3DPTA

Cor domain of rab family protein (roco)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
298
Chain Sequence
SWIKVKEKLVEATTAQRYLNRTEVEKICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLNTSALGYILNEEQIRKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIDNEPEITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLDVKEFIPLPGHPDELVEYKELLGLEKMGRDEYVSGKLEKVFSVSKMLDSVIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Roc-COR domain tandem of C. tepidum, a prokaryotic homologue of the human LRRK2 Parkinson kinase
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Signaling protein
molecule keywords Rab family protein
total genus 87
structure length 298
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16095 COR C-terminal of Roc, COR, domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dptA01
1.10.10.2200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dptA02
3.30.310.200 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3dptA03
2E7WA 2DK8A 3OOPA 4S05A 3TO9A 4OIQF 1FLIA 4PDKA 1Z1DA 4AIHA 5DDGA 4IHTA 3NEUA 2ZO4A 4RB1A 2G7UA 1U5TA 2XAFA 5CLSA 2WC2A 2KIUA 3TQNA 3SXYA 2IVMA 3WE2A 1TNTA 2G9WA 4CXFA 1ZLJA 1JHFA 2BE5F 3KP6A 2CSOA 4B09A 3ROUA 1JE8A 5ILVA 1BIBA 2FNPA 1USSA 3ZMSA 2P4WA 4KMUX 5ICFA 1FP2A 2X4HA 2EFNA 2WWYA 3J80Z 2K4BA 3KZZA 1ZARA 1O3TA 2DFIA 2YU3A 1SFUA 1KYWA 2VC0A 4Q47A 3JTGA 5J8FA 3EQLF 1MZBA 2ZFWA 5ILUA 4EGYA 5AONA 4HDUA 3RPQA 1R1UA 3NQOA 1I27A 4HLXA 4FHTA 4GYIA 2Q0OA 4CHUA 2O0YA 1BC7C 5EEHA 1TQIA 3WE3A 4IXAA 4MHGA 1USTA 4UUVA 3GZ5A 2M5WA 2R7DA 1R23A 4IVNA 1YS7A 4E70A 3QP5A 3Q9VA 1J5YA 5CYVA 1ZN2A 2H27A 2QVOA 1Z6RA 4XLNF 2PI0A 1XMKA 3ML6A 5H20A 2CGPA 1UFMA 2EJRA 4A6EA 1PP8F 3KP3A 4WF2A 3SHFA 2MC3A 4L5JA 3V7RA 4AWXB 5EEGA 4MTEA 2PQ8A 1T6SA 2STTA 1LNWA 1P2FA 2L3DA 4KDPA 1QZZA 1U3EM 1G4DA 4KFCA 2HEOA 5LGTA 3BOQA 2JPBA 2CWEA 2DW4A 3PQJA 2WTEA 4U88A 3F23A 4LLGF 5D4SA 5DCFA 5F6FA 2GZWA 4LK0F 3L7WA 5FGMA 3KP4A 1BI1A 4KN7X 3MZYA 2KIFA 1ZREA 3DPLC 3ISPA 4WK8F 3I58A 3CO6C 1ZGAA 4G6DA 1DUXC 1KQ9A 4OMZA 4GCVA 1STZA 4EJTA 3T8TA 5D8LB 2VXZA 3QPTA 3EDPA 2CQKA 3VFZA 4I7HA 4UXNA 3EYYA 2YR2A 2ACJA 1IXCA 4Q48A 2HGCA 3V8LA 3JAMZ 1KQ8A 3FHZA 2HOEA 2VT3A 2EA4A 3E6MA 4PCQA 2VOOA 3WTVC 2OQRA 3RI4A 3KP2A 2QYOA 3F6OA 2V6CA 3B73A 3ECHA 4OIOF 3R0JA 1B9MA 5F64A 5A2QK 3BY6A 1LDDA 2HWVA 2IA2A 1RIOH 2ZMEA 4O5VA 4JQFA 2W84A 3IRQA 1H9TA 5DV5A 1WKMA 2E7XA 1HQCA 3ABUA 5E20A 1J75A 3Q9SA 3FXRA 4LFUA 2ELHA 4MTDA 2DU9A 1CGPA 3KZYA 5LHGA 1HSJA 1S29A 4LJZF 2ESNA 2MH2A 4ZZLA 1ZAOA 2V79A 1EV7A 5HDNA 1QNTA 4UVAA 4G94A 5FO5A 5E1XA 1YW9A 2XAGA 4L9TA 2UWMA 4WCGA 3RJPA 2RVCA 2Z5UA 4I0AA 4PGGA 2PMUA 1SD6A 2DO7A 2EFPA 3GWZA 3QPHA 2O03A 1K78B 1FY7A 3BJ6A 1FBSA 5ICGA 5DD4A 3E5QA 1YTYA 3K1PA 5FFZA 1IN4A 5CVJA 1ZRDA 2PJPA 4L9JA 2Z9OA 1LVAA 3I5UA 1R1TA 1I1GA 3DQVC 1HW1A 3H3ZA 5L3GA 1R7JA 1NHAA 3WG9A 3DXJF 4NB5A 4XBFA 1G3WA 5D6FA 3B02A 4NHJA 2EV6A 1TBXA 4LGWA 4N0BA 2DI3A 1T39A 5K1YA 2P7VB 2BYVE 5LGUA 3FWEA 3K1MA 1TLHB 3K9TA 1O3RA 4A5NA 1KA8A 4P55A 2L02A 4ENKA 4BNCA 2P6SA 1W4MA 2F5CA 4RB0A 1O3SA 2EV0A 1D5VA 2FNAA 2V1DA 3SZTA 3R60A 1Z91A 2R7FA 1ZG1A 2NNNA 1LJ9A 3GXOA 3QU6A 5DEQA 3MWMA 2QM3A 2YX7A 4M74A 4KICA 2P5VA 1MDMB 3I59B 2COMA 3HOSA 4Y15A 4YG2F 5H6QA 2E1CA 4A0ZA 3E97A 3G3ZA 3LA3A 3F72A 3N4MA 1K79A 4UV9A 3WU0A 3LQQA 2PEXA 4O6JA 5D5XB 1G6NA 2MBFA 2YX4A 3L00A 2EA2A 1XN7A 3W6JB 1L0OC 1O7LA 1OKRA 5HDKA 1RI7A 3F8CA 2IW5A 1SD5A 1O57A 5HS8A 3I53A 5L3EA 4MQVA 4IHSA 1XMAA 2CO5A 4CICA 2FXAA 3PQKA 3CUQC 3PFIA 3FM3A 4ZH4F 2EWNA 3CUOA 2DAOA 3GF2A 4LG0B 1S7OA 2K86A 3WTTC 1E17A 3J80K 2GA2A 4MGRA 4CYDA 4U7DA 4G7HF 3R6SA 1D8KA 3I54A 1SD7A 3S2WA 4EJWA 4HF1A 1BI2A 2HS5A 2RC4A 3M1EA 3LA7A 5E8IA 4EM1A 3GVAA 1QBJA 2HYGD 3ULQB 2QWWA 1WSUA 1IW7F 2QBYA 4RGSA 1FSHA 3LAPA 1TTYA 2J5OA 4K2EA 4ZYHA 1KU3A 2RDPA 3J81Z 2ZMEB 3ELKA 3JW4A 1QGPA 1GXPA 2M1BA 2X0LA 3E6BA 1P4WA 5LEJA 1OYIA 3GEZA 2OQGA 4EMSA 3EETA 5L3CA 1U5TB 1D3YA 2A69F 1RNLA 3KP5A 3WGIA 1U2WA 2OD5A 1Y0UA 3P9IA 3GO5A 5L3DA 1LEAA 1EH8A 2PMHA 1J0RA 2ZNYA 5AIPA 1F9NA 1H9GA 3SQNA 3R4KA 1FYKA 4JBAA 1VTNC 4Q4ZF 2ISZA 3ZMUA 3J7AO 1ZYRF 4HYEA 2NAZA 1G3YA 2HKXA 3HHHA 3TGNA 3OV8A 4WXCA 1QPMA 2V1XA 3L9FA 2IT0A 3T1BA 2FE3A 1U5TC 1S3JA 3QU3A 2VONA 2IJLA 2ISYA 4HW0A 1A04A 6PAXA 3K2ZA 2W24A 1U78A 5J8CA 1FNNA 3FZVA 2STWA 2GIVA 4M72A 5HLHA 4KN4X 4P96A 1XCBA 1AWCA 5HDGA 3NRVA 2CG4A 5HOOA 3H92A 1Z9CA 2LKPA 3KEOA 1Z6TA 1DPUA 3JSOA 4BYYA 3M7GA 2MLGA 3FM5A 1I1SA 3DPTA 5ERIA 4G9YA 3FX3A 2QBYB 2FRHA 4EQQA 5LHHA 3HTSB 1G3TA 4A6DA 4M9XA 1JHHA 1L3LA 1OMIA 1OYYA 2FMLA 3LAJA 3M8FA 1WI9A 2CFXA 3L09A 4MEYF 4I98B 2K7LA 4GXOA 3F8NA 5DYMA 2K4JA 3V4GA 2PBIA 1MJ9A 3GFMA 1P92A 2A6HF 3F22A 5FB2A 1FYLA 1O7FA 4ESFA 2V9VA 3RYPA 1T38A 3RKXA 1K6OA 4I2OA 1XB4A 4AIJA 4EV0A 3KEQA 4OU0A 4M9SA 3K1NA 1I5ZA 2F5DA 1FZPB 4HAMA 1F1ZA 4LLNA 2F5FA 3WTZA 2XIGA 2KJCA 5DUKA 2YSRA 1S7AA 3CUQB 2ZXJA 2H94A 5HS7A 1ZG5A 4O3MA 3Q5FA 3V8KA 4U0YA 2QQAA 2MA3A 4F7ZA 4QLCU 1R1VA 2EB7A 3TKYA 5L3FA 5KK1A 1T98A 4HBLA 2NYXA 2DT5A 4PZJA 1LEBA 3WTUC 3FMSA 2RN7A 3KETA 3TOBA 4XSZF 1V3FA 2A61A 2XAQA 2GXGA 1MGTA 2O3FA 2HTSA 3GFIA 3LQRA 3F6VA 3ZMTA 4IRGA 