT4A 2ATIA 5AVQA 3W9YA 2FOIA 3LLSA 4NPCA 1MAAA 3WMXA 1SIBE 5F33A 4Y0VA 1I36A 2OCGA 3AIKA 4WADA 4I5FA 1CUHA 1USIA 2QUBA 3EGDA 4L5YA 2PE5A 1Y63A 4ARIA 5TGTA 5DYIA 2FPGA 2KMLA 2ZG6A 3EAQA 3TM4A 4UPEA 5JXGA 3AUKA 4IINA 1FMLA 3KWLA 3WFZA 1V16A 2JI7A 1V9LA 5ICCA 3FF4A 1J99A 3MYYA 2J45A 1SC3A 4UATA 4LUCA 3GU3A 3COPA 3WLEA 2C20A 3VR2A 4DY4A 4N9WA 4UBJA 3AI2A 2IITA 2W2XA 3JASB 1OZHA 5DMXA 5IEJA 4DV3B 4RADA 3OZTA 3V6MA 2C3PA 4HDMA 3GLFA 1ZM2A 2CHGA 3LVRE 4JLUA 1CEYA 4NWIA 3LY9A 3TQQA 1Q50A 5A5DA 3I58A 1FSPA 2A0FA 4B09A 2Y99A 1ACLA 4H3HB 3UHFA 2CDCA 3W1WA 3BERA 3SOZA 2IDJA 2NNLD 1YS9A 3ZGOA 1UBMS 2FPXA 5H16A 2EW8A 3CZMA 3HI4A 4KCGA 2CLCX 2YDXA 4I1VA 3MA0A 1ONSA 2JD1A 1BVUA 3LPMA 3WL5A 4YR7A 2WUGA 1M5RA 1H4VB 2J5BA 4UC0A 1Y1SA 1IZ8A 3I37X 4C7MA 1EX1A 1ECJA 2GF0A 4KWIA 5FTJA 4I19A 2X7HA 1FUUA 4IXDA 1IUNA 5FPTA 3ZJ5A 2HWKA 1LBIA 2PVCA 1L4UA 2VXYA 3TLMA 1J7KA 2A0KA 2Q3DA 4EB6A 2O7SA 2QXYA 1VSTA 3PWTA 1VPEA 4WXPA 5KX5F 3U9TA 3BBPA 1JJFA 3G7SA 1JHZA 2FEKA 4D8UA 1REQA 5AJZA 5EYPB 4ETMA 4F7WA 5FBWB 1Y8RB 2V7UA 1DTEA 2J5RA 3H8WA 4FK8A 2FMXA 4KIWA 2YWFA 3WADA 5JEEA 3QG1A 2AWOA 3GLIA 2YUIA 4EM6A 2C7PA 5CEEA 1XRQA 2GOYA 3RUIA 4BNTA 4EI8A 5HSGA 5ALPA 3PXEA 4X1KB 5JAHA 4DLKA 4EW1A 2WT4A 2FRDA 3TLJA 4NC9A 3FGOA 4YGYA 4U2KA 3LCUA 2D1TA 1A4XA 2IJGX 4GE0A 2JI6A 4FP9A 4TRMA 2VPPA 3C98A 2FRVA 3UGQA 1SELA 4RGQA 2V3WA 4EX7A 1XKXA 3M6FA 3N2GB 4BMVA 1N2CE 3IAS6 2H9IA 3N3AC 4TZKA 1JEAA 2PZAA 5GMOA 3I4FA 4L2IB 5T8KA 4CV2A 1HKHA 3EDCA 1T4CA 2ORYA 1JXQA 1N5DA 3QHAA 4G6ZA 1XVUA 2OR3A 2I0FA 1NMSA 2QW0X 1DBRA 4XSGA 5CXSA 4GP7A 4DNQA 4DW8A 1QSGA 1VHTA 1HFWA 3IVMA 1NUQA 1QS0B 3IV6A 4RJIA 1EVKA 1XCOA 2IZ7A 3KCQA 2EEZA 4BDTA 3NVAA 3TLCA 4C21A 4JUIA 1YZLA 1EXNA 2CXSA 5AJVB 5HIJA 3S68A 1LPOA 1T15A 3IBYA 3KPUA 3MTQA 2IU0A 3F3SA 3N8NA 4U0KA 4HEA6 4YRJA 4MDFA 1AN9A 4JC0A 5EHQA 4IIUA 3AF2A 2D1RA 3HEAA 2WWWA 4K9QA 3KXPA 1N2CA 2YJ6A 5J9FA 3IPRA 3KDAA 1QK5A 4OYLA 3ZW9A 1I14A 2NW6A 3OEHD 3B2NA 4GU5A 2VDWB 2RG7A 2EQBA 3QVMA 4FFSA 2IU6A 1SBNE 1G55A 2AUNA 3RRFA 4MGEA 3L0CA 3ZVRA 4A0RA 4B2LA 1GWNA 4ER7A 4GMDA 1NJFA 3FRJA 4BNXA 5FPPA 4GZMA 1YRWA 3C7AA 2X0DA 3BXEA 4E2ZA 5K0TA 5GGYA 2UYCA 2VZ9A 3GDHA 3Q10A 4HUQA 1YFZA 1ZVJA 1ETHA 2FOLA 5EFOA 3UW1A 3JQFC 1YE8A 5AJUA 4BU0A 4EFKA 4BNNA 3RSFA 1RHMA 1JVNA 1SCBA 1NE7A 2AC7A 2ECPA 3DR5A 3EEYA 1F51E 3P9YA 4XZ3A 5HF8A 5LMCA 3DAYA 4IH4A 4AJ4A 3L7KA 1E2FA 1KOGA 3BFXA 2DTDA 4XVCA 4LXUA 4BFXA 4UDYX 5G1OA 1E59A 4FHEA 821PA 4LDPA 1DQZA 2ZWAA 3CRMA 4OUDB 5EVJA 2QL9A 1AF7A 2CN1A 2ODBA 3R6LA 1FC0A 3D6JA 2Y27A 2YIVX 3ZXSA 5KJCA 3Q41A 1OXVA 1P9OA 2B8TA 4JXJA 5DHAA 2CDRA 2Y3IA 4M7WA 3QM1A 1Q1ZA 4OHWA 3HEBA 5KPDA 3AK4A 4TVOA 4DSUA 1PDVA 1RIFA 1B6RA 