3DPTA

Cor domain of rab family protein (roco)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
298
Chain Sequence
SWIKVKEKLVEATTAQRYLNRTEVEKICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLNTSALGYILNEEQIRKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIDNEPEITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLDVKEFIPLPGHPDELVEYKELLGLEKMGRDEYVSGKLEKVFSVSKMLDSVIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Roc-COR domain tandem of C. tepidum, a prokaryotic homologue of the human LRRK2 Parkinson kinase
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Signaling protein
molecule keywords Rab family protein
total genus 87
structure length 298
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16095 COR C-terminal of Roc, COR, domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dptA01
1.10.10.2200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dptA02
3.30.310.200 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3dptA03
1SD6A 4FHTA 4M74A 1ZG5A 1FSEA 1T6SA 5HDGA 3KCCA 3QPTA 2P6SA 2EFQA 2LNBA 3K2ZA 2ISZA 1V3FA 3HRTA 5F64A 3RKWA 1IRFA 1ONVA 1TQMA 4RB3C 5IT9Z 1CF7A 5TRDA 3WGHA 1O7FA 3DKWA 2XAFA 4MHGA 1XCVA 4P9UA 3CUQB 5CYVA 2FEZA 4LJZF 3OV8A 1T38A 2PMUA 2PI0A 2P4WA 3LA3A 1BIAA 1SFUA 5E1XA 4EM1A 4OINF 1SD4A 1RNLA 3HTUA 5LEKA 1G3YA 1OYYA 2FNAA 1REPC 2EFNA 4UVAA 4IHTA 5HOOA 5E1WA 3TO9A 2V1UA 5CLSA 5FB2A 2CYYA 4CZZA 4NB5A 3CJNA 2MLGA 2GXBA 3ULQB 3BDDA 1FPQA 3R0JA 1OYWA 3V8JA 2M30A 5DUIA 1IF1A 5K5RA 3FXUA 2CFXA 3E5QA 2H09A 4L9VA 4CXFA 4EMSA 5BPIA 3E6CC 2E1NA 3ZP5A 5HDKA 1HW5A 1XMKA 1IN6A 4KN4X 3KFWX 3DPTA 2BGCA 3CTAA 1FYLA 4PCQA 3D5LA 1R5GA 2EFOA 2GAUA 4HF0A 1WWXA 3WU1B 2RNJA 5HS9A 5J6XA 2KIUA 3C1DA 5JR3A 1P4AA 2XIGA 3J80Z 2QQ9A 1G6NA 2ZKZA 3BZ6A 1J0RA 5L3CA 4OOIA 2OZUA 2G7HA 4GGGA 1OMIA 2F5CA 2FU4A 2FA5A 2OQRA 1HSJA 1P4WA 1KQ9A 1FYMA 1DP7P 2QZ8A 1G3WA 2G9WA 3KP7A 2DQRA 3GFMA 3RKXA 1MKMA 4KT5C 4CO8A 2O3FA 4BNCA 2Y75A 5CJ9A 2FQ3A 5AIPA 2FNPA 4QWQA 2YU3A 2O61A 4HX7A 2CGPA 5ILUA 2RV8A 2FMYA 1R23A 1I1GA 4WK8F 5L3GA 3I54A 1F1ZA 2DI3A 2HTJA 3TO7A 4EJWA 2NS0A 3L09A 4WF2A 3FHZA 3R0AA 3GO5A 1R22A 2FF4A 3K0LA 2GA2A 3G3ZA 2K4JA 2EWNA 2CW0F 4G94A 2CG4A 3GEZA 2V6CA 2M1BA 4LB6B 4EQQA 5K5QA 1B4AA 1BOAA 4LK1F 4Y15A 5BS6A 2XASA 3LSTA 3FMQA 2K27A 2XAGA 3NEUA 2PJPA 4QLCU 4ZH4F 4UV9A 1KYZA 4BHCA 4EJTA 2QBYA 3FX3A 2ADUA 3T5XA 4A6DA 3L2CA 2XRNA 3FF5A 3GXOA 4DNCA 3WTUC 1I27A 1RZ4A 5A2QK 2OD5A 4CICA 4EV0A 1AWCA 2XGXA 5DEQA 4A0XA 3RPUA 4LG0A 4MTEA 2DBBA 3WGGA 5D6EA 4AIKA 2PLYA 4NQWA 3ZMDA 3P9KA 2EJRA 1FX7A 1R1UA 4M71A 5HVQC 1IZ1A 1FC3A 3QRFF 4EJOA 1I5ZA 3HOSA 4WXDA 3RYRA 4IRGA 3HIFA 4P96A 3IWZA 5AONA 3BJOA 3I64A 2R7FA 2Z5UA 1A04A 1XSVA 2EK5A 5CVJA 1JXSA 4IHSA 1R58A 1FOKA 4ENJA 1Y0UA 4A5NA 2VOOA 3U2RA 4GYIA 2VBWA 1XGOA 3WODF 2MC3A 4WCGA 2HZTA 3O6BB 3ABTA 4NHJA 1XCBA 1XD7A 2NRAC 5D4SA 4L5IA 4PGHA 1BI0A 3IKTA 1I1SA 2NAZA 2D45A 3V7RA 2K86A 2COMA 3ZQ7A 1U2WA 3V8LA 3GFIA 5ILSA 4HV6A 3I59B 1UFMA 4KICA 1XSDA 1ZAOA 3H92A 3ELKA 3Q9SA 2WWYA 1FT9A 1R36A 1LDJA 5F1RA 5BMZA 4KIBA 1WSUA 1USSA 3C18A 3DFGA 1JE8A 2ACJA 1S6LA 4KYWA 3IL2A 1FBQA 1KU7A 2MA3A 2Z33A 2HYGD 4KMUX 3M1EA 3F8FA 4U88A 4RGXA 4EM0B 1XGMA 4N9HA 4L9JA 1IN4A 4BH9A 5JHUA 1OKRA 1UCRA 4EGYA 3WE2A 1BJAA 3CLOA 2FBHA 2OBPA 2PEXA 3SXYA 4L0ZB 1DPRA 1Q1HA 1V4RA 2Z3YA 3LA7A 2QQAA 3COAC 3RTRA 1J2XA 4EGZA 2L54A 3FMSA 4WXCA 3JAMK 4YIIA 1GXQA 4RAZA 4AWXB 1YIOA 4LLNA 1D5VA 3CO6C 5E20A 4U0YA 4HDUA 4XSXF 3HSRA 3KZYA 4KNYA 1YO5C 5JFRA 2YX4A 2MBFA 2E7WA 3HTSB 3F3XA 2ZNYA 1ZGJA 4G6QA 2V1DA 1R5HA 4AIHA 5HLHA 1AOYA 2M5WA 2C6YA 3WE3A 2O03A 5LGNA 5D5UB 4P55A 1K79A 2P7CB 1BN5A 3QP6A 1H0MA 4OIPF 5TJJA 2ZCWA 5ILVA 1J5YA 2DTRA 4RB2C 3SZPA 5HDNA 3F6OA 2STTA 3ZMVA 1TNSA 3VB2A 1T98A 3FZVA 2HOEA 1MDMA 2PBIA 3G73A 5DCMA 3RKYA 2IA2A 4MEXF 4HX4A 2JZYA 5ERIA 4RAYA 5J8FA 5FGMA 1P4XA 2HGCA 4S04A 2LF7A 3GUDA 3WTVC 3TKYA 4BYYA 2P5VA 3NQOA 4ASNA 3ZMZA 1HKTA 4HW0A 1W5SA 5FFXA 3SFZA 4Q47A 4MNUA 3GX4X 1LJ9A 3I71A 4L18B 1VTNC 2RDPA 2DPDA 4ESFA 5BQTA 2HKOA 3HUGA 3HRUA 5KVRA 2W57A 2QUFA 4CGZA 1HW2A 2IPQX 2J5PA 1FP2A 1TQPA 1J7KA 1ZLJA 4IPAA 1Z05A 2DW4A 3FM5A 2Q2EA 1IN7A 1K78A 3L9FA 2V79A 2KIMA 2Y0MA 4UHTA 1SFEA 1KU9A 3HYIA 2ESHA 1GHCA 4N0BA 1MJBA 4HBLA 4RGSA 5EEGA 2L3DA 4HOBA 4HLXA 2DT5A 2OA4A 1LEAA 5ICCA 2FXAA 2LF8A 5IT3A 3FXRA 4CYDA 2JSCA 2M8EA 4M9ZA 2FBKA 2EA2A 2FMLA 3GWZA 4B8XA 4A0YA 1FBSA 1O3TA 3IWFA 2HDCA 5KK1A 1WRJA 3B02A 4GCVA 2RQPA 3CUQC 4RGRA 3LFKA 1ZRFA 1TLHB 4LK0F 3ABUA 4F7ZA 2HEOA 3ZN0A 3WTZA 2QBYB 4PDKA 3KP5A 4H0EA 1TNTA 2STWA 4XBFA 4ENKA 4JK1X 1KA8A 2XUBA 5ICEA 2PN6A 3TGNA 4D0PA 1S3JA 1D8JA 3GF2A 4IRIA 3E6MA 4U7DA 1ZREA 2HWVA 1YFHA 2YR2A 5D5WB 1W4MA 3M9AA 2GWRA 4OIQF 3OOPA 1BC7C 3MAJA 5FFZA 2VE8A 2VT2A 2ZFWA 4Y13A 1KGSA 5CVUA 4MQ9F 4HQEA 1HXDA 4XRFA 2A3SA 1JHFA 2VXZA 2W24A 1KU3A 2NNNA 2H6CA 1WI9A 4HX8A 3KP6A 3ZMUA 4KA4A 3REOA 1I6XA 4XSZF 1KYWA 1QZYA 3I5UA 1FBUA 4B09A 1R00A 1X3UA 4ZYGA 4RB0A 1XMAA 3WTTC 3KE2A 1QBJA 1ON2A 1YG2A 1IN8A 3BPXA 2O6GE 3JAMZ 3HHHA 4CHUA 1T2KA 5D8LB 3DP7A 2PMHA 2QVOA 2RC4A 4AIJA 3J80K 5HLIA 3U9GA 5D4RA 1LDKB 3C7JA 5ICGA 1ZGAA 2DU9A 4G9YA 3BROA 