2XGXA 2FBKA 3KLNA 2H6BA 3LSTA 1B6AA 1B9NA 3JSPA 2LF8A 1YYVA 2OAZA 2LDUA 3WTWC 1O3QA 4OMYA 5JHUA 1GVJA 2IA0A 2EFWA 2KRFA 3N97A 1ZRFA 2TDXA 2PG4A 2HTJA 1B1BA 5FLXK 5D5UB 3GFJA 2GXBA 4IPAA 4A2UA 2HKOA 4HX8A 5K5RA 2DQLA 5IT9K 1XGNA 4EM0B 3DKWA 5LGNA 2FOKA 4OINF 3V7CA 3P9CA 1X3UA 1J9IA 5BPDA 2ZKZA 4ETSA 1RUOA 5TRDA 1F4KA 1DP7P 3RIRA 3ZMVA 4MEXF 2V1UA 1KQ0A 4HF0A 1IN5A 2QQ9A 3MAJA 2VE8A 4AD9A 5HLIA 4YFXF 5ILSA 2RGVA 2P7CB 4A0XA 5HVQC 5D4RA 1B4AA 2EFQA 2ZJ2A 5ICEA 4RAYA 4ESBA 4YIFA 2RKHA 2HQNA 3QP6A 2VOPA 2NS0A 2NRAC 1J59A 3IHUA 1P6RA 1J2XA 3F3XA 3DF8A 4CZZA 1OR7A 5BOXA 1BIAA 1WWXA 3BROA 4NQWA 1CF7A 3GZ6A 3E5UA 3G73A 4RGRA 4HV5A 1BM9A 1BN5A 3ZN1A 2GA1A 2ZBKA 1E2XA 5JVTA 3C1DA 4M9ZA 3QRFF 3GUDA 3BWGA 2M45A 3DP7A 1ULYA 4ASNA 3VB2A 4I09A 2UZKA 1F5TA 4KIGA 2QENA 3HSFA 2AS5F 3I0TA 4G8XA 3I71A 5FFXA 4HOBA 2PN6A 3ABTA 2Y48A 1U8RA 5BMZA 1MD0A 5DCMA 1T0FA 1XDUA 3ERED 2DTRA 4EJOA 2HQRA 2FEZA 3K0LA 2L01A 3U2RA 3SFZA 3IWFA 1YIOA 5BQTA 1KU7A 2M8EA 4M73A 2XKPA 2DBBA 1J7KA 2MH9A 4GO1A 1BBYA 2DK5A 4A0YA 5LBQA 3ZN0A 1ODDA 3MEXA 3HIFA 2P6TA 4M6YA 1MKMA 5F1RA 4RB3C 1H0MA 1RZ4A 2XROA 2EFOA 2P5KA 2Y75A 1XGMA 4IF4A 4M6XA 4UVBA 1P4AA 2ESHA 2A07F 3DV8A 5AIQA 3ZMDA 1HKQA 3RYRA 3IC7A 4KT5C 2NNYA 1WQ2A 1HKTA 2BV6A 1IN8A 4UVCA 2VBYA 4IJAA 2XRNA 4OIRF 5K5OA 3HHGA 1S6LA 4HZFA 4UV8A 4CDGA 3LWFA 3O6BB 2L4MA 1IF1A 3KP7A 3RDIA 3E5XA 3TO6A 5D5WB 4HA8A 1IN7A 2UXXA 5BPIA 2HZTA 2QZ8A 1XSXA 2Y0MA 4XRFA 4DNCA 2IRFG 2QUFA 5J6XA 4HLYA 1REPC 5DUIA 4OOIA 2RQPA 1FPQA 2FF4A 1YLFA 3D5LA 2D2WA 3REOA 3T0YA 1I6XA 1XD7A 4YFNF 1QO0D 2A68F 1AOYA 1SMYF 3CUQA 4BHCA 1YO5C 3U9GA 1SFEA 2Q8KA 4L5IA 3E6DA 3HRUA 2Z99A 1ONVA 4B8XA 1FC3A 4QWQA 4WXDA 2OZ6A 1W5SA 4A12A 4Y17A 1UHWA 3I4PA 4WWCA 4BXUA 1S8NA 2JSCA 3IRRA 2R3SA 5A2QZ 2D1VA 4L9VA 4ZYGA 3MZHA 5E17F 1R5HA 1FP1D 1SFXA 1ZG3A 3V7SA 4FX4A 1FX7A 1ZRCA 3VEPA 2MLKA 3IWZA 4P5OA 4EGZA 4S04A 2XV4S 3HUGA 5LLQA 3F8BA 3LFKA 1KYZA 4EVIA 3GLXA 1LQ1A 3TO7A 5DD8A 2CYYA 1SD4A 1XDSA 1R22A 1ZLKA 3E3VA 4KUMA 1YQAA 3BJAA 4I02A 4R79A 3ZMZA 4UHTA 1SAXA 4PGHA 4HX4A 1P4XA 3TDUC 2P5LC 2C6YA 1PP7U 3CLOA 3D0SA 2O8XA 3ZQ7A 4I01A 4RGUA 1W7PD 3O3KA 3FF5A 3HSRA 2D45A 3V8JA 1XGOA 5E1ZB 4L0ZB 2VC1A 1HW5A 4ZYDA 5IT9Z 1R5GA 2FU4A 3WGHA 3QAHA 3KCCA 1Z05A 2M87A 1C0WA 4I0BA 3CO7C 1FBQA 2VBXA 4ENJA 2B0LA 2QQBA 1BC8C 2KJBA 2QLZA 1WRJA 4KIFA 1DPRA 2FBIA 4HQEA 3GX4X 1GHCA 2JT1A 3CJNA 5CVVA 3HRTA 4TV7A 5IT3A 4CO8A 5HLGA 2HYFA 5E1WA 2A5YB 4FT8A 2ADUA 2BBYA 4AVPA 4G7OF 2OZUA 1FOKA 2P8TA 2DPDA 4WX9A 5H6RA 3BPVA 1EH6A 1DDNA 4ZZDA 2HDCA 3KLOA 4GYGA 2EK5A 1OYWA 3JAMK 1IN6A 2RNJA 3WGGA 1HBXG 4P9FA 2Z3YA 4KA4A 3TDZC 3F21A 5D6EA 2D1HA 1IXSB 1R58A 4RB2C 2Z33A 4DQ2A 3BP8A 3VODA 1HW2A 1IXRC 4BHPA 2GAUA 3C18A 3CDHA 2JZYA 1LB2A 4HQMA 1D8JA 4RAZA 3M8EA 4HF2A 3HYIA 3IL2A 3ZPLA 3BDDA 4LK1F 3K69A 4XSXF 1ZGJA 2YPRA 3FXUA 3JTHA 1TW2A 4GGGA 4R8HA 2DLLA 4ENNA 2O61A 3WODF 1SMTA 2K02A 3J81K 5CVRA 3RPUA 2W85A 1RUNA 2K27A 1FT9A 3M9AA 3ECOA 5BS6A 1OPCA 3W6KB 2H6CA 3FMRA 2FQ3A 2MD5A 2F2EA 1PUEE 1HSTA 1TQMA 2VBZA 2XAHA 2J5PA 2LF7A 5DCMB 1IUYA 4KMFA 1XSVA 4LB5A 1MJBA 1K78A 3WTSC 2XHKA 2VE9A 3O2PE 1IAWA 1Q1HA 3EUHA 3BJOA 3MQ0A 1IRFA 3HSEA 1G3SA 3E6CC 4G7ZF 1FSEA 4XLPF 3WU1B 1T2KA 3P7NA 1BI0A 1XGSA 2HR3A 2VBWA 2LNBA 1YG2A 3T8RA 5D5VB 2WV0A 4LB6B 3U1DA 3FMQA 2L4AA 3QOPA 2L54A 4BHBA 3GYHX 2DPUA 3VOEA 5FD6A 4RGXA 4KNYA 1W7PA 4Y13A 1MJAA 4IRIA 3DEUA 1W7PB 2PFBA 1JXSA 5LEKA 3P9KA 1FBUA 5JI6A 2A6EF 2G7HA 2F5EA 1PDNC 3DPUA 1TQPA 1YW8A 4LMYA 2Q2EA 3F8MA 3HRMA 2HFHA 3TOAA 3WTXC 2O6GE 4L9NA 4Q5SF 1XCVA 3IKVA 2BGCA 5FLXZ 2RV8A 1YS6A 1YW7A 2W25A 1W5TA 3AAFA 4MNUA 2KIMA 3DFGA 4P9UA 2IPQX 1EH7A 4R1HA 1LDKB 3GFLA 3COAC 2ETHA 4OIPF 1UHMA 2A3SA 2PLYA 5KVRA 4UNOA 2XASA 3KE2A 1FYMA 3L2CA 2EV5A 4BQAA 3R0AA 1LDJA 5JFRA 5ED4A 3KFWX 4A5MA 4ESJA 1YFHA 2XKOA 2XVCA 1JGSA 2UXNA 4BAYA 4H0EA 2JTVA 1GXQA 1R00A 3WTYC 1ZH5A 3MCZA 1U6GA 2FA5A 2GWRA 5K5QA 3MFKA 3LA2A 2OBPA 1UB9A 1FWZA 4LLLA 4U0WA 4N9IA 4L18B 3GW2A 1IRGA 5CVUA 2H09A 3H3UA 5LHIA 2FBHA 2AXLA 2LSOA 2XUBA 3T5XA 2ZCWA 4JK1X 1HKSA 2VN2A 1IZ1A 1ZHFA 2XAJA 4FX0A 2JRTA 4EM2A 3BPXA 4YFKF 4U0VA 4ON0A 2BEOA 4N9HA 5HS9A 2OU2A 2VODA 4WXHA 4RS8A 3FXQA 4BH9A 3C3WA 3HOTA 4U7BA 3R61A 2FSWA 5ICCA 1XSDA 3HTUA 3HRSA 2KKOA 2IP2A 1MDMA 1BJAA 1V4RA 3I59A 1KU2A 1QZYA 2VT2A 4L0YB 1R36A 5E18F 5LRRA 4EJUA 1UCRA 5E8GA 1K7AA 1KU9A 4HDVA 4EJVA 4CGZA 5D8KB 2M30A 3RKWA 1TNSA 5TJJA 1QQIA 2OA4A 5JR3A 1BOAA 2IA1A 4HV6A 5LRSA 3CTAA 2W57A 1ON1A 4Z2YA 3RKYA 4M71A 4ZYEA 1BI3A 5CVIA 3BZ6A 3F8FA 5FD5A 2ZNZA 3C7JA 1Z7UA 4HX7A 4LG0A 2CW0F 3SZPA 3IKTA 1KGSA 4LD5A 5CJ9A 3EYIA 4MQ9F 5L3BA 3I64A 4KYWA 4G6QA 1HXDA 3ZP5A 4ENMA 1TW3A 4KIBA 2DQRA 1ON2A 4IRHA 4D0PA 1B59A 2JPCA 4YIIA 1CF7B 2FMYA 3RTRA 4AIKA 2E1NA 2GQQA
chains in the Genus database with same CATH superfamily
