3DPTA

Cor domain of rab family protein (roco)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
298
Chain Sequence
SWIKVKEKLVEATTAQRYLNRTEVEKICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLNTSALGYILNEEQIRKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIDNEPEITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLDVKEFIPLPGHPDELVEYKELLGLEKMGRDEYVSGKLEKVFSVSKMLDSVIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rab family protein
publication title Structure of the Roc-COR domain tandem of C. tepidum, a prokaryotic homologue of the human LRRK2 Parkinson kinase
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Signaling protein
total genus 87
structure length 298
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16095 COR C-terminal of Roc, COR, domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dptA01
1.10.10.2200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dptA02
3.30.310.200 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3dptA03
5EEHA 4L5JA 2O8XA 1K78B 5H6RA 4KT5C 1XB4A 1O7FA 1ZLJA 3GFLA 1U3EM 3LFKA 2L4MA 1IN4A 2E1CA 3ISPA 3RTRA 1WKMA 3HTSB 1IXSB 2BE5F 2K86A 2P6TA 3FXQA 3BZ6A 2H6CA 4L0ZB 1KYZA 1ULYA 5LBQA 4G9YA 2ETHA 1IRGA 1XCBA 2IT0A 4HX7A 1XSDA 1DPRA 3TO6A 5DUKA 2D1VA 4HDUA 1XMAA 3CTAA 1KQ8A 2HTJA 3K1NA 2X0LA 2F5CA 1U5TB 4AIJA 1MJ9A 3KE2A 1KU7A 1B6AA 1YQAA 4HDVA 3GUDA 2M45A 3MWMA 1YW7A 4HQEA 2KIUA 1IRFA 3B73A 1R1TA 3J81Z 3K1MA 3KCCA 1RZ4A 3V7CA 2YSRA 2K02A 3GEZA 1D5VA 4A5NA 3FF5A 1BI3A 1L3LA 4LLNA 1HKQA 1TQPA 4AWXB 5L3FA 1A04A 4LLGF 1K7AA 3E6MA 4XRFA 2STWA 2ZO4A 1Q1HA 2GZWA 2G7UA 1WRJA 2IVMA 4QWQA 2PQ8A 4G7HF 2O03A 4U0WA 4YFNF 5ILSA 5DD4A 1PUEE 1IUYA 1D8JA 1KU2A 4RGRA 3ZMVA 2VOOA 4EJOA 5DCMB 3J80K 1QBJA 2F5DA 1KA8A 2L3DA 3L7WA 3CUQC 1HKSA 5E8GA 3MAJA 1S8NA 3F21A 4B09A 3I59A 3I4PA 5FGMA 4IVNA 5D8KB 3C18A 4HV6A 2VT2A 4MGRA 2DT5A 2IA1A 1CGPA 1YW8A 4ENKA 2YU3A 4M6XA 1YIOA 4S04A 1EH8A 5AIQA 1MDMB 4ZZLA 4G6DA 3DFGA 4L5IA 1OPCA 1K78A 2L4AA 1FY7A 2V6CA 