4QU5A 5DEOA 1KRWA 4AL4A 1GG5A 1TA9A 2MR6A 5A6SB 3ILHA 5KDOA 3D6UA 4B8YA 3DG9A 3RVJA 1YH3A 2WWXA 4BKQA 4FLMA 2WWVD 1Y42X 1CY4A 3EQ7A 3LA6A 4I50F 1CYEA 1AZLA 1LX6A 4IJUA 2ZJ4A 3B8HA 3BRWA 4ZYUA 1E2JA 1R8QA 2PZMA 2QU8A 1WY5A 2B25A 5FUYA 1N7HA 2JCXA 4KPEC 5CJJA 1O95D 1QOQB 3AOEC 1OTYA 2GZRA 4N3CA 3UWKA 3MLBA 4JGIA 1N4DA 4V38A 3RSCA 2BFEA 2JBAA 3KSDO 4RJLA 4DYDA 1K5GA 3DO6A 3AY6A 5DLEA 2Q4TA 3VDMA 4ALNA 4TMTA 1QTNA 4YRTA 5AKIA 2V9PA 4QOIA 4Q9DA 2VJKA 3WWOA 2CNDA 2DH6A 4XUDA 3F5FA 4PVCA 3TJZA 1D2CA 4NL4H 1U7DA 5GQSA 4Z7OB 1A4UA 5DNWA 3CU5A 2KHZA 5AOAA 1JHRA 5FWDA 1JR3E 1PZEA 4JN6B 1VIAA 3ABQB 1NDUA 1P1BA 1J8DA 3GMSA 4V0LA 2P90A 1JSZA 5LJLA 2G4CA 4TGLA 2QGNA 2VLIA 2P9JA 2QTBA 1M33A 1HT2E 2Q1UA 4A10A 4J7XA 3IAM1 1WV0A 1S4QA 5FTMA 1CSEE 4DWWA 4YQYA 3LCMA 4WECA 4I3GA 4RK1A 1WXQA 3NBMA 1UFRA 4CLRA 1EYZA 2G5CA 2P27A 3CLSD 3MTBA 4HAYA 1SQFA 4CKZA 5FUQA 2BGMA 2V7BA 5LD2C 3ESCA 3HU5A 3I0MA 1GOTA 1P4JA 4JOCA 2Z5VA 4G01B 1AKQA 2RC5A 4QUDA 5JWHA 1YULA 4FGJA 4EUFA 3P94A 1ORVA 1T13A 2FQXA 1TD9A 3U44B 1WVMA 5C51B 3G17A 3NBXX 4LN1A 4KOEC 1A71A 2OP1A 3KL4A 1NBOA 4BTLA 4FYVA 2OY0A 4PG5A 5DISB 2GAJA 3U3XA 1AHHA 1SULA 1VJCA 2Q4EA 1COWD 3KEMA 1LB1B 2ADFA 4M22A 4CCSA 1TE2A 4AI6A 1QDLB 1Z35A 2H2IA 2GYVA 3KSZO 3CX4A 3PA8A 3UGKA 4DBVO 2I4IA 2JEOA 3LO8A 3VC7A 5KMGA 2PBFA 4JFAA 1OAOC 4HWTA 2VHZA 1KSFX 1FUEA 2NZ2A 2MR5A 4H3KB 4LBZA 4YCCA 3OQIA 2JIQA 1O0SA 4RMGA 1PD1A 3UJBA 3EAFA 4ZWNA 5KX5B 3ZBUA 2HPVA 1ODTC 4RL4A 1CZNA 2E4WA 2FVXA 5E4TA 5FFMA 2O5VA 5B6PA 3L7LA 4B40A 3AEQA 2PH7A 4UZSA 1S8NA 4NY1A 1KOJA 3PIRA 5HFJA 4CEJB 1EESA 1JPJA 5JYEA 2PMWB 4DVJA 3G49A 4FUQA 3F7NA 1GN9A 2XLCA 3NB0A 1V43A 2DY0A 2JL1A 3DOHA 4O0MA 1ZIOA 1DKRA 4IS2A 4AZ3A 1TZBA 4RPIA 2J4DA 1QXSA 1F5SA 3PIDA 2BTEA 5HE9A 2IEBA 3KSMA 1GPWB 3PEEA 4ZO8A 4WLFA 1VFPA 3L0YA 1ZRNA 5ARDA 3EUFA 1JQJC 1UMCA 2FY8A 2W90A 4RA6A 3TTVA 3FROA 2J5QA 4E31A 3G9TA 5JAUA 4HMPA 2FPOA 1BHO1 1CBUA 1EM6A 3I9MA 4GH5A 2GCOA 5T64A 2PUVA 4KAAA 1BMDA 1GT6A 3BQ9A 2D00A 2AFIB 2FWNA 1XAIA 5FYDA 2X4IA 1W8DA 2J4CA 2CLHB 2YWJA 5CX1B 2Q3MA 3O4HA 5I48A 1VG0B 5ES3A 2X3FA 3OMLA 2W42A 1AGYA 1SG6A 3BE6A 3WLLA 1TL7C 1YB2A 2AIRA 2E4VA 2R62A 2NTVA 4CMAA 4S05A 4H6WA 2ZS8A 5DNCA 1V1MA 4MX8A 5FULA 4HDRB 2BP7A 2Q2NA 2RAUA 2XH8A 3OEYA 3OSUA 3I3SR 3T7AA 1TIBA 1V2HE 1KOLA 3OM0A 3T54A 4BO8A 2F59A 4U7FA 3H2GA 1YZHA 1IHOA 2XPCA 4FHCA 4XQ0A 1NI5A 3I9LA 3T7CA 5DPMA 4F5YA 2QTGA 1S2OA 1GILA 4JL5A 5TQ0A 3OEEA 4N47A 5HRUA 3OQ6A 3OFKA 4XIFA 3G7UA 3HM2A 4TTSA 1FDVA 4HAIA 4RZIA 2BF4A 3H9EO 1G6KA 2C3MA 3EJ6A 1ATIA 1IQ0A 3KM0A 3NUZA 4MULA 2AJ8A 2QG6A 1YO6A 2X14A 2GAOA 4BMCA 4FS8A 1JKJA 5FFNA 3B38A 3H5TA 1QH1B 2P35A 1P1JA 3OSZA 1P6QA 3FZQA 5DHTA 