3DPTA

Cor domain of rab family protein (roco)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
298
Chain Sequence
SWIKVKEKLVEATTAQRYLNRTEVEKICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLNTSALGYILNEEQIRKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIDNEPEITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLDVKEFIPLPGHPDELVEYKELLGLEKMGRDEYVSGKLEKVFSVSKMLDSVIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Roc-COR domain tandem of C. tepidum, a prokaryotic homologue of the human LRRK2 Parkinson kinase
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Signaling protein
molecule keywords Rab family protein
total genus 87
structure length 298
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16095 COR C-terminal of Roc, COR, domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dptA01
1.10.10.2200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dptA02
3.30.310.200 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3dptA03
3WTYC 2Z99A 1MJBA 3GO5A 3BPXA 1W4MA 4JBAA 4RB0A 2IA2A 2VXZA 2H27A 5F1RA 5ILVA 3CUQB 3TQNA 5F6FA 2YU3A 4N0BA 1BM9A 2L3DA 4XBFA 1DP7P 1TLHB 3KP7A 3KEQA 3P7NA 1G3SA 2H6BA 2O3FA 3G73A 4BQAA 1IUYA 1A04A 4RGXA 2V1UA 1HQCA 3FHZA 1P4WA 1XGNA 5L3FA 4ZH4F 4ESFA 3IHUA 2IPQX 1AWCA 1TTYA 5A2QZ 4QLCU 4A6EA 1QGPA 4NQWA 3F8CA 2IJLA 1FX7A 2O03A 3JW4A 2BGCA 3RKYA 1TBXA 4B8XA 5HS9A 5LHHA 5D4RA 3TKYA 2YX4A 2DK8A 2Y75A 2ZMEB 2VOOA 1O57A 1I5ZA 1HKQA 1TW3A 1KYWA 3BY6A 5FFZA 3ZMZA 4HX4A 1D8KA 4CXFA 1G4DA 3WE2A 1BIBA 4L5IA 5BMZA 4AVPA 2NS0A 2W24A 2CSOA 1KQ8A 2BYVE 2DT5A 4CDGA 3PQKA 3CUQA 2E1NA 3GX4X 3RPQA 4AD9A 2IT0A 4IXAA 3HYIA 3E5XA 3QOPA 4CGZA 4PZJA 3PFIA 2K7LA 2UZKA 3GFJA 3ABTA 3DXJF 1IN6A 2GIVA 1Z9CA 2Y48A 3NEUA 3HSEA 2AS5F 1TNTA 2JT1A 4KN7X 3VOEA 4PGHA 4P55A 2STTA 1S8NA 5D4SA 4OIRF 5IT9K 4NB5A 1R5GA 2D1HA 3CUQC 2XKPA 1U3EM 4MGRA 3IRQA 4HZFA 1I1GA 4N9IA 1O3TA 4ASNA 1F4KA 4ZZLA 3BPVA 5LEKA 1R23A 1BN5A 1GVJA 3F6VA 2MC3A 2ADUA 4ENJA 1J7KA 2FE3A 3RDIA 3COAC 2KRFA 5DYMA 3HSFA 2STWA 5AIPA 3IL2A 2VBYA 1S7AA 1YQAA 5BPDA 1FT9A 3HIFA 1TQIA 5FLXZ 4GCVA 4KICA 4BHBA 1G3YA 1ONVA 2K27A 4ON0A 3F3XA 2ZFWA 5D5VB 2M87A 1T2KA 2XKOA 2EFQA 1QBJA 2DQRA 3GYHX 2QWWA 3QP5A 3DF8A 3M7GA 3CO7C 4KA4A 4BAYA 3I5UA 3ZMUA 4EM0B 4UVCA 2O8XA 1B4AA 1G6NA 4I2OA 3DKWA 1ZRCA 3FM5A 1RZ4A 3RIRA 3T8TA 4G7ZF 2WV0A 4HA8A 3W6KB 3LA2A 4I0AA 3J81K 3ZN0A 5IT3A 3CJNA 2HWVA 6PAXA 1WI9A 2P4WA 2TDXA 2LNBA 3V7CA 1U78A 3T1BA 4L0YB 3RYPA 4G6DA 4KT5C 4MNUA 2HTJA 2VE8A 2QZ8A 4CYDA 1XMKA 2J5OA 3GFIA 2QM3A 4XLPF 1S29A 2A68F 4FHTA 2ETHA 1L0OC 1DPUA 2FBIA 2R3SA 5DD4A 4O6JA 3DEUA 3BWGA 1FPQA 3B73A 2Z9OA 1E2XA 4IF4A 3F22A 4EJOA 2ZXJA 1D3YA 1EH6A 2OQRA 1ZLKA 4R1HA 4ZYHA 3MWMA 1W7PD 2A6EF 5HVQC 3C1DA 1V3FA 3R6SA 5LLQA 1BC8C 5LGTA 1RNLA 3KP5A 1KQ0A 2XAFA 3EYIA 1P4AA 2CGPA 2KJBA 4WK8F 5BPIA 1R1VA 2VT3A 3FX3A 4HYEA 4G7OF 4IHTA 2KIFA 2L4AA 3JAMK 4KFCA 3GFMA 3DV8A 1FBQA 4HX8A 4YFNF 1ZN2A 1DPRA 5D6EA 3I58A 3HUGA 3ABUA 5HDNA 1XDUA 2PBIA 4BH9A 1F1ZA 2M45A 3IKTA 1YS7A 3M8EA 2VONA 3ROUA 2WTEA 3PQJA 3LWFA 5DD8A 3WTSC 1H9TA 3ZMVA 3ZMDA 2JTVA 2DPUA 5LBQA 1SD4A 1R1TA 1ULYA 2FMLA 2GA2A 2ZKZA 4LJZF 5HLHA 4RB2C 3ISPA 2WWYA 2G7HA 1IRGA 4G8XA 1O3SA 5HS7A 2PFBA 3BOQA 4ZYDA 4Q48A 3E5QA 4MQVA 2NRAC 1Z6TA 5D8LB 3SXYA 1IRFA 2RKHA 2L4MA 4QWQA 4RAYA 1ZREA 4UNOA 3MAJA 1J0RA 4ENNA 1I27A 1F9NA 1T39A 5LRSA 4OIOF 4GYGA 1H0MA 3M9AA 5BS6A 4OU0A 1Z05A 5IT9Z 3O3KA 4P96A 2XASA 1CF7B 5DCMB 3FXRA 4A0YA 3GWZA 3JAMZ 3IRRA 4WXDA 5TJJA 1EV7A 3K1NA 5DCMA 1OYWA 2F5EA 3FZVA 4HLXA 1R58A 3S2WA 4RB1A 5FB2A 1DUXC 1U5TB 3ZQ7A 5JVTA 4EV0A 5E8IA 2OZUA 3TDZC 2O6GE 1IW7F 3IWZA 1HKSA 1FSEA 4U7BA 2VODA 1WKMA 2K4BA 2OD5A 2GA1A 4AIJA 3F23A 4HDUA 3WGIA 5LGNA 4KDPA 4EJTA 4KYWA 1WRJA 3JSOA 2HKOA 1ODDA 3ZN1A 3IC7A 2DFIA 4I01A 2V9VA 1W7PA 4JK1X 3VODA 1G3TA 1ZRDA 4EGZA 1KA8A 1U8RA 3RKWA 2CQKA 5LHIA 4WWCA 2XVCA 4CZZA 4A5MA 1B6AA 1REPC 1XCVA 4HV5A 1USSA 1YTYA 2W57A 3FMSA 2P7CB 3TO9A 1JHFA 3HHHA 3H92A 2RN7A 4UHTA 4M71A 4PGGA 3ZP5A 2CWEA 1QPMA 2ZNZA 2MA3A 4M74A 2G7UA 4OINF 3RYRA 4ZYEA 4F7ZA 1IAWA 4IVNA 4OOIA 1BJAA 4WXCA 1KYZA 1J59A 2FBHA 1UB9A 2XAQA 4O3MA 4HF1A 5D6FA 5D5UB 2XIGA 2CYYA 2FNAA 3R0JA 1BBYA 3L9FA 5L3GA 3R61A 4AIKA 2EV6A 3K1MA 2GAUA 2HYFA 1X3UA 1R22A 4KUMA 5TRDA 3V7RA 4YIFA 2IW5A 1USTA 1D8JA 2K4JA 2XV4S 3MZHA 3GEZA 3V8LA 2JPBA 4ENMA 4ENKA 3WTXC 2X0LA 2Z5UA 1MJ9A 3TOAA 3F21A 1S6LA 2FEZA 1LDJA 2X4HA 2ELHA 4GO1A 2DK5A 3KP2A 5A2QK 4I02A 5E1XA 2COMA 3K0LA 1LB2A 1HKTA 2XRNA 2J5PA 3BJOA 4MTEA 3U2RA 1XGSA 2CO5A 5BOXA 3KETA 2FU4A 4RGSA 1O3RA 2RGVA 2CG4A 3I53A 4LB5A 2QBYB 4Y13A 1K79A 2HQNA 3WTUC 2FSWA 4Q5SF 3J80Z 5D8KB 4LG0A 2DO7A 4AWXB 3B02A 4G9YA 4U0WA 4L5JA 5L3BA 1KGSA 1XDSA 2EWNA 2FXAA 3N4MA 1BI2A 3KZZA 1O7LA 3OOPA 2NAZA 2V1DA 1T98A 1K78B 4Q4ZF 1KU3A 5DUIA 2RC4A 2EFNA 2K86A 2Z33A 3GFLA 1XCBA 2H94A 1U5TA 4PDKA 1LEAA 3T0YA 1OYYA 2B0LA 2YR2A 2LSOA 4UV9A 3V8KA 5DCFA 2DLLA 3CLOA 3CO6C 4HOBA 5FD5A 4R79A 2EJRA 2FMYA 5K5QA 1BC7C 1HW1A 3GW2A 1UHWA 2BBYA 1XD7A 1SFUA 1ON1A 5FLXK 1QZZA 4A5NA 4FT8A 1Q1HA 2V1XA 5LEJA 1LJ9A 1YFHA 2MBFA 5HS8A 2L02A 3I59B 2NYXA 1J2XA 2IRFG 1XN7A 3FXUA 1EH8A 1T0FA 