1FBUA 3SFZA 4OINF 1BJAA 4IPAA 3I71A 3H3UA 4HF2A 4CICA 1TNSA 5ED4A 2DPUA 3EYIA 1IZ1A 5E1ZB 2UXXA 3VOEA 3WTYC 3E6CC 1R22A 2BBYA 5F64A 4MEXF 2A61A 1IN8A 4L9VA 4XLPF 2FE3A 2YX4A 3ML6A 2L01A 1D3YA 5E8IA 2FBIA 2YR2A 3N97A 4YIIA 2HQNA 3OV8A 5ILUA 4LMYA 1LEBA 4LB6B 5LGTA 1O7LA 2FF4A 1QPMA 1WQ2A 2PG4A 2ISZA 1L0OC 2IJLA 2ESNA 4GYIA 2EV6A 1U5TA 2Z33A 3S2WA 2OAZA 2BGCA 5CVIA 1OKRA 1FP2A 3OOPA 1UFMA 1O3TA 1BN5A 3MCZA 3FXRA 1KQ0A 2EJRA 1KGSA 3FMSA 5HLHA 4N0BA 4EJWA 5DYMA 1P6RA 1V4RA 3BDDA 4CO8A 1D8KA 3DKWA 2JZYA 1H0MA 5JI6A 3R0AA 2W25A 3SQNA 3ELKA 3EETA 4G7OF 2QENA 3MQ0A 4EGZA 2R3SA 2IW5A 3MEXA 5D6EA 5H6QA 4HA8A 2GXBA 1YW9A 5DCFA 5DCMA 5FFXA 2YPRA 4EM1A 2EFWA 2IP2A 3IKVA 2KIMA 3TQNA 4XSXF 3CJNA 4IXAA 1MKMA 3WTXC 3ROUA 1IXRC 3HOSA 4KYWA 4RAZA 4H0EA 2RQPA 2XAGA 1HSTA 4UVAA 5D5UB 2EB7A 1QO0D 4ZZDA 4G7ZF 3I53A 1SD7A 1R1VA 4IRHA 1BI0A 1BC8C 2DFIA 1XSXA 3WTSC 3KZZA 2KJCA 4ZYHA 2HDCA 3WE2A 4YFKF 2QZ8A 1LDDA 3I54A 4MQVA 2D1HA 2EFPA 3G3ZA 2M1BA 3FHZA 5J8FA 3JSOA 2PJPA 3RI4A 4EJVA 5DV5A 2EV0A 3FMQA 1YTYA 1FSHA 4M9SA 2O0YA 2HS5A 3HTUA 2HKOA 4E70A 1P92A 3QP5A 4M74A 1P4AA 3RKXA 3LA7A 3K1PA 4OOIA 1TNTA 1MGTA 1XGOA 2P7CB 1EH7A 4HLYA 2M87A 1BI1A 3BWGA 5E1WA 3WG9A 3F8NA 4G8XA 3KP4A 5FD6A 2R7FA 2CYYA 4G6QA 3NRVA 4MNUA 3T8TA 1U5TC 2TDXA 2LNBA 4RS8A 3IKTA 3O2PE 5BQTA 4L9NA 5FLXK 2CG4A 4DNCA 2RV8A 3L09A 4I02A 1G3WA 4PGGA 1QZZA 2H94A 2Z9OA 1KQ9A 2E7WA 2FU4A 3ZPLA 1XDSA 5F1RA 3K0LA 1LJ9A 5LHHA 4IHSA 4RAYA 1IN7A 4WWCA 3AAFA 4IRIA 4LD5A 2PI0A 1R58A 3H92A 2UZKA 3C1DA 1FPQA 4LJZF 3TOBA 1PP8F 3IRQA 5ICFA 3F3XA 1FC3A 2NAZA 2BEOA 2CGPA 3KEOA 4HF1A 1O3SA 3WGGA 3FWEA 3V8LA 5LGUA 1Z6RA 1HW2A 3LA3A 2ZNYA 2ZFWA 2F5FA 2DTRA 3HRTA 2FQ3A 3I64A 3CO7C 3F22A 3FZVA 3KP3A 2VONA 2A5YB 5LEJA 1I1SA 5LRRA 2VC1A 2FMYA 3KP6A 3ABTA 4PDKA 3RDIA 4UV8A 5E1XA 3ECOA 2GXGA 1BM9A 4QLCU 3V7RA 1Z9CA 1G3SA 4MEYF 4UXNA 2H6BA 3I59B 3M7GA 3IC7A 4UVCA 2VBWA 3CLOA 1XGSA 4GCVA 3CDHA 3HYIA 5TRDA 3COAC 1B1BA 4MHGA 4HYEA 5E20A 4BQAA 2DAOA 4D0PA 2Q0OA 2A07F 2D2WA 3EQLF 4Y17A 2OBPA 