2E7WA 3AKZA 2DK8A 2V6EA 3OOPA 4XORA 3LSMA 4S05A 4BJUA 1LE8A 3TO9A 4OIQF 4F91B 1MMSA 2DA4A 1FLIA 1NH3A 4PDKA 1Z1DA 2DJIA 4AIHA 1PUFA 5DDGA 3V42A 4IHTA 3NEUA 2ZO4A 3BC8A 3ESWB 2G7UA 4RB1A 3J7YJ 1U5TA 2KZGA 3DKXA 1D1BA 2XAFA 4A69C 5CLSA 2BW3A 4JP0A 3TW7A 4B43A 1K35A 2WC2A 4HPQA 5FKKA 1W0TA 2KIUA 3TQNA 2XSJC 3BR1A 3OIOA 3SXYA 2IVMA 1R5ID 3WE2A 1D3UA 1TNTA 2G9WA 1W36C 3LOCA 3JRCA 3K2AA 4CXFA 1TZLA 1ZLJA 1JHFA 1B72B 2BE5F 3KP6A 4XR6A 1SVMA 2CSOA 3HOYJ 3I55I 2MJ7A 4B09A 1QNCA 4M3DA 3ROUA 1JE8A 5ILVA 2H8RA 1BIBA 2FNPA 5B1BH 1USSA 2KL4A 3ZMSA 3PMGA 2JK3A 2P4WA 4H4KC 4KMUX 2NLVA 4EJZA 4AYBA 3A4CA 2DMQA 5ICFA 1XS9A 1FP2A 2X4HA 2EFNA 1UMQA 3H0GJ 2WWYA 3J80Z 3W2WA 2K4BA 3WHCA 1TC3C 1JTYA 2HVRA 2KPMA 1ZK8A 2K9LA 2JWTA 2VQGA 3KZZA 1YJNI 1ZARA 1O3TA 2DFIA 5IP6A 2YU3A 4XLEA 1BW6A 1SFUA 5IYBJ 2V26A 3OS2A 1ZR4A 1KYWA 2VC0A 1VQNI 3TEDA 2QSHX 4X1EA 4Q47A 3RQIA 3JTGA 5J8FA 3EQLF 1MZBA 2KRHA 4XKWA 4A3BJ 3OS1A 1I6HJ 1JT0A 2IBDA 2ZFWA 5ILUA 4EGYA 2EZLA 5AONA 4HDUA 3RPQA 1R1UA 3GLLA 1Z3YA 3NQOA 1I27A 4HLXA 4FHTA 4BEHB 1BOBA 4GYIA 1OCOH 1YX5A 3HS8A 4FCYA 2Q0OA 3HS9A 1PJRA 4ZDLA 4CHUA 4IZZA 2O0YA 1KFIA 1BC7C 5EEHA 2L5QA 1TQIA 3WE3A 2Z2SB 5J1YA 3FK7A 4IXAA 4MHGA 2OTLI 1P5DX 4BXFA 4D5CA 1P5GX 2GM4A 1USTA 2VKEA 3Q3SA 4UUVA 3GZ5A 1ORKA 2M5WA 2R7DA 2R5YB 2CU7A 1R23A 4XOTA 4IVNA 1YS7A 4E70A 2KFDA 3QP5A 2GOXB 3Q9VA 1J5YA 5CYVA 1ZN2A 2H27A 2ZB9A 2R5YA 2QVOA 3RCOA 2X9DA 3IAM2 1DP3A 1AKHB 1Z6RA 2E5ZA 4XLNF 3S1NJ 4BXXJ 2HDDA 2PI0A 3D7QA 1XMKA 3ML6A 2R7WA 2A05A 4I8OA 3ZQLA 4NBQA 5H20A 4J00A 1TT0A 2CGPA 3AG2H 1NVPA 2VPRA 4FE4A 1FJLA 1UFMA 2EJRA 2KDOA 4A6EA 1PP8F 3KP3A 3QYEA 4WF2A 2XAUA 4MO7A 3L2WA 4IX7A 3SHFA 2IEKA 4F93B 2E60A 3LSHA 3CCQI 2MC3A 5IOZA 2NOLA 4L5JA 3V7RA 3MKLA 2BXYA 3BTJA 4AWXB 5EEGA 3S2DJ 4MTEA 3CVSA 2PQ8A 1T6SA 1X1CA 3IH2A 2STTA 3DWLE 3K6GA 3IP4B 4ABZA 1LNWA 4ZDOA 2LRDA 1B72A 3J7AY 1G2HA 1P2FA 2L3DA 2X85A 3VN5A 4KDPA 1GV2A 1QZZA 1T6AA 2JMWA 1S9HA 1U3EM 1G4DA 4KFCA 5BMPA 2HEOA 3NWTA 5LGTA 3EUHC 2Q2EB 3ONQA 2XSDC 4G6TB 3BTCA 1MMAA 3F10A 3BOQA 2JPBA 2CWEA 1FMWA 2DW4A 2WTEA 3PQJA 1K61A 4U88A 3F23A 3JCUC 3H5AA 4LLGF 5LFAA 4E7LA 1E3HA 2LR8A 3LSRA 5HNHA 5D4SA 2X6WA 1XSZA 4CCKA 4ROEB 2LY1A 5DCFA 3S17J 3K4JA 2JPIA 4IKFA 2TCTA 5F6FA 2GZWA 4LK0F 3L7WA 5FGMA 5IYCJ 3QYFA 5EGOA 4MRQA 3KP4A 4UUTA 1BI1A 4KN7X 2DKDA 3ZR8X 4BUPA 3MZYA 2KIFA 2XPWA 1ZREA 3DPLC 4RAGA 3ISPA 3FKJA 2LVSA 3CCMI 4C3JJ 3A01A 2XC7A 1VQOI 2XF6A 4WK8F 2KDZA 3I58A 3CO6C 1GLNA 1ZGAA 4G6DA 1DUXC 1KQ9A 1XMXA 3LSGA 4OMZA 4GCVA 1VTLE 1STZA 4HNTA 3S93A 4EJTA 3KYCB 3T8TA 5D8LB 1ETYA 2VXZA 3QPTA 3ZXSA 3EDPA 2CQKA 4AUXA 3VFZA 2V1NA 4I7HA 1WZ2A 1OJLA 2H1LA 4IHYA 3KYDB 4P1WA 4UXNA 4BU2A 3EYYA 2YR2A 2ACJA 1IXCA 4Q48A 4Y33A 3CCRI 2HGCA 3ZGKA 3DKYA 4D7QA 1ZGWA 3V8LA 3JAMZ 1KQ8A 3FHZA 2HOEA 2VT3A 2EA4A 2XGDA 3E6MA 4PCQA 2VOOA 5EG0B 2OJED 3WTVC 1QU3A 2OQRA 4A93J 2VKVA 2L2OA 3RI4A 3KP2A 2R7XA 2BZTA 2QYOA 2KMUA 3F6OA 4N4NB 2V6CA 3B73A 3ECHA 3C2GA 1KZHA 4OIOF 3R0JA 1B9MA 1DGWY 3F9KA 4S0HB 5F64A 5EJCA 1EUVA 5A2QK 4ZTFA 3HOZJ 3BY6A 1LDDA 2HWVA 2W48A 4AYBN 3KRMA 3IH4A 2IA2A 1J09A 4E7KA 2ZMEA 4O5VA 4CCMA 1RIOH 1BL0A 3IUOA 4JQFA 1U0JA 2W84A 3IRQA 4A3MJ 2K40A 4IHXA 1VF9A 1H9TA 5DV5A 1WKMA 1SFOJ 2E7XA 1HQCA 3ABUA 5E20A 3DU5A 1J75A 2IS1A 2OV7A 3O8HA 3TMOA 3Q9SA 3ENOC 3FXRA 1EBMA 4LFUA 2ELHA 4MTDA 2K9QA 2DU9A 1HC8A 3KYLA 2TRTA 2ZFUA 2PWWA 4DIQA 1CGPA 3KZYA 5LHGA 5GPAA 1HSJA 1S29A 4LJZF 3BR5A 5KAFC 1VQ8I 1X1AA 3OSGA 1VI0A 2WB1N 2ESNA 3H5NA 2MH2A 5GADJ 4ZZLA 1C47A 2DT6A 1ZAOA 2V79A 3CF5F 1EV7A 1HDPA 5HDNA 1QNTA 1QNAA 1ENHA 4UVAA 4BE1A 2PMZA 4G94A 5FO5A 5E1XA 1YW9A 2XAGA 4L9TA 5E3MA 1SEUA 2UWMA 4WCGA 4PSXA 3RJPA 1IJWC 3A0HC 2RVCA 2Z5UA 1W36D 3Q0VA 4I0AA 4PGGA 1X58A 1WI3A 1N78A 2HZMA 2L7ZA 3FDYA 1ETQA 2PMUA 4IHWA 2DT7B 3CCEI 4RDUA 1SD6A 1WJFA 2DO7A 2EFPA 3GWZA 1UL7A 3QPHA 1N25A 1T08B 1MMDA 2O03A 4B4CA 3OYFA 1K78B 4E7ZA 1FY7A 3BJ6A 3MKWB 4QTRA 2FKMX 1FBSA 5ICGA 2E36A 5DD4A 3E5QA 1YTYA 3SYTA 3K1PA 3RSNA 5F1JA 4EAGA 3OIQA 3OL3A 1SVOA 5FFZA 1X2NA 1YRNA 1IN4A 5CVJA 4C9YA 1ZRDA 3I0WA 2PJPA 4L9JA 2Z9OA 1LVAA 2ICWG 3I5UA 1R1TA 1OQYA 1I1GA 3DQVC 1HW1A 2QRDA 3H3ZA 5L3GA 1WH5A 1R7JA 1S72I 4HEA2 1NHAA 1M5Q1 4BJ5C 3WG9A 3DXJF 1KYFA 1Y56A 3SEZA 1X2MA 2LKSA 2ZXHA 4NB5A 4XBFA 2I10A 1G3WA 1T56A 5D6FA 3B02A 4NHJA 1YE9A 2EV6A 1TBXA 4LGWA 4N0BA 2DI3A 2VQCA 3K70C 2ECBA 2COBA 2R7QA 1T39A 5K1YA 2M8GX 2P7VB 2BYVE 2ELJA 3VYTB 5HLTA 5LGUA 3TP0A 3FWEA 3K1MA 2LREA 1TLHB 1GT0C 3K9TA 5KCMA 3FBIB 1O3RA 3ZQHA 4A5NA 1KA8A 4PJNA 1KYDA 1HU0A 2CFOA 4P55A 2AO9A 2HOAA 2VL8A 2L02A 2QEXI 3K70D 4ENKA 4BNCA 2P6SA 1W4MA 3G4SI 1TUOA 2JHJA 2F5CA 5M5WJ 4RB0A 1O3SA 2DYSH 2EV0A 4ZJZA 1VTOA 1D5VA 3MN2A 2HNHA 2FNAA 4IQ4A 3VDXA 3X2QH 1OCCH 2V1DA 2NVQJ 3SZTA 2W82A 3AG1H 4PJMA 3R60A 2NOZA 3SEQA 1Z91A 2R7FA 1ZG1A 1QN9A 1FIPA 2NNNA 2PX9A 1Q1VA 2LKXA 1LJ9A 3GXOA 2HZDA 2WAQN 3QU6A 3MWMA 5DEQA 2DDAA 1B9KA 1ITYA 2QM3A 2YX7A 2AQEA 1Z77A 2IGMA 4M74A 4KICA 2P5VA 5LD2C 1ETKA 1MDMB 2WB1A 4CZCA 2Y31A 3I59B 4XK4A 4BY7J 4ZDPA 4PY5A 2EIMH 2COMA 4Y4RA 3HKZA 3HOSA 2P81A 4Y15A 4YG2F 5H6QA 2VQHA 2E1CA 2Y0SN 2LBFA 4CFFA 2FGTA 4A0ZA 1VQ5I 3E97A 3G3ZA 4AVZA 1VQ4I 3LA3A 1G8XA 4F3QA 3F72A 3N4MA 3ULXA 4WZSD 1K79A 4UV9A 4PJJA 2LAEA 3ABMH 5J1UA 3WU0A 3LQQA 4V19K 2PEXA 3OH9A 4O6JA 5D5XB 2ELKA 1AA7A 2ME6A 1LUJB 1G6NA 2MBFA 2YX4A 3OSTA 2XGCA 3L00A 2EA2A 1XN7A 2CV0A 3W6JB 4XKBA 1UT4A 2V4JC 1L0OC 1O7LA 1OKRA 5HDKA 4NNJA 5GPCA 4Q11A 1RI7A 2R7UA 1YQKA 3F8CA 2FD5A 2IW5A 4PFOA 1X19A 1SD5A 3DBRB 4HNVA 1O57A 