2BV6A 2DO7A 3DPLC 1W7PB 3IKVA 3K1NA 1EV7A 3F6VA 3DXJF 4FX0A 2X0LA 3E6DA 3N97A 4UUVA 3JW4A 1MJAA 2ZMEA 3T1BA 4BAYA 5H6RA 5LBQA 3ECOA 1HQCA 2IRFG 2AS5F 1LDDA 1ZHFA 3KZZA 4P5OA 4YFNF 3L00A 3SQNA 3BJ6A 4ZYDA 1F4KA 1STZA 1B59A 4ESBA 3FXQA 3E6BA 4LLGF 3M8EA 5DCFA 2DAOA 1J59A 3RIRA 3R4KA 1QQIA 2L4AA 1CF7B 4HYEA 4AVPA 4U0WA 3E5XA 3I4PA 3GFJA 3WU0A 4UXNA 4WX9A 1OPCA 4IJAA 3KLNA 1HSTA 3HHGA 2JPCA 1DDNA 3PQJA 3RDIA 3S2WA 4ENNA 3RJPA 3IRRA 3BOQA 3MWMA 4A12A 1K6OA 3BWGA 5K5OA 4GXOA 2HTSA 3KLOA 4KDPA 2AXLA 5CVIA 3P9IA 2X4HA 4BQAA 4OU0A 1QNTA 3R61A 1DPUA 2Y48A 3HSEA 3LQRA 3M8FA 2HS5A 3L7WA 1PUEE 5A2QZ 3I58A 1S7OA 1YW8A 4ETSA 1Z91A 4KN7X 1BI1A 5H20A 2MD5A 4LFUA 3GZ5A 6PAXA 2BBYA 4HF1A 4EM2A 1O3RA 4A5MA 2YSRA 4HV5A 3IHUA 2Z99A 3GVAA 1P92A 3V7SA 5L3EA 1LEBA 5ED4A 3MCZA 1PDNC 4EJUA 4P9FA 4UVBA 4R8HA 1LB2A 3ROUA 5F6FA 1YW9A 1G3TA 2MH9A 2KJBA 2JRTA 4KIFA 3GYHX 2G7UA 1R1TA 5LGTA 4RGUA 4I0AA 3TDZC 1B1BA 1ZG1A 3LA2A 4GO1A 1IRGA 2IA1A 2P7VB 4BXUA 2P5LC 2NYXA 2GIVA 2VC0A 2GQQA 1MD0A 2VBZA 3VFZA 2A61A 5FD5A 4O3MA 5FLXZ 3O2PE 5LEJA 4ENMA 2JTVA 1RIOH 3DEUA 1R7JA 5BPDA 4R1HA 2DQLA 2HFHA 4M6XA 5ICFA 1L0OC 3BPVA 3GFLA 1R1VA 1O3QA 1B9NA 4RS8A 5E8IA 1XN7A 3C3WA 4L5JA 1WKMA 1O7LA 1ZYRF 3VOEA 1SD5A 1FWZA 4HA8A 1HKSA 4OIRF 3MZYA 3EQLF 3SHFA 5DDGA 4LB5A 2ZO4A 2VE9A 2IVMA 4LG0B 1QZZA 3P7NA 2EB7A 4K2EA 3K69A 3FMRA 3KEOA 1KU2A 5E18F 3K1PA 3EUHA 2VC1A 3J7AO 2FBIA 3V4GA 3E97A 2RN7A 5DD4A 3ZN1A 2A07F 3T8TA 3F21A 2K7LA 2IP2A 1OYIA 1KQ8A 3RPQA 1G3SA 1XDSA 3O3KA 4M72A 4G7OF 5AIQA 1Z7UA 2ESNA 3F23A 4L9TA 3KEQA 4O5VA 5LHHA 3KP3A 1OR7A 3QU3A 3TO6A 3JSOA 1H9GA 3WTYC 3CDHA 1JHHA 1IW7F 1YW7A 2UZKA 2M87A 1IXCA 3QAHA 3Q9VA 2PQ8A 2VT3A 5HS7A 1UHMA 1YS7A 1IXRC 4MEYF 2WTEA 4JBAA 1K78B 1B6AA 2PFBA 4XLNF 4I98B 1Z9CA 2V1XA 1QPMA 2VN2A 3JSPA 1CGPA 2ZMEB 3LQQA 3F72A 3WGIA 1U5TB 2VBYA 1TQIA 2DFIA 5LRRA 1Z6RA 4ZZLA 2QWWA 5LHGA 4MTDA 1W7PA 2R7DA 2KKOA 3ZPLA 1HBXG 4IXAA 1ZRDA 2IA0A 5JI6A 5DV5A 2DPUA 2EFPA 3K1MA 5J8CA 4Q5SF 3EETA 4G6DA 3V8KA 1FZPB 2XAHA 5FO5A 5EEHA 1D3YA 1H9TA 2BYVE 2R3SA 1FSHA 2F5EA 4MGRA 5DD8A 3V7CA 3BP8A 4EJVA 5FLXK 2D1HA 2GZWA 3MQ0A 4KFCA 2HR3A 2LSOA 5K1YA 2WC2A 3I53A 4ON0A 3RYPA 1FY7A 1XGNA 4L9NA 1S29A 4S05A 1ULYA 1TTYA 2EFWA 3J81Z 2VBXA 1P2FA 1U5TA 2A6HF 3DQVC 3N4MA 3WTSC 1JGSA 2F5DA 2FOKA 3TOAA 1XGSA 2EV5A 2XAJA 1C0WA 2XVCA 3Q5FA 1B9MA 4EVIA 1Z6TA 3SZTA 3BY6A 3WG9A 2A68F 4YG2F 1QO0D 1XSXA 5LRSA 4FT8A 2VODA 2Q8KA 2KJCA 5D6FA 4Y17A 1XB4A 4ZYEA 3KETA 3VEPA 2DK8A 2UXXA 3AAFA 1HKQA 1LNWA 5LHIA 4Q4ZF 3T0YA 3FWEA 4LMYA 4Z2YA 2KIFA 1IAWA 3TQNA 1FYKA 2Q0OA 1EH8A 4PGGA 4KMFA 1MZBA 1TW2A 1YS6A 3M7GA 2HKXA 3EYYA 5H6QA 3F8NA 1F9NA 2L4MA 3GW2A 1SMYF 4R79A 1MDMB 4E70A 1BC8C 2OZ6A 4YIFA 3ZMTA 2CSOA 3BJAA 5D5VB 1EH6A 3EDPA 2YX7A 2QQBA 1S8NA 2A5YB 2DLLA 4I09A 4I7HA 4ZZDA 1WQ2A 2EV0A 2UXNA 2E7XA 2H27A 3VODA 4HAMA 4LD5A 4GYGA 1EH7A 1MJ9A 3HSFA 1SD7A 1NHAA 3LWFA 3KP2A 4N9IA 4HQMA 4PZJA 2ETHA 3GZ6A 3U1DA 3RI4A 1HW1A 4IRHA 3LAPA 3P9CA 4BHBA 1U6GA 1QGPA 2ZXJA 4HZFA 1O57A 3KP4A 3QPHA 3QU6A 5DUKA 2M45A 4HDVA 3MFKA 2NNYA 2FE3A 3I59A 2PG4A 1U8RA 5E8GA 4G7HF 2D1VA 2K4BA 4KUMA 2F5FA 3T8RA 2E1CA 3HOTA 4UNOA 2O8XA 1FP1D 3MZHA 1W7PD 1YTYA 3ECHA 3H3UA 2ZBKA 1FNNA 1D8KA 1MGTA 5DCMB 5L3DA 1T39A 1GVJA 4Q48A 2OQGA 4I0BA 1BBYA 5IT9K 5LLQA 4A0ZA 2UWMA 5BOXA 1KQ0A 1UHWA 5L3BA 1G4DA 3WTXC 3DF8A 4IVNA 4L0YB 1U78A 1ZARA 2VONA 5HLGA 2F2EA 4ZYHA 4CDGA 3ZMSA 2V9VA 2VOPA 2RVCA 1IN5A 1BI2A 4OMYA 3CUOA 2DK5A 1ZN2A 1SMTA 3CO7C 3F8CA 1BI3A 1BM9A 1E17A 2P5KA 1F5TA 4M73A 2RGVA 2GXGA 1P6RA 4AD9A 4LGWA 2GA1A 1ZLKA 4OMZA 3D0SA 3F8BA 1L3LA 2ELHA 4YFXF 2QM3A 4I2OA 1J9IA 1ZRCA 2LKPA 2QLZA 1YYVA 1ON1A 2D2WA 3LAJA 1U5TC 3ISPA 4JQFA 4IF4A 2A6EF 4HF2A 1PP8F 3HRSA 3E3VA 3R6SA 1ODDA 2K02A 1BIBA 2EA4A 1J75A 4WWCA 3PFIA 3PQKA 1FLIA 4HLYA 5DYMA 1SFXA 2P6TA 4KIGA 3ERED 4FX4A 1TBXA 4DQ2A 3J81K 2L01A 2XV4S 3JTGA 2IW5A 5HS8A 3I0TA 4WXHA 2KRFA 4M6YA 2CQKA 3HRMA 1Z1DA 5JVTA 1UB9A 1GXPA 2O0YA 3NRVA 4ESJA 1YQAA 1W5TA 5L3FA 4I01A 3R60A 1USTA 5CVRA 2WV0A 2XKPA 2TDXA 3EYIA 5D8KB 2OU2A 1E2XA 2XHKA 2J5OA 3JTHA 4G7ZF 1O3SA 2FRHA 4M9XA 2RKHA 1ZG3A 1U3EM 2MH2A 4YFKF 4M9SA 1T0FA 2ISYA 3QOPA 3E5UA 4OIOF 4UV8A 3DV8A 3CUQA 2QYOA 4O6JA 5LGUA 2B0LA 4UVCA 1RI7A 3MEXA 3FM3A 2OAZA 5FD6A 2ZJ2A 1YLFA 3QP5A 4LLLA 4XLPF 2W25A 4RB1A 5E17F 2XKOA 1LQ1A 3F22A 3IC7A 1K7AA 2JT1A 2XROA 3GLXA 4A2UA 3W6JB 3WTWC 4I02A 2XAQA 2Z9OA 4MQVA 2JPBA 3TOBA 2CWEA 4TV7A 3TDUC 2IJLA 2LDUA 3K9TA 1DUXC 2IT0A 1S7AA 3IRQA 4U0VA 2HQRA 1IXSB 2H94A 5CVVA 2ZNZA 1SAXA 1TW3A 2HQNA 3W6KB 5D5XB 4BHPA 1ZH5A 4U7BA 2HYFA 2EV6A 3DPUA 4G8XA 3B73A 2BE5F 2L02A 1RUOA 2QENA 2H6BA 3H3ZA 2W84A 1XDUA 5E1ZB 1IUYA 2FSWA 2MLKA 1PP7U 1RUNA 4A6EA 2BEOA 2W85A 2CO5A 1LVAA 2A69F 2P8TA 3F8MA 3ML6A 2YPRA
chains in the Genus database with same CATH superfamily