1I5ZA 3RYRA 1ZGJA 1YYVA 3EDPA 1R23A 4ESFA 5D6FA 2AXLA 1NHAA 2XAHA 5BPDA 2W84A 2FA5A 1SFUA 1DP7P 4YFXF 1W5SA 1LNWA 1FYMA 3GZ5A 3BJ6A 1SFXA 1J2XA 4BH9A 2RVCA 5ERIA 4L9TA 2G9WA 1BIAA 3ZMZA 1O57A 3GF2A 3LAPA 5JVTA 2QUFA 3E6DA 1W7PA 3O6BB 2LF7A 3WTVC 3SXYA 1SMTA 2GA2A 1G6NA 3H3ZA 3QU3A 3F6OA 2G7HA 2ISYA 3I0TA 2MA3A 1LQ1A 2A3SA 3HRSA 3HUGA 4LGWA 2RDPA 3TGNA 5ICEA 4GGGA 3EYYA 4JK1X 4Z2YA 2VBZA 4JBAA 3IWFA 5A2QZ 2VE8A 1P4WA 1J0RA 3J80Z 3BPXA 3WGHA 1XCVA 2FBHA 4P96A 1V3FA 5D4RA 3BP8A 2P5KA 2FOKA 2CW0F 4HF0A 5A2QK 1R7JA 1Z1DA 4HZFA 2QQ9A 4RGSA 2W85A 1FYLA 4ENNA 2PN6A 3TKYA 3L00A 2KRFA 1KYWA 4KUMA 4L9JA 1LVAA 1ZRCA 2OU2A 5HS8A 4HLXA 4XBFA 4OIOF 5DUIA 3BJAA 2FEZA 3GFIA 3ZN1A 2P4WA 1ZAOA 4ON0A 4S05A 1WI9A 5LGNA 3ABUA 1PP7U 3F8CA 1F5TA 1HW5A 4ENMA 1FWZA 2NYXA 2K27A 5JR3A 1YS7A 5JHUA 4U7BA 1QZYA 3VB2A 1LDJA 4FX4A 4GYGA 5CLSA 2NNYA 2CSOA 1K6OA 3PQKA 4UHTA 2PEXA 5KVRA 5AONA 4IHTA 2Y0MA 5K1YA 2QM3A 1YO5C 2B0LA 1J59A 4Y15A 2P6SA 3LAJA 1ON2A 1R5HA 1Z05A 2COMA 5LLQA 2XKPA 2JPBA 1YFHA 4YG2F 3R0JA 1T98A 1XMKA 1JE8A 3KETA 3DEUA 3WU0A 1HSJA 4CDGA 4KIGA 5D8LB 2IA2A 2V79A 2L54A 2O61A 2XVCA 3Q9SA 1W4MA 1GXPA 5L3BA 1T2KA 1Y0UA 2KIFA 2IA0A 3KP5A 5J8CA 1LDKB 2UWMA 4KMFA 3JSPA 2V1XA 1JHFA 4HX8A 4O3MA 4AD9A 2M5WA 1R36A 2Q8KA 2FBKA 1OYIA 2DW4A 1I27A 3QPTA 3E5XA 4I09A 3V8JA 4XSZF 3QOPA 3KZYA 2V1UA 2CQKA 4RB3C 4CGZA 1S6LA 3ERED 3BY6A 2CFXA 3DPLC 2IRFG 1AWCA 1T0FA 3HRMA 2CO5A 1MJAA 4GO1A 2E7XA 1U2WA 1QGPA 4EQQA 3DQVC 3F8MA 3F6VA 4P9FA 3SZTA 3FM5A 3GWZA 2XUBA 4ZYEA 1SD5A 2WV0A 3JTHA 5IT9Z 4ZYGA 4IRGA 1XGMA 2ZMEA 1TQMA 1ZG1A 2DK5A 2QVOA 4IF4A 1FX7A 2XASA 2FSWA 1FZPB 1Z6TA 1TBXA 4GXOA 1RNLA 4NB5A 3ZN0A 5IT9K 2VBXA 2PLYA 4UVBA 5DDGA 3HHGA 1XN7A 2GAUA 2STTA 4RGUA 1HW1A 4UUVA 3GX4X 3RYPA 4YIFA 1JHHA 5D5XB 3M8FA 3M1EA 1SAXA 3DPUA 2EFQA 1YG2A 2DPDA 2Q2EA 2Z3YA 4BNCA 1ZG5A 2LF8A 5D5WB 2FNPA 4MTDA 2QBYA 2P5LC 4M73A 5BS6A 1FBQA 3DF8A 5LRSA 2VC0A 4A0YA 4KIFA 3LWFA 4MTEA 1VTNC 3B02A 3CUOA 1SD6A 1RUNA 3MZYA 4NHJA 2VXZA 5ILVA 2RGVA 4WK8F 1ZH5A 