4Y17A 3GXOA 1TQMA 2OA4A 1PUEE 4DQ2A 3ERED 4BXUA 5HDGA 4P5OA 2KKOA 1FBSA 3K2ZA 4HBLA 3V8JA 1K7AA 3KLOA 4OIQF 3WTWC 4FX0A 2DQLA 4I98B 1TW2A 2ACJA 3QU3A 1MGTA 2AXLA 2H6CA 3DP7A 1K78A 5CVVA 2JRTA 1IF1A 4TV7A 4LK0F 4EJUA 2FOKA 4U7DA 2OZ6A 2LF8A 3MQ0A 2EFPA 3GUDA 1UCRA 4LLLA 3R4KA 3MFKA 2YX7A 4UXNA 3LSTA 3GZ5A 5HLIA 4S05A 5E8GA 3GLXA 2LKPA 2W85A 3REOA 3E5UA 2W84A 3HRUA 4DNCA 1P92A 4D0PA 3O2PE 3K9TA 4P9FA 2IVMA 3ZMSA 2RQPA 3T5XA 1IN5A 5H6RA 2QQ9A 2VT2A 3TO7A 3R60A 1FP1D 3V4GA 5H20A 3KFWX 4CICA 2EK5A 1MDMB 1XGMA 1MZBA 4XSXF 3EUHA 1MKMA 2BV6A 2ZMEA 5DDGA 3SZTA 1R00A 2NNYA 4KIFA 4RS8A 4RB3C 1ZRFA 2YSRA 4BYYA 3DFGA 2L01A 1G3WA 2H09A 2UXXA 5HLGA 3C7JA 1V4RA 4JQFA 4GGGA 5E17F 5FD6A 3E3VA 5E18F 2FRHA 2KIUA 4OIPF 2D2WA 3KEOA 4BNCA 2OQGA 1IN4A 3CDHA 2EA2A 2PN6A 3VB2A 2E7WA 5CLSA 1R5HA 3LQQA 2F5CA 2ZJ2A 2M5WA 2VN2A 1HSJA 3L00A 4OMZA 2GXGA 2Y0MA 1U2WA 2HFHA 5ICGA 4U0YA 3TGNA 4U88A 3FMQA 3BP8A 3O6BB 2FF4A 3GVAA 5DUKA 1ON2A 1XSXA 2XROA 4LGWA 1IN8A 1HBXG 2KIMA 1E17A 1B9MA 1FY7A 3L2CA 1QNTA 1YS6A 3WE3A 1FZPB 1ZG1A 2OAZA 3ECHA 5FGMA 3FF5A 2IP2A 2LF7A 4G6QA 2V6CA 1YO5C 3J80K 4HDVA 4ZYGA 3CTAA 1IZ1A 1Z1DA 4NHJA 4PCQA 5J8CA 4EMSA 3WTTC 5LRRA 1OR7A 1ZARA 1W5SA 5JI6A 3RTRA 1KU7A 4HV6A 2DPDA 1XMAA 4LG0B 2IA0A 1R7JA 1ZG3A 2UWMA 3F8MA 3WGGA 5ICFA 3ECOA 2HQRA 5DV5A 4KNYA 3CUOA 5LHGA 2RDPA 1KU9A 4KN4X 2VBXA 1HW2A 3EETA 3QP6A 2P5KA 1PDNC 1QO0D 1FSHA 2HKXA 1Y0UA 5AIQA 2XAGA 3WTVC 5EEHA 3SZPA 3MEXA 5L3EA 1SAXA 1AOYA 1Z91A 1C0WA 2A6HF 4ESBA 3C3WA 1QZYA 2JZYA 4IRGA 4FX4A 1RI7A 3M1EA 4MEXF 1J5YA 3DPUA 1ZAOA 2M1BA 2UXNA 2HR3A 3F6OA 1FLIA 1VTNC 5CVIA 2O0YA 3Q9SA 2LDUA 1RIOH 1GXQA 1YG2A 2R7DA 1JGSA 1XB4A 5F64A 5ILSA 3F8BA 2P6SA 3P9KA 5J6XA 3NQOA 2ESNA 2QBYA 4XRFA 4WX9A 1SD5A 4HF2A 1PP7U 4HLYA 2F2EA 2PI0A 2P7VB 2XGXA 1TNSA 1SFXA 5JFRA 3WU0A 1H9GA 3L7WA 2QVOA 2PG4A 4WCGA 5KK1A 2HDCA 1QQIA 1ZH5A 3KCCA 4KMFA 1U5TC 3I64A 4YFKF 5E1ZB 1FC3A 4IHSA 2HYGD 5CJ9A 2A3SA 2G9WA 3GF2A 1ZGAA 4EM1A 4O5VA 3F8NA 1GHCA 2FBKA 2ESHA 2FQ3A 2ISZA 3ZPLA 1R36A 4IRIA 4CHUA 1Z7UA 1FYKA 1ZLJA 3HRTA 4I0BA 1W5TA 2EFWA 1CGPA 2O61A 2PQ8A 3LAJA 4A0XA 2VC0A 1W7PB 4RGRA 2V79A 4I09A 4EJWA 3BJAA 3KP3A 2ZNYA 4S04A 3D0SA 2QUFA 3C18A 4U0VA 5KVRA 4UVAA 5H6QA 3QRFF 3JTGA 3RJPA 2OU2A 2A5YB 4ESJA 4WF2A 2GXBA 1FNNA 4IPAA 4MHGA 3L09A 3LA7A 5AONA 2HTSA 4LD5A 1FYLA 2WC2A 4RAZA 5ILUA 3DQVC 1R1UA 1YW8A 1WQ2A 3KLNA 4LMYA 2VBWA 4HQEA 2A07F 2R7FA 3WODF 4KIGA 4EQQA 2DAOA 3F72A 1SD7A 2RV8A 4A0ZA 2DBBA 1ZHFA 3HRSA 3I71A 3RKXA 3E97A 2MLGA 1FOKA 1LDDA 3V7SA 1XGOA 3J7AO 1IXSB 5ERIA 1J9IA 1B59A 2M30A 5FFXA 2PMHA 2IA1A 3E6MA 3I0TA 5K1YA 3E6DA 5CYVA 2RNJA 3IWFA 4L9VA 4BHPA 1WWXA 2A61A 1K6OA 5CVRA 2HGCA 2P8TA 2QQBA 4YIIA 4HW0A 4EVIA 1JXSA 3WGHA 2GQQA 2MLKA 2JPCA 1LQ1A 2MD5A 2P6TA 3QPHA 1HXDA 2VE9A 3F8FA 1S7OA 3RI4A 4YFXF 5JR3A 3Q5FA 1YW9A 4KIBA 3KE2A 2Q0OA 3E6CC 3SQNA 4UUVA 3H3UA 3LFKA 5K5RA 1IXRC 4GYIA 2EV0A 3U1DA 1SD6A 4G7HF 3FM3A 2PEXA 1BI0A 4LK1F 1STZA 3JSPA 2NNNA 4EJVA 2CFXA 3HTSB 2MH9A 3HSRA 4M9ZA 2HS5A 2CW0F 4M9XA 5LGUA 2W25A 1PP8F 2GZWA 4A2UA 1MD0A 3Q9VA 4XSZF 2Q8KA 2E7XA 3LAPA 1SFEA 3NRVA 4B09A 5BQTA 1XSDA 3I54A 3LA3A 4K2EA 2DI3A 3DPLC 3BZ6A 2K02A 2XAHA 3RPUA 2EA4A 3EDPA 3ZMTA 3VEPA 3BJ6A 1BIAA 2RVCA 3E6BA 1BI3A 3TDUC 1D5VA 2A69F 3HRMA 1OYIA 5D5WB 5FO5A 1P4XA 1YYVA 5K5OA 5ED4A 2JSCA 3VFZA 1B9NA 4I7HA 1FWZA 3IKVA 1L3LA 4N9HA 3GZ6A 3ELKA 1P2FA 3BDDA 2FNPA 2EFOA 2BEOA 3WU1B 3K1PA 3KP4A 4MEYF 4HF0A 2D45A 2QLZA 4UVBA 2ZO4A 3P9IA 5JHUA 3ML6A 3QAHA 4L18B 3HTUA 5J8FA 1B1BA 2QENA 4YG2F 3HOSA 4M6YA 4LLNA 2GWRA 3T8RA 5HDKA 4LFUA 3P9CA 2VC1A 1I1SA 5E1WA 4M9SA 5EEGA 3MZYA 1LVAA 1P6RA 1IXCA 2QQAA 1WSUA 3WTZA 1BOAA 2HZTA 3HOTA 1LEBA 1T6SA 2YPRA 3AAFA 1SMYF 2XUBA 1YLFA 3N97A 4R8HA 3H3ZA 2PLYA 2P5VA 5L3CA 2HEOA 1KU2A 4MTDA 1MJAA 1EH7A 4Q47A 2P5LC 1F5TA 3KP6A 2QYOA 2HOEA 4P9UA 4ZZDA 1BI1A 4L0ZB 3SHFA 4LB6B 2EV5A 3JTHA 5HOOA 4OMYA 2F5FA 3DPTA 1OKRA 4ETSA 4L9TA 1S3JA 4CO8A 4M72A 4EGYA 1T38A 2ZBKA 2PMUA 1I6XA 1XSVA 2E1CA 4WXHA 3FMRA 5E20A 2M8EA 1JE8A 3G3ZA 5ICEA 2KJCA 5CVJA 5L3DA 4UV8A 1JHHA 2XAJA 1RUOA 2DTRA 4AIHA 5DEQA 1YIOA 3R0AA 4GXOA 3MCZA 1IN7A 2XHKA 2ISYA 1NHAA 2BE5F 2OBPA 2F5DA 1KQ9A 1HSTA 2C6YA 3TOBA 1YW7A 2D1VA 3QU6A 3ULQB 1O3QA 1RUNA 3EQLF 4BHCA 2Q2EA 4Y15A 4MQ9F 5CVUA 1OMIA 1FP2A 1Z6RA 3WG9A 1OPCA 3U9GA 3TO6A 1GXPA 3LQRA 2DU9A 4KMUX 4A6DA 1CF7A 4M6XA 3I4PA 3OV8A 3BROA 2PJPA 3QPTA 4L9NA 2EB7A 3I59A 2L54A 3EYYA 1ZG5A 1U6GA 4XLNF 4EM2A 2DW4A 1ZGJA 5ICCA 4L9JA 2ZCWA 1ZYRF 4Z2YA 4HQMA 4H0EA 4HX7A 1J75A 3FXQA 4M73A 4A12A 4HAMA 4E70A 4IJAA 4LLGF 1UFMA 1SMTA 2Z3YA 1DDNA 1UHMA 3FWEA 3D5LA 1FYMA 4IRHA 1HW5A 2VBZA 3HHGA 4G94A 3K69A 3M8FA 4RGUA 2VOPA 5D5XB 1TQPA 1MDMA 1LDKB 1FBUA 2FA5A 1O7FA 3KZYA 3SFZA 1LNWA 2MH2A 3W6JB 3J81Z
chains in the Genus database with same CATH superfamily