1SD6A 3M8JA 4FHTA 4M74A 3PIOF 1ZG5A 1FTTA 1FSEA 3MKLA 3RCOA 2VJJA 1T6SA 5HDGA 3EUHC 2H5AX 2DXIA 3KCCA 3QPTA 1G59A 3CWSA 1TWFJ 2P6SA 2EFQA 2BXYA 2LNBA 3K2ZA 4W97A 4MIMA 2ISZA 1V3FA 2L9VA 4A3CJ 3FBIB 1XX5A 2IGMA 3HRTA 5F64A 5J3LA 3RKWA 3V42A 3S3MA 1IRFA 1ONVA 1TQMA 2JSPA 2V4JC 1JTXA 4RB3C 5IT9Z 1CF7A 3OYAA 3FXKA 5TRDA 5M3FJ 2DA4A 3WGHA 4DIQA 2X1DA 1O7FA 3K4BA 1ZR4A 3DKWA 2XAFA 4MHGA 1XCVA 4HNUA 4EAIA 5B3SH 4P9UA 3CUQB 5CYVA 3A01B 2B9SA 4ROEB 3L2UA 2FEZA 4LJZF 3IH2A 4EALA 2X6XA 2QKMB 3B6AA 3OV8A 2QQ8A 3L2RA 1T38A 2PMUA 2PI0A 1M1EB 2P4WA 2ZC2A 3LA3A 2IGNA 1BIAA 3CESA 1SFUA 2HOAA 3U1KA 3A4CA 5E1XA 2WBMA 4EM1A 4OINF 2A6TA 1SD4A 2PJRB 1RNLA 3HTUA 5LEKA 1G3YA 1OYYA 2FNAA 1REPC 2EFNA 1WJDA 4UVAA 1S72I 5HOOA 5E1WA 2EIMH 3TO9A 4ZTFA 5CLSA 2V1UA 5JLWA 1F36A 4IHTA 5FB2A 2CYYA 4CZZA 1KY7A 2JHJA 2R0QC 4NB5A 1MBJA 2DMPA 3CJNA 3VSLA 3ZQHA 1I6HJ 4F91B 2MLGA 2DOEA 2KIQA 2GXBA 3ULQB 5F08A 3CMMA 3BDDA 3IAS2 2LMDA 1FPQA 3R0JA 1PVSA 2CUEA 1OYWA 2EZKA 2MSYA 3LMMA 1ZTRA 3V8JA 2M30A 5DUIA 1IF1A 3J7AY 5K5RA 2DA6A 2OTJI 3FXUA 3H0GJ 5M3MJ 1J3MA 2CFXA 3CCMI 1PUFA 4CCKA 3H9GA 1QTPA 1VF9A 3E5QA 1OFCX 3OC3C 2H09A 1WHUA 2VIXA 1MBKA 4X6AJ 1QVUA 4NC6A 3RSMA 4CYCA 4PJNA 5IP6A 4L9VA 1PZDA 4CXFA 4Y33A 1YTFA 3LSKA 4AC0A 2GOMA 5EZHA 4BXFA 1VFCA 2R7OA 4EMSA 5BPIA 3E6CC 2E1NA 3ZP5A 1FN7A 5HDKA 2HZMA 1HW5A 4L5EA 1XMKA 4BU2A 3G1MA 1QN3A 2W00A 3H0DA 1IN6A 2VQGA 4KN4X 3KFWX 3DPTA 2BGCA 4W1UA 3CTAA 2CUZA 1FYLA 2WAFA 4PCQA 3D5LA 5F27A 4HNVA 1R5GA 2EFOA 2XGCA 4PJ0C 3JRHA 3TP3A 2GAUA 4HF0A 1WWXA 3WU1B 1IC8A 2RNJA 1S9HA 3HKZN 5HS9A 5J6XA 2F4OB 2WA0A 4D5FA 2KIUA 2LREA 4MLOA 3S32A 2CS3A 3C1DA 2E60A 5FKMA 5JR3A 1JT6A 1P4AA 1BR2A 2XIGA 1QA6A 3H5RA 2H1LA 2QQ9A 3J80Z 1N3AA 5FKOA 1G6NA 1QTSA 2ZKZA 2ME0A 3BZ6A 4MFDA 2P0WA 4MFEA 1J0RA 5L3CA 2ZFDB 4OOIA 3BC8A 4HNTA 1APLC 2OZUA 3S3OA 2G7HA 4GGGA 2LP0A 4I76A 3BG5A 3LFUA 2JK3A 1OMIA 2F5CA 5IYCP 2FU4A 2FA5A 2OQRA 1K4SA 1HSJA 4E7JA 2Y0SA 1D0XA 3JR9A 1VKLA 1P4WA 1KQ9A 2VQLA 1FYMA 1M5Q1 5BMNA 1FIAA 1DP7P 2KZVA 3CVTA 3KYDB 2QZ8A 4QIWN 4YRVA 1RKWA 3TMOA 3VPRA 1JUMA 5GTHC 1ACIA 1G3WA 1UHSA 2G9WA 2DQRA 2K5CA 3KP7A 1JKPC 1KYFA 3GFMA 4BUPA 3RPUD 3RKXA 1XTAA 1UMQA 4IOAF 5GAEJ 1OCTC 2F7LA 1MKMA 1VQKI 1FEXA 1HLVA 1VQPI 3Q0UA 4KT5C 1LXTA 4IQ4A 4II3A 1OCPA 1WCMJ 4CO8A 3S14J 1NTCA 1VQLI 3ZR8X 3S93A 4XKVA 2O3FA 3A0HC 4BNCA 2Y75A 2Q2EB 5CJ9A 3LSGA 5JVGF 2FQ3A 5AIPA 2NOEA 2FNPA 4QWQA 2YU3A 1IV6A 2O61A 4HX7A 2E71A 1N25A 2CGPA 5ILUA 1UELB 2RV8A 1H8AC 2Y69H 2W82A 2FMYA 1R23A 1I1GA 4WK8F 5L3GA 3I54A 4X0GA 1F1ZA 2DMQA 2DI3A 2HTJA 3TO7A 4EJWA 2NS0A 1R4XA 2F5VA 1IGNA 1JFIC 2DYSH 3L09A 1LWWA 1FOYA 4WF2A 3Q0VA 3FHZA 3R0AA 3GO5A 1R22A 2FF4A 4CCJA 3K0LA 1KYDA 2GA2A 1K6YA 2NVYJ 2K40A 2K4JA 3G3ZA 3MVPA 3S1NJ 1M3QA 5J47A 3S17J 5KAFC 2EWNA 2CW0F 3X2QH 4G94A 2CV0A 4XQFA 3BR6A 2CG4A 4MO7A 4BE1A 3K4NA 3GEZA 2V6CA 2M1BA 1V55H 3Q3SA 1RR7A 4LB6B 4EQQA 5K5QA 1B4AA 1UG2A 3FK6A 1ERDA 2HDDA 1BOAA 1SANA 4LK1F 3MN2A 2K85A 1JT0A 2LKSA 4QTRA 1EF4A 3H36A 4Y15A 5BS6A 2XASA 3LSTA 2LD5A 2M4GA 3FMQA 4E7HA 2K27A 1X2NA 2XAGA 3NEUA 3W2AA 2PJPA 3IV5A 3H5NA 5C44J 4QLCU 4ZH4F 3HGGA 4UV9A 1KYZA 3HOWJ 4BHCA 2Y8QA 1R9TJ 3RSNA 3IAM2 4EJTA 3CCRI 2QBYA 3FX3A 2ADUA 4LIUA 4FASD 2R5XA 3T5XA 4A6DA 4D5CA 3L2CA 1T8IA 5FKKA 4C2MJ 2EINH 4C30A 2XRNA 4CFFA 3FF5A 3RPJA 3GXOA 4DNCA 3WTUC 1I27A 4KT6A 1SFOJ 1RZ4A 5A2QK 2OD5A 4CICA 4EV0A 1AWCA 2XGXA 3H3VK 4U87A 5DEQA 4A0XA 3RPUA 4LG0A 3G1LA 2WAEA 4MTEA 2BHYA 2DBBA 4IX7A 2EBIA 1AA7A 5JN5A 2XC7A 3WGGA 2IXSA 5D6EA 4AIKA 2M7BA 2PLYA 4NQWA 2CV2A 2O5RA 1DP3A 1LWVA 2TRTA 3ZMDA 3P9KA 1R49A 4BY1J 1QRYA 4DYCA 5H2FC 1W36C 2EJRA 2X48A 1E3HA 1FX7A 1R1UA 4M71A 2JA6J 2EZLA 5HVQC 1OISA 4D7NA 2ME6A 1IZ1A 1FC3A 3AL0C 3I0XA 2DA3A 1TC3C 3QRFF 3JREA 3PIPF 4GRIA 4EJOA 3S1QJ 1I5ZA 3HOSA 2F48A 4RM3A 4TPSA 5BNGA 3H9JA 4WXDA 1GV5A 4EAJA 3RYRA 2MYSA 4IRGA 2XSDC 3HIFA 1BA5A 4P96A 3IWZA 3HS8A 5AONA 1SC7A 1QN5A 3BJOA 5GPCA 3I64A 2MW8A 2R7FA 2PMZN 4B43A 2Z5UA 3CW7A 2MABA 5IOYA 1XS9A 1YOVB 2EK5A 1A04A 1XSVA 5CVJA 2KL4A 5EYRA 4PJJA 1JXSA 4IHSA 1NK3P 3SDBA 4DULA 3NARA 3K4LA 1R58A 1S5LC 1E3PA 1FOKA 3O8HA 3SNSA 2Y9YA 4ENJA 1Y0UA 1MP9A 4A5NA 2VOOA 3U2RA 1Y6IA 1HDPA 4GYIA 2VBWA 3BZKA 1XGOA 1ZK8A 3WODF 2MC3A 4WCGA 2HZTA 1P9QC 2W1OA 3OYLA 3O6BB 3ABTA 4BEHA 4NHJA 4YIRX 3E7LA 1VQOI 4CCMA 3VDXA 3I3LA 4B48A 3GTQJ 1OCZH 1XD7A 1XCBA 3CJTB 2NRAC 5D4SA 1YHQI 1IRXA 2HDWA 2X51A 3H5AA 4L5IA 4DZPA 5IYDJ 3HXLA 4PGHA 2EILH 3KEYA 1W0UA 3BR2A 1BI0A 5KL0A 3BTCA 4EEFG 3LSIA 5J1YA 2ZXIA 3N05A 2H1KA 5EPCA 3IKTA 5EZGA 3H9QA 1I1SA 2NAZA 5GTIC 2D45A 2BW3B 3S3NA 3OS2A 2JVGA 3V7RA 3HPGA 3KYCB 2V9JA 1VOKA 2G30A 2QLVA 3G2BA 2K86A 1XMXA 2COMA 3BG6A 1GDTA 3ZQ7A 2F6CA 1U2WA 1D3UA 1TWCJ 1MBEA 3VYSB 3V8LA 1LFPA 3GFIA 3HBLA 4JX6A 4E4HA 3J7YJ 5ILSA 4HV6A 3I59B 2AXTC 2JRMA 1P5DX 1UFMA 4KICA 1XSDA 3U21A 1ZAOA 2W4SA 3CDLA 2YU9J 3ZCOA 3H92A 3ELKA 3Q9SA 2WWYA 4UUSB 1FT9A 3OYNA 4HG2A 3NWTA 3OH6A 1R36A 1LDJA 5F1RA 5BMZA 4KIBA 1WSUA 1USSA 3C18A 3DFGA 4M3BA 1JE8A 4CUGA 2ACJA 4RDUA 1Y8QB 1S6LA 2LRDA 4CA0A 4KYWA 3IL2A 2QSFX 2X1EA 1FBQA 2QF7A 1ETQA 5B66C 1N75A 5CKTA 1KU7A 1LE8B 2AQFA 2MA3A 2Z33A 4A3DJ 3OH9A 1GUUA 2HYGD 3CQZJ 5TISC 4KMUX 3M1EA 3SJMA 3A1YA 4HPQA 3F8FA 4U88A 4RGXA 4EM0B 1XGMA 1Y1VJ 3JRAA 4N9HA 4L9JA 1IN4A 2WB1A 4BH9A 5JHUA 1HDDC 2WV1A 2NWVA 4A3IJ 1OKRA 4RLQA 1UCRA 1SEUA 4EGYA 1X58A 1IJWC 3ZQQA 3JCUC 3WE2A 2HI3A 1BJAA 3CLOA 1I39A 2FBHA 2OBPA 2PEXA 3SXYA 4L0ZB 4ITVA 1DPRA 1Q1HA 1V4RA 1KZHA 1IG7A 5EG0B 2Z3YA 3M3YJ 3ZXSA 3KRMA 3LA7A 