2LDUA 1H9GA 4DQ2A 3W6KB 2PFBA 2R7DA 2P8TA 4KA4A 3ZMSA 4LG0A 5FLXZ 2W24A 1FNNA 2HKXA 5HDGA 2D45A 4P55A 2Z5UA 2MH2A 4B8XA 5LHIA 4I2OA 1EV7A 2GIVA 2GWRA 1W7PB 5LEKA 1SMYF 2J5OA 3V8KA 3KLOA 1B9MA 5HDKA 3E97A 3ZMDA 2Y48A 3K69A 4O5VA 3VFZA 2PBIA 2K4BA 1IW7F 5KK1A 1P4XA 3WGIA 2QYOA 3DXJF 4U88A 1ZN2A 3HRUA 4R8HA 2ACJA 2RKHA 2V1DA 2VBYA 1B9NA 3T0YA 3IWZA 2GQQA 4F7ZA 4UV9A 3I5UA 1YS6A 1J5YA 4Q4ZF 5HOOA 5FD5A 2NNNA 1G3YA 1T39A 2DBBA 2HOEA 3WTTC 1BC7C 1REPC 4EV0A 5L3GA 5F6FA 5DEQA 3GW2A 4WX9A 4CHUA 4M72A 2JRTA 5TJJA 2MD5A 3HOTA 1ZG3A 3QAHA 4ESBA 3K2ZA 3GO5A 4R1HA 2A68F 3REOA 3MFKA 2DQLA 3F72A 2WWYA 3KP2A 3U1DA 3WE3A 1IF1A 5AIPA 4JQFA 4KN4X 1Z7UA 3HHHA 1GXQA 2XGXA 2DO7A 2HEOA 2H27A 3R60A 2HQRA 5HVQC 2VN2A 1RUOA 1U6GA 3HSEA 3KEQA 5LHGA 2JPCA 3VODA 4I98B 2LKPA 2A6EF 2QQAA 3LQRA 1S7AA 1WSUA 2ZCWA 3DPTA 4FT8A 2JT1A 5CVVA 2EWNA 1FP1D 2OQGA 3QPHA 3BROA 3ECHA 2F2EA 1O3QA 4A0ZA 2EA4A 2X4HA 4HX4A 1F4KA 1JXSA 1USSA 2WC2A 5HDNA 2WTEA 3RPQA 3G73A 3SZPA 1ON1A 3JTGA 4EMSA 4TV7A 3CO6C 5BOXA 2A6HF 4RB0A 3DP7A 1PDNC 3WODF 2QQBA 4I01A 5CJ9A 2OD5A 3ZQ7A 5E18F 5L3CA 4OU0A 3I58A 2MC3A 2H09A 1G3TA 2ADUA 1SD4A 5L3DA 4ETSA 1ZYRF 4BHBA 1DDNA 3HSRA 2M30A 4CXFA 3T8RA 3HIFA 5EEGA 4EM2A 3R4KA 1ONVA 3JAMZ 4PCQA 1XGNA 1R1UA 5FB2A 4EGYA 1Z91A 1OYWA 2BYVE 2OQRA 3Q5FA 2K4JA 4R79A 4AIKA 4ESJA 3BJOA 3JAMK 3ZMUA 1TTYA 4HBLA 4Q48A 3TDZC 2NRAC 1HBXG 3J81K 1ZHFA 3FMRA 1P2FA 3EUHA 5FO5A 4M9ZA 5BPIA 3GZ6A 2XAFA 4HQMA 3KLNA 2FMLA 2GA1A 2XAQA 2ZMEB 4KMUX 5D5VB 3D5LA 3JW4A 1YLFA 5DD8A 2DU9A 2IPQX 5K5QA 4ZYDA 3NQOA 3QP6A 3L2CA 4KDPA 1CF7A 1FBSA 4A12A 2AS5F 1ZGAA 1USTA 3HSFA 1J7KA 3QRFF 4WF2A 3V7SA 3F8BA 1DPUA 4FHTA 3P9IA 1J75A 1IN6A 4L0YB 1R00A 4WXDA 1K79A 1S3JA 4I0BA 2KKOA 3U2RA 2JSCA 1HQCA 3KFWX 3P9KA 1MZBA 2XRNA 5IT3A 4RB1A 2QBYB 4EM0B 1E2XA 1FYKA 5ICGA 3IL2A 4OMZA 4XLNF 1HKTA 3DV8A 3O3KA 5J6XA 4M9XA 4HV5A 1UHMA 1W5TA 3TO9A 1E17A 4Q47A 3WTZA 2EFNA 4NQWA 4L18B 2RNJA 1I1GA 1UHWA 2M8EA 2EK5A 1XD7A 2XROA 3PQJA 2L02A 5HS7A 4EVIA 4A6DA 3LQQA 1ZLKA 3ULQB 