3TDNA 3TL2A 3WP1B 4BIMA 1CEEA 4ZU6X 3KD3A 4KXUA 3EF1A 5A9TA 2Y9MB 1F6BA 2HTEA 1P7VA 1XZGA 2Q8PA 4JP1A 4WZ6A 3SQDA 4B2IA 4E46A 2HQ1A 5IXJA 2FEPA 5H0IA 1MQ9A 3GLFE 3R3JA 1HFJA 4BNGA 4JDPA 4FSXA 3WGIA 4RBNA 2IYSA 2H8GA 4I0WB 1HZJA 3G5TA 3P97A 4N54A 3UFXB 4DDMA 4Q4DA 1MR3F 3ML1A 4EJSB 4H3SA 3ROQA 1D2GA 2AOVA 2W2OA 3A4MA 3NBYC 5EXSA 3ZNNA 2OKCA 1O97C 1ZD4A 1ZXLA 3BVPA 1U7OA 3FMIA 3ESAA 3M4ZA 4H6PA 5DT2A 2LPMA 3D0KA 1PFUA 1ZU4A 2IUYA 2ZYDA 2YOHA 1XG5A 3A1VA 2NAFA 2ZITA 3DDCA 3GFTA 3FUWA 1A5SB 3N74A 1W52X 3R4CA 4G4GA 4HNSA 4QASA 4GXQA 4XFDA 5FWXB 3P9XA 4JC8A 5K8IA 2WTUA 2R79A 2I1LA 3SKYA 1CUSA 3LC1O 1B8OA 2VHUA 1NPTO 4RWEA 1B74A 4ZOLA 3RSSA 2WUFA 5IT9A 2G82A 1CUWA 1YS4A 3T7SA 5DM4A 3S5UA 2B94A 1YK1A 3OZCA 1E6LA 4CIXA 3LOPA 3LU1A 3OJFA 4RTNA 2JEZA 3DCYA 1GUDA 3MGAA 3W6UA 2PMBA 3CRRA 2QXTA 4D5GA 2D3WA 4AC9A 2WA2A 1SHLA 1T8WA 4HHEA 2JAUA 2VF5X 4JJGA 3DHVA 5AK4A 3TD2A 1N2HA 1U0OC 3MAGA 4XPIA 2ZTLA 2O2ZA 4GEGA 2XW6A 5IBCA 5LUAA 5I7OA 1Z7WA 3ZU3A 2F48A 1PGPA 4V3BA 3T9BA 5SZIA 3TLBA 5JJBA 2DKNA 2I1QA 3N7UA 2PLAA 2Q99A 2ZIZA 1GLGA 2E1RA 1PV2A 3EG5A 2RHGB 2RFLA 3I2KA 3OH8A 2C0QA 3UAZA 3WLJA 5HEKA 2G5GX 4F1KA 3MZ0A 4MR9A 5HG0A 4BWVA 4J2TA 3ZTYA 1W4AA 1ABBA 3OCVA 3TEMA 5KTNA 4J07A 3BAZA 4N12A 3BGVA 4J7AA 4N40A 1W36B 1MAHA 1YZYA 2A4KA 2TS1A 4DPMA 3QQ5A 2GESA 4B6RA 4YRMA 1RC1A 2ATEA 3KSAC 1NJ5A 2W6JD 2ENUA 2DR2A 4RSRA 5F7ZA 1ZM4A 5IBPA 2GBGA 2GCPA 3T5BA 1HKUA 3BA6A 1P29A 2C2HA 2QTLA 5E2IA 1U7PA 2O9JA 5ETJA 1N25A 2AMVA 1O5IA 4QLBA 4IQ8A 3I61A 1KC1A 4N0MA 4NMMA 2QYSA 1KMHA 4BMYA 1YKGA 1UBEA 4XQCA 2O8EA 3K6JA 3K7EA 4H0FA 1OIWA 3BJEA 4FOSA 1LCIA 1QCZA 1MOQA 2G6TA 2A9FA 5H80A 3WJ2A 2G8LA 4J0GA 2A9VA 2WILA 3F7MA 1KE2A 1UOPA 5JDIC 1S2GA 5I9TA 4C3OB 4G3XA 1AV7A 1U2ZA 1PX2A 1O87A 2LBPA 2W83A 1MO4A 3P32A 1JDVA 1GZ6A 5BSRA 2IHTA 1FMFA 3WGGA 2JAQA 3F9CA 4AJ2A 4MRRA 3ZLVA 3HABA 4PHCA 2CK3D 5DI9A 4EGFA 2IDMA 4TLCA 2O2HA 4WI1A 1QIMA 4LK3A 4EKGA 2AZXA 2EYUA 1T4BA 3VMFA 5CITA 5TEVA 4DVGA 2J0SA 4ITVA 2FETA 1DB3A 4JT4A 1CQJB 3IC5A 2LNDA 4MW5A 3CVUA 1TAUA 3NS7A 2RK4A 3FYDA 1YQXA 3FOWA 3MTIA 4LYEA 5CVUA 2NP6A 4KKVA 3E6AA 3Q0IA 4EUNA 2FPUA 4EHAA 2FF5A 5KQMA 2CYBA 3FYSA 3PXCX 3RS9A 4YFYA 3DDHA 4BJ5A 2XDWA 1R4AA 1M0WA 2GFHA 1XPOA 1Z4QA 3HB0A 2VH2A 1DJOA 3FDIA 3H42B 4Q16A 2GFIA 3PFNA 4KU4A 4DHWA 1QGYA 3F5MA 4W9RA 4XKJA 4RJTA 3UMVA 1GUYA 3GFRA 4UBKA 4LWPA 1NJ2A 2WHEA 3GFVA 3W8EA 5AVRA 3WGVA 1XLTC 2FP4B 4QTYA 1E1RA 1WSDA 1A2BA 2H2AA 1L3IA 1M1XB 4XM0A 4TTIA 1ODIA 1WBBA 5K01A 1Q3HA 2DPYA 3M9LA 1L4GA 4ESEA 5JRZA 1JQAA 3ZI7A 1XFAA 4GLOA 1EIWA 4WASA 1U5CA 2HMWA 3D31A 4LY9A 3EGXB 4NEHB 5JBIA 1KL7A 2ACEA 1A72A 1QH9A 2TYSB 3PC3A 1E1CB 1SIUA 1ZD2P 5F9FA 1YJBA 3WXMA 