2QQAA 3TW7A 2JA7J 5EF6A 3D5RC 3O8GA 2Y31A 4NC8A 3COAC 3RTRA 2M3AA 4ZYAA 2DKAA 1J2XA 4EGZA 2L54A 2E1OA 5K7FA 2E1MC 1WJFA 3FMSA 1YJWI 4WXCA 3DKXA 3JAMK 4YIIA 4RBOA 4KISA 1G2HA 1GXQA 5J1RA 5HSHA 2O7OA 2JQ7A 3K4CA 4RAZA 4AWXB 1YIOA 4LLNA 1DGWY 1D5VA 3CO6C 1SVOA 2L7KA 4G6TB 3SZGA 3LNQA 5E20A 2JWTA 4U0YA 4HDUA 4XSXF 1LWYA 1QN7A 1RKTA 3HSRA 2CW8A 1T56A 3KZYA 3CZ6A 2BHZA 2BXZA 3A0BC 4NC7A 3I56I 1MNDA 5FLMJ 2ECBA 2V1NA 3HKZA 4XKBA 5F0FA 3DEWA 4KNYA 1GT0C 3HEFA 1MBGA 1YO5C 1HF0A 5JFRA 2JOIA 4PSWA 4AUXA 3BQYA 4DZJA 2YX4A 2DA7A 2MBFA 4ZTJA 2E7WA 2OPTA 3HTSB 5GAHJ 2JHNA 3F3XA 2ZNYA 1ZGJA 4G6QA 2V1DA 4I6ZA 4P1WA 3DBLB 2JA8J 4A3BJ 1R5HA 4AIHA 1AKHB 5HLHA 1YJNI 1AOYA 4D7RA 1BW6A 2M5WA 2GIZA 2VI6A 1D1CA 3WE3A 2C6YA 2O03A 4XOPA 5LGNA 5D5UB 4JX4A 3M1CA 4P55A 1PUFB 4NUBA 1K79A 2P7CB 4M6VA 4A3MJ 2CUFA 1BN5A 3K4JA 3QP6A 2HXIA 4LITA 1H0MA 1BR4A 2NVXJ 4OIPF 5TJJA 1WJ5A 2ZCWA 5ILVA 2KDOA 1J5YA 2DTRA 3OL4A 1I50J 4RB2C 3SZPA 5HDNA 3IP4B 3HOUJ 3F6OA 2STTA 1JI8A 5IYBJ 2HYJA 4XKWA 3ZMVA 1TNSA 2HNHA 3DTIA 3VB2A 1T98A 3ABMH 3FZVA 2HOEA 1MDMA 3CC4I 2PBIA 3G73A 5DCMA 3RKYA 2IA2A 4MEXF 2OJED 4HX4A 2XPVA 2JZYA 4PY5A 5ERIA 3HM5A 2V9PA 2FX0A 2M9HA 4HSRA 4RAYA 2GLOA 5J8FA 3ENCA 1MPGA 5F0CA 1JDYA 5FGMA 1K4TA 2EPFA 2ZMEC 5FRNA 4BY7J 1P4XA 2HGCA 1HA8A 3AFHA 1VTOA 3D4VA 1YI2I 3OYCA 2QR1A 1JJ6C 1T0FC 1X1CA 1SVMA 2VJ5A 4S04A 3HJEA 2DODA 2LF7A 4EATA 5KNLA 2JA5J 1G8XA 4E7SA 5M5YJ 3GUDA 2NOZA 3WTVC 2ID3A 3TKYA 2P5VA 4BYYA 1NK2P 3NQOA 3AKZA 4ASNA 3ZMZA 1HKTA 4HW0A 1W5SA 5FFXA 3SFZA 4Q47A 4MNUA 3GX4X 1LJ9A 3I71A 4L18B 1VTNC 2CRGA 2RDPA 2K3PA 2DPDA 4ESFA 2V26A 1QN9A 5BQTA 2HKOA 3HUGA 3HRUA 5KVRA 2W57A 2V9KA 2QUFA 4CGZA 1HW2A 3KX2A 2IPQX 2J5PA 5DTDA 3QYEA 5DM7F 1FP2A 1SAUA 1TQPA 2A05A 1J7KA 1PYVA 1FMWA 2VB6A 1ZLJA 4IPAA 1Z05A 3HDDA 2DW4A 3FM5A 2BY0A 5FKNA 2W7NA 2ICWG 4CCLA 4NQWB 2Q2EA 4BL0B 1FTZA 1IN7A 2CU7A 3C04A 1A35A 3E0JB 3DEEA 4IEJA 3TL4X 1TT5B 1WGXA 1K78A 3PO2J 2NS7A 3L9FA 1TZLA 4QPOA 2V79A 2R7WA 2KIMA 3EIKA 2Y0MA 4UHTA 1SFEA 1KU9A 3HYIA 2K9MA 2ESHA 1ITYA 3K70C 1GHCA 2NOLA 1X4OA 2VJ0A 4N0BA 4RM2A 2K3FA 4C3HJ 1MJBA 3W2VA 3S2DJ 3ENOC 4HBLA 1CQTA 2ZJPF 4RGSA 3PFYA 2IGOA 4M3GA 5EEGA 1YE9A 3PSIA 2H8WA 2L3DA 4HLXA 4HOBA 4A3KJ 2O8KA 2DT5A 2OA4A 5F1JA 1EJ9A 4C3IJ 2MGQA 1LEAA 2DA2A 5ICCA 1RC9A 1I3AA 2FXAA 3TBIA 1IRZA 1UJ8A 2LF8A 5IT3A 2DYRH 1POGA 2H8RA 5F04A 1TL8A 3I0WA 3FXRA 4CYDA 2JSCA 2M8EA 4M9ZA 4EJYA 1WQAA 2FBKA 2EA2A 2FMLA 1XPXA 2XF7A 3PM1A 1FIPA 1J09A 2ZB9A 2W48A 2OCCH 3GWZA 4B8XA 4A0YA 1FBSA 5KHDA 1O3TA 3IWFA 2HDCA 5KK1A 4D9JA 1WRJA 3B02A 4GCVA 2RQPA 3GCMA 4A3LJ 3OS0A 1Q9UA 1QN4A 3CUQC 2R7UA 3ABLH 3PUFA 4RGRA 3LFKA 1ZRFA 2JVHA 2R5YA 1LPQA 1TLHB 3EAYA 1TBAB 4LK0F 1KONA 1X3ZB 3ABUA 5CPRB 2HXOA 3ERMA 1K35A 2FGTA 3OSEA 4F7ZA 2HEOA 1RPWA 2DMUA 5IY5H 3ZN0A 2H4LX 1Z7LA 3WTZA 1K2YX 2QBYB 4PDKA 3KP5A 3DWLE 4H0EA 1W5CC 1TNTA 2STWA 4Q11A 4XBFA 4ENKA 4JK1X 2I5UA 2HL9A 1KA8A 2XUBA 5ICEA 4II2A 2PN6A 3TGNA 4D0PA 4BDYA 1S3JA 3CC2I 1D8JA 3GF2A 4IRIA 1B72A 4ZDLA 1EA3A 3E6MA 4U7DA 3KPHA 2HWVA 1ZREA 1YFHA 3OR2C 2YR2A 2MG4A 4C2TA 5D5WB 1W4MA 3M9AA 1GLNA 1X1DA 2FOWA 5EJCA 2GWRA 4OIQF 3OOPA 1BC7C 1TWHJ 2MJ7A 1CDWA 4CCOA 1K61A 3MAJA 2NVQJ 2M8GX 5FFZA 2VE8A 2VT2A 5EGOB 2ZFWA 4Y13A 4RA2A 1KGSA 5CVUA 2IGKA 4MQ9F 4HQEA 1HXDA 3AG4H 4XRFA 3BG7A 2W24A 1JHFA 2A3SA 2VXZA 3DLAA 1KU3A 2H6CA 1WI9A 2NNNA 3G4SI 2FUG2 1GVDA 4HX8A 3KP6A 1C47A 3ZMUA 4E7IA 4KA4A 2EZHA 3REOA 1WH7A 1F43A 5CQGA 1I6XA 1P7JA 3HC7A 4XSZF 1KYWA 1QZYA 2Z16A 3I5UA 2IAIA 2NOFA 4BBRJ 1FBUA 4B09A 1N3CA 1R00A 3OYHA 3N89A 1ETVA 4F93B 1X3UA 3H35A 3M4OJ 4ZYGA 3MKYB 4QG5A 4RB0A 4FE7A 2QREA 2FQ4A 3GTPJ 1TWGJ 1XMAA 3WTTC 2KZGA 5J40A 2D0CA 5E3NA 3VYRB 3BZCA 2A5WA 3KE2A 1QBJA 1AISA 2R7VA 1ETXA 1ON2A 1YG2A 1IN8A 2HPIA 5J4VA 5E3OA 3BPXA 2O6GE 3JAMZ 3VWBA 2GOXB 4PFOA 1YQLA 3HHHA 4CHUA 2XGEA 1T2KA 5D8LB 2DFFA 4A3FJ 2KISA 4AYBA 9ANTA 3DP7A 1TUOA 2PMHA 2QVOA 2RC4A 4C9YA 2M0CA 4AIJA 2M0MA 2WADA 3FKJA 2HVSA 3J80K 3GBGA 5HLIA 3U9GA 5D4RA 1DGRM 3C2GA 1LDKB 4RAFA 3OLPA 3C7JA 5ICGA 1Z0XA 1ZGAA 2DU9A 3E1SA 4G9YA 4IL6C 1BL0A 3G1OA 4BE2A 2EIJH 3BROA 2BV6A 2DO7A 3DPLC 1W7PB 3IKVA 1QNBA 1WI3A 3BQZA 1E42A 3K1NA 5F9CA 1EV7A 2XPUA 1YRNB 3F6VA 3MMYB 4S0HB 1R4MB 1D5YA 4J19A 3DXJF 1FOXA 4FX0A 3OSMA 2X0LA 3DU6A 3E6DA 4JYKA 3CMYA 3N97A 4UUVA 3JW4A 1W0TA 1MJAA 2ZMEA 1UZCA 3K4MA 1Y1WJ 3CCEI 1BR1A 3LSPA 1YIJI 3GZNB 3T1BA 4BAYA 4M3FA 2JMWA 5H6RA 1ETKA 3HZJA 5LBQA 3ECOA 3FBNB 1HQCA 2LK2A 1YITI 2R7RA 2IRFG 2AS5F 1LDDA 1ZHFA 3KZZA 4P5OA 3FXLA 4YFNF 5JHFA 1A31A 1DU6A 3L00A 2CMPA 3SQNA 1RR8C 3KZIC 3EUKL 3BJ6A 1OR7C 2QA4I 4ZYDA 3BR3A 3JRDA 1F4KA 3KIOA 1STZA 2L7ZA 2WY8Q 1B59A 2GBYA 4ESBA 3FXQA 5DS9A 5C4XJ 4ZJZA 3IH7A 3E6BA 4LLGF 3IUOA 3M8EA 1VQ4I 1EUVA 2LAEA 5DCFA 2DAOA 3PUBA 1YQRA 2I5WA 1J59A 1N78A 3QPLA 2XB0X 3QQAA 3RIRA 4FTHA 2IS2A 2FUVA 3R4KA 1QQIA 2L4AA 1CF7B 4HYEA 4AVPA 1W1WE 3E5XA 3A02A 3I4PA 2E5ZA 4U0WA 4DBRA 1WH5A 2RAEA 3OYJA 3GFJA 3BTJA 4LOCA 3S15J 3WU0A 4UXNA 4DGWB 4WX9A 2E2HJ 1OPCA 4IJAA 3KLNA 2DJIA 2KFDA 1HSTA 3HHGA 2JPCA 4B44A 1DDNA 2DA1A 3P5JA 3PQJA 2NVUB 3BR5A 3RDIA 3S2WA 4ENNA 3RJPA 3GTGJ 3HUGB 2Z0FA 4CSWA 3IRRA 3BOQA 2LOOA 3BTLA 3MWMA 