1OCCH 3WTYC 4KISA 4GFBA 4NNJA 3IAS2 2DOEA 2Z99A 1MJBA 3GO5A 3BPXA 1W4MA 4XR6A 3CCMI 4JBAA 1YE9A 2CJJA 1UAAA 4RB0A 2IA2A 2VXZA 1ETKA 3D5SC 1LVKA 1LE8B 2H27A 2VKDA 1H8AC 9ANTA 1Z21A 2WB1N 5F1RA 5ILVA 3CUQB 3TQNA 1ZELA 5F1JA 5F6FA 3F10A 2YU3A 4N0BA 1BM9A 2L3DA 2CUFA 3ZRGA 4XBFA 1DP7P 1RR8C 2ZSIB 1TLHB 3T4NA 1U8BA 4IHWA 2PWWA 3KP7A 3KEQA 3P7NA 1G3SA 2GM4A 2H6BA 2O3FA 3G73A 2CV0A 4BQAA 1IUYA 1Y1VJ 5JN5A 5GAGJ 1JI8A 1A04A 4RGXA 3DKYA 2M34A 2MFZA 2V1UA 5EDNA 1HQCA 4AM3A 4M3DA 2DKDA 3OS1A 3FHZA 1P4WA 3OIPA 1XGNA 5L3FA 4D1QA 2NVQJ 2DN0A 5IP9J 4ZH4F 2JHJA 4FISA 4DW6A 4ESFA 2Y8LA 3IHUA 2AQFA 4Y4RA 3OL4A 2IPQX 1AWCA 1TTYA 5A2QZ 1QHHD 4QLCU 4HRIA 4A6EA 2LLKA 3A03A 3OYEA 1QGPA 4NQWA 3F8CA 2IJLA 1FX7A 1K4SA 2I5UA 2O03A 3E7LA 2Z2SB 4XL9A 3DCFA 3JW4A 2BGCA 1VQ8I 2R7TA 3HS9A 3RKYA 1TBXA 2E2IJ 1G59A 4IX7A 3OC3C 4B8XA 2L7MP 5HS9A 5LHHA 5D4RA 4CFFA 2CW7A 3TKYA 4CCNA 2FKFA 2YX4A 2DK8A 2VJJA 3AG2H 2Y75A 3TW6A 3OCIA 2ZMEB 1YRNA 2LG4A 2VOOA 1O57A 1HLVA 1I5ZA 2H1LA 3VSLA 1HKQA 1SEUA 1TW3A 1KYWA 1JDYA 3BY6A 5FFZA 4ZC3A 3ZMZA 4HX4A 1G8XA 2OV7A 1D8KA 2DODA 4CXFA 1G4DA 3DBRB 2E1MB 3WE2A 1BIBA 1X4OA 2W82A 5K7HA 4L5IA 4B1RA 5BMZA 2KZVA 4AVPA 2NS0A 2W24A 3QQAA 1BW5A 2A05A 2OCEA 3A02A 2CSOA 1KQ8A 2BYVE 4ZDOA 2DT5A 3A0HC 4CDGA 3PQKA 5J1RA 1C4GA 3GLLA 3CUQA 3JRCA 3NARA 2E1NA 5B1BH 1EA3A 1E3HA 2IXSA 3PNTA 3GX4X 2KFDA 3MKLA 1SAUA 3FKJA 3RPQA 4V2FA 2PJRB 4AD9A 3KTUA 1PCMX 4IQ4A 1YJWI 3A2KA 2IT0A 1S5LC 4IXAA 3HYIA 5J40A 1QNAA 3E5XA 1MW7A 1UG0A 2A6TA 2RNGA 3QOPA 2LRDA 3VYSB 4PZJA 4CGZA 1MMAA 3PFIA 1PUFB 2CMPA 4BQQA 1OISA 4JX4A 2K7LA 2UZKA 1VFCA 5FKKA 1OLTA 3GFJA 1WI3A 3ABTA 3QYFA 3AG3H 3DXJF 3ULXA 1IN6A 2GIVA 2VJ5A 1Z9CA 3RPUD 2Y48A 3ZR8X 5GAHJ 2V4JC 3NEUA 3OH6A 1A31A 4MIMA 2BXYA 4BBSJ 3OYJA 2ZFDB 3OGDA 3HSEA 4EJZA 3N05A 2AS5F 1TNTA 2JT1A 5FKOA 2DFFA 4KN7X 1O4XA 2QKMB 3VOEA 4PGHA 4P55A 2ME6A 1F36A 2STTA 3DEEA 1S8NA 5D4SA 3HPGA 2JA2A 1MMDA 2DMTA 1TUOA 4OIRF 5IT9K 4NB5A 1R5GA 1LWWA 2D1HA 1K35A 2HXIA 3CUQC 5HNHA 5C44J 2XKPA 1U3EM 4MGRA 3MKWB 1X2NA 1X3WB 1QU3A 2NOFA 1AA7A 1ETYA 3IRQA 4HZFA 5CKTA 1ZR4A 1I1GA 3KYDB 2JK3A 1HC8A 3FXKA 2IV9A 4N9IA 1O3TA 3GZNB 4ASNA 2NOBA 2HVSA 4B47A 1F4KA 1D5YA 3BTLA 4ZZLA 3BPVA 5LEKA 1R23A 2E5NA 2ECCA 4BJUA 1XX5A 1BN5A 1GVJA 2DMPA 3F6VA 2MC3A 2ADUA 4CCJA 4ENJA 4B0AA 1J7KA 2FE3A 3GMEA 1X2MA 4XQFA 3RDIA 3COAC 4C2TA 2KRFA 5DYMA 3HSFA 2STWA 5AIPA 3IL2A 2XAUA 2VBYA 1S7AA 5E3MA 2TRTA 1YQAA 5BPDA 1FT9A 3HIFA 3S3MA 1TQIA 5IYDP 2CQQA 3PFYA 4I99C 4BU2A 1OCOH 1EF4A 1M1EB 5FLXZ 4GCVA 5JVGF 3BTCA 4KICA 4BHBA 2R0QC 1G3YA 4HSRA 1ONVA 2K27A 4ON0A 3F3XA 2ZFWA 5FLMJ 5D5VB 2M87A 1T2KA 2IEKA 1MP9A 2R5YA 2XKOA 3TE5A 2EFQA 2K9NA 1QBJA 3LFUA 3Q0VA 2DQRA 1IDZA 2Y30A 1K6YA 3GYHX 4IHVA 4IO9F 5KHDA 4CCLA 4N4OB 1NH2A 2QWWA 3QP5A 3DF8A 2V9JA 3CMEI 3S17J 3M7GA 3CO7C 2LKXA 4KA4A 4BAYA 5B1AH 2M2EA 3I5UA 4QTRA 2F48A 3ZMUA 4EM0B 1R4NB 4UVCA 2O8XA 4JX5A 1B4AA 1G6NA 5M5XJ 2DTZA 4BEHB 4I2OA 1KO9A 3DKWA 1ZRCA 3FM5A 3OYKA 1RZ4A 1I3AA 3RIRA 1I50J 1WJWA 1BR2A 1RKWA 5TGTA 2R7QA 3T8TA 4G7ZF 1A5JA 3LSPA 2WV0A 4HA8A 4XN0A 2KDZA 2YH5A 3W6KB 2R5ZB 2JHNA 3LA2A 2M8GX 4I0AA 3J81K 3ZN0A 3G6EI 5IT3A 1S72I 1HF0A 3CJNA 2LOOA 2JPIA 2ZFUA 3M4OJ 1IUFA 2HWVA 3BTIA 6PAXA 2KT0A 3F0CA 1WI9A 2P4WA 2TDXA 1ETVA 1NTCA 1SFOJ 2LNBA 3V7CA 1U78A 3PJRA 2Y31A 2BVLA 1QHGA 2DJNA 2HXOA 1WJBA 3T1BA 4L0YB 1W80A 3RYPA 1YQRA 4G6DA 3PUFA 3A0BC 1HDDC 2LVSA 2E1MC 3I4NJ 3H9GA 2BHYA 4UB6C 2JMWA 4KT5C 4MNUA 3JRIA 2HTJA 2VE8A 1D0XA 2QZ8A 4RAFA 3FHNA 1XG1A 4CYDA 1XMKA 2J5OA 3KPHA 3GFIA 2HOAA 2QM3A 3ESWB 4XRSA 4XLPF 4AYBN 4B3XA 1S29A 2BZTA 4BE2A 2A68F 3K7AJ 4KJZA 2Z16A 3PNYA 5C4JJ 1JUSA 4FHTA 4ROCB 2ETHA 3OH9A 2ID6A 3CC4I 1L0OC 1DPUA 1QNCA 4V19K 2FBIA 4EAKA 2R3SA 1RRJA 3W2AA 1H88C 5DD4A 4O6JA 2HDWA 1YX5A 2BW3A 3OWTA 2HQAA 4EAJA 3SYTA 4L5EA 1TT0A 2FUG2 3H35A 1NGMA 3S14J 3AG4H 1MBJA 2PMZA 5EJCA 1V54H 1YI2I 3DEUA 1RKTA 3BWGA 4Q11A 4JP0A 4C3HJ 1FPQA 2OPTA 1RR7A 5HODA 3B73A 2BHZA 2Z9OA 1AISA 1N25A 1E2XA 3MKYB 4IF4A 3KEYA 3F22A 2OJED 4A3GJ 4EJOA 3O8GA 2CS3A 2ZXJA 4XLHA 2FX0A 2M9HA 1PCZA 1D3YA 1FTTA 1EH6A 1FMWA 3H36A 2OQRA 3CMAI 2DT6A 3OR1C 1RPWA 2DDAA 1ZLKA 4R1HA 2XPVA 4ZYHA 3MWMA 1W7PD 2A6EF 5HVQC 3C1DA 1V3FA 2M4KA 3EUAA 3R6SA 5LLQA 1BC8C 2NVUB 5LGTA 1LKXA 2VXDA 3DBLB 3A4CA 2HPMA 1RNLA 2W48A 4BE0A 3KP5A 1KQ0A 2IAIA 1D0YA 2XAFA 3QWLA 3CWAA 5KAFC 3EYIA 1P4AA 2CGPA 2KJBA 2LR8A 4WK8F 4FQGA 2VT3A 1R1VA 1D1AA 3FX3A 4CH7A 5BPIA 1LE8A 2FQ4A 4HYEA 4G7OF 3CF2A 4IHTA 2KIFA 5DTDA 2L4AA 3JAMK 4KFCA 2X6WA 3GFMA 4CCOA 5EG0A 3DV8A 1FBQA 4XNFA 2XF6A 2Z1DA 3K4LA 4HX8A 4YFNF 1ZN2A 1DPRA 1KY7A 2HNHA 5D6EA 3I58A 2VQGA 3MD2A 2LKSA 2JSPA 2L0KA 2OF7A 4NUBA 1KFIA 3HUGA 3ABUA 5HDNA 3ZQLA 1XDUA 1SVOA 3SDBA 1NK2P 2PBIA 4BH9A 1F1ZA 4XOTA 1MBHA 3SEQA 2M45A 1N3AA 4ZDLA 1YS7A 3IKTA 3I0WA 3M8EA 1X1PA 3VWBA 4PJLA 2GLOA 3BQZA 2VONA 3W3CA 3ROUA 2WTEA 3PQJA 3HEFA 3LWFA 5DD8A 3GBGA 1BR1A 3WTSC 1H9TA 3ZMVA 1AU7A 3ZMDA 2JTVA 5IPAA 1R4MB 2DPUA 3CDIA 1MH4A 2K9SA 2DMNA 3BR3A 3RQ4A 1T08B 5LBQA 3D4VA 2M0CA 1SD4A 1DP3A 1M3HA 1R1TA 1OCRH 1ULYA 4RLFA 2KMUA 4W1UA 1Y56A 2FMLA 2R7UA 2ID3A 4CUGA 4ANJA 1Y39A 3L2VA 1MIJA 2D0BA 2GA2A 2ZKZA 3FBIB 4LJZF 5HLHA 3I0XA 2JVGA 4RB2C 3BQYA 3ISPA 2WWYA 3U21A 3ZGKA 2G7HA 2R5YB 3ABLH 1IRGA 2A5WA 2VL8A 2R93J 4G8XA 1O3SA 5EGOA 1ETOA 2NVMA 5HS7A 2LAEA 1UZCA 2BY2A 2PFBA 3BOQA 4ZYDA 5JHFA 2DA3A 2CUZA 4Q48A 3E5QA 4MQVA 3BG3A 2NRAC 3OSMA 3B6AA 1ENHA 1Z6TA 2RAEA 4RM3A 2KIQA 3PSIA 5D8LB 3HOVJ 4E7KA 3SXYA 3JRFA 1IRFA 2RKHA 2NOGA 2L4MA 3H5NA 1GV2A 