3F0CA 4Y3OA 5HS8A 3JREA 3I53A 5L3EA 4XM3A 2NXNB 3H3VK 5E3NA 2DFFA 4MQVA 2R7VA 3BCBA 4IHSA 1LKXA 3TW6A 1XMAA 3GMEA 2CO5A 4CICA 2FXAA 3VWBA 3PQKA 3CUQC 3PFIA 2ZMEC 3FM3A 3RZDJ 4B44A 4RM2A 1I3AA 2X6XA 4ZH4F 2EWNA 3CUOA 2XGEA 2DAOA 3GF2A 4LG0B 1H8AC 3GTQJ 2IGOA 1S7OA 2K86A 3PO2J 5EZGA 3NARA 3WTTC 1ETOA 4IL6C 1E17A 3J80K 2M3AA 2GA2A 4MGRA 4CYDA 4U7DA 2HPMA 3S1QJ 4G7HF 3OCIA 1EKEA 3R6SA 1D8KA 3I54A 5F0FA 1HCRA 1KY6A 1SD7A 3S2WA 2E19A 4EJWA 4HF1A 1JKQC 1BI2A 2HS5A 2RC4A 3M1EA 3A2KA 1MBKA 3CDIA 3LA7A 5E8IA 2HYJA 4EM1A 3G1OA 3GTJJ 2LYCA 4RM3A 2OUMA 4D9JA 3GVAA 5J4YA 1HA8A 1QBJA 2HYGD 3ULQB 2QWWA 1WSUA 1HDDC 4EJYA 3OSFA 2R7ZJ 3HG9A 1IW7F 1M1EB 2K3FA 2QBYA 3I3WA 4RGSA 1TBAB 1FSHA 4NDLA 5DTDA 5F0CA 4EEFG 1HLVA 3LAPA 1PVSA 1XTAA 1TTYA 2J5OA 4K2EA 2RAEA 4JX6A 4ZYHA 1U9OA 1KU3A 2RDPA 3J81Z 3H35A 2ZMEB 2AHQA 2K9MA 3ELKA 1T8IA 2EINH 3N05A 4BL0B 3JW4A 1QGPA 1GXPA 2M1BA 3OOUA 2X0LA 5GAHJ 3E6BA 3MKZA 1P4WA 5LEJA 1OYIA 3GEZA 4XN0A 1PYVA 1HF0A 5F9CA 2OQGA 4EMSA 3CCSI 3EETA 5L3CA 1VOKA 3SDGA 3C2BA 3G1MA 4C2MJ 1U5TB 4MFEA 3OYHA 1JGGA 1D3YA 2A69F 1RNLA 3W3CA 3KP5A 3WHBA 3WGIA 2KT0A 2L9NA 2DOAA 2ZXWH 1U2WA 5IYCP 2OD5A 1TWAJ 1Y0UA 3H1ZA 2K5CA 3W2AA 3P9IA 3GO5A 3M07A 1PZDA 3QWLA 5L3DA 1LEAA 1EH8A 2PMHA 3C2HA 2QQ8A 4PJ0C 1J0RA 4WX8A 2ZNYA 5AIPA 1F9NA 3K4MA 3LSJA 3S3MA 3LSIA 4YELA 1Y1WJ 4DJAA 2DMTA 1H9GA 3LL7A 3HC7A 4J01A 3SQNA 3R4KA 1FYKA 5J4VA 4JBAA 1VTNC 4Q4ZF 2ISZA 5DM7F 3ZMUA 1AHDP 3D5RC 3J7AO 1D5YA 2IV9A 2VI6A 1ZYRF 3DLLF 4HYEA 2NAZA 1G3YA 2R7OA 2LD5A 4XLFA 2HKXA 1W5CC 3HHHA 3OV8A 3TGNA 1W0UA 4PJLA 4WXCA 2YA3A 1QPMA 3E7LA 2IGKA 2EQRA 3A02A 1IV6A 1WCMJ 2XPUA 2I5WA 2F5VA 2V1XA 2AXTC 1PCJX 3L9FA 1FMVA 1RETA 2IT0A 3S8PA 1E3PA 4XIDA 2I5UA 2WADA 1U9NA 1BW5A 1FEXA 1UELB 3T1BA 3K4LA 4CCJA 2ZJRF 2O3OA 2X48A 1ETXA 1BR2A 4IO9F 1VQPI 2FE3A 5KNLA 4FQGA 4BACA 1U5TC 1S3JA 5HNFA 3QU3A 2FUG2 2VONA 2IJLA 4DW6A 1Y1VJ 1AU7A 2ISYA 2EIKH 4HW0A 1A04A 6PAXA 2NOHA 2FKFA 1ETVA 2JHNA 3K2ZA 2F4MB 2JVGA 1X4OA 3DCFA 3ABKH 1FTTA 2W24A 2NVYJ 1U78A 1K4SA 1MSFC 5J8CA 1FNNA 4AIDA 2ZSIB 3FZVA 2STWA 2GIVA 4D7RA 2MGQA 4M72A 4KN4X 4P96A 3CDLA 5HLHA 2ZJPF 1XCBA 3BKQX 1AWCA 5HDGA 3NRVA 2R5ZA 5FRMA 5FLVA 3LMMA 2CG4A 5HOOA 3H92A 1Z9CA 3O8GA 1BR1A 4M3BA 2WY8Q 3EIKA 2LKPA 3ABLH 3KEOA 1WHUA 1Z6TA 3E1SA 3OMYA 1DPUA 5FKLA 3JSOA 2PMZN 4BYYA 3CW7A 3M7GA 2EH3A 5JHFA 3CWSA 2MLGA 3FM5A 3QOEA 1I1SA 2VPLA 2E5NA 3DPTA 4ROCB 3AL0B 5ERIA 3VYRB 1R49A 1NGMA 2F48A 4G9YA 3FX3A 2QBYB 1WPKA 2FRHA 4EQQA 5LHHA 2EPFA 1YJWI 2OC6A 4BJTA 3HTSB 1G3TA 3CC4I 4A6DA 4M9XA 2EZIA 1JHHA 1L3LA 4E7IA 1OMIA 1GVDA 2BHZA 2ME0A 1V5GA 1OYYA 2FMLA 3LAJA 2IS2A 2RQQA 3OYDA 4TPSA 2R92J 3M8FA 1FOYA 1WI9A 5FLMJ 1E3OC 2LBFB 2ZC2A 4HRIA 2CFXA 3IAS2 3L09A 2DOEA 1RKTA 4MEYF 4I98B 2K7LA 3FXOA 3I4MJ 4GXOA 3F8NA 5DYMA 2K4JA 1NK3P 2D5VA 1T95A 3V4GA 4BE2A 2PBIA 1I3QJ 1Z7LA 1MJ9A 4RMNA 3GFMA 1P92A 1A5JA 5EZHA 5DM6F 2A6HF 3F22A 1SAUA 5FB2A 2JA5J 3M4OJ 2CQNA 1FYLA 1O7FA 5J1RA 4ESFA 3ZOBA 5KHDA 2ID6A 1KY7A 2V92A 2V9VA 3HEFA 4XMYA 3RYPA 2LOOA 2QRCA 3HPGA 2V9KA 1ACIA 2E34A 2JVHA 1Y0NA 1T38A 3RKXA 1ETWA 4GRIA 1K6OA 4I2OA 2ZSHB 1XB4A 3CESA 2IS4A 2P0WA 4AIJA 4EV0A 2KIQA 3KEQA 4OU0A 2HVQA 4M9SA 3VSKA 1MNEA 3K1NA 1I5ZA 2F5DA 1FZPB 3CVTA 3AG3H 4HAMA 1F1ZA 2JUCA 4LLNA 3BR6A 1WH7A 4B3XA 1T0FC 3I4NJ 2E2HJ 2F5FA 3FIWA 3WTZA 2XIGA 2KJCA 4B48A 2OOYA 5DUKA 4KJZA 2YSRA 2OCCH 3JRDA 1S7AA 1OR7C 2IGNA 3CUQB 3QPSA 2ZXJA 3CCLI 3CCUI 2H94A 5B5EC 5HS7A 3FHNA 2CUJA 2O9LA 3OIPA 1ZG5A 1W1WE 1QA6A 4O3MA 3GTOJ 3Q5FA 3V8KA 2K85A 2DODA 3CWTA 4IOAF 2L0KA 4MLOA 4U0YA 2QQAA 3DTIA 1V5EA 2CQ7A 2MA3A 3ASNH 2CUFA 4RLFA 4F7ZA 1Y8QB 4QLCU 1R1VA 2EB7A 4GDFA 3TKYA 1YITI 4DZPA 5L3FA 4HSTA 2LH9A 1F43A 5KK1A 3CC2I 1T98A 4HBLA 1QZEA 2NYXA 1RR8C 1JT6A 3UKGA 2DT5A 4PZJA 1LEBA 3WTUC 1YIJI 2W1OA 2K9SA 3FMSA 4NC6A 2RN7A 1VFCA 3KETA 2XPVA 5KL0A 3TOBA 4F92B 4XSZF 1V3FA 2A61A 4F55A 1KYUA 2XAQA 2GXGA 4XNFA 1IO2A 1MGTA 3CMYA 2MZ8A 2VKDA 2O3FA 3S2HJ 2HTSA 3GFIA 1QN7A 3Q0UA 4EALA 3LQRA 3F6VA 3ZMTA 4IRGA 4GFBA 3L1PA 3D1NI 3CJTB 3H9QA 2XGXA 1OCTC 2FBKA 2KISA 3KLNA 3RPUD 2H6BA 3LSTA 3LSPA 2CRGA 1DU0A 2JSPA 3G1LA 1B6AA 1B9NA 4HNUA 4NQWB 3DEEA 3JSPA 2CH0A 4C2UA 2LF8A 2DMNA 4DBQA 3DLAA 3OYNA 1NTCA 4QPOA 1YYVA 2K3PA 1O4XA 2OAZA 2LDUA 4OAYA 3WTWC 2QKLB 1O3QA 3RQ4A 4OMYA 5JHUA 3S3OA 2F4OB 3D5SC 3W2VA 1GVJA 2IA0A 2QGUA 5FKOA 4KISA 2EFWA 2KRFA 1Y6IA 4L5EA 4II2A 4PSWA 5FKNA 3GTMJ 3HPHA 3N97A 1A6QA 1I50J 2TDXA 4UUSA 1ZRFA 1MBHA 2HTJA 2PG4A 3HXLA 1HOMA 1YI2I 4BBRJ 1H89C 1B1BA 1XPXA 5IYBP 2R7SA 2UUZA 5FLXK 1MBGA 3GFJA 5D5UB 2CV1A 4A3GJ 1RC9A 2GXBA 5JLWA 4IPAA 4A2UA 2HKOA 2FQ4A 4HX8A 2QA4I 2WV1A 5K5RA 4QPQA 2DQLA 5IT9K 5FROA 3BG3A 2NS7A 2E1OA 1XGNA 3DKWA 4EM0B 5LGNA 9ANTA 4D5FA 2CV2A 4ZYAA 4BBSJ 2FOKA 2Z16A 2A6TA 4OINF 3V7CA 3P9CA 2BY3A 3OYAA 1DGRM 1X3UA 1J9IA 5BPDA 2CUEA 2ZKZA 4ETSA 1MNMC 1RUOA 2MFZA 5TRDA 2NVMA 3OGDA 4BGDA 5B66C 1F4KA 2BXZA 1DP7P 2QF7A 1N77A 2KP6A 3RIRA 4PFPA 3ZMVA 4MEXF 4B3AA 1LFPA 1KQ0A 4HF0A 4CSWA 2V1UA 1IN5A 2QQ9A 3MAJA 1TP4A 4PK4A 4XKVA 1GDTA 2VE8A 4AD9A 3PDKA 1YX3A 5HLIA 4YFXF 5F04A 5ILSA 2RGVA 4WXAA 4DBRA 2LY9A 4CYCB 2P7CB 4A0XA 5HVQC 4OWRB 5D4RA 1B4AA 2EFQA 2HU9A 