4A12A 1O4XA 1K6OA 5M5WJ 1IV8A 1QHHD 3BWGA 2PX9A 1BW5A 5K5OA 4GXOA 2HTSA 2L7FP 3KLOA 4D1QA 4KDPA 2AXLA 5CVIA 1T33A 3WU2C 3P9IA 2X4HA 4D7QA 4BQAA 4OU0A 1QNTA 2BZTA 2KT0A 3CDIA 2E2JJ 1A6IA 3R61A 1DPUA 4Y3OA 5IYDP 2Y48A 3HSEA 2RREA 3LQRA 3M8FA 2LH9A 4DJAA 2HS5A 5C3EJ 1DQUA 1IDZA 3L7WA 1PUEE 3MD2A 3FDYA 5A2QZ 4CZCA 2KPMA 3I58A 1WJCA 2X6YA 2XF6A 3L2QA 2E5NA 2YA3A 2K9NA 2CH0A 2NOGA 1S7OA 1YW8A 4BJ6C 4ETSA 2M7AA 1Z91A 4KN7X 1BI1A 2HOSA 2V8QA 2M34A 5H20A 4GDFA 1OCOH 4IHXA 2XB5A 4XLEA 2MD5A 2VJIA 3GZ5A 4LFUA 2BBYA 6PAXA 4HF1A 2Z2SB 1YJ9I 4EM2A 1O3RA 3F9KA 4A5MA 1VNDA 2YSRA 4HV5A 3IHUA 2Z99A 1TBPA 3GVAA 1P92A 3OYIA 3V7SA 1LVKA 4FISA 5L3EA 2P81A 2KQRA 1LEBA 3DTKA 1HCRA 1LE8A 1UT4A 5ED4A 2Y0SN 2OCEA 3MCZA 4A3EJ 1PDNC 3VSKA 2X85A 4EJUA 1JTYA 4P9FA 3OYKA 4UVBA 3OIPA 2R7SA 4M3EA 4R8HA 1LB2A 3ULXA 2FJ1A 2VJ4A 5F0HA 3HOVJ 3ROUA 5F6FA 2R5ZB 4BQNA 2KRCA 5FROA 5C4JJ 2L2OA 5B1AH 4IHYA 2CQXA 1PVEA 1YW9A 1G3TA 2MH9A 3OGDA 2LBFB 2KJBA 1VQ9I 2JRTA 2CFOA 4KIFA 4UB6C 3GYHX 4GFBA 4PJLA 2G7UA 2WB1N 1MBFA 2O3OA 1R1TA 5LGTA 1KFIA 2LY9A 4RGUA 4I0AA 3TDZC 3HS9A 1B1BA 1ZG1A 3LA2A 4GO1A 1FMVA 1IRGA 1NG7A 5LFAA 2IA1A 4H4KC 2P7VB 4BXUA 2P5LC 3S16J 2NYXA 2LY1A 3S1RJ 2GIVA 2VC0A 4XK4A 4IHVA 2GQQA 3VN5A 1WJBA 1MD0A 2HU9A 3RZDJ 2VBZA 3OR1C 3VFZA 2A61A 5IOZA 1QNAA 2DDBA 3I4MJ 4F55A 5J1UA 3OL3A 5FD5A 4O3MA 5FLXZ 1V54H 3O2PE 4B3XA 3ASMA 2NXNB 4X1EA 5HNHA 5LEJA 4ENMA 2HOTA 2JTVA 1RIOH 4EAGA 3QWLA 3DEUA 1R7JA 2V6EA 1PCMX 2DTZA 2HZDA 3ESWB 5BPDA 1MH4A 4R1HA 3SYTA 3ZQCA 4AVZA 2DQLA 5FLVA 2HFHA 4M6XA 4XICA 5ICFA 2BY3A 1XC5A 1L0OC 3BPVA 3GFLA 4BQOA 4A69C 1R1VA 3CCUI 1O3QA 1B9NA 3K4KA 4RS8A 5E8IA 4AU7A 1XN7A 2I8DA 3MZ8A 3C3WA 1A36A 4L5JA 1WKMA 1O7LA 1NH2A 1ZYRF 1JGGA 3VOEA 1SD5A 1FWZA 3ZOBA 3CCYA 3GTLJ 1MNEA 4HA8A 1HKSA 4OIRF 2IS1A 3MZYA 2QGUA 2CW7A 3EQLF 3SHFA 2WAQN 5DDGA 1QZEA 4LB5A 1PCJX 2VKEA 2ZO4A 3OIQA 4D7MA 2VE9A 2IVMA 3LL7A 1SFKA 4OAYA 4LG0B 1QZZA 1WJEA 4Y7NJ 3P7NA 4DW6A 1H88C 2EB7A 3TW6A 3BLYA 5GP9A 3CLQA 4K2EA 1W80A 2OTLI 3K69A 1W36D 2QRDA 3QYBA 4XL9A 3FMRA 2KDZA 3KEOA 4E7KA 1KU2A 5E18F 1R6RA 3ZQFA 4V2FA 1EBMA 2NOHA 3K1PA 4JP0A 2ZJQF 3EUHA 2VC1A 1A6QA 1D0YA 3J7AO 4F92B 2FBIA 2Y2ZA 3ABKH 4ZC3A 1DIZA 4E6KG 2E1MB 2OOYA 3OSFA 2LG4A 4LIVA 4B4CA 3V4GA 2X1CA 4XN3A 3E97A 2RN7A 5DD4A 5TGTA 2PMZA 3ZN1A 2A07F 1KYUA 2IEKA 4JOMA 4WXAA 3T8TA 2JUCA 3F21A 2K7LA 2IP2A 1OYIA 3F0CA 1KQ8A 2AO9A 3RPQA 1JKOC 2ECCA 1G3SA 4IQJA 3LSHA 4PUSA 1XDSA 1UT7A 3O3KA 3OMYA 2Z8UA 4N4NB 4M72A 3DU5A 4G7OF 3DLLF 5AIQA 1YQKA 1ENHA 1JUPA 1X2MA 4XNFA 1Z7UA 4AM3A 2ESNA 5B1BH 3F23A 4L9TA 1QNEA 5AN4A 4V2GA 3KEQA 2OF7A 3Q0WA 1TWAJ 2Y30A 4O5VA 1KO9A 5LHHA 2DOAA 3KP3A 1OR7A 3QU3A 1E0EA 1MBHA 1QHGA 2VXDA 2ZSHB 1ETWA 3TO6A 4XORA 4ZDPA 2K9QA 3JSOA 4BDZA 1TP4A 1H9GA 3WTYC 3CDHA 1Z77A 1JHHA 1IW7F 3CCSI 1YW7A 2JUGA 2UZKA 4AYBN 2M87A 4BACA 3ZQLA 4XKCA 2R4GA 3VYUB 2E2IJ 1IXCA 3QAHA 3Q9VA 4FQGA 3A2KA 2MD0A 2IS4A 4CYCB 1VQ6I 1QU3A 2PQ8A 2VT3A 3OSTA 5HS7A 1RETA 2NOBA 1UHMA 3SEQA 1WJAA 1YS7A 2DOFA 2LYCA 2XRLA 1IXRC 4MEYF 2WTEA 1MMAA 1S7EA 1HC8A 1YQMA 3CCLI 3ASNH 4JBAA 1K78B 2VUMJ 3HOYJ 1B6AA 2PFBA 3OYEA 4XLNF 1YRNA 4I98B 1Z9CA 3G6EI 2YUSA 3LOCA 2V1XA 4E7ZA 1VQ5I 2DCEA 3VYTB 3QODA 1QPMA 2VN2A 3JSPA 2XPWA 4NNJA 1VZ0A 1CGPA 2R7TA 2ZMEB 2CQNA 3HOZJ 3LQQA 3I55I 3DBHB 3F72A 3WGIA 1X3WB 1ZELA 2VKVA 4OWRB 3AG2H 2QSHX 1U5TB 3UKGA 2VBYA 2RQQA 1OJLA 3CCQI 3PL8A 1X4PA 3HG9A 3HGYA 1TQIA 2CJJA 3L1PA 2DFIA 5LRRA 1U9OA 2V92A 1Z6RA 1Y56A 4ZZLA 3FHNA 4BXXJ 2QWWA 4Y52J 4B3AA 5LHGA 4MTDA 2XSJC 4A3GJ 1W7PA 1JUSA 2UV1A 2R7DA 2KKOA 3ZPLA 4BJTA 1HBXG 1BJZA 2EH3A 1VQ8I 1D0ZA 1LKXA 1LFBA 4IXAA 3S1MJ 3NA5A 4M3DA 2GM4A 1ZRDA 2VLAA 2IA0A 2O9LA 2IV9A 2R7QA 5JI6A 5DV5A 2DPUA 2E36A 2EFPA 2UUZA 3K1MA 3ZQGA 4Z6YA 4ABZA 5M5XJ 2KP6A 2ZXWH 2MZ8A 5J8CA 4XMYA 3FK7A 3EETA 4G6DA 4Q5SF 3V8KA 2M4KA 1FZPB 2XAHA 5FO5A 5EEHA 3CMAI 2E35A 1D3YA 2PWWA 1H9TA 1D1AA 3DKYA 2BYVE 2R3SA 1FSHA 2F5EA 3QPSA 2EZIA 4KJZA 5E3LA 4I8OA 3CWAA 4MGRA 1V5FA 5DD8A 3SFIA 3V7CA 2HQAA 2XDVA 3BP8A 4DOZA 4EJVA 2VQCA 5FLXK 1OQYA 1XSZA 2D1HA 2WY7Q 2R5YB 2GZWA 3MQ0A 4KFCA 4MRQA 2HR3A 2YH5A 3RKQA 2LSOA 1X19A 2Z1DA 5K1YA 2WC2A 3PO3J 4F52A 3IH4A 3I53A 4ON0A 3RYPA 3OYDA 5JLXA 1FY7A 2B7EA 1XGNA 4L9NA 4B47A 1S29A 2R93J 3CP8A 4S05A 1M3HA 2QEXI 1ULYA 1TTYA 3OYFA 2EFWA 4AIDA 3J81Z 2VBXA 1P2FA 1U5TA 5HLTA 5B5EC 4XLHA 1U0JA 2A6HF 1JJ8C 3DQVC 3N4MA 3ZQIA 3BR0A 3OIOA 3WTSC 3PNTA 4XN0A 1JGSA 2PJRA 2F5DA 1MIJA 2FOKA 1MH3A 3TOAA 2FKMX 1XGSA 2EV5A 3M07A 2XAJA 1C0WA 2XVCA 3Q5FA 3WG7H 1B9MA 4NBQA 2VASA 2N8GA 4EVIA 2L9RA 2LY2A 1Z6TA 3BCBA 3FKIJ 3BY6A 3SZTA 4IHWA 1V5SA 3WG9A 1JKRC 2A68F 4YG2F 1QO0D 3B6CA 1KFQA 1XSXA 4HEA2 5LRSA 2NLVA 4FT8A 3IH3A 2VODA 2Q8KA 2KJCA 2K9LA 5D6FA 4XLFA 4Y17A 4BS9A 1R5ID 1XB4A 4BE0A 4ZYEA 1U9NA 3KETA 3CP2A 1ZR2A 2ZXHA 2BW3A 1P7IA 1C4GA 1LFUP 3VEPA 1Y39A 2DK8A 2UXXA 2WAQA 3A03A 1V5GA 2KLOA 4RLFA 3AAFA 1VTLE 1BOBA 1MMDA 2VQHA 3SEZA 4QPQA 4KITB 1HKQA 4G12A 2ZFUA 1LNWA 1ZKGA 3BCAA 2X6WA 5LHIA 3CF2A 4FCYA 4Q4ZF 5EDNA 3T0YA 3FWEA 1FOWA 4LMYA 4Z2YA 2F4IA 2KIFA 1IAWA 1N77A 3FXMA 3TQNA 1FYKA 2Q0OA 2AQEA 4RODB 1EH8A 2ZSIB 4PGGA 4KMFA 1MZBA 3WHCA 1TW2A 2R7ZJ 1YS6A 5LD2C 