4QWQA 1FIPA 2X6OA 2LD5A 4RAYA 1ZREA 1LWYA 4UNOA 3JRBA 2JQ7A 3MAJA 3I3LA 1P9QC 1JFIC 1J0RA 2QSFX 4NC6A 1X1CA 4ENNA 1XSZA 3VYRB 1I27A 1F9NA 1T39A 5LRSA 3J7AY 4OIOF 2XC7A 2Y69H 4GYGA 2P81A 1H0MA 3M9AA 5BS6A 4OU0A 1OCPA 1Z05A 1C9BB 5M5YJ 4XLAA 3S1NJ 4B44A 4XLCA 5IT9Z 3O3KA 2WBMA 1HOMA 3PM1A 1R9TJ 4P96A 2XASA 5HNFA 1BJZA 3DWLE 1CF7B 2VPLA 5DCMB 2X9DA 3FXRA 1JGGA 4DOZA 4BGDA 1MMSA 1YX3A 4A0YA 3CVTA 1UT4A 3PMGA 2AXTC 2FUVA 4BACA 2NVXJ 3GWZA 3JAMZ 5BMPA 3KRMA 3BR2A 3PO2J 3IRRA 4WXDA 1VQ7I 5TJJA 2OC6A 1EV7A 3K1NA 1QN3A 3CMYA 2OOXA 5DCMA 1JT0A 1VF9A 1OYWA 2F5EA 3FZVA 4HLXA 4BDZA 1R58A 3S2WA 3WHBA 4RB1A 5FB2A 2JA8J 1IO2A 1U5TB 3ZQ7A 1DUXC 5JVTA 4EV0A 1NG7A 5E8IA 2O3OA 1QTSA 2ELKA 2OZUA 3OS2A 3BT9A 1B72B 4II2A 3TDZC 1YOVB 5JLWA 3A1YA 4RDUA 2O6GE 2KL4A 4CA0A 1MH3A 1IW7F 3IWZA 2W1OA 4E7HA 1HCRA 3S15J 1HKSA 1FSEA 2VKVA 3DU6A 4U7BA 4J19A 1WH7A 2VODA 2Y0SA 1WKMA 2LTPA 5CQEA 2K4BA 2OD5A 4IHYA 2GA1A 3N89A 2MYSA 4AIJA 4LIUA 3F23A 4HDUA 3WGIA 2XPWA 3OYAA 3OIOA 3K2AA 2DMQA 5LGNA 4KDPA 3FK7A 3FISA 4EJTA 2R4GA 2WADA 4KYWA 1LFBA 1KYUA 3H9JA 1JKQC 1WRJA 3JSOA 4IEJA 2HKOA 4C2UA 2M4GA 3L2QA 1ODDA 3FXJA 3DTKA 1OQYA 3IC7A 2E19A 1ETXA 3ZN1A 2EHBD 2DFIA 4I01A 2V9VA 2KLOA 4CYCA 1W7PA 4JK1X 3VODA 5F27A 3KYLA 1GV5A 3AL0C 1B8IB 4F92B 1G3TA 2WY7Q 3JRHA 1ZRDA 4EGZA 1KA8A 4A3DJ 1U8RA 3RKWA 1QTPA 3SEZA 2CQKA 4PSWA 5LHIA 4WWCA 2XVCA 4CZZA 3V42A 4A5MA 1B6AA 3U1KA 1REPC 1XCVA 2H1KA 4HV5A 1E42A 1IRXA 2CQNA 1USSA 2CUJA 2WV1A 1YTYA 3I3WA 2MGQA 2XPUA 3PIPF 2ZJRF 1P5GX 2W57A 1ORKA 3FMSA 5FLVA 4A3EJ 1AKHA 2P7CB 3JCUC 3TO9A 2HU9A 2CQ7A 1JHFA 3HHHA 1U9NA 4XONA 3H92A 2RN7A 1WH5A 5EEAA 1VKLA 4UHTA 1TC3C 4M71A 4PGGA 3ZP5A 2CWEA 1SC7A 1QPMA 2KISA 4EALA 2ZNZA 4WXAA 1NVPA 2MA3A 3LSIA 4M74A 1W0UA 2G7UA 2JN6A 4OINF 3RYRA 1A6QA 1VQOI 4ZYEA 2XSDC 3IH2A 3Q3SA 4F7ZA 1J3MA 1IAWA 3AFHA 4IVNA 1KFQA 4OOIA 1BJAA 4WXCA 1KYZA 2NOJB 3Q0UA 2ZXWH 2HOTA 1J59A 1TZLA 2JOIA 2FBHA 1UB9A 2XAQA 2DT7B 4O3MA 3CVSA 2CV1A 4HF1A 1JT6A 5D6FA 5D5UB 1YJNI 2XIGA 1HU0A 3K4NA 2CYYA 2FNAA 3R0JA 1BBYA 5J3LA 3ZOBA 3L9FA 1W36C 1VQ4I 2HKPA 5F04A 4ZYAA 5L3GA 3R61A 1VQKI 4AIKA 3OYNA 1B9KA 2EV6A 3IAM2 2GXAA 3K1MA 2NOEA 2GAUA 1MNEA 2HYFA 2BY0A 2LY1A 1X3UA 2ME0A 1R22A 2Y0SN 4KUMA 5TRDA 4AVZA 1R5ID 1ZTRA 2BY1A 1GLNA 3V7RA 2QRCA 4YIFA 2IW5A 1USTA 3GTJJ 3S93A 3K4KA 2K85A 1D8JA 1FEXA 2K4JA 2XV4S 2K3FA 3GEZA 3MZHA 3C2GA 3V8LA 2JPBA 4ENMA 4ENKA 3WTXC 2E71A 2X0LA 2IGOA 3OSTA 2Z5UA 1MJ9A 4CCMA 4J01A 2VJIA 3EIKA 4HEA2 2MG4A 3BCBA 1WZ2A 3TOAA 2R5ZA 3L2WA 1S6LA 3F21A 2FEZA 2NVYJ 2X6YA 1LDJA 2X4HA 4RM2A 2VQHA 4D7MA 1T6AA 2DYRH 2ELHA 4GO1A 4XOPA 2DK5A 3KP2A 2DA7A 5A2QK 3CCJI 4GDFA 4I02A 5E1XA 2COMA 3K0LA 1LB2A 1HKTA 2XRNA 3HBLA 1K2YX 1V55H 2J5PA 3BJOA 4MTEA 2LP0A 3KIOA 3UNGC 3U2RA 1XGSA 2CO5A 4DYRA 5BOXA 3KETA 5J4VA 1Q1VA 2FU4A 2OTJI 4RGSA 4NC8A 1O3RA 2RGVA 2CG4A 2WAQA 3I53A 3ASNH 2BXZA 4LB5A 2QBYB 4LOCA 4Y13A 1K79A 2HQNA 4B43A 1CDWA 3WTUC 2FSWA 4Q5SF 3SZGA 3J80Z 5D8KB 2JUCA 3CCUI 4LG0A 1RESA 2DO7A 4AWXB 2MD0A 3B02A 1D3UA 4G9YA 4U0WA 5M3FJ 4L5JA 4QG5A 5L3BA 1KGSA 4KT6A 1XDSA 1WJDA 4XKBA 4MO7A 2EWNA 2FXAA 3BR6A 2G30A 3HKZN 1QN9A 3LSMA 1IG7A 2XF5A 3X2QH 3N4MA 3RQIA 1BI2A 4A3IJ 5M3MJ 3KZZA 1O7LA 3OOPA 4X0GA 3QODA 2NAZA 2V1DA 4A3BJ 2TCTA 1T98A 2DMUA 5J1YA 1K78B 2E2HJ 3ENCA 1CQTA 1HDPA 2YU9J 4Q4ZF 5J1UA 2RREA 1NG6A 3D5RC 5LD2C 1KU3A 1RM1A 2R7OA 4E6KG 4A3JJ 5DUIA 2NLVA 2RC4A 1YTFA 2EFNA 4A3CJ 2K86A 2V7FA 2Q2EB 5E3NA 1V5EA 2Z33A 3GFLA 3GTPJ 2H8RA 2QLVA 3MMYB 1XCBA 2H94A 1U5TA 3IH4A 4PDKA 4Y3OA 4FE4A 2NOIA 3OYBA 4XIDA 1XPXA 2O9LA 3W2VA 1LEAA 3T0YA 2V8QA 1LPQA 1OYYA 3MVPA 5IY5H 2B0LA 3I55I 2YR2A 5C4XJ 2LSOA 4UV9A 3V8KA 4BEHA 5DCFA 2DLLA 5IYBP 3CLOA 5B5EC 3CO6C 1JJ8C 2E2JJ 3OMYA 4HOBA 5FD5A 4R79A 1PUFA 5GP9A 2EJRA 2FMYA 2PX9A 3PO3J 5K5QA 2OCCH 1BC7C 2BY3A 5E3LA 1HW1A 2XGCA 2B63J 3RZOJ 3GW2A 1UHWA 2BBYA 1XD7A 3K4BA 4B4CA 1SFUA 1ON1A 3MN2A 4M3EA 5FLXK 1MMGA 3IUOA 2EZHA 2D0AA 1QZZA 3BR5A 3DTEA 3S32A 3S2DJ 4A5NA 4FT8A 1Q1HA 2K40A 3S1MJ 2V1XA 2VB6A 5LEJA 1LJ9A 2EPFA 1YFHA 2MBFA 5HS8A 4A93J 3KYCB 3QYBA 1YQMA 2L02A 3I59B 2NYXA 2W00A 3OYMA 1J2XA 2IRFG 2VASA 2R7SA 3SFIA 1LUJB 1XN7A 2R7XA 2O8KA 3FXUA 1EH8A 1IV6A 1T0FA 4Y17A 3GXOA 4CZCA 1Z77A 1TQMA 3RPJA 4BJ5C 1DGWY 5JMVD 2OA4A 2MZ8A 2X85A 1BOBA 1PUEE 4DQ2A 1A36A 5EGOB 4A69C 3ERED 3GTKJ 1MBGA 4BXUA 4DBQA 5HDGA 2H4LX 3IH7A 4ITVA 1MSFC 2Y8QA 4P5OA 2KKOA 1X1BA 2XGDA 2IS6A 3J7ZI 1FBSA 3K2ZA 1YRNB 2Y2ZA 4HBLA 2I10A 3V8JA 1MSEC 2EZKA 1K7AA 3KLOA 4OIQF 2L2OA 5C3EJ 4WZSD 3OIQA 1G2HA 2EQRA 3WTWC 4FX0A 2DQLA 5EG0B 3DLLF 4I98B 1VTLE 1TW2A 3H0DA 2ACJA 3HOZJ 3QU3A 1X1AA 2R7WA 1MGTA 2L9RA 1A35A 2AXLA 2H6CA 3DP7A 1K78A 5CVVA 2JRTA 3HB9A 1IF1A 4MLOA 1FOXA 3TW7A 2IS2A 4TV7A 5IOYA 4LK0F 4EJUA 2H8WA 3OSGA 2V26A 2FOKA 1QN4A 5B66C 4U7DA 2OZ6A 3GTOJ 2DFHA 2LF8A 3MQ0A 3PSFA 2EFPA 2BVMA 1WJEA 3GUDA 1UCRA 4LLLA 4Y33A 3R4KA 4OAZA 3MFKA 4BE1A 2YX7A 4UXNA 1TBPA 4DZPA 2DA1A 3M1CA 2CW8A 3LSTA 1T33A 3GZ5A 5HLIA 4S05A 1JTXA 1GDTA 5E8GA 3GLXA 3S8PA 1GUUA 2LKPA 2W85A 5K7FA 4XRSG 2R7ZJ 3REOA 3E5UA 2VIXA 3OYCA 3D7QA 1OJLA 1PJRA 2W84A 2QCOA 4DGWB 3HRUA 4DNCA 1P92A 4D0PA 5DS9A 3QOEA 2R7VA 2VUMJ 3LOCA 1BR4A 3O2PE 