2ZJ2A 4RAYA 1RPWA 5ICEA 3CCVI 4ESBA 1OCRH 4YIFA 2LMDA 1POGA 3BT9A 2GOMA 4B1RA 2RKHA 4JYKA 4ZTJA 2HQNA 2V7FA 3QP6A 2VOPA 2NS0A 1DU6A 2NRAC 3B6AA 3BR3A 4JOMA 1J59A 3IHUA 3HOVJ 1VQ7I 1LPQA 1P6RA 2X6OA 2NOIA 4BDYA 1DIZA 1X4PA 1J2XA 3F3XA 3BZCA 5B3SH 4AM3A 3DF8A 4CZZA 1OR7A 5BOXA 1BIAA 2MW8A 1WWXA 2DTZA 4M3GA 1JJ8C 3BROA 4NQWA 1QHGA 1CF7A 1RR7A 1RM1A 3GZ6A 5C4JJ 1IV8A 3TBIA 3PNVA 3E5UA 3G73A 1QN5A 5JVGF 1AKHA 5IP7J 4RGRA 1MSEC 2HVSA 4A3CJ 1TGHA 4HV5A 1BM9A 3OYLA 1BN5A 3ZN1A 3BQZA 3A0BC 2MD0A 2GA1A 1P9QC 2ZBKA 1E2XA 2CS3A 2QR1A 4Z6YA 1SFKA 1IUFA 4C7PA 1UJ8A 5JVTA 1VNDA 3JRFA 3SDBA 2XDVA 3C1DA 4M9ZA 3GUDA 3QRFF 3AL0C 3BWGA 2M45A 3DP7A 1ULYA 3M8JA 3VB2A 4ASNA 1YTBA 4I09A 1WVRA 3CZ6A 5IYDP 4IHVA 1MBEA 2UZKA 1VQKI 3RPJA 1JFIC 2X1DA 2BW3B 2XB0X 1F5TA 4KIGA 2QENA 1XX5A 3HSFA 3HOUJ 5IP9J 1WFXA 1NH2A 2AS5F 3I0TA 4G8XA 3I71A 2VLAA 1WJEA 2V9JA 2DA1A 4HOBA 5FFXA 2QCOA 2PN6A 4AC0A 4UB6C 1JUSA 3BG5A 3ABTA 3KIOA 2Y48A 1R4MB 3W6VA 2YU9J 1FTZA 1UHSA 1U8RA 1FIAA 2DXIA 5BMZA 2B63J 1MD0A 4FE7A 1T0FA 5DCMA 3PIPF 1SVLA 1XDUA 2DDBA 3ERED 2DTRA 2ECCA 3U1KA 4ITVA 2QREA 1ZKGA 2HQRA 4EJOA 2FEZA 3K0LA 5CQEA 2L01A 3CCYA 2EILH 3U2RA 5EDNA 1J3MA 3SFZA 4DGWB 3IWFA 1YIOA 5HSHA 5BQTA 1KU7A 2M8EA 4EAIA 4M73A 1OCPA 1B8IA 2XKPA 2DBBA 1J7KA 2R4GA 2OPTA 4LITA 5F08A 3ENCA 3OYIA 2MH9A 4E7SA 4GO1A 1JKPC 1BBYA 3CP2A 2HXOA 2DK5A 4A0YA 3SNSA 4AU7A 1CQTA 5LBQA 4BQOA 2DA6A 3ZN0A 3L2UA 1ODDA 3MEXA 4XICA 1Y39A 1SC7A 1C9BB 3PM1A 3FXLA 3HIFA 3S14J 5E79C 2P6TA 4OAZA 4M6YA 1MKMA 3DBLB 1OLTA 2NOGA 5F1RA 1A31A 4RB3C 3SFIA 1H0MA 1RZ4A 1NG7A 2XROA 2EZHA 2EFOA 3IV5A 2P5KA 2CW8A 2Y75A 1X3ZB 1XGMA 4IF4A 4M6XA 3BG9A 3BZKA 4IQJA 4UVBA 1P4AA 2ESHA 3SZGA 2A07F 2WY7Q 1RKWA 4MFDA 4DULA 3DV8A 1N3CA 5AIQA 3ZMDA 1PVEA 2WAEA 2NVUB 1HKQA 2EZKA 3RYRA 4EAKA 3IC7A 2DA7A 5AN4A 3OWTA 1VQ6I 4LOCA 4KT5C 1IC8A 4RAFA 2E2IJ 2F4IA 1PUFB 4XLHA 1WQ2A 2NNYA 1JJ6C 1HKTA 2BV6A 1IN8A 4UVCA 1OCZH 2VBYA 4IJAA 1WJ5A 4BDZA 5EGOB 3CLQA 3HZJA 3LNQA 3S1MJ 3H0DA 2XRNA 3G6EI 1K2YX 4OIRF 5K5OA 2YS9A 3HHGA 3QQAA 1S6LA 4CUGA 4HZFA 4IOCF 4UV8A 1B8IB 4CDGA 3LWFA 3MMYB 1UT7A 2QSGX 3JRAA 2JA8J 3QODA 3O6BB 1E42A 2IAIA 1MH4A 2L4MA 1D1AA 1IF1A 3HL2A 3KP7A 2QKMB 1MPGA 3RDIA 3E5XA 3GZNB 3TO6A 4HA8A 5D5WB 1IN7A 2UXXA 1AISA 1IRXA 4NUBA 5BPIA 3AFHA 4FTHA 2NOFA 1EJ9A 3CWUA 1D1CA 1SANA 5F27A 4HJHA 1TWFJ 3K10A 3ZQFA 2R93J 2HZTA 2QZ8A 1XSXA 2Y0MA 1X1DA 4XRFA 4DNCA 2IRFG 2QUFA 1IDZA 1YTFA 4M3EA 5EYRA 3H9GA 5EG0A 5J6XA 5J3LA 1WGXA 4HLYA 4CCNA 1REPC 5DUIA 2Y8LA 2MC4A 4OOIA 2RQPA 2MG4A 1FPQA 3G2BA 2FF4A 2JA7J 1YLFA 3L2QA 2I8DA 1K4TA 5IOYA 3BCAA 2D2WA 3D5LA 3REOA 3T0YA 3TE5A 2K9NA 3A01B 3FKIJ 3DU6A 1I6XA 2H4LX 1XD7A 4YFNF 3MKYB 1QO0D 2A68F 3NA5A 1YQMA 2IS6A 4X6AJ 1AOYA 1SMYF 3CUQA 4BHCA 4E7JA 1YO5C 3U9GA 3HGGA 1SFEA 2Q8KA 2Y30A 4PUSA 4L5IA 3E6DA 3HRUA 4YEJA 2M7AA 2F6CA 2Z99A 5IPAA 2XF5A 1WJDA 1IDYA 2HPIA 3OR2C 2M4GA 3J7ZI 1GUUA 2H1KA 3CJQB 3EUKL 3GTPJ 2XF7A 5BMNA 5DS9A 2HDWA 1VZ0A 4B0AA 2OCEA 1ONVA 4B8XA 2EBIA 2VXDA 2M9HA 3PL8A 1FC3A 2O7OA 1N3AA 1KO9A 5J40A 4QWQA 4WXDA 2PJRB 3ASMA 2OZ6A 1W5SA 4A12A 2O5RA 1P7JA 2PJRA 1QN8A 4Y17A 1UHWA 2BY2A 3I4PA 3WU2C 4WWCA 1QPIA 4BXUA 1S8NA 2JSCA 3L2VA 3IRRA 2R3SA 3OYMA 2D1VA 4KT6A 5A2QZ 4L9VA 4CYCA 3I0XA 4ZYGA 3MZHA 5E17F 1R5HA 2UV1A 4XQFA 1FP1D 4A3IJ 2JQ7A 1SFXA 5E3LA 1MP9A 1V5FA 4JX4A 1ZG3A 3V7SA 5EEAA 1YQLA 4FX4A 1X3WB 2DKCA 1FX7A 2CJJA 3HGYA 3HBLA 3VEPA 2MLKA 1ZRCA 1FOXA 3IWZA 2CW7A 4P5OA 4RLQA 4A3JJ 4EGZA 4S04A 1VQMI 3OSMA 2XV4S 3HUGA 5LLQA 3F8BA 2F7LA 3LFKA 5GAGJ 3B6CA 2W7NA 1KYZA 3TL4X 3VPRA 4BJ6C 4EVIA 3CMEI 3OL4A 3PJRA 1WJWA 4A3EJ 3GLXA 1S7EA 1LQ1A 4B47A 3IH7A 1LFBA 1PCMX 4E7HA 3H5RA 3TO7A 3F0ZA 5DD8A 2CYYA 1SD4A 3RSMA 1XDSA 1R22A 4BS9A 1ZLKA 3E3VA 2HOTA 4KUMA 2LLKA 1YQAA 3H1CA 4XRMA 1JKRC 2R5ZB 1Z21A 3BJAA 1DQUA 4I02A 1ZR2A 4R79A 3ZMZA 4UHTA 2Z0FA 1SAXA 4PGHA 4HX4A 4RA2A 1P4XA 3FISA 2HOSA 1LXTA 3TDUC 2P5LC 1U8BA 2C6YA 1PP7U 3CLOA 2BHYA 3D0SA 4NC7A 1QVTA 4A3DJ 3IH3A 2O8XA 2L7KA 3ZQ7A 4I01A 3M1CA 1M3QA 4RGUA 2G0EA 1W7PD 1S5LC 3K4BA 4BEHA 2Y0SA 3O3KA 3HB9A 1JUPA 3QYBA 3FF5A 3HSRA 2D45A 4D1QA 1Q9UA 2Y69H 3V8JA 2VUMJ 1TT5B 4A3FJ 4CCLA 3L2RA 1RRJA 1PCZA 3ERMA 1XGOA 4UY8I 5E1ZB 2M0MA 4L0ZB 2VC1A 4CCOA 5C4XJ 1HW5A 4ZYDA 4LIVA 5IT9Z 1R5GA 2FU4A 4M3FA 1QTPA 3BG7A 3WGHA 3BTIA 1BA5A 3QAHA 2YUSA 2Y9YA 3MD2A 3DBHB 3KCCA 1Z05A 2M87A 1C0WA 2O8KA 1YOVB 4I0BA 2ZXIA 3A03A 2DA5A 3CO7C 2JA6J 3T4NA 5TISC 1FBQA 4DOZA 2D0AA 2VBXA 3BR0A 2L7FP 4LIUA 3PSIA 4ENJA 2B0LA 2LK2A 2QQBA 2V9PA 1BC8C 2KJBA 2QLZA 4ANJA 2OTJI 1OFCX 4BQQA 4QG5A 4UUSB 1TBPA 2B9SA 1WRJA 2ZJQF 4KIFA 1DPRA 5K7ZA 2FBIA 5C3EJ 1XG1A 4HQEA 2LTPA 2DFHA 3GX4X 3S15J 2JT1A 3WG7H 1GHCA 2ZFDB 3CJNA 2QLVA 1CDWA 5GAEJ 1LVKA 5CVVA 2HXIA 3VSLA 4X0GA 3HRTA 4YRVA 4TV7A 5IT3A 4II3A 1V55H 4CO8A 5HLGA 3G71I 4Y52J 1TL8A 2HYFA 1F36A 2E1MC 5E1WA 3HOXJ 2A5YB 3CP8A 4FT8A 2D0CA 2ADUA 2BBYA 3BLYA 4AVPA 4G7OF 1YJ9I 2OZUA 3JRGA 5JMVD 1FOKA 1ZQ3P 5FRNA 4JX5A 2P8TA 3NWSA 2DPDA 4W97A 4WX9A 5H6RA 1UZCA 1EH6A 3BPVA 3OYCA 1N39A 1LWYA 1DDNA 4ZZDA 1A35A 3ZQGA 2HDCA 4EAJA 3H36A 2DOFA 3KLOA 2CQXA 3PSFA 4GYGA 2DMUA 2EK5A 1OYWA 3JAMK 1QHHD 3JR9A 2HQ5A 2VJ4A 1IN6A 2RNJA 