2EQRA 3L2WA 3CWTA 1AHDP 3M7GA 2HKXA 3EYYA 5H6QA 2NVMA 1HU0A 3F8NA 1F9NA 5HODA 3PDKA 2L4MA 3T4NA 2Q1ZB 2LBFA 3GW2A 1SMYF 4R79A 1MDMB 3CD6I 4E70A 5EG0A 1BC8C 2COBA 5KCMA 1X1PA 3OOUA 1NG6A 2OZ6A 4YIFA 3ZMTA 1ZQ3P 4DBQA 2CUJA 3BG9A 2CSOA 3BJAA 5D5VB 1EH6A 4HSTA 4QSHA 3EDPA 3UR3C 2YX7A 2QQBA 1S8NA 2A5YB 1GV2A 3FXJA 5E3MA 1UL7A 2DLLA 4I09A 5GPAA 1T6AA 4I7HA 3BR1A 5EGOA 4ZZDA 4FE4A 1QVTA 2ID6A 2LC2A 2QCOA 3FIWA 1MMSA 1QN8A 1WQ2A 1Y0NA 4BQQA 2EV0A 2UXNA 1MNMC 2E7XA 4NDLA 2YS9A 2H27A 3CVSA 3VODA 3CCJI 2JPIA 3OCIA 3GTMJ 4HAMA 4LD5A 2BY1A 2IS6A 3HB9A 4GYGA 4XRMA 2EHBD 1EH7A 3OSGA 1Z3YA 3K6GA 1MJ9A 4E7LA 3HSFA 1SD7A 3HOXJ 2BVLA 1NHAA 3LWFA 3KP2A 4N9IA 3OYBA 4HQMA 4PZJA 2BY2A 2ETHA 3GZ6A 3JRFA 1X1AA 1N39A 3U1DA 3RI4A 1HW1A 2FKFA 1ETOA 2K9SA 1T08B 2R7XA 1E3OC 4IRHA 3LAPA 3P9CA 4BHBA 1U6GA 2E19A 1QGPA 2ZXJA 4HZFA 1O57A 3KP4A 1OLTA 3QPHA 2MFZA 2HKPA 3QU6A 3ZRGA 4C7PA 2BOLA 3C2BA 5DUKA 2M45A 4HDVA 2HVQA 3MFKA 2NNYA 1H89C 2FE3A 3I59A 3I4NJ 2PG4A 1U8RA 5E8GA 4G7HF 2D1VA 3CMEI 5DM6F 3GTKJ 2V7FA 3OYMA 2NVTJ 2K4BA 4KUMA 1ETYA 1Q1VA 3K2AA 3FXOA 1QNCA 2F5FA 3OYGA 3BKQX 3T8RA 2KRHA 2E1CA 3HOTA 4UNOA 3KYLA 4I99C 2O8XA 4IZZA 1FP1D 2TCTA 2HL8A 3MZHA 1W7PD 1YTYA 3CWUA 5JMVD 3ECHA 3K70D 3H3UA 4HJHA 1IDYA 2ZBKA 3DTEA 1FNNA 1D8KA 2D5VA 2IBDA 1MGTA 1WFXA 2F4MB 3DBRB 1U8BA 4PFPA 5DCMB 5L3DA 1T39A 1B8IA 3QOEA 4A93J 5IP7J 1GVJA 2OQGA 4I0BA 4Q48A 1BBYA 4B1RA 5IT9K 3D7QA 5LLQA 4EJZA 4A0ZA 2UWMA 5BOXA 1KQ0A 1VQMI 3W3CA 2CQQA 2XHIA 1UHWA 5L3BA 2LLKA 1G4DA 3WTXC 3GLLA 3DF8A 4IVNA 4L0YB 1U78A 2OOXA 3GMEA 1ZARA 2VONA 5HLGA 2F2EA 4BJ5C 4ZYHA 3CJQB 3PNYA 4FETA 5CQEA 3ZMSA 4CDGA 4DYQA 1FJLA 3H1ZA 2V9VA 4WZSD 2VOPA 2RVCA 1IN5A 1BI2A 1DU0A 4OMYA 3CUOA 4XOTA 1NGMA 2DK5A 3S2HJ 1ZN2A 1QPIA 1SMTA 1ORKA 3MKZA 4B0AA 3CO7C 3F8CA 1MSEC 1I3QJ 3H1CA 1BI3A 1BM9A 2KHMA 2JN6A 1E17A 2RNGA 2P5KA 3OWTA 2DT7B 4XIDA 1F5TA 4IL8A 4M73A 2RGVA 5IYCJ 4BBSJ 2DKCA 1EKEA 2GXAA 3EUAA 1B72B 2GXGA 1P6RA 4AD9A 4V19K 1B8IB 4LGWA 1RM1A 3UW2A 2GA1A 3F0ZA 4XRSG 3PMGA 1V5EA 5KAIC 2LTPA 1ZLKA 4OMZA 3D0SA 3F8BA 1WVRA 3BT9A 1L3LA 2ELHA 4YFXF 2QM3A 2NS8A 4IO9F 3RQIA 4I2OA 1J9IA 4PSXA 1D1BA 4YELA 5FKLA 2G0EA 3ONQA 1ZRCA 2LKPA 2QLZA 1YYVA 4BJUA 3S8PA 3AG1H 2L9NA 1ON1A 1MMNA 4DYRA 2D2WA 3LAJA 1U5TC 3ISPA 4BGDA 4BKXA 3CJRB 2DMTA 4JQFA 4IF4A 2A6EF 4HF2A 1PP8F 1VOLB 3HRSA 3E3VA 2VL8A 4LG3A 5GADJ 3R6SA 1JKQC 4XLAA 1ODDA 2K02A 1BIBA 3ZGKA 5EEAA 4UY8I 1WJWA 2L9SA 2EA4A 4A3JJ 1J75A 4WWCA 3PFIA 3PQKA 3I3WA 1FLIA 1UG0A 5K7ZA 4HLYA 5DYMA 2B63J 1NH3A 1C9BB 1SFXA 2HVRA 2ELJA 2P6TA 4KIGA 3ERED 4FX4A 3DCFA 2D0AA 1OCCH 1TBXA 4DQ2A 3J81K 1KY6A 2LVSA 2NOIA 2L01A 4HRIA 2Y8LA 2XV4S 3JTGA 2LKXA 2IW5A 5HS8A 3AG3H 3I0TA 2KRFA 4WXHA 2Y9ZA 4M6YA 5IYBP 3SDGA 2CQKA 2OV7A 1VQ7I 3HRMA 1Z1DA 5HNFA 5JVTA 1UB9A 1GXPA 2XGDA 3LSJA 1P5GX 5FRMA 1MW7A 2L5QA 2DKDA 2O0YA 3OY9A 3NRVA 4ESJA 2MC4A 1YQAA 3GTJJ 2DDAA 1W5TA 1VI0A 5L3FA 4ROCB 4I01A 1YTBA 3R60A 4XLCA 1USTA 1TGHA 5CVRA 2KMUA 1UAAA 3TE5A 2WV0A 2XKPA 1PJRA 5FJ8J 3FISA 2OUMA 2HZSA 3D1NI 2TDXA 3EYIA 2QSGX 5D8KB 1WPKA 2OU2A 2L0KA 1E2XA 2XHKA 2J5OA 3JTHA 2DJNA 4G7ZF 1O3SA 1Z67A 4EAKA 2FRHA 4M9XA 2RKHA 1LUJB 1TT0A 3PNVA 1RRJA 1ZG3A 1U3EM 2MH2A 4YFKF 1IUFA 3TP0A 5J4YA 2LFBA 4M9SA 1T0FA 2QKLB 2CQ7A 1Z21A 4N4OB 4F3QA 3RQ4A 2ISYA 3I9V2 4CCNA 3QOPA 3E5UA 3WHBA 4OIOF 2OC6A 4UV8A 3BG3A 2FD5A 1RESA 3JRBA 2HQ5A 3DV8A 2BVMA 2D0BA 1YX5A 2QYOA 3CUQA 3QYFA 4O6JA 3A01A 1AU7A 1NVPA 5IP9J 4ZDOA 3L2VA 5LGUA 2B0LA 3UNGC 4UVCA 2VKHA 5K7HA 1RI7A 3MEXA 2ZJRF 3CC7I 3FM3A 2OAZA 1B9KA 4XRSA 4J01A 3C2HA 5FD6A 2ZJ2A 1YLFA 4BEHB 2QRCA 2XAUA 4UUTA 3QP5A 4XONA 4J00A 3W2WA 4LLLA 5GAGJ 4XLPF 2W25A 1Z3XA 1XG1A 4IOCF 4RB1A 3JRCA 4UB8C 1A5JA 3LSRA 2DA5A 3CCVI 4PK4A 4Y4RA 1HOMA 5E17F 2XKOA 2AHQA 1LQ1A 3CF5F 3ASOH 1T95A 3F22A 3IC7A 1OCRH 1K7AA 2JT1A 2XROA 1QN6A 3GLXA 3MKWB 2DFHA 2R5ZA 3BTIA 1SVLA 4A2UA 3W6JB 1X1BA 3PSFA 3WTWC 2VPRA 4C3JJ 3HL2A 4I02A 2XAQA 2Z9OA 4MQVA 2JPBA 3EPZA 3LSMA 3G71I 2CV1A 3NAUA 2I10A 3GTOJ 1PCZA 2HPMA 3AL0B 3TOBA 2M2EA 1Y8RB 2CWEA 4TV7A 2IJLA 2XF5A 3TDUC 3OS1A 5BMPA 2LDUA 3KTUA 2X6OA 3K7AJ 3K10A 1IO2A 4OAZA 3W6VA 3K9TA 1AKHA 2JJ7A 2DFEA 4JX5A 5E79C 3JRIA 1DUXC 3J7ZI 2IT0A 1S7AA 3IRQA 4U0VA 2HQRA 1IXSB 2R92J 2H94A 2LR8A 2ZNZA 5CVVA 1SAXA 1TW3A 2HQNA 3W6KB 5D5XB 4BHPA 1VQNI 1ZH5A 4U7BA 2VPLA 2HYFA 1YX3A 4UUSA 4XM3A 2EV6A 4C2UA 3JRGA 2EIKH 3DPUA 2E34A 4G8XA 4WX8A 3TEDA 4RAGA 2X9DA 2NOJB 3B73A 3F10A 2BE5F 2DN0A 2L02A 3HPHA 1RUOA 2QENA 2H6BA 3H3ZA 4PJMA 4RMNA 2DMNA 2W84A 2JA2A 1ZGWA 1XDUA 1MMGA 2ELKA 5E1ZB 1IUYA 3RZOJ 2FSWA 2MLKA 1R71A 1PP7U 4YEJA 3D5SC 1RUNA 1K83J 4ANJA 4A6EA 1MSFC 4CH7A 2BEOA 2IV8A 5IPAA 4XR6A 1R4NB 2DT6A 2CO5A 2W85A 3PJRA 2L7MP 1LVAA 2VKDA 3NWSA 2A69F 2P8TA 3TDHA 4IKFA 1WZ2A 3F8MA 3ML6A 2YPRA
chains in the Genus database with same CATH topology