3DBHB 1WJAA 3K9TA 4P9FA 2IVMA 4M3FA 5HLTA 2JJ7A 1LXTA 3ZMSA 5F0CA 2RQPA 3T5XA 1IN5A 3CP8A 4XN3A 5H6RA 4C7PA 4BXXJ 1D1BA 3HS8A 2QQ9A 3EPZA 4A3FJ 2VT2A 1T0FC 1WJ5A 3TO7A 3R60A 5BMNA 1FP1D 4BJ6C 3V4GA 5H20A 3KFWX 1TWCJ 4CICA 2EK5A 1Z3YA 4XKWA 1MDMB 3ZXSA 1XGMA 3ASOH 4XRMA 1MZBA 3DU5A 2MSYA 3M07A 5FRMA 4XSXF 3EUHA 3OYFA 4IHXA 3PDKA 1MKMA 2BV6A 3BC8A 3E1SA 4XICA 4J00A 2ZMEA 5DDGA 5AN4A 1ETQA 3SZTA 1R00A 2NNYA 4KIFA 3VN5A 1W1WE 4RS8A 4RB3C 1ZRFA 3HOUJ 2YSRA 3K6GA 2DFEA 3ZQCA 2X48A 4BYYA 3DFGA 2L01A 1G3WA 5FKMA 3DKXA 2H09A 3PL8A 1JTYA 2ICWG 2UXXA 5HLGA 2HYJA 3C7JA 1V4RA 4JQFA 4GGGA 5E17F 5FD6A 3E3VA 5E18F 2FRHA 2D0CA 2KIUA 3CD6I 1T95A 4OIPF 2I5WA 3C2HA 4XMYA 1VQ6I 3CWSA 2D2WA 1FOWA 3KEOA 4BNCA 2OQGA 1QN7A 1VTOA 3OYDA 2MW8A 1IN4A 1DIZA 3CDHA 4UUSA 5F08A 3CCVI 2EA2A 5E79C 2PN6A 3VB2A 2E7WA 3NWTA 3BZCA 5CLSA 1R5HA 3LQQA 3CCRI 2D5VA 3EAYA 1BW6A 2F5CA 2M5WA 2RQQA 2ZJ2A 5EF6A 2VN2A 1HSJA 4DZJA 3L00A 1MPGA 2ECBA 2HQ5A 4OMZA 4QPQA 1NK3P 5IYDJ 2GXGA 4U87A 2Y0MA 2V1NA 2KRHA 4F3QA 3ENOC 4FE7A 4N4NB 1U2WA 1V5FA 2HFHA 1X1DA 4JYKA 3CESA 5ICGA 1Z67A 4U0YA 3TGNA 4U88A 3FMQA 3BP8A 2DA2A 3O6BB 2FF4A 3GVAA 3I4MJ 5DUKA 2WB1A 1AKHB 1ON2A 1XSXA 2XROA 3K4CA 4LGWA 1IN8A 2UV1A 4AC0A 5IYCJ 2QGUA 1HBXG 2KIMA 1E17A 1B9MA 1FY7A 2E34A 2L7KA 3BKQX 4PK4A 3SNSA 3L2CA 1VQMI 3CP2A 1QNTA 3O8HA 1YS6A 4S0HB 3WE3A 2AHQA 2CRGA 1N75A 3MKZA 1FZPB 3EUKL 1ZG1A 2OAZA 3ECHA 5FGMA 3KZIC 3FF5A 3S16J 3HXLA 2IP2A 2LF7A 4PJJA 4G6QA 4QPOA 2ZB9A 1MBFA 2XB0X 1SVMA 2V6CA 1FJLA 1YO5C 1QRYA 3J80K 3S1QJ 4HDVA 4ZYGA 2Y9ZA 3CTAA 1IZ1A 1Z1DA 2DJIA 5FKNA 2W4SA 1VQLI 4NHJA 4PCQA 3ASMA 5J8CA 4EAIA 3HC7A 1MNDA 1P7IA 1Y8QB 4M3BA 4EMSA 4FETA 3LNQA 3WTTC 3PUBA 1T56A 2GOXB 1J09A 1RC9A 5LRRA 1PVSA 1OR7A 3S1RJ 2ELJA 1ZARA 2DA4A 2VI6A 1SFKA 1W5SA 2CV2A 4DYCA 2M7AA 5JI6A 3G1OA 3RTRA 4XM3A 1KU7A 2XRLA 4BKXA 4HV6A 4C9YA 4D7NA 1IJWC 2DPDA 5H2FC 1ERDA 5KCMA 1W5CC 1XMAA 4OAYA 2V92A 3IH3A 4LG0B 1ZK8A 1UG2A 2IA0A 1R7JA 1ZG3A 3RCOA 2E36A 4I6ZA 4I76A 3TP0A 2UWMA 4FCYA 3F8MA 3WGGA 3JRDA 5ICFA 3ECOA 2HQRA 3OYLA 4F52A 5DV5A 3HL2A 2B9SA 4KNYA 1XMXA 3CUOA 2R92J 1XTAA 5LHGA 2RDPA 1KU9A 3CCQI 4KN4X 3VPRA 2VBXA 3DEWA 1HW2A 2WAFA 3EETA 3QP6A 2P5KA 4RA2A 3TMOA 1PDNC 3BG9A 3BTJA 1QO0D 5CPRB 2CU7A 5GPCA 1FSHA 2HKXA 4NBQA 4NDLA 4I8OA 2EBIA 3QPLA 4TPSA 1Y0UA 1A6IA 1JUPA 1FOYA 2XAGA 5AIQA 3WTVC 4C30A 2HZDA 5EEHA 3HJEA 3SZPA 1I6HJ 4X1EA 3MEXA 1SVLA 3CDLA 4LIVA 5L3EA 1SAXA 1AOYA 4XKCA 1PCJX 2COBA 4Y7NJ 2EIMH 1Z91A 2FD5A 4BJTA 2LBFA 2KPMA 2JA7J 1ACIA 4BXFA 1VZ0A 2A6HF 4B3AA 1C0WA 2JVHA 1V5GA 4M6VA 2MJ7A 3H1CA 4ESBA 1W0TA 2DA5A 1ZGWA 4XK4A 3C3WA 4HJHA 1QZYA 4E7ZA 3OSFA 2JZYA 4IRGA 2GBYA 1QVTA 5F0HA 4FX4A 1RI7A 3M1EA 4MEXF 4EJYA 5F9CA 2O5RA 1J5YA 1U9OA 3DPUA 1X4PA 1APLC 1ZKGA 1Y1WJ 1ZAOA 2M1BA 1QNBA 2UXNA 1YTBA 5F0FA 2HR3A 3F6OA 3HKZA 4ZTJA 1FLIA 4P1WA 5CVIA 1VTNC 1KONA 2XB5A 2O0YA 2WY8Q 3Q0WA 3Q9SA 2LDUA 1YHQI 1RIOH 2FKMX 1GXQA 1YG2A 1HA8A 2NOLA 4UUSB 2R7DA 1JGSA 2K5CA 2ZXIA 3AL0B 1XB4A 2EIJH 4PFOA 4XORA 4IOCF 1OFCX 1QZEA 3ZQIA 1JJ6C 2EILH 2VQLA 3HPHA 1FMVA 5F64A 1D0ZA 5ILSA 2MABA 3ERMA 2P6SA 3F8BA 5K7ZA 3P9KA 2QA4I 1VOKA 1FN7A 5J6XA 5KAIC 3NQOA 2ESNA 4BQNA 2QBYA 2DA6A 4XRFA 4WX9A 5IYBJ 1SD5A 1VI0A 3E0JB 1E3OC 2QSHX 5GAEJ 3QPSA 4A3LJ 4HF2A 4FTHA 1PP7U 3P5JA 4HLYA 1GT0C 2F2EA 3VYTB 1KZHA 4FASD 5DM7F 5EZGA 2P7VB 5IP6A 2PI0A 4MRQA 2F6CA 1UMQA 2XGXA 3VDXA 2NS7A 1TNSA 1SFXA 5EYRA 3GTLJ 5JFRA 1YQKA 3WU0A 2JA6J 1H9GA 2CFOA 1PZDA 3L7WA 3S3OA 2QVOA 3CQZJ 4AU7A 4PFPA 4UY8I 2PG4A 4WCGA 4CYCB 5KK1A 2K9MA 4E4HA 2HDCA 1QQIA 1ZH5A 3KCCA 2HDDA 4KMFA 1U5TC 3I64A 4YFKF 2QF7A 5E1ZB 4D5FA 3JRAA 1BL0A 1FC3A 4II3A 3K70D 3I56I 4QSHA 4E7IA 3HOWJ 4IHSA 2LFBA 1WQAA 1NH3A 3HM5A 2HYGD 5CJ9A 2A3SA 4IZZA 2G9WA 1YITI 3GF2A 4NQWB 4IL8A 1ZGAA 4EM1A 4O5VA 3F8NA 4IQJA 1GHCA 3DLAA 2FBKA 2ESHA 1QNEA 4HG2A 4E7JA 4EAGA 2FQ3A 2ISZA 3ZPLA 4XLEA 2KRCA 3UKGA 4G12A 1R36A 2G0EA 4IRIA 1TWAJ 2F4MB 2PMZN 4UB8C 4CHUA 1Z7UA 1FYKA 4PUSA 1B72A 1ZLJA 2LYCA 2VJ4A 3HRTA 3BG6A 2R7RA 4I0BA 1W5TA 4D5CA 1ZR2A 2F5VA 1Z3XA 2M0MA 3MZ8A 2DYSH 5TISC 4D7RA 3WU2C 2EFWA 4DULA 3H3VK 1CGPA 2O61A 2PQ8A 3LAJA 4A0XA 2VC0A 1W7PB 3FXOA 4AYBA 4RGRA 3HOYJ 2V79A 3CCEI 1XC5A 3H1ZA 2EINH 4I09A 4WX8A 4EJWA 3BJAA 3KP3A 2YA3A 4YIRX 1ZQ3P 3LL7A 2ZNYA 2ZMEC 4S04A 3D0SA 2QUFA 3C18A 4EATA 4U0VA 1WCMJ 5KVRA 2WAEA 3F0ZA 5E3OA 2DDBA 3NAUA 4UVAA 5H6QA 3QRFF 2HVRA 3A01B 1PVEA 2X6XA 3JTGA 3RJPA 2LY2A 3I9V2 2OU2A 2A5YB 4ESJA 4WF2A 2GXBA 1FNNA 2OUMA 4IPAA 2E1OA 3LSKA 2N8GA 2L9VA 5J47A 4MHGA 3VSKA 3CCSI 3SJMA 1KYFA 3L09A 1POGA 4KITB 3LA7A 1P5DX 5AONA 1M3QA 1TGHA 2HTSA 3CC2I 4LD5A 1FYLA 2WC2A 4RAZA 1R6RA 3WHCA 3G1MA 2ZJQF 3M3YJ 5ILUA 4RBOA 3DQVC 4G6TB 1R49A 3CW7A 1R1UA 1WGXA 1YW8A 4HNVA 2L9NA 1WQ2A 3OSEA 3LSRA 2MC4A 2GIZA 1X58A 3KLNA 2CH0A 4LMYA 2VBWA 4MFDA 1IV8A 4HQEA 2A07F 2R7FA 3BG5A 3WODF 3KX2A 3GTQJ 2IS4A 4KIGA 4EQQA 1M5Q1 2DAOA 1LFPA 4D7QA 5FROA 3F72A 1VQ9I 1SD7A 1VNDA 3K4JA 3K4MA 4AIDA 2YS9A 2RV8A 3CJQB 4A0ZA 2ZJPF 3K10A 2DBBA 2KHMA 4RAGA 1ZHFA 3HRSA 1F43A 3I71A 3RKXA 3E97A 2MLGA 1FOKA 2KP6A 3RSNA 2WAQN 4D9JA 1LDDA 3V7SA 1XGOA 3IP4B 3J7AO 2XDVA 1IXSB 3G1LA 5ERIA 1J9IA 1R71A 4HNTA 1B59A 