1Z67A 2FJ1A 1LWVA 2WA0A 3WGGA 1BR4A 1HBXG 2Y9ZA 4BE0A 1WJCA 4P9FA 2Z3YA 4KA4A 3TDZC 3F21A 1X1BA 3E0JB 5E3OA 3I3LA 5D6EA 2D1HA 2OF7A 1IXSB 1R58A 4RODB 4RB2C 2FOWA 3OY9A 2Z33A 4DQ2A 3BP8A 5GP9A 2VASA 3BG6A 3VODA 2EIJH 2WAQA 1HW2A 1IXRC 5M5XJ 4BHPA 2GAUA 1KFQA 3C18A 4C3HJ 3CDHA 3CJRB 2Z8UA 1N75A 2A5WA 2JZYA 1LB2A 4HQMA 1D8JA 4RAZA 3M8EA 5KAIC 5H2FC 4HF2A 3HYIA 3ZRGA 3IL2A 3ZPLA 3BDDA 5EF6A 4LK1F 2IV8A 3K69A 4XSXF 1ZGJA 1QNEA 3C04A 2YPRA 2VQLA 3FXUA 3JTHA 2Q1ZB 1WQAA 1TW2A 1V5SA 3PNTA 4I76A 4HG2A 4GGGA 4R8HA 5JN5A 2DLLA 4ENNA 1V54H 2O61A 3WODF 1SMTA 2K02A 2VJIA 2NOBA 3J81K 5CVRA 2GBYA 2AQFA 2VKHA 3RPUA 2VJJA 2W85A 2VJ0A 1RUNA 3KZIC 5CQGA 2K27A 3H9JA 3S3NA 1FT9A 3M9AA 2LFBA 3ECOA 5BS6A 2E71A 2BY1A 1OPCA 1Z0XA 4C30A 3W6KB 3GTGJ 2H6CA 3FMRA 2FQ3A 2MD5A 4HSRA 2DN0A 3OYGA 3CF2A 2F2EA 1TWCJ 3UR3C 1PUEE 1R4XA 1KONA 1HSTA 1TQMA 2VBZA 2XAHA 4UB8C 2JN6A 2J5PA 2R7TA 2LF7A 5DCMB 1IUYA 4KMFA 1XSVA 3PFYA 4LB5A 3M3YJ 1JTXA 1MJBA 2BVMA 2G30A 2VIXA 3SJMA 4U87A 1K78A 2DKAA 3WTSC 2XHKA 1MBJA 2VE9A 3O2PE 1IAWA 5K7FA 3EUHA 1Q1HA 3BJOA 3BR2A 3OSEA 2NOEA 3MQ0A 4V2GA 1IRFA 3HSEA 1G3SA 3E6CC 4G7ZF 1FSEA 4XLPF 2R7RA 2RREA 3WU1B 4I6ZA 1T2KA 5J47A 3JRBA 2KRCA 3P7NA 3UNGC 4M6VA 3U21A 4XONA 4XLCA 2JRMA 4XLAA 1BI0A 4BKXA 1XGSA 2HR3A 2VBWA 2HL8A 2JOIA 2FX0A 2LNBA 3ZQQA 3HOWJ 3FK6A 4E6KG 3JRHA 1YG2A 3T8RA 3GTLJ 2LP0A 4QSHA 5D5VB 2WV0A 4LB6B 5FKMA 3U1DA 3FMQA 2XHIA 1VQLI 2L4AA 2N8GA 3QOPA 2L54A 4BHBA 1QN4A 3GYHX 2DPUA 3VOEA 4DYRA 3OYBA 5FD6A 2FUVA 4RGXA 5EPCA 4A3KJ 3OYJA 1W7PA 4Y13A 1MJAA 2MABA 3DEUA 4FASD 4IRIA 4KNYA 1RESA 1W7PB 2PFBA 2DA2A 5IY5H 2NOJB 1JXSA 3K4CA 5LEKA 2CMPA 3HJEA 3P9KA 4IEJA 2L7MP 1FBUA 1IRZA 5JI6A 2A6EF 2DMPA 2HI3A 3KEYA 2G7HA 2B7EA 4DYQA 2F5EA 1PDNC 3EUAA 3DPUA 3AG4H 2Y8QA 1TQPA 1QRYA 3HKZN 2BY0A 2BOLA 1TWGJ 1YW8A 4LMYA 2Q2EA 2H8WA 3F8MA 3HRMA 2HFHA 1IG7A 3TOAA 3CC7I 3PO3J 1I39A 3WTXC 2O6GE 2JA2A 2JUGA 4L9NA 1MBFA 1ZELA 2Y2ZA 3QPLA 4Q5SF 2KZVA 1XCVA 3CD6I 3IKVA 3OC3C 4XRSA 1NK2P 2BGCA 1TWHJ 5M3FJ 5FLXZ 2RV8A 2HZSA 1YS6A 2D0BA 4A3LJ 4DZJA 4LG3A 2DYRH 2L9SA 4D7MA 3EPZA 1YW7A 2W25A 2WAFA 5F0HA 1W5TA 4DYCA 5GTIC 2HL9A 3AAFA 4MNUA 2X6YA 4Y7NJ 2KIMA 1M3HA 2RNGA 3DFGA 4P9UA 2X1CA 2IPQX 5GTHC 3I56I 1EH7A 4R1HA 1A6IA 1LDKB 3FXKA 3GFLA 3COAC 1OISA 2ETHA 2CUZA 4OIPF 2W00A 1UHMA 2A3SA 3RKQA 2E2JJ 4W1UA 4CA0A 2DJNA 2PLYA 5KVRA 4UNOA 2XASA 3KE2A 1K83J 1FYMA 2GXAA 3L2CA 2X51A 2EV5A 3HDDA 4BQAA 1JKOC 3R0AA 1YRNB 1LDJA 3K7AJ 5JFRA 4QIWN 5ED4A 2M0CA 3EAYA 3KFWX 4A5MA 4ESJA 3OH6A 4BY1J 1YFHA 2BVLA 2XKOA 3Q0WA 2Z1DA 2XVCA 2R5XA 2R0QC 2IXSA 1JGSA 5M3MJ 2UXNA 4BAYA 4H0EA 2LG4A 3CWAA 2GIZA 5TGTA 1YHQI 2LC2A 3OR1C 2WBMA 3KPHA 3NAUA 2JTVA 3ZQIA 4YIRX 1GXQA 1R00A 3DEWA 3WTYC 1ZH5A 3OLPA 3GBGA 2E35A 1MMNA 3MZ8A 3MCZA 1H88C 1U6GA 2NS8A 3JRIA 1LWWA 2FA5A 3ZCOA 2GWRA 4MIMA 2KLOA 4D7NA 2W4SA 3PUBA 5K5QA 2H5AX 2HKPA 3MFKA 3LA2A 2OBPA 1QTSA 1UB9A 1VKLA 1FWZA 4LLLA 4U0WA 1EF4A 3GCMA 4N9IA 2JJ7A 5JLXA 4L18B 3GW2A 1IRGA 4E4HA 4I99C 3GTKJ 3D4VA 4C3IJ 1QN6A 5CVUA 2M2EA 4V2FA 1D0XA 2H09A 3OS0A 3H3UA 2ID3A 5LHIA 4ZC3A 2FBHA 1D0ZA 3PIOF 2AXLA 2LSOA 2XUBA 3T5XA 5BNGA 1IGNA 3BQYA 2ZCWA 4JK1X 1HKSA 1MNDA 3KTUA 2QSFX 3ZQCA 1WJAA 2VN2A 4XKCA 1IZ1A 1ZHFA 2KHMA 2XAJA 3CMMA 4FX0A 2JRTA 4EM2A 3BPXA 1QVUA 1T33A 4YFKF 3ASOH 4U0VA 2XB5A 4ON0A 2BEOA 2YH5A 4N9HA 1BJZA 2M7BA 3LFUA 1ERDA 2L9VA 1WJBA 5HS9A 2OU2A 5CPRB 2VODA 4WXHA 4RS8A 2DCEA 3HUGB 1W80A 2M4KA 3FXQA 3KX2A 2DA3A 3LSKA 3P5JA 4BH9A 3C3WA 1P7IA 4KITB 3HOTA 5C44J 3K4NA 2GLOA 4U7BA 3R61A 2FSWA 4J19A 3UW2A 1R71A 4N4OB 3N89A 1QNBA 2VB6A 1NG6A 5ICCA 4IL8A 1XSDA 2DFEA 3DTEA 3HTUA 1JI8A 1X1PA 3HRSA 2KKOA 2IP2A 4BQNA 1D0YA 2LY2A 4XRSG 1MDMA 3S16J 1BJAA 1V4RA 1EA3A 3I59A 1KU2A 4FETA 1QZYA 4G12A 3RZOJ 2VT2A 3S32A 1R36A 4L0YB 3FXMA 5E18F 5LRRA 4EJUA 1UCRA 1C4GA 2VJ5A 3A1YA 5E8GA 1K7AA 4EATA 1KU9A 3TDHA 1YQRA 4FISA 4HDVA 1JDYA 2HQAA 4EJVA 5D8KB 4CGZA 4F52A 1E0EA 2M30A 3RKWA 1R9TJ 1TNSA 3K4KA 4XOPA 5TJJA 1FOWA 3CMAI 1GV5A 1QQIA 2OA4A 4NC8A 2KQRA 5JR3A 3DTKA 1MIJA 1BOAA 2IA1A 4HV6A 4XL9A 1ZTRA 5LRSA 3OYKA 1LFUP 2XRLA 1UAAA 1MMGA 5K7HA 1Z3XA 3CTAA 3MVPA 3BTLA 4XN3A 2W57A 3I9V2 1ON1A 2E1MB 1Y8RB 3CQZJ 4Z2YA 3RKYA 3S1RJ 2NWVA 2CQQA 1XC5A 4M71A 4ZYEA 2EHBD 1BI3A 5CVIA 3CCJI 2L9RA 3BZ6A 5B1AH 2X1EA 2MYSA 3F8FA 2NVXJ 5FD5A 4RBOA 2ZNZA 3C7JA 1Z7UA 3PNYA 4HX7A 3VYUB 5M5YJ 1R4NB 4LG0A 1APLC 4CH7A 2CW0F 2M34A 5CKTA 1KGSA 4LD5A 3SZPA 3IKTA 5CJ9A 1UG2A 1UG0A 5HODA 3EYIA 4MQ9F 3FBNB 2NVTJ 5L3BA 3I64A 2OOXA 4KYWA 1FN7A 2V8QA 4G6QA 1HXDA 3HM5A 3VYSB 3ZP5A 1JUMA 4ENMA 1TW3A 3FXJA 4KIBA 3PUFA 2DQRA 1VOLB 1ON2A 4IRHA 3TP3A 2MSYA 4D0PA 5IYDJ 1B59A 4C2TA 2JPCA 1MH3A 1VQ9I 4YIIA 1K6YA 3OYEA 2FMYA 5FJ8J 1CF7B 1A36A 1QN3A 3RTRA 4AIKA 1R6RA 1MW7A 1G59A 2E1NA 1LE8B 2GQQA
chains in the Genus database with same CATH topology