1SD6A 4FHTA 4M74A 3M8JA 1ZG5A 1FSEA 3RCOA 2VJJA 1T6SA 5HDGA 3EUHC 2DXIA 3KCCA 3QPTA 1G59A 2P6SA 2EFQA 2LNBA 3K2ZA 2ISZA 1V3FA 3HRTA 2IGMA 3FBIB 5F64A 3RKWA 3V42A 3S3MA 1IRFA 1ONVA 1TQMA 2JSPA 2V4JC 4RB3C 5IT9Z 1CF7A 3OYAA 5TRDA 3WGHA 4DIQA 2X1DA 1O7FA 3K4BA 3DKWA 2XAFA 4MHGA 1XCVA 4HNUA 4P9UA 3CUQB 5CYVA 4ROEB 3L2UA 2FEZA 4LJZF 2X6XA 3OV8A 2QKMB 3L2RA 1T38A 2PMUA 2PI0A 2P4WA 3LA3A 2IGNA 1BIAA 1SFUA 3CESA 3A4CA 5E1XA 2WBMA 4EM1A 4OINF 2A6TA 1SD4A 2PJRB 1RNLA 3HTUA 5LEKA 1G3YA 1OYYA 2FNAA 1REPC 2EFNA 1WJDA 4UVAA 4IHTA 5HOOA 5E1WA 3TO9A 2V1UA 4ZTFA 5CLSA 1KY7A 5FB2A 2CYYA 4CZZA 4NB5A 3CJNA 3VSLA 4F91B 2MLGA 2GXBA 3ULQB 3CMMA 3BDDA 3IAS2 1FPQA 3R0JA 3LMMA 1OYWA 3V8JA 2M30A 5DUIA 1IF1A 3J7AY 5K5RA 3FXUA 2CFXA 4CCKA 3H9GA 1QTPA 3E5QA 3OC3C 2H09A 2VIXA 4PJNA 4L9VA 1PZDA 4CXFA 4Y33A 1YTFA 3LSKA 2GOMA 4BXFA 4EMSA 2R7OA 5BPIA 3E6CC 2E1NA 3ZP5A 1FN7A 5HDKA 2HZMA 1HW5A 1XMKA 4BU2A 1QN3A 2W00A 3H0DA 1IN6A 2VQGA 4KN4X 3KFWX 3DPTA 2BGCA 3CTAA 2CUZA 1FYLA 2WAFA 4PCQA 3D5LA 1R5GA 2EFOA 2GAUA 4HF0A 1WWXA 3WU1B 2RNJA 1S9HA 5HS9A 5J6XA 2WA0A 2KIUA 2LREA 4MLOA 3S32A 3C1DA 2CS3A 2E60A 5JR3A 1P4AA 2XIGA 1BR2A 3H5RA 3J80Z 2QQ9A 1N3AA 1G6NA 1QTSA 2ZKZA 3BZ6A 2P0WA 1J0RA 5L3CA 4OOIA 3BC8A 4HNTA 2OZUA 3S3OA 2G7HA 4GGGA 3LFUA 1OMIA 2F5CA 5IYCP 2FU4A 2FA5A 2OQRA 1HSJA 4E7JA 2Y0SA 1D0XA 1P4WA 1KQ9A 2VQLA 1FYMA 1DP7P 2KZVA 2QZ8A 4YRVA 3TMOA 1G3WA 2G9WA 3KP7A 2DQRA 2K5CA 1KYFA 3GFMA 4BUPA 3RPUD 3RKXA 1MKMA 4KT5C 4IQ4A 4II3A 4CO8A 3ZR8X 3S93A 4XKVA 2O3FA 4BNCA 2Y75A 2Q2EB 5CJ9A 3LSGA 2FQ3A 5AIPA 2NOEA 2FNPA 4QWQA 2YU3A 2O61A 4HX7A 2CGPA 5ILUA 1UELB 2RV8A 2W82A 2FMYA 1R23A 1I1GA 4WK8F 5L3GA 3I54A 4X0GA 1F1ZA 2DI3A 2HTJA 3TO7A 4EJWA 2NS0A 1R4XA 2F5VA 1JFIC 3L09A 1LWWA 4WF2A 3FHZA 3R0AA 3GO5A 1R22A 2FF4A 4CCJA 3K0LA 1KYDA 2GA2A 3G3ZA 1K6YA 2K4JA 1M3QA 2EWNA 2CW0F 4G94A 2CV0A 4XQFA 2CG4A 4BE1A 3K4NA 3GEZA 2V6CA 2M1BA 4LB6B 4EQQA 5K5QA 1B4AA 1ERDA 1BOAA 4LK1F 4Y15A 5BS6A 2XASA 3LSTA 3FMQA 2M4GA 4E7HA 2K27A 2XAGA 3W2AA 3NEUA 2PJPA 3H5NA 4QLCU 4ZH4F 4UV9A 1KYZA 4BHCA 3RSNA 3IAM2 4EJTA 2QBYA 3FX3A 2ADUA 4LIUA 4FASD 3T5XA 4A6DA 3L2CA 4C30A 2XRNA 3FF5A 3RPJA 3GXOA 4DNCA 3WTUC 1I27A 4KT6A 1RZ4A 5A2QK 2OD5A 4CICA 4EV0A 1AWCA 2XGXA 4U87A 5DEQA 4A0XA 3RPUA 4LG0A 2WAEA 4MTEA 2DBBA 4IX7A 1AA7A 2XC7A 3WGGA 2IXSA 5D6EA 4AIKA 2M7BA 2PLYA 4NQWA 2CV2A 2O5RA 1DP3A 1LWVA 3ZMDA 3P9KA 1W36C 2EJRA 1FX7A 1R1UA 4M71A 5HVQC 1IZ1A 1FC3A 3AL0C 3I0XA 3QRFF 4EJOA 4GRIA 1I5ZA 3HOSA 4RM3A 4TPSA 3H9JA 4WXDA 3RYRA 2MYSA 4IRGA 3HIFA 4P96A 3IWZA 3HS8A 5AONA 1QN5A 3BJOA 3I64A 2R7FA 4B43A 2Z5UA 2MABA 1A04A 1XSVA 2EK5A 5CVJA 2KL4A 1JXSA 4PJJA 4IHSA 3SDBA 4DULA 3K4LA 1R58A 1FOKA 3SNSA 4ENJA 1Y0UA 1MP9A 4A5NA 2VOOA 3U2RA 1Y6IA 4GYIA 2VBWA 1XGOA 3WODF 2MC3A 4WCGA 2HZTA 1P9QC 2W1OA 3OYLA 3O6BB 3ABTA 4BEHA 4NHJA 4CCMA 3VDXA 3I3LA 4B48A 1XCBA 1XD7A 2NRAC 5D4SA 4L5IA 1IRXA 2HDWA 2X51A 3H5AA 3HXLA 4PGHA 3KEYA 1BI0A 3LSIA 2ZXIA 3N05A 3IKTA 1I1SA 3H9QA 2NAZA 2D45A 2BW3B 3S3NA 3OS2A 2JVGA 3V7RA 3HPGA 1VOKA 2G30A 3G2BA 2K86A 2COMA 3BG6A 3ZQ7A 2F6CA 1U2WA 1D3UA 3VYSB 3V8LA 3GFIA 1LFPA 4E4HA 5ILSA 4HV6A 3I59B 1UFMA 4KICA 1XSDA 3U21A 1ZAOA 2W4SA 3ZCOA 3H92A 3ELKA 3Q9SA 2WWYA 1FT9A 3OYNA 4HG2A 3NWTA 1R36A 1LDJA 5F1RA 5BMZA 4KIBA 1WSUA 1USSA 3C18A 3DFGA 1JE8A 4CUGA 2ACJA 1S6LA 4KYWA 2LRDA 4CA0A 3IL2A 2X1EA 1FBQA 1N75A 5CKTA 1KU7A 2MA3A 2AQFA 2Z33A 2HYGD 4KMUX 3M1EA 3A1YA 4HPQA 3F8FA 4U88A 4RGXA 4EM0B 1XGMA 4N9HA 4L9JA 1IN4A 2WB1A 4BH9A 5JHUA 1OKRA 4RLQA 1UCRA 4EGYA 3ZQQA 3WE2A 1BJAA 3CLOA 2FBHA 2OBPA 2PEXA 3SXYA 4L0ZB 4ITVA 1DPRA 1Q1HA 1V4RA 2Z3YA 3ZXSA 3KRMA 3LA7A 2QQAA 3D5RC 4NC8A 3COAC 3RTRA 2M3AA 4ZYAA 1J2XA 4EGZA 2L54A 3FMSA 1WJFA 2E1MC 4WXCA 3DKXA 3JAMK 4YIIA 4KISA 1GXQA 3K4CA 4RAZA 4AWXB 1YIOA 4LLNA 1DGWY 1D5VA 3CO6C 2L7KA 4G6TB 3SZGA 5E20A 4U0YA 4HDUA 4XSXF 1LWYA 1QN7A 3HSRA 2CW8A 3KZYA 3CZ6A 4NC7A 1MNDA 2V1NA 3HKZA 4XKBA 4KNYA 1YO5C 5JFRA 2JOIA 4PSWA 2YX4A 2MBFA 4ZTJA 2E7WA 3HTSB 3F3XA 2ZNYA 1ZGJA 4G6QA 2V1DA 4P1WA 1R5HA 4AIHA 5HLHA 1AOYA 2M5WA 2C6YA 3WE3A 1D1CA 2O03A 4XOPA 5LGNA 5D5UB 3M1CA 4P55A 1K79A 4NUBA 2P7CB 1BN5A 3QP6A 3K4JA 4LITA 1H0MA 1BR4A 4OIPF 5TJJA 1WJ5A 2ZCWA 5ILVA 2KDOA 1J5YA 2DTRA 3OL4A 4RB2C 3SZPA 5HDNA 3IP4B 3F6OA 2STTA 1JI8A 4XKWA 3ZMVA 1TNSA 2HNHA 3DTIA 3VB2A 1T98A 3FZVA 2HOEA 1MDMA 2PBIA 3G73A 5DCMA 3RKYA 2IA2A 4MEXF 4HX4A 2JZYA 4PY5A 5ERIA 4HSRA 4RAYA 5J8FA 5FGMA 5FRNA 1P4XA 2HGCA 1HA8A 3AFHA 1VTOA 3OYCA 1T0FC 1X1CA 2VJ5A 4S04A 4EATA 2LF7A 5KNLA 2NOZA 1G8XA 4E7SA 3GUDA 3WTVC 3TKYA 4BYYA 2P5VA 3NQOA 3AKZA 4ASNA 3ZMZA 1HKTA 4HW0A 1W5SA 5FFXA 3SFZA 4Q47A 4MNUA 3GX4X 1LJ9A 3I71A 4L18B 1VTNC 2RDPA 2K3PA 2DPDA 4ESFA 2V26A 1QN9A 5BQTA 2HKOA 3HUGA 3HRUA 5KVRA 2W57A 2V9KA 2QUFA 4CGZA 1HW2A 3KX2A 2IPQX 2J5PA 3QYEA 1FP2A 1SAUA 1TQPA 1J7KA 1PYVA 1FMWA 2VB6A 1ZLJA 4IPAA 1Z05A 2DW4A 3FM5A 2W7NA 4CCLA 4NQWB 2Q2EA 4BL0B 1IN7A 3E0JB 3DEEA 3TL4X 1K78A 3L9FA 1TZLA 4QPOA 2V79A 2R7WA 2KIMA 3EIKA 2Y0MA 4UHTA 1SFEA 1KU9A 3HYIA 2K9MA 2ESHA 3K70C 1GHCA 2NOLA 1X4OA 2VJ0A 4N0BA 4RM2A 1MJBA 3W2VA 4HBLA 4RGSA 3PFYA 2IGOA 5EEGA 1YE9A 3PSIA 2L3DA 4HOBA 4HLXA 2DT5A 2OA4A 1LEAA 5ICCA 2FXAA 3TBIA 2LF8A 5IT3A 3I0WA 3FXRA 4CYDA 2JSCA 2M8EA 4M9ZA 4EJYA 2FBKA 2EA2A 2FMLA 2XF7A 1J09A 3GWZA 4B8XA 4A0YA 1FBSA 5KHDA 1O3TA 3IWFA 2HDCA 5KK1A 4D9JA 1WRJA 3B02A 4GCVA 2RQPA 3OS0A 1QN4A 3CUQC 2R7UA 4RGRA 3LFKA 1ZRFA 2JVHA 1TLHB 1TBAB 4LK0F 1KONA 3ABUA 5CPRB 2FGTA 4F7ZA 2HEOA 3ZN0A 3WTZA 1Z7LA 2QBYB 4PDKA 3KP5A 