4BL0B 5CQGA 2E60A 3EUHC 3ONQA 4OWRB 1Q9UA 3JRGA 3WG7H 2L9SA 1KYDA 2M30A 1QPIA 5FFXA 5FRNA 2OOYA 2PMHA 2IA1A 3E6MA 3I0TA 5K1YA 1XS9A 4BY7J 3E6DA 5CYVA 4NC7A 3A01A 2RNJA 3IWFA 4L9VA 4BHPA 1WWXA 4JOMA 2A61A 4EEFG 1K6OA 2DXIA 1VQNI 1N3CA 5CVRA 2HGCA 4B48A 2P8TA 2IGNA 2QQBA 4ZTFA 4YIIA 4HW0A 5IP7J 1I3QJ 2VLAA 3LMMA 2JWTA 2IS1A 3G4SI 2AQEA 4EVIA 1JXSA 3WGHA 2EZIA 2GQQA 2MLKA 2JPCA 4W97A 3SDGA 1LQ1A 3CWTA 5GADJ 1D1CA 2MD5A 2K3PA 4QIWN 2Z8UA 2P6TA 3QPHA 2XHIA 4C2MJ 1HXDA 3OOUA 2VE9A 3F8FA 1S7OA 3RI4A 1IC8A 4YFXF 4A3MJ 5JR3A 3Q5FA 1YW9A 5IOZA 3CZ6A 1TP4A 4KIBA 3KE2A 1N39A 2Q0OA 3E6CC 3SQNA 4UUVA 2EH3A 3H3UA 1MBKA 3LFKA 4BQOA 5K5RA 1IXRC 4GYIA 5FJ8J 2EV0A 3U1DA 1MMNA 1SD6A 4C3JJ 3J7YJ 4HSTA 4G7HF 3FM3A 2PEXA 3GCMA 3CF5F 2DKCA 1BI0A 4H4KC 1STZA 4LK1F 3JSPA 2X1DA 2PJRA 2NNNA 4CCKA 4PJ0C 4EJVA 2CFXA 3HTSB 2MH9A 3HSRA 4M9ZA 1KY6A 2HS5A 2CW0F 4M9XA 5LGUA 2BOLA 2W25A 1PP8F 1DU6A 1UT7A 2GZWA 4A2UA 5J4YA 3W6VA 1MD0A 3C04A 3NA5A 5IYCP 3Q9VA 4XSZF 2K9QA 1K4TA 4IOAF 4AUXA 2Q8KA 2E7XA 3D1NI 3TDHA 3LAPA 3W2WA 1E0EA 3BCAA 3F9KA 3H0GJ 1SFEA 1Z0XA 3NRVA 4B09A 5BQTA 3I54A 3LA3A 1XSDA 3S2HJ 1RETA 4K2EA 3CWUA 1VQ5I 2DI3A 3DPLC 2KQRA 3HGGA 3OYHA 3BZ6A 3L2UA 3JR9A 1JKPC 2LK2A 2K02A 3M8JA 2XAHA 3RPUA 2EA4A 2IGKA 3NWSA 3EDPA 2XSJC 3ZMTA 1TL8A 1GVDA 3VEPA 2L7FP 1UHSA 3ABKH 3BJ6A 2VPRA 1BIAA 2RVCA 3E6BA 3B6CA 3OL3A 1BI3A 3TDUC 1D5VA 1N78A 2A69F 3HRMA 1TWGJ 1OYIA 4E7SA 5D5WB 5FO5A 1P4XA 1R4XA 2B7EA 4PJMA 1ITYA 1YYVA 5K5OA 4RODB 1SANA 5B3SH 2DOAA 1Y6IA 3ZQQA 5ED4A 2JSCA 2LH9A 3VFZA 4Z6YA 1B9NA 4I7HA 2QR1A 1FWZA 2UUZA 1UL7A 1S7EA 2VJ0A 3CJRB 3ZCOA 3RSMA 1QN5A 2XGEA 1OCZH 1S9HA 2HZSA 3IKVA 3OYGA 1WVRA 1L3LA 4N9HA 3GZ6A 2FOWA 3ELKA 2QSGX 4LG3A 2X51A 1P2FA 3CCLI 3BDDA 1WFXA 2FNPA 2I8DA 2EFOA 2JUGA 4UUTA 2BEOA 5KNLA 3WU1B 1QN6A 4LITA 3K1PA 3KP4A 1EJ9A 1EUVA 2HL9A 4MEYF 2Q1ZB 2CQXA 4HF0A 2YUSA 2FJ1A 2D45A 1QA6A 2QKLB 2QLZA 4IKFA 2F7LA 1QN8A 4PSXA 5GTIC 2GOMA 4UVBA 2ZO4A 3ZQFA 3P9IA 5JHUA 3ML6A 3QAHA 4L18B 3HTUA 5J8FA 1B1BA 2QENA 3FBNB 4YG2F 3HOSA 2HI3A 4M6YA 1JKOC 4LLNA 1UJ8A 2QREA 2GWRA 4DBRA 1Y0NA 3T8RA 3PIOF 1YIJI 5HDKA 4LFUA 3P9CA 1OCTC 3H5AA 2K9LA 2VC1A 1I1SA 4X6AJ 2V6EA 2V9PA 4V2GA 5E1WA 4M9SA 5EEGA 2L5QA 3CMMA 3MZYA 5BNGA 1YJ9I 2IBDA 1VQPI 1LVAA 1V5SA 1P6RA 1IXCA 4F91B 2NOHA 2QQAA 3FDYA 3OYIA 1WSUA 2Y9YA 3WTZA 4YRVA 3CCYA 3L1PA 2LMDA 1BOAA 2IGMA 2XF7A 2HZTA 1IGNA 3HOTA 4RMNA 4HPQA 1LEBA 3DTIA 4CSWA 4BDYA 1T6SA 2LY9A 1FTZA 2YPRA 3AAFA 4DJAA 2JA5J 3C2BA 3UR3C 1SMYF 4XKVA 1K83J 2BW3B 3FKIJ 2XUBA 1C47A 1YLFA 1Z7LA 4XLFA 4R8HA 3N97A 3H3ZA 2PLYA 2KZGA 2P5VA 4C3IJ 4DIQA 5L3CA 2HEOA 1KU2A 1X19A 1MJAA 1Y8RB 4MTDA 5HSHA 1EH7A 1N77A 4BUPA 3FXMA 1DU0A 4IL6C 1FIAA 3QYEA 1TWFJ 1ETWA 4Q47A 1EBMA 2M7BA 2P5LC 3OLPA 1F5TA 3KP6A 1W36D 3ABMH 2QYOA 3ZQGA 1MNMC 1TWHJ 5GPAA 2AO9A 1X3ZB 5M5WJ 4ZDPA 3BG7A 1U0JA 1H89C 1EKEA 2HOEA 4P9UA 2HZMA 5EZHA 4ZZDA 1BI1A 4L0ZB 3SHFA 4LB6B 3BLYA 2EV5A 3JTHA 2CUEA 5EPCA 5HOOA 1IRZA 4Y52J 1WJFA 4OMYA 2F5FA 3DPTA 4F93B 1OKRA 4ETSA 1PYVA 4L9TA 2LC2A 5LFAA 3G2BA 4ZJZA 1S3JA 2E35A 4CO8A 2JRMA 4M72A 4EGYA 1T38A 2NOZA 4BBRJ 3LSGA 2ZBKA 2PMUA 2LBFB 2NWVA 3TL4X 5FKLA 1I6XA 1XSVA 2M3AA 2E1CA 4WXHA 3FMRA 4GRIA 2Z0FA 5E20A 2M8EA 1JE8A 2DKAA 3G3ZA 3BZKA 1OR7C 5ICEA 2KJCA 2ZC2A 2O7OA 2QRDA 4MFEA 3H9QA 5CVJA 2NVTJ 5L3DA 2F4OB 2HVQA 2OTLI 3UW2A 3S3NA 2HOSA 3FK6A 4UV8A 1JHHA 2XAJA 4RLQA 2VKHA 4F55A 1RUOA 4HNUA 2DTRA 4AIHA 3L2RA 5DEQA 1BA5A 3RKQA 3CJTB 1YIOA 3R0AA 2X1EA 4GXOA 3MCZA 1IN7A 3TBIA 3TEDA 3BR1A 1E3PA 2XHKA 4BS9A 1TT5B 2ISYA 2ZXHA 3VYUB 3AG1H 1NHAA 2BE5F 3K70C 2OBPA 1WPKA 2F5DA 3OR2C 1KQ9A 1HSTA 3HG9A 2C6YA 4ROEB 3PNVA 3TOBA 1LFUP 3CC7I 2R5XA 1YW7A 2D1VA 4A3KJ 3HZJA 3QU6A 3ULQB 1O3QA 1K61A 1RUNA 3EQLF 4PY5A 4BHCA 2Q2EA 3TP3A 2VKEA 4Y15A 4MQ9F 1QVUA 5CVUA 1JUMA 3LSHA 1B8IA 1UELB 4ABZA 1OMIA 1TBAB 3IV5A 2VQCA 1AHDP 1FP2A 1MBEA 1Z6RA 2KDOA 3WG9A 3ZQHA 3CLQA 3HDDA 3GTGJ 5JLXA 1OPCA 3FIWA 3TO6A 3U9GA 2WA0A 3G71I 1GXPA 5DM6F 2FGTA 3LQRA 2EIKH 2DU9A 4JX6A 4KMUX 4A6DA 1CF7A 4PJNA 4M6XA 3I4PA 1YQLA 3OV8A 3BROA 1WJCA 2PJPA 3QPTA 2DCEA 1IDYA 4L9NA 2EB7A 2L7ZA 3I59A 2P0WA 1WHUA 2L54A 3EYYA 1ZG5A 2LREA 1LWVA 1I39A 2V9KA 1U6GA 4XLNF 4EM2A 3GTMJ 2DW4A 1ZGJA 5ICCA 3BR0A 4L9JA 3JREA 1T8IA 3RZDJ 2X1CA 2ZCWA 1ZYRF 4Z2YA 4YELA 1JKRC 4HQMA 4H0EA 1DQUA 3LSJA 3H5RA 4HX7A 2H5AX 2ZSHB 4DYQA 1J75A 3FXLA 2E5ZA 3FXQA 4M73A 1P7JA 4A12A 4YEJA 4HAMA 4E70A 4IJAA 4LLGF 5KL0A 1UFMA 2HL8A 1SMTA 2Z3YA 3OY9A 1DDNA 2F4IA 4BY1J 1UHMA 2QEXI 3FWEA 3D5LA 2DOFA 1FYMA 2W7NA 3HGYA 4IRHA 1HW5A 2VBZA 3AKZA 2IV8A 4E7LA 2EZLA 3HHGA 5GTHC 4G94A 1DGRM 2HPIA 3K69A 3M8FA 2NXNB 4RGUA 2QQ8A 1VOLB 2VOPA 5D5XB 1TQPA 1MDMA 1LDKB 1FBUA 2FA5A 1O7FA 3HOXJ 3KZYA 3HUGB 4M3GA 3SFZA 1LNWA 2MH2A 3OS0A 3W6JB 2NS8A 3J81Z
chains in the Genus database with same CATH topology