4LFUA 1IN5A 4LG0B 2FNAA 2LSOA 1FT9A 3T5XA 1SFEA 2VODA 4BYYA 2HWVA 1X3UA 3K9TA 1T6SA 2PMHA 3C3WA 2JTVA 1WWXA 1BIBA 1HXDA 2EFOA 1F1ZA 2ZBKA 5CYVA 1U78A 1RI7A 5BMZA 4ENJA 6PAXA 2FXAA 4U0YA 2OZUA 2O6GE 3TO7A 3PFIA 2ELHA 1DUXC 1T38A 4OMYA 5H20A 4WXCA 2QWWA 4U7DA 2F5EA 2FRHA 3TOAA 3Q9VA 4ASNA 1EH6A 5HLIA 1BI2A 4KFCA 4A0XA 1TLHB 2DLLA 1B4AA 4KIBA 3J7AO 2O3FA 2KJBA 3TDUC 2HYGD 4RB2C 5CVUA 4M71A 3RKWA 4IJAA 1O3RA 2C6YA 2HZTA 1S7OA 2P7VB 5D4SA 3GYHX 3M9AA 4BHCA 4I7HA 2ZNZA 1FLIA 2XKOA 2HFHA 3E6BA 3BOQA 4N9IA 4AVPA 4N9HA 3GLXA 1H9TA 5L3EA 3FM3A 4I0AA 1GHCA 5K5RA 2NS0A 2E1NA 4LLLA 3V4GA 1STZA 2HGCA 2RN7A 1W7PD 1OYYA 3CUQB 2ESHA 3FXUA 1C0WA 5JFRA 2K7LA 4O6JA 3WTWC 1MDMA 1MJBA 4LB5A 3E5UA 1ZREA 1TW2A 2YX7A 1AOYA 4WXHA 1ODDA 4A5MA 2XAJA 4KN7X 3R6SA 4LK1F 1U8RA 2XV4S 4MQ9F 4AIHA 1LB2A 2CWEA 1F9NA 1I6XA 1TW3A 1GVJA 4HAMA 5CVJA 4OIPF 3GXOA 3F23A 2MLKA 4RGXA 4FX0A 2MLGA 3QU6A 1B59A 4LK0F 5HS9A 3C7JA 3F8FA 2BV6A 2UXNA 5HLGA 4BHPA 1G4DA 3L9FA 1LEAA 1IAWA 4KICA 3MZHA 1ZRDA 2XHKA 3E5QA 4CYDA 4BXUA 1BOAA 3FX3A 4K2EA 1UCRA 1BBYA 3WTUC 5ICCA 1FSEA 3KP7A 1OMIA 1TQIA 4OIRF 4A2UA 3W6JB 2ZKZA 4BAYA 1FOKA 4OIQF 3E3VA 3GVAA 2J5PA 1XDUA 4M6YA 4KNYA 2DK8A 3ZP5A 1XSVA 2OA4A 3P7NA 2PMUA 2DI3A 3U9GA 2P5VA 3R61A 4P9UA 5K5OA 1KU3A 3P9CA 4Q5SF 5CVRA 1JGSA 2RC4A 1ZRFA 4EJUA 5E17F 3T1BA 3WU1B 3M8EA 4CZZA 1UB9A 2MBFA 2OZ6A 1R5GA 1OR7A 3N4MA 2QLZA 4G94A 3NEUA 1QQIA 2ZJ2A 4HOBA 3RPUA 4ZH4F 4PGHA 3CUQA 3RKYA 2DQRA 2W57A 1J9IA 2HR3A 2Z99A 4WCGA 4EJTA 3RIRA 2MH9A 2HTSA 3RJPA 3VEPA 4PZJA 5FFZA 3D0SA 1KU9A 2VT3A 1CF7B 2A69F 1IXCA 3ZMTA 2HYFA 1QNTA 3SHFA 2XIGA 3GFMA 1MD0A 3LSTA 1S29A 3BPVA 2VE9A 1RIOH 4U0VA 2EV5A 3GFJA 2EA2A 2ZXJA 4HW0A 3IHUA 2V9VA 2Y75A 4P5OA 4UNOA 4Y13A 3LA2A 2VOPA 3IRRA 4A6EA 1ZARA
chains in the Genus database with same CATH superfamily