1U04A 4QJ4A 5CCDA 3AL0C 2R6R1 4JJZA 3ZGNA 4QTTB 3PQ3A 3MN1A 2NSDA 1R3DA 4JS0A 1KEVA 13PKA 3K15A 2PK3A 3V80A 1KQOA 4PANA 4HDKB 4P3KA 4OG2A 1F6DA 3PRJA 1P1KA 3C74A 3AI1A 4I8DA 3OIFA 2JHCA 2RK6A 1UC9A 4ZT7A 3OBIA 4M6WA 1RBZA 4QFDA 2A0YA 2ZYRA 4BV2A 1N9ZA 1RTKA 1RRMA 2QA5A 1NG9A 3AFIA 3U6KA 4K6OA 3DC2A 1VGVA 2F00A 3CFYA 3FVQA 4MAMA 3TI9A 4B76A 2AKEA 4G0XA 1USWA 2HSZA 2O14A 2QSYA 4PLWA 2NXWA 4U2DA 5AW5A 3K6SB 1CZKA 3N7AA 1QCCA 3UGTA 4DLXA 4BRWA 4LX0A 4EAQA 3RAPR 1U0FA 4EI7A 2VUTA 3AVUA 1NP3A 4NK5A 4DMMA 2KW5A 4X45A 5CTAA 1N5JA 3NWBA 2VBIA 5A5VA 1YS2X 2VHXA 2ZBFA 1DX4A 3CZPA 2BUCA 2FFAA 1UEIA 2MINA 3NFRA 3R75A 4E1VA 3O75A 4RSMA 2NVWA 7ADHA 1JIQA 2PX5A 2Z8ZA 2ZUDA 3FB1A 4LHWA 4P2GA 4RANA 1NJSA 2YMQA 1ZSNA 3EQ9A 4AZ0A 1AXRA 3TW6A 2ABWA 2J7PD 1PFYA 3BRSA 3KB6A 4WAUA 1N8SA 4B4WA 1QV9A 3SR0A 2WIJA 1T5OA 2HK7A 3PBKA 3D0RA 4HDRA 2PH5A 3LVBA 3JQBA 4JLMA 2BZGA 3WYFA 1ONPA 1EK5A 1GY8A 4KLCA 3Q7EA 5C34B 5CFMA 2LTAA 3NVMB 3IHLA 5IN5A 3SZOA 3U81A 3UJ8A 3ZGXA 3TTYA 1ENZA 5HRCA 1X1BA 3DZDA 2QTNA 1UKZA 3E3LA 1RRPA 3QX9A 3KB8A 5EQDA 3TQIA 3ZGYA 3FMOB 3AR9A 1HSOA 4C4ZA 4CV0A 1TJ4A 2PNFA 3GARA 2Y2VA 5GM2A 4PTYA 5CH8A 1W5AA 2AV6A 4IIJA 4YXWA 5KTOA 5J2UF 5IARA 5BWCA 2R8XA 1JAIA 2ONYA 1OX4A 3GLTA 1UPXA 3O84A 2Q6OA 1DT3A 3Q2KA 1MX1A 4I50A 3ZCRA 4JJAA 3GLKA 1EG2A 1RRVA 4B79A 4P7JA 3TOXA 5FBVB 1MIOB 4W5RA 1FFSA 4EPWA 3U80A 2HRDA 3FPFA 3HTXA 2V8OA 3T9FA 4Y2XA 1UL1X 3MXOA 4FJ2A 4A1FA 4AT1A 1MORA 1W2HA 1XRRA 1ZZEA 4A27A 3LBFA 5ALUA 1CUIA 5BQ3A 2VQ3A 2PIAA 3RUAA 1LDNA 3CINA 4PG8A 1B42A 4YP5A 1WUYA 3B9QA 1SKYB 1CUJA 2YZ2A 5CIQA 3PXXA 3WRVA 4AZ3B 3SJZA 1DAFA 4QEZA 1YIDA 3LO5A 4IUYA 2VTEA 4ZAZA 1R16A 3AC0A 3WK4A 4YYEA 3GVCA 4X6UA 5EWMB 3L8CA 2ATCA 4O2RA 3GUHA 1DX9A 3EK2A 3ND5A 4AN4A 3BIXA 4QFCA 4RE5A 2P3OA 4K6GA 3IAFA 4D25A 1L4NA 2JFYA 1ZGCA 5K0LA 4DV2B 4HGRA 3ZHRA 2BGNA 4KJZA 4AURA 3RU9A 1KY5A 1NJ6A 1UUFA 5EE9A 1HTTA 1QFZA 2D1YA 4WXEA 2VBCA 3S2FA 3RBZA 4QXMA 3NTOA 2JZCA 5DOZA 4UJ5A 5G0SA 1BS1A 4BJ6A 4QUBA 1ZWKA 4L7VA 1G291 3ODPA 4NP6A 1P81A 2V1UA 3HVIA 1KWGA 1XTQA 3RABA 4P4UA 3HN6A 3VMMA 1SHUX 3KC2A 4ILKA 3UT5A 3C5HA 3PX3A 3USES 4RY2A 2ZLBA 2J67A 1RBQA 2FE4A 2XAAA 1SRQA 3Q7IA 3NRCA 3MJHA 4QDUA 3VR3A 3ZH9B 2FJPA 4H6VA 3ZZTA 1W5SA 3QKSB 3GAFA 3M6UA 2C96A 2EFCB 2OBYA 2P5UA 2VK4A 1I33A 3MEQA 3QMPA 3HH8A 2PRSA 2WVAA 3T1TA 4C2TA 3UC9A 4AK9A 1Z4NA 4DLNA 4ZOEA 2HYDA 3WB0A 2PD3A 4Y6QA 1TPZA 1SJ9A 3VNUA 4N01A 2WJPA 4CKWA 5JRJA 3P2OA 5G0VA 5EQTA 3ZD6A 1UPFA 1W0JA 3L4SO 4L76A 3ENNA 2J9GA 3O8QA 2WU0A 4OIMA 3AG5A 4OXRA 2PPVA 1AV6A 2AJDA 2Q9CA 2XR1A 1RI5A 1USUA 3AJRA 5CLQA 1CE8B 1GGNA 1WOMA 4PZDA 4F4IA 4KV7A 3E8SA 4JYBA 4L3OA 3MFYA 4TUYB 5I6DA 3S4YA 1EVZA 1MRZA 3DCIA 