3WTYC 4KISA 4NNJA 3IAS2 2Z99A 1MJBA 3GO5A 3BPXA 1W4MA 4XR6A 4JBAA 1YE9A 1UAAA 4RB0A 2IA2A 2VXZA 3D5SC 1LVKA 2H27A 2VKDA 1Z21A 5F1RA 5ILVA 3CUQB 3TQNA 1ZELA 5F6FA 3F10A 2YU3A 4N0BA 1BM9A 2L3DA 3ZRGA 4XBFA 1DP7P 2ZSIB 1TLHB 3KP7A 3KEQA 3P7NA 1G3SA 2H6BA 2O3FA 3G73A 2CV0A 4BQAA 1IUYA 1JI8A 1A04A 4RGXA 2V1UA 3DKYA 2MFZA 1HQCA 3OS1A 3FHZA 1P4WA 3OIPA 1XGNA 5L3FA 4D1QA 4ZH4F 4ESFA 3IHUA 2AQFA 4Y4RA 3OL4A 2IPQX 1AWCA 1TTYA 5A2QZ 1QHHD 4QLCU 4HRIA 4A6EA 3OYEA 1QGPA 4NQWA 3F8CA 2IJLA 1FX7A 2O03A 2Z2SB 4XL9A 3JW4A 2BGCA 2R7TA 3HS9A 3RKYA 1TBXA 1G59A 4IX7A 3OC3C 4B8XA 5HS9A 5LHHA 5D4RA 2CW7A 3TKYA 4CCNA 2YX4A 2DK8A 2VJJA 2Y75A 3OCIA 2ZMEB 2LG4A 2VOOA 1O57A 1I5ZA 3VSLA 1HKQA 1TW3A 1KYWA 3BY6A 5FFZA 3ZMZA 4ZC3A 4HX4A 1G8XA 2OV7A 1D8KA 4CXFA 1G4DA 2E1MB 3WE2A 1BIBA 1X4OA 2W82A 4L5IA 5BMZA 2KZVA 4AVPA 2NS0A 2W24A 2CSOA 1KQ8A 2BYVE 4ZDOA 2DT5A 4CDGA 3PQKA 3CUQA 2E1NA 1EA3A 2IXSA 3PNTA 3GX4X 3RPQA 1SAUA 3FKJA 2PJRB 4AD9A 3KTUA 4IQ4A 3A2KA 2IT0A 4IXAA 3HYIA 1QNAA 3E5XA 1MW7A 1UG0A 3QOPA 2A6TA 4CGZA 2LRDA 2RNGA 4PZJA 3VYSB 1MMAA 3PFIA 2CMPA 4BQQA 2K7LA 2UZKA 1OLTA 3GFJA 3ABTA 3QYFA 3DXJF 3ULXA 1IN6A 2GIVA 1Z9CA 2VJ5A 3RPUD 2Y48A 3ZR8X 2V4JC 3NEUA 3OYJA 3HSEA 4EJZA 3N05A 2AS5F 1TNTA 2JT1A 4KN7X 2QKMB 3VOEA 4PGHA 4P55A 2STTA 3DEEA 1S8NA 5D4SA 3HPGA 2JA2A 1MMDA 4OIRF 5IT9K 4NB5A 1R5GA 1LWWA 2D1HA 3CUQC 5HNHA 2XKPA 1U3EM 4MGRA 3MKWB 1QU3A 2NOFA 1AA7A 3IRQA 4HZFA 5CKTA 1I1GA 2IV9A 4N9IA 1O3TA 4ASNA 2NOBA 2HVSA 4B47A 1F4KA 4ZZLA 3BPVA 5LEKA 1R23A 2E5NA 1BN5A 1GVJA 3F6VA 2MC3A 2ADUA 4ENJA 4CCJA 4B0AA 1J7KA 2FE3A 4XQFA 3RDIA 3COAC 4C2TA 2KRFA 5DYMA 3HSFA 2STWA 5AIPA 3IL2A 2XAUA 2VBYA 1S7AA 1YQAA 5BPDA 1FT9A 3HIFA 3S3MA 1TQIA 5IYDP 3PFYA 4BU2A 5FLXZ 4GCVA 4KICA 4BHBA 1G3YA 4HSRA 1ONVA 2K27A 4ON0A 3F3XA 2ZFWA 5D5VB 2M87A 1T2KA 1MP9A 2XKOA 2EFQA 1QBJA 3LFUA 2DQRA 1K6YA 3GYHX 1NH2A 5KHDA 4CCLA 4N4OB 2QWWA 3QP5A 3DF8A 3M7GA 3CO7C 4KA4A 4BAYA 3I5UA 3ZMUA 4EM0B 4UVCA 2O8XA 1B4AA 1G6NA 4BEHB 4I2OA 1KO9A 3DKWA 1ZRCA 3FM5A 3OYKA 1RZ4A 3RIRA 1BR2A 3T8TA 5TGTA 2R7QA 4G7ZF 2WV0A 4HA8A 4XN0A 2YH5A 3W6KB 3LA2A 4I0AA 3J81K 3ZN0A 5IT3A 3CJNA 2LOOA 2ZFUA 2HWVA 6PAXA 1WI9A 2P4WA 2TDXA 3PJRA 2LNBA 3V7CA 1U78A 2BVLA 1QHGA 1WJBA 3T1BA 4L0YB 1W80A 3RYPA 1YQRA 4G6DA 2E1MC 3H9GA 4KT5C 4MNUA 2HTJA 2VE8A 1D0XA 2QZ8A 3FHNA 4CYDA 1XMKA 2J5OA 3GFIA 2QM3A 4XLPF 4B3XA 1S29A 4BE2A 2A68F 4KJZA 2Z16A 3PNYA 4FHTA 4ROCB 2ETHA 1L0OC 1DPUA 1QNCA 2FBIA 2R3SA 3W2AA 5DD4A 4O6JA 2HDWA 1YX5A 2BW3A 3OWTA 2HQAA 3SYTA 1TT0A 2FUG2 3H35A 1NGMA 2PMZA 3DEUA 3BWGA 4Q11A 1FPQA 3B73A 2Z9OA 1AISA 1E2XA 3MKYB 4IF4A 3F22A 3KEYA 4EJOA 2CS3A 2ZXJA 4XLHA 1PCZA 1D3YA 1EH6A 1FMWA 2OQRA 2DT6A 3OR1C 1ZLKA 4R1HA 4ZYHA 3MWMA 1W7PD 2A6EF 5HVQC 3C1DA 1V3FA 2M4KA 3EUAA 3R6SA 5LLQA 1BC8C 5LGTA 1LKXA 2VXDA 3A4CA 2HPMA 1RNLA 4BE0A 3KP5A 1KQ0A 2XAFA 1D0YA 3EYIA 1P4AA 2CGPA 2KJBA 4WK8F 5BPIA 1R1VA 2VT3A 3FX3A 1D1AA 4CH7A 4HYEA 4G7OF 3CF2A 4IHTA 2KIFA 2L4AA 3JAMK 4KFCA 2X6WA 3GFMA 4CCOA 3DV8A 1FBQA 4XNFA 2XF6A 2Z1DA 3K4LA 4HX8A 4YFNF 1ZN2A 1DPRA 1KY7A 2HNHA 5D6EA 3I58A 2VQGA 3MD2A 2JSPA 4NUBA 3HUGA 3ABUA 5HDNA 1XDUA 3SDBA 2PBIA 4BH9A 1F1ZA 4XOTA 3SEQA 2M45A 1N3AA 3IKTA 1YS7A 4ZDLA 3I0WA 3M8EA 3VWBA 4PJLA 2VONA 3W3CA 3ROUA 2WTEA 3PQJA 3LWFA 5DD8A 3GBGA 1BR1A 3WTSC 1H9TA 3ZMVA 3ZMDA 2JTVA 2DPUA 3RQ4A 5LBQA 1SD4A 1DP3A 1M3HA 1R1TA 1ULYA 4RLFA 2KMUA 1Y56A 2FMLA 2R7UA 4CUGA 4ANJA 3L2VA 2D0BA 2GA2A 2ZKZA 4LJZF 5HLHA 3FBIB 3I0XA 4RB2C 2JVGA 3ISPA 2WWYA 3U21A 3ZGKA 2G7HA 1IRGA 2A5WA 2VL8A 4G8XA 1O3SA 5HS7A 2LAEA 2PFBA 3BOQA 4ZYDA 5JHFA 2CUZA 4Q48A 3E5QA 4MQVA 2NRAC 3OSMA 1Z6TA 4RM3A 3PSIA 5D8LB 4E7KA 3SXYA 1IRFA 2RKHA 2L4MA 3H5NA 4QWQA 4RAYA 1ZREA 1LWYA 4UNOA 3MAJA 3I3LA 1P9QC 1JFIC 1J0RA 4ENNA 1X1CA 3VYRB 1I27A 1F9NA 1T39A 5LRSA 3J7AY 4OIOF 2XC7A 4GYGA 1H0MA 3M9AA 5BS6A 4OU0A 1C9BB 1Z05A 4XLAA 4B44A 4XLCA 5IT9Z 3O3KA 2WBMA 4P96A 2XASA 5HNFA 3DWLE 1CF7B 2VPLA 5DCMB 3FXRA 4DOZA 4BGDA 1YX3A 4A0YA 1UT4A 4BACA 3GWZA 3JAMZ 3KRMA 3IRRA 4WXDA 5TJJA 2OC6A 1EV7A 3K1NA 1QN3A 5DCMA 1OYWA 2F5EA 3FZVA 4HLXA 4BDZA 1R58A 3S2WA 4RB1A 5FB2A 1DUXC 1U5TB 3ZQ7A 5JVTA 4EV0A 1NG7A 5E8IA 2O3OA 1QTSA 2OZUA 3OS2A 3TDZC 4II2A 3A1YA 2O6GE 2KL4A 4CA0A 1IW7F 3IWZA 2W1OA 4E7HA 1HKSA 1FSEA 3DU6A 4U7BA 2VODA 2Y0SA 1WKMA 5CQEA 2K4BA 2OD5A 2GA1A 3N89A 2MYSA 4AIJA 4LIUA 3F23A 4HDUA 3WGIA 3OYAA 5LGNA 4KDPA 4EJTA 4KYWA 2R4GA 2WADA 3H9JA 1WRJA 3JSOA 1KYUA 2HKOA 4C2UA 2M4GA 3L2QA 1ODDA 3ZN1A 3IC7A 3DTKA 2DFIA 4I01A 2V9VA 2KLOA 1W7PA 4JK1X 3VODA 3KYLA 3AL0C 4F92B 1G3TA 1ZRDA 2WY7Q 4EGZA 1KA8A 1U8RA 3RKWA 1QTPA 3SEZA 2CQKA 5LHIA 4PSWA 4WWCA 2XVCA 4CZZA 3V42A 4A5MA 1B6AA 1REPC 1XCVA 4HV5A 1E42A 1IRXA 1USSA 1YTYA 2CUJA 2W57A 3FMSA 2P7CB 3TO9A 2HU9A 1JHFA 3HHHA 4XONA 3H92A 2RN7A 4UHTA 4M71A 4PGGA 3ZP5A 2CWEA 1QPMA 2ZNZA 1NVPA 2MA3A 4M74A 3LSIA 2G7UA 4OINF 3RYRA 4ZYEA 4F7ZA 1IAWA 3AFHA 4IVNA 4OOIA 1BJAA 4WXCA 1KYZA 2NOJB 1J59A 1TZLA 2JOIA 2FBHA 1UB9A 2XAQA 2DT7B 4O3MA 4HF1A 2CV1A 5D6FA 5D5UB 2XIGA 1HU0A 3K4NA 2CYYA 2FNAA 3R0JA 1BBYA 3L9FA 1W36C 5L3GA 4ZYAA 3R61A 4AIKA 3OYNA 1B9KA 2EV6A 3IAM2 3K1MA 2NOEA 2GAUA 1MNEA 2HYFA 2LY1A 1X3UA 1R22A 4KUMA 5TRDA 4AVZA 3V7RA 1GLNA 4YIFA 2IW5A 1USTA 1D8JA 3K4KA 3S93A 2K4JA 2XV4S 3MZHA 3GEZA 3V8LA 3C2GA 2JPBA 4ENMA 4ENKA 3WTXC 2X0LA 2IGOA 3OSTA 2Z5UA 1MJ9A 4CCMA 4J01A 2VJIA 3EIKA 4HEA2 3BCBA 3TOAA 3F21A 1S6LA 3L2WA 2FEZA 2X6YA 1LDJA 2X4HA 4RM2A 2VQHA 2ELHA 4GO1A 4XOPA 2DK5A 3KP2A 5A2QK 4I02A 5E1XA 2COMA 3K0LA 1LB2A 1HKTA 