4IL8A 5EEHA 4L5JA 2O8XA 1K78B 5H6RA 4KT5C 5GPCA 4A3BJ 2H4LX 5EZHA 2VI6A 2B63J 3G2BA 1XB4A 5J1UA 1O7FA 1ZLJA 3GFLA 4ZTJA 4QG5A 1U3EM 2E35A 3LFKA 1XPXA 2DFHA 2L4MA 2XC7A 1IN4A 3BG6A 3RQ4A 1DQUA 2E1CA 2MYSA 3ISPA 3RTRA 1SFKA 1WKMA 3WHBA 1W36C 2KQRA 3HTSB 3OWTA 1K6YA 1N75A 5E3LA 1IXSB 5DM7F 2BE5F 4HG2A 2K86A 4NQWB 3A0BC 2P6TA 1RR7A 1ZK8A 2R7OA 3FXQA 3BZ6A 1VQKI 2UV1A 3HKZA 4LG3A 4I99C 2H6CA 4PJLA 4L0ZB 1KYZA 1ULYA 4NC7A 5LBQA 4G9YA 4NNJA 3ZQIA 1QN8A 2OC6A 2ETHA 4AVZA 2XPVA 1IRGA 1XCBA 2IT0A 3VSLA 2VJJA 4B3AA 1FMVA 4HX7A 1XSDA 1DPRA 3TO6A 2OTJI 5DUKA 3VPRA 2D1VA 1ETWA 2EILH 4HDUA 1XMAA 1X3WB 3CTAA 4BQNA 5JHFA 2EIKH 1KQ8A 3HS8A 2HTJA 3NA5A 4QIWN 4NDLA 2COBA 3K1NA 4DULA 2X0LA 2BY1A 4FQGA 1KY7A 2Y9YA 2F5CA 1U5TB 1AA7A 4AIJA 2JSPA 4XICA 1F43A 1MJ9A 3KE2A 3OIPA 1KU7A 1B6AA 3UR3C 2DKAA 1WJBA 1TBPA 3X2QH 2IS6A 1YQAA 1IV6A 3I3WA 4HDVA 3GUDA 1VOKA 5J4YA 1ETQA 2M45A 3MWMA 3ZXSA 3BR0A 1VQOI 1YW7A 4HQEA 3SEZA 2KIUA 1IRFA 1XTAA 3OL4A 1A31A 3B73A 1JKRC 1NH2A 1R1TA 3J81Z 2IGKA 1MPGA 3K1MA 3KCCA 1RZ4A 3V7CA 3LSPA 5J3LA 5BMNA 2YSRA 2K02A 3GEZA 4RLFA 1D5VA 4A5NA 3FF5A 1UL7A 1PVEA 5IOZA 2NS8A 3S14J 1BI3A 2IBDA 5HODA 4LOCA 1L3LA 4LLNA 1HKQA 1TQPA 1N78A 4L5EA 4AWXB 3HOXJ 5L3FA 4E7SA 2NOHA 1D5YA 1A04A 4LLGF 1K7AA 2KZGA 2P0WA 1RKTA 2R7TA 3E6MA 3BT9A 1OR7C 4XRFA 2ZO4A 4D1QA 2STWA 1Q1HA 2GZWA 4JYKA 2G7UA 1WRJA 2IVMA 4QWQA 2PQ8A 4G7HF 4WX8A 2O03A 4U0WA 1K61A 2YU9J 4YFNF 5ILSA 2F4IA 5DD4A 1PUEE 1IUYA 3PSIA 2DYRH 4E7HA 5IP9J 1D8JA 2VJ4A 1KU2A 3OR2C 4RGRA 2ZJPF 3ZMVA 3M07A 3W2VA 2VOOA 4EJOA 5DCMB 4EAKA 3HM5A 2CQXA 3J80K 1QBJA 2E2HJ 3FKJA 2F5DA 2R5YB 1DP3A 2VKEA 1KA8A 2L3DA 5FRMA 1WJFA 3L7WA 3CUQC 1T8IA 4BE1A 1HKSA 5E8GA 1QN4A 3MAJA 1MBKA 1S8NA 3F21A 1V5EA 1OCTC 5BMPA 2ZJRF 4B09A 3I59A 2O8KA 3I4PA 5FGMA 3F9KA 3BTIA 4IVNA 3M3YJ 5D8KB 1R4NB 3RPJA 3VWBA 2IV8A 3C18A 4HV6A 1U9NA 2QGUA 1ETKA 2V26A 3RSMA 1CDWA 4Y7NJ 2VT2A 4MGRA 1VI0A 2JN6A 3CCJI 2HVQA 4TPSA 2DT5A 2V1NA 2OCCH 5B1AH 2IA1A 4XKVA 1CGPA 1YW8A 2ZFDB 1EBMA 3FBNB 1ETXA 4ENKA 2CS3A 2YU3A 4M6XA 4B3XA 1YIOA 3LMMA 1EH8A 4S04A 2X9DA 4QPQA 5AIQA 1BR1A 1XC5A 1MDMB 2X85A 3QODA 4G6DA 4ZZLA 4XLHA 3JRFA 3DFGA 4L5IA 1OPCA 1K78A 2L4AA 3S16J 1E0EA 1FY7A 5IPAA 3JRDA 2V6CA 1ENHA 1FBUA 