4L3VA 1QP7A 4RVOA 1UH5A 3E53A 3TKYA 3WLFA 2ZKIA 2PMEA 1Y0BA 1L5GB 3LMKA 3B1YA 3DVSX 4CI9A 1SY7A 1ONBA 1GUBA 1ESCA 3CCCA 3PUKA 4IP0A 2QZJA 4MQBA 4BLRA 4QUEA 5BW4A 3RRZA 4D5EA 2MINB 1YJ8A 4MUJA 4JQZA 1Q74A 1E18A 1Z0ZA 2FFBA 2P6PA 1G6Q1 1L9XA 1ZN7A 1A9ZA 3C8ZA 2D8MA 1AHNA 2HGSA 1FA9A 1ZC3A 4F8EA 4L4XA 1JR3A 1MHTA 1IG0A 3CUYA 1ZQ9A 1KIMA 2C1ZA 2YJ3A 3CTMA 4LCJA 3KJIA 5J59A 4EHNA 2G5TA 2Q28A 3SVLA 5FQOA 4O4IF 1Z34A 4CF7A 3AHJA 3QBTA 1OOEA 2JIRA 4GL4A 4ZODA 4U7PB 1R0XA 5K3EA 1T1JA 3C0KA 4RDXA 3SHOA 1UBHS 1B3BA 1B0ZA 1E9BA 5AW4A 1T2UA 1QH8A 2ZSBA 1X7GA 1NV8A 3L8GA 4N8DA 2YJTD 4R8LA 5JJKA 4Z3OA 3SYNA 1IPEA 1JDBB 4R7TA 3IESA 4I1IA 3EGEA 4M54A 3B6EA 2ZRMA 1B2RA 2W2TA 3JVUA 2DECA 4MCIA 4CDMA 3WDLA 5SY9A 4HZIA 3TQCA 4A0FA 1NW7A 4NBSA 4YP1A 1QMGA 5IVHA 2NPIA 1D6MA 3R3HA 5KC9A 1FNCA 1L4YA 5JPCA 4Q1DA 1U31A 1U0NA 3AOGA 1CB7A 2J3EA 1RCFA 4MJXA 4ACAA 3SSMA 4V0ME 1BA2A 3GJYA 3OCXA 2E18A 1A9TA 2PR2A 2JFHA 3BJIC 2V8BA 4HFNA 1AKMA 5B3AA 2GA8A 2IPMA 3H11B 4YRZA 4JX9A 1QIHA 1OFGA 1NMXA 4JGGA 3IAS1 4XEUA 3U3OA 2O8EB 3A3OA 2YNMA 2FEWB 3QUTA 2ZYIA 1U80A 2BISA 4C0LA 3SYMA 2JLCA 1I4OA 1KAQA 4W5NA 4TYYA 3LCJA 3JWPA 4Y2SA 4AQYB 1IXZA 5KJ6A 3VJRA 2ISSD 4AF6A 3NDIA 2ADMA 1K08A 3KJFA 4HUJA 1S01A 2OFXA 3SJUA 5KZMB 2QM3A 4GWKA 4IOLA 1TPYA 4MQFB 2H85A 5CVDA 4DZZA 4RTPA 2DR0A 2B1GA 4CN8A 2GERA 5BMOA 1OH5A 3ZZUA 4M9UA 3ZZMA 1ZH8A 3EG9B 1I4DD 4FFRA 3IODA 2XHEA 5CGQB 5D86A 3SSOA 2WUDA 4ARVA 4N18A 4UNPA 3LPNA 3SXUA 2IF2A 5T41A 3X1WA 4DA9A 4C9BA 3QE2A 3PHGA 1N2CB 1Z22A 5J2UB 4EZEA 4CQMD 1TIKA 3F3KA 1R4MA 3KUKA 5F1PA 4BRUA 1I94B 2IIBA 2JFPA 3HYLA 1LUAA 4TT3D 1JB9A 4KV9A 4J49A 4P83A 2O50A 1I2MA 4ND6A 2B1JA 4FGZA 4QTXA 4EG4A 3HWRA 1D5WA 2HSGA 1EPUA 3FZNA 3W5UA 4V03A 4C0BA 4MUFA 2AFHE 2WWIA 1P60A 1MDBA 2Z09A 5FAKA 4MRPA 3WX0A 5TIIA 4G0UA 3DOEA 2JLVA 1A04A 4CTJA 2BM8A 3WMWA 3EA0A 3WOHA 2DAPA 5PGMA 2BTQB 1CCWA 1KPGA 4J43A 4FQ5A 4JI3B 3ICOA 1Z73A 3BFKA 4N6OA 3C1AA 5T7BA 4GBJA 4UTXA 1II8A 1BFUA 4AQDA 4TWBA 3KHTA 4F2PA 4Z4EA 5LDGA 2WYHA 3D5TA 1UQUA 1IXRC 2ACWA 3BK2A 1HL7A 2A58A 3M83A 5A03A 3C3EA 1TUGA 4N3NA 2V65A 4KDRA 5JBNA 3UMYA 3BOSA 4YPVA 2VDMB 3U3DA 1KZ7B 3ON5A 3KZVA 4K9MA 1Y98A 3LGXA 4CFYA 1PF7E 4Q82A 1NQTA 2BCJQ 4BFCA 5DWQA 4G97A 3M89A 2RHJA 2I80A 2WDPA 2VPTA 1SU7A 4KZKA 5DP1A 2PUEA 4UCXA 4R2JA 3PEWA 5K2OA 4OBBA 1X7ZB 2GZMA 2WHPA 2P2LA 1Z0IA 5CVJA 3T4EA 3HACA 5EUCA 1M74A 4ZZ0A 2X86A 4JBGA 2QMEA 1BXZA 5CDYA 2XADA 5DTMA 4RPKA 4C7OA 1YGYA 1RI3A 3VDXA 1J2YA 5DX0A 4EY6A 1E1QA 5TQVA 3JTMA 2ZWIA 3EPHA 3I1IA 2A5JA 4ZK2A 1G6HA 1KZ9A 1KQPA 1L6RA 2IEDA 3K9HA 3UUFA 1W30A 3DEAA 3STHA 1VYVA 2P41A 2HMYB 1GZ7A 4HF7A 2BGGA 3QFCA 3GAMA 1C4XA 4BGEA 3CF2A 3VVCA 4NECA 3N8DA 