2XRNA 2J5PA 3BJOA 4MTEA 3UNGC 3U2RA 1XGSA 2CO5A 5BOXA 3KETA 2FU4A 4RGSA 4NC8A 1O3RA 2RGVA 2CG4A 2WAQA 3I53A 4LB5A 2QBYB 4Y13A 1K79A 2HQNA 4B43A 1CDWA 3WTUC 2FSWA 4Q5SF 3SZGA 3J80Z 5D8KB 4LG0A 2DO7A 4AWXB 2MD0A 3B02A 1D3UA 4G9YA 4U0WA 4L5JA 5L3BA 1KGSA 4KT6A 1XDSA 1WJDA 4XKBA 2EWNA 2FXAA 2G30A 1QN9A 3LSMA 2XF5A 3N4MA 1BI2A 3KZZA 1O7LA 3OOPA 4X0GA 3QODA 2NAZA 2V1DA 1T98A 1K78B 4Q4ZF 2RREA 1NG6A 3D5RC 5LD2C 1KU3A 1RM1A 2R7OA 4E6KG 5DUIA 2RC4A 1YTFA 2EFNA 2K86A 2V7FA 2Q2EB 2Z33A 1V5EA 3GFLA 3MMYB 1XCBA 2H94A 1U5TA 4PDKA 4Y3OA 2NOIA 3OYBA 3W2VA 1LEAA 3T0YA 1OYYA 2B0LA 2YR2A 2LSOA 4UV9A 3V8KA 4BEHA 5DCFA 2DLLA 5IYBP 3CLOA 3CO6C 3OMYA 4HOBA 5FD5A 4R79A 2EJRA 2FMYA 5K5QA 1BC7C 1HW1A 3GW2A 1UHWA 2BBYA 1XD7A 3K4BA 1SFUA 1ON1A 5FLXK 1MMGA 3IUOA 2D0AA 1QZZA 3DTEA 3S32A 4A5NA 4FT8A 1Q1HA 2V1XA 2VB6A 5LEJA 1LJ9A 1YFHA 2MBFA 5HS8A 3QYBA 1YQMA 2L02A 3I59B 2NYXA 2W00A 3OYMA 1J2XA 2IRFG 2VASA 2R7SA 1XN7A 2R7XA 3FXUA 1EH8A 1T0FA 4Y17A 3GXOA 4CZCA 1TQMA 3RPJA 4BJ5C 1DGWY 2OA4A 2MZ8A 2X85A 1BOBA 1PUEE 4DQ2A 3ERED 4BXUA 4DBQA 5HDGA 3IH7A 4ITVA 4P5OA 2KKOA 1X1BA 2IS6A 1FBSA 3K2ZA 4HBLA 3V8JA 1K7AA 3KLOA 4OIQF 2L2OA 4WZSD 3OIQA 3WTWC 4FX0A 2DQLA 4I98B 1VTLE 1TW2A 3H0DA 2ACJA 3QU3A 1X1AA 2R7WA 1MGTA 2AXLA 2H6CA 3DP7A 1K78A 5CVVA 2JRTA 1IF1A 4MLOA 2IS2A 4TV7A 4LK0F 4EJUA 2V26A 2FOKA 1QN4A 4U7DA 2OZ6A 2LF8A 3MQ0A 3PSFA 2EFPA 2BVMA 1WJEA 3GUDA 1UCRA 4LLLA 4Y33A 3R4KA 3MFKA 4OAZA 4BE1A 2YX7A 4UXNA 1TBPA 3M1CA 3LSTA 2CW8A 3GZ5A 5HLIA 4S05A 5E8GA 3GLXA 3S8PA 2LKPA 2W85A 3REOA 3E5UA 2VIXA 3OYCA 1PJRA 2W84A 4DGWB 3HRUA 4DNCA 1P92A 4D0PA 3QOEA 2R7VA 3O2PE 1BR4A 3K9TA 4P9FA 1WJAA 2IVMA 5HLTA 3ZMSA 2RQPA 3T5XA 1IN5A 3CP8A 5H6RA 4XN3A 1D1BA 3HS8A 2QQ9A 3EPZA 2VT2A 1T0FC 1WJ5A 3TO7A 3R60A 1FP1D 4BJ6C 3V4GA 5H20A 3KFWX 4CICA 2EK5A 1MDMB 1Z3YA 4XKWA 3ZXSA 1XGMA 1MZBA 3DU5A 5FRMA 4XSXF 3EUHA 3OYFA 1MKMA 2BV6A 3BC8A 3E1SA 4J00A 2ZMEA 5DDGA 5AN4A 3SZTA 1R00A 2NNYA 4KIFA 3VN5A 4RS8A 4RB3C 1ZRFA 2YSRA 3K6GA 4BYYA 3DFGA 2L01A 1G3WA 3DKXA 2H09A 3PL8A 2UXXA 5HLGA 3C7JA 1V4RA 4JQFA 4GGGA 5E17F 5FD6A 3E3VA 5E18F 2FRHA 2D0CA 2KIUA 1T95A 4OIPF 2I5WA 3C2HA 4XMYA 2D2WA 3KEOA 4BNCA 2OQGA 1QN7A 1VTOA 3OYDA 1IN4A 3CDHA 2EA2A 2PN6A 3VB2A 2E7WA 3NWTA 5CLSA 1R5HA 3LQQA 2F5CA 2ZJ2A 2M5WA 2RQQA 2VN2A 1HSJA 3L00A 4OMZA 4QPQA 2GXGA 4U87A 2Y0MA 2V1NA 2KRHA 4F3QA 4N4NB 1U2WA 1V5FA 2HFHA 1X1DA 5ICGA 3CESA 4U0YA 3TGNA 4U88A 3FMQA 3BP8A 3O6BB 2FF4A 3GVAA 5DUKA 2WB1A 1ON2A 1XSXA 2XROA 4LGWA 3K4CA 1IN8A 2UV1A 1HBXG 2KIMA 1E17A 1B9MA 1FY7A 2L7KA 4PK4A 3SNSA 3L2CA 3CP2A 1QNTA 1YS6A 3WE3A 1FZPB 1N75A 3MKZA 1ZG1A 3EUKL 2OAZA 3ECHA 5FGMA 3FF5A 3HXLA 2IP2A 2LF7A 4PJJA 4G6QA 4QPOA 2V6CA 1YO5C 3J80K 4HDVA 4ZYGA 3CTAA 1IZ1A 1Z1DA 2DJIA 4NHJA 2W4SA 4PCQA 3ASMA 5J8CA 3HC7A 1MNDA 4EMSA 4FETA 3WTTC 3PUBA 2GOXB 1J09A 5LRRA 1OR7A 2ELJA 1ZARA 1SFKA 1W5SA 2CV2A 2M7AA 5JI6A 3RTRA 4XM3A 1KU7A 4HV6A 4C9YA 2DPDA 1ERDA 5KCMA 1XMAA 4OAYA 4LG0B 2IA0A 1R7JA 1ZG3A 3RCOA 2UWMA 3F8MA 3WGGA 5ICFA 3ECOA 2HQRA 3OYLA 4F52A 5DV5A 3HL2A 4KNYA 3CUOA 5LHGA 2RDPA 1KU9A 4KN4X 2VBXA 1HW2A 3EETA 2WAFA 3QP6A 2P5KA 3TMOA 1PDNC 1QO0D 5CPRB 1FSHA 2HKXA 4I8OA 4TPSA 1Y0UA 5AIQA 2XAGA 3WTVC 4C30A 2HZDA 5EEHA 3SZPA 3MEXA 5L3EA 1SAXA 4LIVA 1AOYA 4XKCA 1Z91A 4BJTA 2LBFA 2KPMA 4BXFA 1C0WA 2A6HF 1VZ0A 2JVHA 1V5GA 2MJ7A 4ESBA 3C3WA 1QZYA 4E7ZA 2JZYA 4IRGA 4FX4A 1RI7A 3M1EA 4MEXF 4EJYA 2O5RA 1J5YA 3DPUA 1X4PA 1ZAOA 2M1BA 1QNBA 2UXNA 1YTBA 2HR3A 3F6OA 3HKZA 4ZTJA 1FLIA 1VTNC 5CVIA 4P1WA 1KONA 2O0YA 2WY8Q 3Q9SA 2LDUA 1RIOH 1GXQA 1YG2A 1HA8A 2NOLA 2R7DA 1JGSA 2K5CA 2ZXIA 3AL0B 1XB4A 4PFOA 4XORA 2VQLA 3HPHA 1FMVA 5F64A 5ILSA 1D0ZA 2MABA 3F8BA 2P6SA 3P9KA 1VOKA 1FN7A 5J6XA 3NQOA 2ESNA 4BQNA 2QBYA 4XRFA 4WX9A 1SD5A 3E0JB 4HF2A 1PP7U 4HLYA 2F2EA 2PI0A 3VYTB 4FASD 2P7VB 2F6CA 2XGXA 3VDXA 1TNSA 1SFXA 1YQKA 5JFRA 3WU0A 1H9GA 2CFOA 1PZDA 3L7WA 3S3OA 2QVOA 4AU7A 4PFPA 2PG4A 4WCGA 5KK1A 2K9MA 4E4HA 2HDCA 1QQIA 1ZH5A 3KCCA 4KMFA 1U5TC 3I64A 4YFKF 5E1ZB 1FC3A 4II3A 3K70D 4E7IA 4IHSA 2HYGD 5CJ9A 2A3SA 4IZZA 2G9WA 3GF2A 4NQWB 1ZGAA 4EM1A 4O5VA 3F8NA 1GHCA 4IQJA 2FBKA 3DLAA 2ESHA 1QNEA 4HG2A 4E7JA 2FQ3A 2ISZA 3ZPLA 4XLEA 2KRCA 1R36A 4IRIA 4CHUA 1Z7UA 1FYKA 4PUSA 1ZLJA 2LYCA 3HRTA 2VJ4A 3BG6A 2R7RA 4I0BA 1W5TA 2F5VA 1Z3XA 2M0MA 2EFWA 4DULA 1CGPA 2O61A 2PQ8A 3LAJA 4A0XA 2VC0A 1W7PB 4AYBA 4RGRA 2V79A 3H1ZA 4I09A 4EJWA 3BJAA 3KP3A 3LL7A 2ZNYA 4S04A 3D0SA 2QUFA 3C18A 4EATA 4U0VA 5KVRA 2WAEA 3F0ZA 2HVRA 4UVAA 5H6QA 3QRFF 2X6XA 3JTGA 3RJPA 2LY2A 3I9V2 2OU2A 2A5YB 4ESJA 4WF2A 2GXBA 1FNNA 2OUMA 4IPAA 3LSKA 4MHGA 3VSKA 1KYFA 3L09A 4KITB 3LA7A 5AONA 1M3QA 1TGHA 2HTSA 4LD5A 1FYLA 2WC2A 4RAZA 1R6RA 5ILUA 3DQVC 4G6TB 1R1UA 1YW8A 2L9NA 1WQ2A 2MC4A 3KLNA 4LMYA 2CH0A 2VBWA 4HQEA 2A07F 2R7FA 3WODF 3KX2A 2IS4A 4KIGA 4EQQA 2DAOA 1LFPA 5FROA 3F72A 1SD7A 3K4MA 3K4JA 2RV8A 3CJQB 4A0ZA 3K10A 2DBBA 2KHMA 1ZHFA 3HRSA 3I71A 3RKXA 3E97A 2MLGA 1FOKA 2KP6A 3RSNA 4D9JA 1LDDA 3V7SA 1XGOA 3J7AO 3IP4B 2XDVA 1IXSB 5ERIA 1J9IA 4HNTA 1B59A 4BL0B 5CQGA 2E60A 3EUHC 3ONQA 4OWRB 2L9SA 1KYDA 2M30A 5FFXA 5FRNA 2PMHA 2IA1A 3E6MA 3I0TA 5K1YA 3E6DA 5CYVA 4NC7A 2RNJA 3IWFA 4L9VA