4F91B 2DOAA 3SFZA 4OINF 1BJAA 4B1RA 2R7RA 4W1UA 4IPAA 3I71A 4EALA 3H3UA 4HF2A 3LSKA 4CICA 1TNSA 5ED4A 2DPUA 3EYIA 1IZ1A 1ZKGA 5E1ZB 2UXXA 3VOEA 3CMMA 3WTYC 3E6CC 1R22A 2BBYA 5F64A 3S1RJ 4MEXF 2A61A 1T6AA 5F08A 1IN8A 4L9VA 4XLPF 2FE3A 1NVPA 2YX4A 3ML6A 2L01A 1D3YA 5E8IA 3S2DJ 4PSWA 3GCMA 3W2AA 2FBIA 1WHUA 2YR2A 3BCBA 5F1JA 3N97A 4YIIA 4E7JA 4DIQA 2HQNA 3OV8A 3F0ZA 4M3FA 2LH9A 5ILUA 3C04A 1HDDC 5F0FA 1VQMI 1JGGA 1ZQ3P 1Z7LA 4LMYA 1LEBA 5GAEJ 4LB6B 3OYEA 4M3BA 5LGTA 1O7LA 1LVKA 2JHNA 2FF4A 2N8GA 3LSGA 1X1DA 3TEDA 1QPMA 1WQ2A 2PG4A 2ISZA 1L0OC 2IJLA 2ESNA 4GYIA 3OS1A 2EV6A 2XB0X 1YRNB 2FGTA 1TWAJ 1QRYA 1U5TA 3ENOC 3L1PA 3BG9A 4XONA 3S1QJ 2Z33A 3S2WA 2OAZA 1OCOH 2BGCA 5CVIA 1OKRA 1FP2A 3OOPA 1UFMA 1O3TA 1BN5A 3MCZA 3FXRA 1KQ0A 2EJRA 1KGSA 1UZCA 3FMSA 1WJAA 2X6WA 5HLHA 4GDFA 1W0TA 1MW7A 3G1LA 4N0BA 2CUZA 4EJWA 5DYMA 4N4NB 4C3IJ 1P6RA 2HPIA 4BY1J 2DYSH 3HOZJ 2NOEA 2A5WA 1V4RA 2DJNA 3BDDA 4KJZA 4CO8A 1D8KA 2EZIA 4BXFA 2E71A 3TDHA 3DKWA 2JZYA 1H0MA 1HOMA 4B4CA 5JI6A 3G6EI 3R0AA 2W25A 1RETA 1A5JA 2V92A 3SQNA 3ELKA 3EETA 3CCVI 4G7OF 3QPLA 1JTXA 2QENA 1QU3A 1Q1VA 1TP4A 3MQ0A 1QN9A 1IRXA 4FCYA 4EGZA 3PO3J 2R3SA 3HZJA 2ZJQF 2HL9A 2V9KA 2XAUA 3C2GA 2IW5A 2XPWA 3MEXA 1JUMA 5D6EA 5H6QA 4IKFA 3HKZN 1MMDA 4HA8A 2GXBA 4E6KG 1YX3A 1YW9A 2M9HA 5GP9A 5DCFA 5DCMA 5FFXA 2KLOA 2YPRA 2LBFB 4EM1A 2EFWA 2IP2A 3I9V2 3HDDA 2R5YA 3IKVA 2KIMA 3CWAA 4HNUA 1FJLA 2HDWA 2NVYJ 1LUJB 3TQNA 3OMYA 4XSXF 4C2MJ 2VLAA 1QHHD 2I10A 1QPIA 3CDLA 3CJNA 4IXAA 1MKMA 3WTXC 3GTJJ 3ROUA 1GV5A 1MH4A 1IXRC 3TW6A 2KHMA 3HOSA 3CF5F 4KYWA 4RAZA 1K2YX 4H0EA 2RQPA 2XAGA 1HSTA 3PIOF 4UVAA 5D5UB 2ZC2A 2EB7A 3CWSA 4BQQA 1W5CC 1QO0D 2X6YA 3PNYA 4ZZDA 5M5XJ 4G7ZF 2Z0FA 3I53A 4UUSA 1SD7A 3QOEA 4BGDA 1R1VA 3G71I 2BXZA 3CP8A 2HQAA 4IRHA 2K85A 4OWRB 3TP0A 5JLWA 1BI0A 1BC8C 3J7AY 2WY8Q 2DFIA 1XSXA 3KZZA 3M8JA 2KJCA 4BJ5C 3WTSC 4ZYHA 2HDCA 2KZVA 2O3OA 4D7QA 3DEWA 3H1CA 3IH3A 3WE2A 5EDNA 2BW3B 4YFKF 3OYGA 2QZ8A 3K70C 1LDDA 4BJ6C 3I54A 2L0KA 3LSIA 2L9VA 1OJLA 4MQVA 