2R1TB 3KSRA 2VPIA 4AY3A 3BH7A 1NBHA 2NUTB 4FYIA 2NVUA 2FSIA 2Y1DA 3F8SA 1FNNA 4PX9A 5CFRA 3TTSA 3C1OA 3BREA 3TLGA 1BGWA 3NC1C 4PZ0A 4CFSA 4UUAA 1TA4A 1IRXA 2ZTMA 4KQ6A 5ER6A 1AMNA 4HQOA 3RS3A 1XD8A 2DERA 3MJCA 2PAAA 5U9CA 2B4RO 1N2SA 4NBKA 4GC5A 2GTHA 1CE8A 2X8BA 3KHUA 1GR0A 4JAVC 4PBTA 3ZY6A 4C0QC 2Z5LA 4BNMA 1R0CA 1TLFA 3PUJA 3GYGA 4MKIA 1LF5A 3OPYB 1TQHA 1NZFA 4UJ3A 2BDEA 5JAZA 2HH9A 4QGBA 4QTUB 1V3VA 3VHLB 5B12A 3F5SA 2WF5A 2GEFA 3AUYA 1GFZA 3PEFA 1F14A 3BZWA 1A9OA 1OXBB 2WHRA 3N2YA 4OI1A 4D8WA 1XPRA 1V8ZA 1WD5A 3EPPA 1NYLA 1JA0A 2I4OA 4B3FX 1E0DA 4C78A 2C78A 2AG0A 2BGTA 4FE3A 3C8MA 3AT1A 1JDPA 4M1ZA 2DVMA 3DZ8A 1C9KA 2ZRQA 1HF3A 3FH0A 2NPFA 4YAUA 1ZDMA 2ZULA 3DJFA 1HXHA 1I3OA 2XRFA 1MAWA 5CTJA 1YKFA 4MGKR 4WCFC 1T1SA 1R64A 3IJ5A 3AH8A 3T6KA 1ZUNA 2XZLA 3WBJA 4W5QA 3AUJB 3LRPA 1H22A 3CJQA 4JXKA 4Q18A 1WZNA 1WKCA 4EKIA 4ZI2A 1VMEA 3FPJA 3OPMA 3WYNA 4EQ6B 4KR7A 1UC5B 1QPZA 3FHTA 3WGKA 2R9VA 5BWBA 1W9MA 1V8OA 2HL6A 5FYQA 5H68A 3VI3B 4CNBA 3V2GA 4N9QA 4DSAA 1MOZA 3K09C 4O2BA 3A3NA 1TD1A 2BI7A 1NT4A 3O03A 2BKVA 5CG1A 4O8CA 2G1KA 5F98A 1MZPA 1TAGA 2XUHA 2C2BA 2G28A 3AB7A 5CB0A 2WJIA 4ENPA 1SG0A 2CZQA 5HWSA 1AGPA 1R6UA 3I5UA 1Q0RA 1QAQA 3O90A 1W85B 1F20A 3CWCA 3ISJA 3QA9A 1H0SA 4MMYB 1R9GA 4I50B 1T0IA 4WLEA 3WNDA 1DEXA 1A1VA 1QP0A 4YRBA 4JASB 1PJZA 1QQ5A 2G1UA 3F6RA 1NRIA 5FBRB 2PV0A 3N70A 1VCMA 2EXXA 4EL0A 2CY0A 4YT8A 2QE7A 2XUZA 4MWSA 1T3TA 4EG1A 3HXOA 3UY4A 1AN0A 1TZKA 2P75A 4HAXA 4PVDA 3W5SA 3N6VA 5GP1A 3KKOA 1IVSA 2WAAA 3OZFA 4PO8A 4X1IB 5T3YA 1TF7A 2I2WA 3ANNA 4NS1A 3KTAB 3KJQA 3TNDA 1R5BA 3NBZC 3OLYA 5KSZA 1N5LA 3OCYA 4ZVLA 2O5EA 2QD5A 4YWJA 4CF5A 4DSOA 2OGWA 4Z4QA 2O8FB 2SHKA 3K0KA 2ZJYA 3NXKA 1M73E 4RS4A 4TM8A 4ZO7A 3T7RA 1IHPA 1J97A 1ZAKA 2X77A 4FCVA 4D82A 1F0YA 1BA3A 1KMMA 1TM5E 3L93A 3ZYCA 3ZIUA 1H1DA 3M4JA 1E3QA 4K03A 4PQYA 3W5CA 2IIPA 3PQDA 2RIPA 3GBPA 3H87A 2XCQA 1ZGAA 1E7YA 4Y98A 2VP5A 1WD7A 2WJAA 1MB2A 5FLEX 1ZK4A 2UXCB 1RZ3A 3HRIA 4MIKA 2A14A 2DU8A 2VYQA 5IC6A 4DV5B 5JD5A 2QRVA 4BATA 5EJ9A 3R7SA 1Z8DA 1ZNXA 4Q3EA 4KNYA 1IZ9A 1WHTB 2ZI9A 2FK8A 4RIIA 1U7HA 3AHGA 3VKFA 5JWOA 1ZW6A 3T9CA 4QICA 3LQ4A 3OFSA 4U7TB 2WAYA 4CM5A 5CDGA 2Q4RA 4LQCA 5C32A 4BNFA 3BULA 2CSXA 3TRHA 4WK2B 4KQXA 5ESXA 2MHCA 1P2UA 1XQXA 3E1KA 1Q21A 4QHYA 4RLSA 4YJFA 5DCYA 5F1KA 4K87A 3Q8WA 3AKZA 1IUKA 3U39A 3I23A 3GG2A 1U3DA 2NUAA 1EJ0A 2Q4OA 1I5EA 1NQOA 1TYCA 1XA3A 1XEXA 3LF1A 4QUAA 3PGVA 4D3ZA 3ZWCA 3B9BA 1YB7A 3CURA 3WE7A 4FINA 2ZRAA 2BEKA 1V8BA 4OHPA 5B2ZA 2PZBA 5K0FA 5AXDA 2G36A 4IDHA 3PNVA 1EQ2A 2TSYB 3COZA 3HJTA 1NN0A 4FYKA 3RC1A 4KITB 1YVRA 2A8YA 7YASA 2NYUA 1Q77A 2YMMA 3WHLA 4EGCB 1T2CA 1W88A 2ZJFA 1EE9A 1N5RA 1DXYA 4TLMB 