3DWLE 4H0EA 1TNTA 2STWA 4Q11A 4XBFA 4ENKA 4JK1X 1KA8A 2XUBA 5ICEA 4II2A 2PN6A 3TGNA 4D0PA 4BDYA 1S3JA 1D8JA 3GF2A 4IRIA 4ZDLA 3E6MA 1EA3A 4U7DA 1ZREA 2HWVA 1YFHA 3OR2C 2YR2A 4C2TA 5D5WB 1W4MA 3M9AA 1GLNA 1X1DA 2GWRA 4OIQF 3OOPA 1BC7C 2MJ7A 1CDWA 4CCOA 3MAJA 5FFZA 2VE8A 2VT2A 2ZFWA 4Y13A 1KGSA 5CVUA 2IGKA 4MQ9F 4HQEA 1HXDA 4XRFA 3BG7A 2A3SA 1JHFA 2VXZA 2W24A 1KU3A 2NNNA 2H6CA 1WI9A 3DLAA 2FUG2 4HX8A 3KP6A 3ZMUA 4E7IA 4KA4A 3REOA 5CQGA 1I6XA 3HC7A 4XSZF 1KYWA 1QZYA 2Z16A 3I5UA 2NOFA 1FBUA 4B09A 1N3CA 1R00A 3OYHA 3N89A 4F93B 1X3UA 3H35A 4ZYGA 3MKYB 4RB0A 1XMAA 3WTTC 2D0CA 3VYRB 2A5WA 3KE2A 1QBJA 1AISA 2R7VA 1ON2A 1YG2A 1IN8A 2HPIA 3BPXA 2O6GE 3JAMZ 3VWBA 2GOXB 4PFOA 1YQLA 3HHHA 4CHUA 1T2KA 5D8LB 4AYBA 3DP7A 2PMHA 2QVOA 2RC4A 4C9YA 4AIJA 2M0MA 2WADA 3FKJA 2HVSA 3J80K 3GBGA 5HLIA 3U9GA 5D4RA 1DGRM 3C2GA 1LDKB 3C7JA 5ICGA 1ZGAA 2DU9A 4G9YA 3E1SA 4BE2A 3BROA 2BV6A 2DO7A 3DPLC 1W7PB 3IKVA 1QNBA 1E42A 3K1NA 1EV7A 3F6VA 3MMYB 3DXJF 4FX0A 3OSMA 2X0LA 3E6DA 3N97A 3DU6A 4UUVA 3JW4A 1MJAA 2ZMEA 3K4MA 1BR1A 3T1BA 4BAYA 5H6RA 5LBQA 3ECOA 3FBNB 1HQCA 2IRFG 2R7RA 2AS5F 1LDDA 1ZHFA 3KZZA 4P5OA 5JHFA 4YFNF 3L00A 2CMPA 3SQNA 3EUKL 3BJ6A 1OR7C 4ZYDA 1F4KA 1STZA 2WY8Q 1B59A 4ESBA 3FXQA 4ZJZA 3IH7A 3E6BA 4LLGF 3IUOA 3M8EA 2LAEA 5DCFA 2DAOA 3PUBA 1YQRA 2I5WA 1J59A 1N78A 3RIRA 2IS2A 3R4KA 1QQIA 2L4AA 1CF7B 4HYEA 4AVPA 4U0WA 3E5XA 3I4PA 2E5ZA 4DBRA 3OYJA 3GFJA 3WU0A 4UXNA 4WX9A 4DGWB 1OPCA 4IJAA 3KLNA 2DJIA 1HSTA 3HHGA 2JPCA 1DDNA 4B44A 3PQJA 3RDIA 3S2WA 4ENNA 3RJPA 3HUGB 4CSWA 3IRRA 3BOQA 3MWMA 4A12A 1K6OA 2LOOA 3BWGA 1QHHD 5K5OA 4GXOA 2HTSA 3KLOA 4D1QA 4KDPA 2AXLA 5CVIA 3P9IA 2X4HA 4BQAA 4OU0A 1QNTA 3R61A 1DPUA 4Y3OA 5IYDP 2Y48A 3HSEA 2RREA 3LQRA 3M8FA 2LH9A 4DJAA 2HS5A 1DQUA 3L7WA 1PUEE 3MD2A 3FDYA 5A2QZ 4CZCA 2KPMA 3I58A 1WJCA 2X6YA 2XF6A 3L2QA 2E5NA 2CH0A 1S7OA 1YW8A 4BJ6C 4ETSA 2M7AA 1Z91A 4KN7X 1BI1A 5H20A 4XLEA 2MD5A 4LFUA 3GZ5A 6PAXA 2BBYA 2VJIA 4HF1A 2Z2SB 4EM2A 1O3RA 4A5MA 3F9KA 2YSRA 4HV5A 3IHUA 2Z99A 1TBPA 3GVAA 1P92A 3OYIA 3V7SA 1LVKA 5L3EA 2KQRA 1LEBA 3DTKA 1UT4A 5ED4A 3MCZA 1PDNC 3VSKA 4EJUA 2X85A 4P9FA 3OYKA 4UVBA 3OIPA 2R7SA 4R8HA 1LB2A 3ULXA 2VJ4A 3ROUA 5F6FA 4BQNA 2KRCA 5FROA 2L2OA 1YW9A 1G3TA 2MH9A 2LBFB 2KJBA 2JRTA 4KIFA 2CFOA 3GYHX 4PJLA 2G7UA 2O3OA 1R1TA 5LGTA 4RGUA 4I0AA 3TDZC 3HS9A 1B1BA 1ZG1A 3LA2A 4GO1A 1FMVA 1IRGA 1NG7A 5LFAA 2IA1A 4H4KC 2P7VB 4BXUA 2P5LC 2NYXA 2LY1A 2GIVA 2VC0A 2GQQA 3VN5A 1WJBA 1MD0A 2HU9A 2VBZA 3VFZA 3OR1C 2A61A 1QNAA 4F55A 3OL3A 5FD5A 4O3MA 5FLXZ 3O2PE 4B3XA 3ASMA 5LEJA 4ENMA 5HNHA 2JTVA 1RIOH 3DEUA 1R7JA 2V6EA 2HZDA 5BPDA 4R1HA 3SYTA 4AVZA 2DQLA 2HFHA 4M6XA 5ICFA 1L0OC 3BPVA 3GFLA 4BQOA 1R1VA 1O3QA 1B9NA 3K4KA 4RS8A 5E8IA 4AU7A 1XN7A 2I8DA 3C3WA 4L5JA 1WKMA 1O7LA 1NH2A 1ZYRF 3VOEA 1SD5A 1FWZA 4HA8A 1MNEA 1HKSA 4OIRF 2IS1A 3MZYA 2CW7A 3EQLF 3SHFA 5DDGA 4LB5A 2ZO4A 3OIQA 2VE9A 2IVMA 3LL7A 4LG0B 1SFKA 4OAYA 1QZZA 1WJEA 3P7NA 2EB7A 3BLYA 4K2EA 1W80A 3K69A 1W36D 3QYBA 4XL9A 3FMRA 3KEOA 4E7KA 1KU2A 5E18F 1R6RA 1EBMA 2NOHA 3K1PA 3EUHA 2VC1A 1D0YA 3J7AO 4F92B 2FBIA 4ZC3A 4E6KG 2E1MB 2LG4A 4LIVA 3V4GA 2X1CA 4XN3A 3E97A 2RN7A 5DD4A 3ZN1A 2A07F 2PMZA 5TGTA 1KYUA 4JOMA 3T8TA 3F21A 2K7LA 2IP2A 1OYIA 1KQ8A 3RPQA 1G3SA 4IQJA 3LSHA 4PUSA 1XDSA 1UT7A 3O3KA 3OMYA 2Z8UA 4N4NB 4M72A 3DU5A 4G7OF 1YQKA 5AIQA 4XNFA 1Z7UA 2ESNA 3F23A 4L9TA 1QNEA 5AN4A 3KEQA 4O5VA 1KO9A 5LHHA 2DOAA 3KP3A 1OR7A 3QU3A 1E0EA 1QHGA 2VXDA 2ZSHB 3TO6A 4XORA 4ZDPA 3JSOA 4BDZA 1H9GA 3WTYC 3CDHA 1JHHA 1IW7F 1YW7A 2JUGA 2UZKA 4BACA 2M87A 4XKCA 2R4GA 3VYUB 1IXCA 3QAHA 3Q9VA 3A2KA 2MD0A 2IS4A 1QU3A 3OSTA 2PQ8A 2VT3A 5HS7A 2NOBA 1UHMA 3SEQA 1WJAA 1YS7A 2LYCA 1IXRC 4MEYF 2WTEA 1MMAA 1YQMA 4JBAA 1K78B 1B6AA 2PFBA 3OYEA 4XLNF 4I98B 1Z9CA 2V1XA 4E7ZA 2DCEA 3VYTB 3QODA 1QPMA 2VN2A 3JSPA 4NNJA 1VZ0A 1CGPA 2R7TA 2ZMEB 3LQQA 3F72A 3WGIA 1ZELA 4OWRB 1U5TB 2VBYA 2RQQA 3PL8A 1X4PA 3HG9A 1TQIA 2DFIA 5LRRA 1Z6RA 1Y56A 4ZZLA 3FHNA 2QWWA 5LHGA 4MTDA 2XSJC 1W7PA 2UV1A 2R7DA 2KKOA 3ZPLA 1HBXG 4BJTA 1D0ZA 1LKXA 4IXAA 1ZRDA 2VLAA 2IA0A 2IV9A 2R7QA 5JI6A 5DV5A 2DPUA 2EFPA 2UUZA 3K1MA 2KP6A 2MZ8A 5J8CA 4XMYA 4Q5SF 3EETA 4G6DA 3V8KA 2M4KA 1FZPB 2XAHA 5FO5A 5EEHA 1D3YA 1H9TA 1D1AA 3DKYA 2BYVE 2R3SA 1FSHA 2F5EA 4KJZA 4I8OA 4MGRA 5DD8A 1V5FA 3V7CA 2HQAA 3BP8A 4EJVA 2XDVA 5FLXK 2VQCA 4DOZA 2D1HA 2WY7Q 2GZWA 3MQ0A 4KFCA 2HR3A 2YH5A 2LSOA 1X19A 2Z1DA 5K1YA 2WC2A 4F52A 3I53A 4ON0A 3RYPA 3OYDA 1FY7A 1XGNA 4L9NA 4B47A 1S29A 3CP8A 4S05A 1M3HA 1ULYA 1TTYA 2EFWA 3OYFA 3J81Z 2VBXA 1P2FA 1U5TA 5HLTA 4XLHA 1U0JA 2A6HF 3DQVC 3N4MA 3WTSC 3PNTA 4XN0A 1JGSA 2PJRA 2F5DA 2FOKA 3TOAA 1XGSA 2EV5A 2XAJA 1C0WA 2XVCA 3Q5FA 1B9MA 2VASA 4EVIA 2LY2A 1Z6TA 3BCBA 3SZTA 3BY6A 3WG9A 2A68F 4YG2F 1QO0D 1XSXA 5LRSA 4HEA2 4FT8A 2VODA 2Q8KA 2KJCA 2K9LA 5D6FA 4XLFA 4Y17A 4BS9A 1XB4A 4BE0A 4ZYEA 3KETA 3CP2A 2ZXHA 2BW3A 3VEPA 2DK8A 2UXXA 2WAQA 1V5GA 2KLOA 4RLFA 3AAFA 1VTLE 1BOBA 1MMDA 2VQHA 3SEZA 4QPQA 4KITB 1HKQA 2ZFUA 1LNWA 3BCAA 2X6WA 5LHIA 3CF2A 4Q4ZF 3T0YA 3FWEA 4LMYA 4Z2YA 2F4IA 2KIFA 1IAWA 1N77A 3TQNA 1FYKA 2Q0OA 2AQEA 4RODB 1EH8A 2ZSIB 4PGGA 4KMFA 1MZBA 1TW2A 1YS6A 5LD2C 3L2WA