2E7WA 3AKZA 2DK8A 2V6EA 3OOPA 4XORA 3LSMA 4S05A 3TO9A 4OIQF 4F91B 1FLIA 4PDKA 1Z1DA 2DJIA 4AIHA 5DDGA 3V42A 4IHTA 3NEUA 2ZO4A 4RB1A 3BC8A 2G7UA 1U5TA 2XAFA 3DKXA 1D1BA 5CLSA 2BW3A 4B43A 2WC2A 4HPQA 2KIUA 3TQNA 2XSJC 3SXYA 2IVMA 3WE2A 1D3UA 1TNTA 2G9WA 1W36C 4CXFA 1TZLA 1ZLJA 1JHFA 2BE5F 3KP6A 4XR6A 2CSOA 2MJ7A 4B09A 1QNCA 3ROUA 1JE8A 5ILVA 1BIBA 2FNPA 1USSA 3ZMSA 2KL4A 2P4WA 4H4KC 4KMUX 4EJZA 4AYBA 3A4CA 5ICFA 1FP2A 2X4HA 2EFNA 2WWYA 3J80Z 3W2WA 2K4BA 2HVRA 2KPMA 2K9LA 2VQGA 3KZZA 1ZARA 1O3TA 2DFIA 2YU3A 4XLEA 1SFUA 3OS2A 2V26A 1KYWA 2VC0A 4Q47A 3JTGA 5J8FA 3EQLF 1MZBA 2KRHA 4XKWA 3OS1A 2ZFWA 5ILUA 4EGYA 5AONA 4HDUA 3RPQA 1R1UA 1Z3YA 3NQOA 1I27A 4HLXA 4FHTA 4BEHB 1BOBA 4GYIA 1YX5A 3HS8A 2Q0OA 3HS9A 1PJRA 4CHUA 4ZDLA 4IZZA 2O0YA 1BC7C 5EEHA 2L5QA 1TQIA 3WE3A 2Z2SB 4IXAA 4MHGA 4BXFA 1USTA 4UUVA 3GZ5A 2M5WA 2R7DA 1R23A 4XOTA 4IVNA 1YS7A 4E70A 3QP5A 2GOXB 3Q9VA 1J5YA 5CYVA 1ZN2A 2H27A 2QVOA 3RCOA 3IAM2 1DP3A 1Z6RA 4XLNF 2E5ZA 2PI0A 1XMKA 3ML6A 2R7WA 4I8OA 5H20A 2CGPA 1TT0A 4J00A 1NVPA 1UFMA 2EJRA 4A6EA 2KDOA 1PP8F 3KP3A 3QYEA 4WF2A 2XAUA 4IX7A 3L2WA 3SHFA 4F93B 2E60A 3LSHA 2MC3A 2NOLA 4L5JA 3V7RA 4AWXB 5EEGA 4MTEA 2PQ8A 1T6SA 1X1CA 2STTA 3DWLE 3K6GA 3IP4B 1LNWA 4ZDOA 2LRDA 3J7AY 1P2FA 2L3DA 2X85A 3VN5A 4KDPA 1QZZA 1S9HA 1U3EM 1G4DA 4KFCA 2HEOA 3NWTA 5LGTA 3EUHC 2Q2EB 3ONQA 4G6TB 1MMAA 3F10A 3BOQA 2JPBA 2CWEA 2DW4A 3PQJA 2WTEA 1FMWA 4U88A 3F23A 3H5AA 4LLGF 5LFAA 4E7LA 5HNHA 5D4SA 2X6WA 4CCKA 4ROEB 5DCFA 2LY1A 3K4JA 4IKFA 5F6FA 2GZWA 4LK0F 3L7WA 5FGMA 3QYFA 3KP4A 1BI1A 4KN7X 3ZR8X 4BUPA 3MZYA 2KIFA 1ZREA 3DPLC 3ISPA 3FKJA 2XC7A 2XF6A 4WK8F 3I58A 3CO6C 1GLNA 1ZGAA 4G6DA 1DUXC 1KQ9A 3LSGA 4OMZA 4GCVA 1VTLE 1STZA 4EJTA 3S93A 4HNTA 3T8TA 5D8LB 2VXZA 3QPTA 3ZXSA 3EDPA 2CQKA 3VFZA 2V1NA 4I7HA 4P1WA 4UXNA 4BU2A 3EYYA 2YR2A 2ACJA 1IXCA 4Q48A 4Y33A 2HGCA 3ZGKA 3DKYA 3V8LA 3JAMZ 1KQ8A 3FHZA 2HOEA 2VT3A 2EA4A 3E6MA 4PCQA 2VOOA 3WTVC 1QU3A 2OQRA 2R7XA 3RI4A 2L2OA 3KP2A 2QYOA 2KMUA 3F6OA 4N4NB 2V6CA 3B73A 3ECHA 4OIOF 3C2GA 3R0JA 1B9MA 1DGWY 3F9KA 5F64A 5A2QK 4ZTFA 3BY6A 1LDDA 2HWVA 3KRMA 2IA2A 1RIOH 1J09A 2ZMEA 4O5VA 4CCMA 4E7KA 3IUOA 4JQFA 1U0JA 2W84A 3IRQA 1H9TA 5DV5A 1WKMA 2E7XA 1HQCA 3ABUA 5E20A 1J75A 3DU5A 2IS1A 2OV7A 3TMOA 3Q9SA 3FXRA 1EBMA 4LFUA 2ELHA 4MTDA 2DU9A 3KYLA 2ZFUA 4DIQA 1CGPA 3KZYA 5LHGA 1HSJA 1S29A 4LJZF 1X1AA 2ESNA 3H5NA 2MH2A 4ZZLA 2DT6A 1ZAOA 2V79A 1EV7A 5HDNA 1QNTA 1QNAA 4UVAA 4BE1A 4G94A 5FO5A 2PMZA 5E1XA 1YW9A 2XAGA 4L9TA 2UWMA 4WCGA 4PSXA 3RJPA 2RVCA 2Z5UA 1W36D 4I0AA 4PGGA 1N78A 2HZMA 3FDYA 2PMUA 2DT7B 1SD6A 2DO7A 2EFPA 3GWZA 1WJFA 3QPHA 1MMDA 2O03A 3OYFA 1K78B 4E7ZA 1FY7A 3BJ6A 3MKWB 1FBSA 5ICGA 5DD4A 3E5QA 1YTYA 3SYTA 3K1PA 3RSNA 3OIQA 3OL3A 5FFZA 1IN4A 5CVJA 1ZRDA 4C9YA 3I0WA 2PJPA 4L9JA 2Z9OA 1LVAA 3I5UA 1R1TA 1I1GA 3DQVC 1HW1A 3H3ZA 5L3GA 1R7JA 4HEA2 1NHAA 4BJ5C 3WG9A 3DXJF 1KYFA 1Y56A 3SEZA 2ZXHA 4NB5A 4XBFA 1G3WA 5D6FA 3B02A 4NHJA 1YE9A 2EV6A 1TBXA 4LGWA 4N0BA 2DI3A 2VQCA 3K70C 2R7QA 1T39A 5K1YA 5HLTA 2P7VB 2BYVE 2ELJA 3VYTB 5LGUA 3FWEA 3K1MA 2LREA 1TLHB 3K9TA 5KCMA 1O3RA 3FBIB 4A5NA 1KA8A 4PJNA 1KYDA 1HU0A 2CFOA 4P55A 2VL8A 2L02A 3K70D 4ENKA 4BNCA 2P6SA 1W4MA 2F5CA 4RB0A 1O3SA 2EV0A 4ZJZA 1VTOA 1D5VA 2HNHA 2FNAA 4IQ4A 3VDXA 2V1DA 3SZTA 2W82A 4PJMA 3R60A 2NOZA 3SEQA 1Z91A 2R7FA 1ZG1A 1QN9A 2NNNA 1LJ9A 3GXOA 2HZDA 3QU6A 5DEQA 3MWMA 1B9KA 2QM3A 2YX7A 2AQEA 2IGMA 4M74A 4KICA 2P5VA 5LD2C 1MDMB 2WB1A 4CZCA 3I59B 4ZDPA 4PY5A 2COMA 4Y4RA 3HKZA 3HOSA 4Y15A 4YG2F 5H6QA 2VQHA 2E1CA 2LBFA 2FGTA 4A0ZA 3E97A 3G3ZA 4AVZA 3LA3A 1G8XA 4F3QA 3F72A 3N4MA 3ULXA 4WZSD 1K79A 4UV9A 4PJJA 2LAEA 3WU0A 3LQQA 2PEXA 4O6JA 5D5XB 1AA7A 1G6NA 2MBFA 2YX4A 3OSTA 3L00A 2EA2A 1XN7A 2CV0A 3W6JB 4XKBA 1UT4A 2V4JC 1L0OC 1O7LA 1OKRA 5HDKA 4NNJA 4Q11A 1RI7A 2R7UA 1YQKA 3F8CA 2IW5A 4PFOA 1X19A 1SD5A 1O57A 4Y3OA 5HS8A 3I53A 5L3EA 4XM3A 4MQVA 2R7VA 3BCBA 4IHSA 1LKXA 1XMAA 2CO5A 4CICA 2FXAA 3VWBA 3PQKA 3CUQC 3PFIA 3FM3A 4B44A 4RM2A 4ZH4F 2X6XA 2EWNA 3CUOA 2DAOA 3GF2A 4LG0B 2IGOA 1S7OA 2K86A 3WTTC 1E17A 3J80K 2M3AA 2GA2A 4MGRA 4CYDA 4U7DA 2HPMA 4G7HF 3OCIA 3R6SA 1D8KA 3I54A 1KY6A 1SD7A 3S2WA 4EJWA 4HF1A 1BI2A 2HS5A 2RC4A 3M1EA 3A2KA 3LA7A 5E8IA 4EM1A 2LYCA 4RM3A 2OUMA 4D9JA 3GVAA 1HA8A 1QBJA 2HYGD 3ULQB 2QWWA 1WSUA 4EJYA 3HG9A 1IW7F 2QBYA 4RGSA 1TBAB 1FSHA 3LAPA 1TTYA 2J5OA 4K2EA 4ZYHA 1KU3A 2RDPA 3J81Z 3H35A 2ZMEB 2K9MA 3ELKA 3N05A 4BL0B 3JW4A 1QGPA 1GXPA 2M1BA 3OOUA 2X0LA 3E6BA 3MKZA 1P4WA 5LEJA 1OYIA 3GEZA 4XN0A 1PYVA 2OQGA 4EMSA 3EETA 5L3CA 1VOKA 1U5TB 3OYHA 1D3YA 2A69F 1RNLA 3W3CA 3KP5A 3WGIA 2L9NA 2DOAA 1U2WA 5IYCP 2OD5A 1Y0UA 3H1ZA 2K5CA 3W2AA 3P9IA 3GO5A 1PZDA 5L3DA 1LEAA 1EH8A 2PMHA 3C2HA 1J0RA 2ZNYA 5AIPA 1F9NA 3K4MA 3S3MA 3LSIA 4YELA 4DJAA 1H9GA 3LL7A 3HC7A 4J01A 3SQNA 3R4KA 1FYKA 4JBAA 1VTNC 4Q4ZF 2ISZA 3ZMUA 3D5RC 3J7AO 2IV9A 1ZYRF 4HYEA 2NAZA 1G3YA 2R7OA 4XLFA 2HKXA 3HHHA 3TGNA 3OV8A 4PJLA 4WXCA 1QPMA 2IGKA 2I5WA 2F5VA 2V1XA 3L9FA 1FMVA 2IT0A 3S8PA 2WADA 3T1BA 1UELB 3K4LA 4CCJA 2O3OA 1BR2A 2FE3A 5KNLA 4BACA 1U5TC 1S3JA 5HNFA 3QU3A 2VONA 2FUG2 2IJLA 2ISYA 4HW0A 1A04A 6PAXA 2NOHA 3K2ZA 2JVGA 1X4OA 2W24A 1U78A 5J8CA 1FNNA 3FZVA 2STWA 2ZSIB 2GIVA 4M72A 5HLHA 4KN4X 4P96A 1XCBA 1AWCA 5HDGA 3NRVA 5FRMA 3LMMA 2CG4A 5HOOA 3H92A 1Z9CA 1BR1A 3EIKA 2WY8Q 2LKPA 3KEOA 1Z6TA 3E1SA 3OMYA 1DPUA 3JSOA 4BYYA 3M7GA 5JHFA 2MLGA 3FM5A 3QOEA 1I1SA 2VPLA 3DPTA 2E5NA 4ROCB 3AL0B 5ERIA 3VYRB 1NGMA 4G9YA 3FX3A 2QBYB 2FRHA 4EQQA 5LHHA 2OC6A 4BJTA 