2PZLA 5E9JA 5BSGA 1YZVA 2QTRA 2XCIA 4WOBA 1W76A 2EX4A 4MI6A 3KZCA 1F6WA 1SB8A 2HBYA 3NZEA 2ODQA 2ATVA 5CH5A 3VNBA 4OXIA 4RA9A 2B20A 4DCTA 3H1BA 4YQEA 1FTNA 4MDHA 3H5LA 3CX3A 4E5YA 3ZHVA 5AYVA 2ZPUA 4KE9A 1YNSA 2Q41A 4HN4B 4QPPA 2ZZNA 3IPLA 4ZZ2A 1NV9A 2HF8A 4LF4B 3O8NA 1J70A 2GXUA 4XJTA 4MYCA 4XTRA 3HKDA 1BJRE 2VL7A 2Y76A 3HKCA 4L72A 1O5TA 3K0HA 2CFSA 5JLAA 1O6FA 4LRQA 4RCZA 4XD7D 5B2FA 3VA7A 3DTNA 1RACA 3RW9A 2IW3A 3B20A 3B6KA 3CZ4A 2F1RA 3LVQE 1H2BA 1QIJA 1Z88A 5LU8A 3FB4A 3B9RA 1ZONA 4D4IA 3T5PA 4OFWA 2IE0A 4JC5A 4GYYA 3A58B 1EP1B 2F64A 3KJEA 3KTDA 1PL0A 4H6XA 5JPIA 3JVIA 1ZHHA 2YJNA 4Z51A 4XWTA 1PLJA 5AI0A 4PX5A 5ALVA 3SBDA 4YMTA 1N3LA 1LS6A 1JEDA 1EFRA 1W2WB 2X0FA 3AERA 3W8FA 4E5SA 3MOSA 4WTOA 4GSLA 1OB2A 3D8RA 4CKEA 1ZA2A 3OESA 5G41A 2HCJB 2OAGA 4CL2A 1GAQA 3KKMA 3HJFA 4XVRA 1GUZA 4YRAA 5MDHA 1P17A 3OIUA 1PFVA 2BMFA 2EJBA 4KHZA 2IS6A 1UT8A 3CPEA 4Y0NA 4ZQHA 4S2EA 2Z08A 4ZCTA 3WGYA 3W9BA 4FBGA 1QFXA 4M1MA 2ERXA 3S2YA 1WULS 3P96A 5JZMA 2HA6A 3A36A 3N76A 4G8DA 4INJA 2WHXA 1UZUA 2AJLI 2JJ2D 3LD9A 1XXLA 2FW1A 3W1EA 3ROZA 3ZWPA 4HUTA 4WBNA 5NLLA 2PM8A 2QVZX 2QY6A 2XF8A 3AU8A 1YRAA 2Q5LA 2Y05A 3QPDA 2XOKD 4ITUA 5B7NA 1FVFA 2Y93A 1YZFA 4DM7A 2WJJA 2WA1A 2AZTA 3HA2A 3SK0A 2YCBA 1FVOA 3BB4A 3GUYA 1R0WA 4INOA 4W1SA 4I9UA 1LNSA 1BYIA 3B9PA 1WRBA 2OCAA 3D81A 4IGAA 1LNQA 3LX8A 2BM9A 3HLKA 5DJ5A 5TGDA 3PR3A 5L45A 1UQRA 5K99A 2FZ4A 4EKEA 1XZLA 2NQTA 2TMYA 1USKA 3BMQB 4BB5A 1OV4A 2UUCB 3GP5A 5F2KA 2NO0A 3R4VA 5JO9A 3O8BA 3WO1A 1MW9X 4WGFA 4EPVA 1G5QA 2C9BA 4DDWA 2Y1GA 1WHSA 5EEHA 2QJWA 3TFWA 4LOJA 4H7PA 3ZWKA 1MN6A 2QZZA 5FTNA 2R97A 4LJ8A 1JYEA 3KIPA 5LUBA 1UC4B 2XE8A 3NETA 2QRMA 4AKGA 3CMMA 4X1OA 1ZK0A 1WOYA 2W6PA 3JCZA 4JMPA 3WV4A 4C7BA 1CK4A 3HVJA 3RLIA 4CU2A 5I3ZA 3M6MD 3NYWA 1NY5A 1ZMBA 1HV8A 1J42A 2BMDA 2OQRA 3I3OA 5IFKA 1KEPA 4C06A 5UKDA 2P68A 1ZITA 3JAKB 3O94A 3P20A 3B5EA 3G9XA 2G70A 4J7CA 3GZNB 3K70C 1GFWA 4LC9A 4XJVA 3NVKI 2NWQA 2PA0A 2H9AA 2W6MA 3GRFA 4QYXA 4YK7A 4JT8A 3TEJA 3L07A 4RW0A 5HIMA 3UWSA 4LBYA 4PYJA 4E0BA 1PQWA 1ORRA 2CVPA 1F38A 5CK4A 4QREA 1ZJYA 2ECFA 2BHTA 3OUTA 4NENB 7ABPA 1Y7TA 3QRWA 5IJ0A 3SR3A 1OUMA 3GGCA 3HC7A 3R7WB 5G3YA 5HMMA 1DC8A 2P2YA 4MEJA 2ADOA 4MEAA 5K4GA 4NJOA 4J9UE 1QR2A 1MO6A 1PT8A 3F2IA 4L02A 1F8YA 1AUOA 3EIWA 3LQQA 3X2FA 2V3CC 4BNJA 4CMEC 1FNDA 3I76A 1UJ4A 2Y0CA 2AFIE 2BFBA 2CVFA 2GLUA 3H2JA 3NHUA 2BAGA 2GT1A 4QXOA 3HSYA 1RPAA 1UWCA 2QX7A 3A31A 1UBKS 1GGFA 2D7JA 5BSKA 4UOQA 4D9KA 3ICEA 5EHXA 1BFDA 2OBFA 2Z6QA 4EABA 2HFKA 3LHIA 1J8YF 1C9NA 2FXIA 4UHKA 4MGYR 4FKZA 1R6VA 3LFHA 2JJQA 3MGCA 3QHPA 1T6BY 2I4MA 2VCHA 2XQGA 1K8QA 1LTKA 4HGNA 2JIMA 3GLFB 1T5IA 2ZCUA 2Z2KA 3VU1A 3SS8A 2EJUA 3QOYA 4GGOA 1ULSA 4LE1A 5JSKA 2P9GA 2AX3A 4Q5IA 4OPMA 4L07A 2IHUA 4NBWA 1KHHA 1Y8QB 3H0KA 1GG8A 3COSA 3ID6C 4LHSA 3CUUA 2C2WA 2N1MA 2O6HA 4JY7A 4MWCA 1H8EA 1PZHA 4IGKA 4UEOA 1IOLA 3DF7A 1GN8A 1SA0B 1P3JA 1C7EA 3KQYA 3PB3A 4XM2A 1EFPA 1K1EA 1G21B 1V16B 3GPCA 2FZVA 4RFSA 2FN3A 1ADBA 4YJ2F 5EMMA 3HVKA 3AONB 3SX0A 4EKNB 4A23A 3SLKA 1JRLA 4P0QB 1XRSB 1X80A 3V8BA 4CIWA 4AKIA 3CB4A 3RGGA 1GEEA 5JROA 1S9DA 4OSOA 1J23A 1BQEA 1GCIA 4LC1A 3VJLA 4EF6A 1HUQA 1FYXA 1C30A 2HJRA 2ZJ3A 3ORFA 3QBEA 4MVJG 3X0DA 3B78A 1SVLA 1UODA 2X0RA 4KK3A 5KJ1A 2ZYAA 4W8OA 4IV0A 3TIVA 1U99A 3G1WA 3PDWA 3HR4A 4C7VA 2QMQA 1GZVA 4Q7JB 2QW1A 2XVYA 4UXHA 4ZDIA 2AXNA 4M9CA 4GKJB 1EDOA 3MT8A 4QBHA 3NJRA 3QMMA 4MP8A 3LCCA 4DNOA 1ZUWA 4ETWA 5LLDA 1NR1A 4K86A 2A0WA 1V25A 3K5WA 2BTOA 4EMUA 2DCUA 5KQRA 3HB9A 2FRXA 2XA1A 2GBLC 4NCIA 4P31A 4I1RA 3VH2A 4AJPA 3Q2IA 1ISIA 4B3GA 3QJYA 4DM3A 5EKUA 1Q1EA 1HQYE 3L46A 3QJ5A 1V96A 2QUIA 1YD7A 1WU8A 4O4JA 4KMRA 3TMYA 1NXXA 3I83A 3TSAA 4A26A 5JCZA 1K7CA 2IP4A 1SB9A 1Z0FA 4LZNA 4R40A 3U49A 4C6HA 1ZKMA 2C8JA 3IMGA 4PRZA 4NULA 1R3UA 3GLIE 5BMVF 1O57A 4ATNA 4YMSA 4UBMA 1G3UA 2OORC 1VMAA 3GJ0A 1CUXA 2IPNA 2V0CA 2HU2A 2A33A 5FF9A 2IV7A 4CIDA 3Q3CA 3A28A 2AE2A 5JQGF 2IGBA 3Q2OA 1FYWA 5TJHA 2CV2A 1M76A 4XIIA 3AEQB 4KWCA 3TSWA 3JZDA 2GNOA 1TUBB 2IOFK 4NS4A 4IZ6A 2X19A 2E1PA 4YLYA 5EJ5A 1A2QA 1E1MA 4PYKA 4PZUA 5KC8A 2GPTA 3K20A 4GZ6A 4EPXA 1S8AA 4KIJA 5HTKA 2Z6AA 2FJ0A 1UKBA 5AHOA 3N28A 3LWNA 5DTIA 1F7UA 1EDDA 2OG2A 4OUKX 4LSGA 3LP8A 1NLFA 3TKAA 3AMVA 1L7MA 5DF1A 4UFPA 2PQ0A 3DHWC 2FR8A 2NIPA 2P7IA 1HQKA 4DT1B 5C7OO 2YNMC 5I7WA 2HHJA 2GEKA 3OCWA 4RORA 3AF3A 3AW9A 2I6TA 5F1OA 3E7PA 3VSDA 1YV9A 4MQ6A 5TMDA 3WLNA 3ROXA 2QQGA 4BEWA 1VE5A 3QKIA 3P2JA 3O82A 4HGOA 4PBSA 4UVDA 421PA 4GQBA 1LI5A 1UEJA 1R00A 1DIOB 4YECA 5FI1B 3V8MA 1JMVA 5JMTA 3T3IA 4CZ2A 3FJOA 2EZUA 1JLLA 2DPGA 4CR7A 5BURA 3IEVA 2LVBA 4KMMA 2GDJA 3NTQA 1C1XA 3FNIA 4FLFA 2JB9A 4UOZA 2J59A 4CRWB 1UP7A 3I53A 3LSYA 4Y6PA 4YP9A 1D04A 4IYRA 3JPWA 2D6FA 1MAUA 2Y92A 3M7IA 1RRCA 1YQ9A 1G8HA 1IWOA 3QOXA 4JUFA 1V41E 3JQFA 1A5TA 1W48A 2GJSA 1VJ1A 2MYPA 3CJTA 3VU3A 2HEGA 4CMCA 1NKTA 4LJ7A 4PS0A 2WQ6A 2YWXA 2DTXA 3KT6A 4DQDA 1Q1NA 4TX1A 1OKKD 1Z7GA 4OL9A 3N8KA 4S24A 2QSJA 4NYJQ 3BGSA 5A5EA 1M3SA 4LE2A 2X9VA 1P77A 5BV2P 3TSOA 2B61A 1EWRA 3FUXA 3NANA 3T9EA 4LNUB 5KQSA 5I51A 4NE2A 3L8FA 3RJ9A 1VRVA 4F71A 1N6IA 2VK1A 1AUPA 1EBFA 1JLLB 3UG6A 4G0NA 4FJ0A 3RNLA 1Z18A 1XCJA 4X6XA 5AI4A 2OB2A 2N9UA 1I6WA 5EJMA 5HUJA 1R7RA 2XXBA 4LY3A 4EUHA 2TRSB 5U4QA 3WK6A 3JD2A 4XDHA 3B8EA 2R86A 1JE1A 2QJTA 1N5OX 1BWRA 3HY3A 3VBEA 4R1OA 4C2UA 4EAAA 4GOJA 1T3SA 4EI9A 3K71B 4F2WA 3A9UA 5JLJA 4KVFA 4YMHA 3RT7A 4MQUA