3HTSB 1G3TA 4A6DA 4M9XA 1JHHA 1L3LA 4E7IA 1OMIA 1V5GA 1OYYA 2FMLA 3LAJA 2IS2A 2RQQA 3OYDA 4TPSA 3M8FA 1WI9A 2LBFB 4HRIA 2CFXA 3L09A 3IAS2 4MEYF 4I98B 2K7LA 4GXOA 3F8NA 5DYMA 2K4JA 3V4GA 1T95A 4BE2A 2PBIA 4RMNA 1Z7LA 1MJ9A 3GFMA 1P92A 2A6HF 3F22A 5FB2A 1SAUA 1FYLA 1O7FA 4ESFA 5KHDA 1KY7A 2V9VA 3RYPA 4XMYA 2LOOA 3HPGA 2V9KA 2JVHA 1T38A 3RKXA 1K6OA 4I2OA 4GRIA 2ZSHB 1XB4A 3CESA 2IS4A 2P0WA 4AIJA 4EV0A 3KEQA 4OU0A 2HVQA 4M9SA 3VSKA 1MNEA 3K1NA 1I5ZA 2F5DA 1FZPB 4HAMA 1F1ZA 4LLNA 4B3XA 1T0FC 2F5FA 3WTZA 2XIGA 2KJCA 4B48A 5DUKA 4KJZA 2YSRA 1S7AA 1OR7C 3CUQB 2IGNA 2ZXJA 2MZ8A 2H94A 5HS7A 2CUJA 3FHNA 3OIPA 1ZG5A 4O3MA 3Q5FA 3V8KA 4MLOA 4U0YA 2QQAA 3DTIA 1V5EA 2MA3A 4RLFA 4F7ZA 4QLCU 1R1VA 2EB7A 3TKYA 5L3FA 4HSTA 2LH9A 5KK1A 1T98A 4HBLA 2NYXA 2DT5A 4PZJA 1LEBA 3WTUC 2W1OA 3FMSA 2RN7A 3KETA 3TOBA 4F92B 4XSZF 1V3FA 2A61A 4F55A 1KYUA 2XAQA 2GXGA 4XNFA 1MGTA 2VKDA 2O3FA 2HTSA 3GFIA 1QN7A 3LQRA 3F6VA 3ZMTA 4IRGA 3H9QA 2XGXA 2FBKA 3KLNA 3RPUD 2H6BA 3LSTA 2JSPA 1B6AA 1B9NA 4HNUA 4NQWB 3DEEA 3JSPA 2CH0A 4C2UA 2LF8A 4DBQA 3DLAA 3OYNA 4QPOA 1YYVA 2K3PA 2OAZA 2LDUA 4OAYA 3WTWC 2QKLB 1O3QA 4OMYA 3RQ4A 5JHUA 3S3OA 3D5SC 3W2VA 1GVJA 2IA0A 4KISA 2EFWA 2KRFA 1Y6IA 4II2A 4PSWA 3N97A 1ZRFA 3HPHA 2TDXA 2PG4A 2HTJA 3HXLA 1B1BA 5IYBP 2R7SA 2UUZA 5FLXK 5D5UB 3GFJA 2CV1A 2GXBA 4IPAA 4A2UA 2HKOA 4HX8A 5K5RA 4QPQA 2DQLA 5IT9K 5FROA 1XGNA 4EM0B 3DKWA 5LGNA 2CV2A 4ZYAA 2FOKA 2Z16A 4OINF 3V7CA 2A6TA 3P9CA 3OYAA 1DGRM 1X3UA 1J9IA 5BPDA 2ZKZA 4ETSA 1RUOA 5TRDA 2MFZA 4BGDA 1F4KA 1DP7P 1N77A 2KP6A 3RIRA 4PFPA 3ZMVA 4MEXF 2V1UA 1KQ0A 4HF0A 1LFPA 4CSWA 1IN5A 2QQ9A 3MAJA 4XKVA 4PK4A 2VE8A 4AD9A 1YX3A 5HLIA 4YFXF 5ILSA 2RGVA 4DBRA 2P7CB 4A0XA 5HVQC 4OWRB 5D4RA 1B4AA 2EFQA 2ZJ2A 5ICEA 4RAYA 2HU9A 4ESBA 4YIFA 2GOMA 2RKHA 4ZTJA 2HQNA 2V7FA 3QP6A 2VOPA 2NS0A 2NRAC 4JOMA 1J59A 3IHUA 2NOIA 1P6RA 4BDYA 1X4PA 1J2XA 3F3XA 3DF8A 4CZZA 1OR7A 5BOXA 1BIAA 1WWXA 3BROA 4NQWA 1QHGA 1CF7A 1RM1A 3GZ6A 3TBIA 3PNVA 3E5UA 3G73A 1QN5A 4RGRA 2HVSA 1TGHA 4HV5A 1BM9A 3OYLA 1BN5A 3ZN1A 2MD0A 2GA1A 1P9QC 2ZBKA 1E2XA 2CS3A 1SFKA 5JVTA 3SDBA 3C1DA 4M9ZA 3QRFF 3GUDA 2XDVA 3AL0C 3BWGA 2M45A 3DP7A 1ULYA 4ASNA 3VB2A 3M8JA 1YTBA 4I09A 3CZ6A 5IYDP 3RPJA 2UZKA 1JFIC 2X1DA 2BW3B 1F5TA 4KIGA 2QENA 3HSFA 1WFXA 1NH2A 2AS5F 3I0TA 4G8XA 3I71A 2VLAA 1WJEA 5FFXA 4HOBA 2PN6A 3ABTA 2Y48A 1U8RA 2DXIA 5BMZA 1MD0A 5DCMA 1T0FA 1XDUA 3ERED 2DTRA 4ITVA 4EJOA 2HQRA 2FEZA 3K0LA 5CQEA 2L01A 3U2RA 3SFZA 4DGWB 3IWFA 1YIOA 5BQTA 1KU7A 2M8EA 4M73A 2XKPA 2DBBA 1J7KA 2R4GA 4LITA 3OYIA 2MH9A 4E7SA 4GO1A 1BBYA 3CP2A 2DK5A 4A0YA 3SNSA 4AU7A 5LBQA 4BQOA 3L2UA 3ZN0A 1ODDA 3MEXA 1C9BB 3HIFA 2P6TA 4OAZA 4M6YA 1MKMA 1OLTA 5F1RA 4RB3C 1H0MA 1RZ4A 1NG7A 2XROA 2EFOA 2P5KA 2Y75A 2CW8A 1XGMA 4IF4A 4M6XA 4IQJA 4UVBA 1P4AA 2ESHA 3SZGA 2A07F 2WY7Q 4DULA 3DV8A 1N3CA 5AIQA 3ZMDA 2WAEA 1HKQA 3RYRA 3IC7A 5AN4A 3OWTA 4KT5C 2F4IA 2NNYA 1WQ2A 1HKTA 4XLHA 2BV6A 1IN8A 4UVCA 2VBYA 4IJAA 1WJ5A 4BDZA 3H0DA 2XRNA 4OIRF 5K5OA 3HHGA 1S6LA 4CUGA 4HZFA 4UV8A 4CDGA 3LWFA 3MMYB 1UT7A 3QODA 3O6BB 1E42A 2L4MA 1IF1A 1D1AA 3HL2A 3KP7A 2QKMB 3RDIA 3E5XA 3TO6A 5D5WB 4HA8A 1IN7A 2UXXA 1AISA 1IRXA 5BPIA 4NUBA 3AFHA 2NOFA 1D1CA 3K10A 2HZTA 2QZ8A 1XSXA 2Y0MA 4XRFA 4DNCA 2IRFG 1X1DA 2QUFA 1YTFA 3H9GA 5J6XA 4HLYA 4CCNA 1REPC 5DUIA 4OOIA 2MC4A 2RQPA 1FPQA 3G2BA 2FF4A 1YLFA 3L2QA 2I8DA 3D5LA 2D2WA 3REOA 3T0YA 3BCAA 3DU6A 1I6XA 1XD7A 4YFNF 3MKYB 1QO0D 2A68F 1YQMA 2IS6A 1AOYA 1SMYF 3CUQA 4BHCA 4E7JA 1YO5C 3U9GA 1SFEA 2Q8KA 4PUSA 4L5IA 3E6DA 3HRUA 4YEJA 2M7AA 2F6CA 2Z99A 2XF5A 1WJDA 2HPIA 3OR2C 2M4GA 3CJQB 3EUKL 2XF7A 2HDWA 1VZ0A 4B0AA 1ONVA 4B8XA 2VXDA 3PL8A 1FC3A 1N3AA 1KO9A 2PJRB 4QWQA 4WXDA 3ASMA 2OZ6A 1W5SA 4A12A 2O5RA 2PJRA 1QN8A 4Y17A 1UHWA 3I4PA 4WWCA 4BXUA 1S8NA 2JSCA 3L2VA 3IRRA 2R3SA 3OYMA 5A2QZ 2D1VA 4KT6A 4L9VA 3I0XA 4ZYGA 3MZHA 5E17F 1R5HA 2UV1A 4XQFA 1FP1D 1SFXA 1MP9A 1V5FA 1ZG3A 3V7SA 1YQLA 4FX4A 1FX7A 1ZRCA 3VEPA 2MLKA 3IWZA 2CW7A 4P5OA 4RLQA 4EGZA 4S04A 3OSMA 2XV4S 3HUGA 5LLQA 3F8BA 3LFKA 2W7NA 1KYZA 4EVIA 3TL4X 4BJ6C 3OL4A 3PJRA 3GLXA 1LQ1A 4B47A 3IH7A 3F0ZA 4E7HA 3H5RA 3TO7A 5DD8A 2CYYA 1SD4A 1XDSA 1R22A 4BS9A 1ZLKA 3E3VA 4KUMA 1YQAA 1Z21A 3BJAA 4I02A 1DQUA 4R79A 3ZMZA 4UHTA 1SAXA 4PGHA 4HX4A 1P4XA 3TDUC 2P5LC 2C6YA 1PP7U 3CLOA 3D0SA 4NC7A 2O8XA 2L7KA 3ZQ7A 4I01A 3M1CA 1M3QA 4RGUA 1W7PD 3K4BA 4BEHA 3O3KA 2Y0SA 3QYBA 3FF5A 3HSRA 2D45A 4D1QA 3V8JA 1PCZA 4CCLA 3L2RA 1XGOA 5E1ZB 2M0MA 4L0ZB 2VC1A 4CCOA 1HW5A 4ZYDA 4LIVA 5IT9Z 1R5GA 2FU4A 1QTPA 3WGHA 3BG7A 3QAHA 3MD2A 3KCCA 1Z05A 2M87A 1C0WA 4I0BA 2ZXIA 3CO7C 1FBQA 4DOZA 2D0AA 2VBXA 4LIUA 3PSIA 4ENJA 2B0LA 2QQBA 1BC8C 2KJBA 2QLZA 4ANJA 4BQQA 1TBPA 1WRJA 4KIFA 1DPRA 2FBIA 4HQEA 3GX4X 1GHCA 2JT1A 3CJNA 1CDWA 1LVKA 5CVVA 3VSLA 4X0GA 3HRTA 4YRVA 4TV7A 5IT3A 4II3A 4CO8A 5HLGA 2HYFA 2E1MC 5E1WA 2A5YB 3CP8A 4FT8A 2D0CA 2ADUA 2BBYA 3BLYA 4AVPA 4G7OF 2OZUA 1FOKA 5FRNA 2P8TA 3NWSA 2DPDA 4WX9A 5H6RA 3BPVA 1EH6A 3OYCA 1N39A 1LWYA 1DDNA 4ZZDA 2HDCA 3KLOA 3PSFA 4GYGA 2EK5A 1OYWA 3JAMK 1QHHD 2VJ4A 1IN6A 2RNJA 1LWVA 3WGGA 2WA0A 1BR4A 1HBXG 4BE0A 4P9FA 1WJCA 2Z3YA 4KA4A 3TDZC 3F21A 1X1BA 3E0JB 3I3LA