2D1HA 2EFPA 3G3ZA 2M1BA 2DA4A 3DBHB 5J8FA 3FHZA 2L7KA 4W97A 3JSOA 5K7FA 2PJPA 3RI4A 3MKLA 4EJVA 3LNQA 1B8IB 2PWWA 1JKPC 5DV5A 1HLVA 2EV0A 2QEXI 3FMQA 5TISC 2NOZA 2JVGA 4MIMA 1YTYA 1FSHA 4M9SA 2R7XA 2O0YA 3I56I 2HS5A 2W48A 4CCOA 4F52A 1F36A 2BY2A 2HKOA 3HTUA 3KRMA 3RKQA 4N4OB 1QNBA 4E70A 1P92A 3QP5A 4M74A 2KT0A 3FKIJ 2MGQA 3H9QA 4ZYAA 3DEEA 1P4AA 1XG1A 3RKXA 2D5VA 1MBFA 3G4SI 3LA7A 4XRSG 2M7AA 3LSMA 3K1PA 1B9KA 2YS9A 1D1AA 5LFAA 5FLMJ 1OCCH 4C9YA 4OOIA 1TNTA 1MGTA 3HOWJ 1XGOA 2P7CB 4KT6A 3VSKA 1EH7A 3SDGA 4HLYA 3ASNH 4PJMA 2M87A 1MBHA 1HCRA 1BI1A 3BWGA 5E1WA 5KHDA 4IHWA 2QREA 3WG9A 3F8NA 2R4GA 1WFXA 4G8XA 4J19A 1YRNA 3KP4A 5FD6A 3Q0VA 1WJ5A 2BZTA 2R7FA 3OH9A 2CYYA 3H5AA 2YH5A 1RR8C 3FK7A 3LFUA 1J3MA 2IEKA 4F92B 4G6QA 4X6AJ 2RAEA 1VKLA 4RMNA 3JRAA 3NRVA 1FTTA 4MNUA 3B6AA 2I5UA 1CQTA 2NOLA 5JVGF 3T8TA 1U5TC 3UKGA 2TDXA 2LNBA 4MO7A 2MSYA 4RS8A 3IKTA 3FISA 3BLYA 3O2PE 5BQTA 1S72I 1ETYA 4L9NA 5FLXK 1MIJA 2CG4A 3ESWB 4DNCA 3SZGA 1H8AC 3PNTA 3OYNA 2NWVA 2RV8A 2XGCA 3L09A 4I02A 2K9QA 3ERMA 1QHGA 1G3WA 2XHIA 2EZKA 4ROCB 4PGGA 1QZZA 2H94A 3PL8A 4CSWA 2XSDC 3K70D 3S3NA 5CQEA 2Z9OA 5M5YJ 2G30A 1C9BB 1KQ9A 2E7WA 2FU4A 1HU0A 3CC7I 5IYDJ 3M4OJ 1E42A 3ZPLA 1XDSA 5F1RA 3K0LA 1LJ9A 5LHHA 4GFBA 4RAYA 1IN7A 4WWCA 4IHSA 3AAFA 4IRIA 2QA4I 4LD5A 2PI0A 2JHJA 1R58A 1A35A 3H92A 2UZKA 3C1DA 1FPQA 1PJRA 4LJZF 3K4CA 2V4JC 3TOBA 4Z6YA 3VDXA 1PP8F 4IQJA 3IRQA 5ICFA 1BOBA 4HSTA 3F3XA 2K3FA 4BEHB 1FC3A 1HA8A 2Z16A 1VQ8I 1TWFJ 2BEOA 2NAZA 3ASOH 4A3FJ 5KAIC 2HOAA 3KEOA 2M0MA 2CGPA 3CCLI 4HF1A 1Y1VJ 1I39A 1KY6A 1O3SA 4CYCA 1PCJX 5C3EJ 1VFCA 2WA0A 3WGGA 2FJ1A 3FWEA 1YJNI 3SNSA 3V8LA 5LGUA 1Z6RA 4FASD 3DU6A 4YEJA 1HW2A 1YTBA 2DA5A 1AKHA 3S17J 4II3A 2JA6J 1VOLB 4D5FA 3LA3A 2ZNYA 4CA0A 3CJRB 4CCLA 4EEFG 3IH7A 2ZFWA 2NVUB 2F5FA 1VF9A 2DTRA 3HRTA 3BTCA 5EGOB 2FQ3A 3I64A 2W82A 3D5RC 3RZOJ 3CO7C 3T4NA 2HU9A 3F22A 4KISA 1D0XA 3FZVA 1QZEA 3KP3A 2VONA 2A5YB 5LEJA 1B8IA 1I1SA 3KIOA 1QN7A 5LRRA 2VC1A 2DMPA 2FMYA 3KP6A 2MD0A 3ABTA 4PDKA 3RDIA 4CCKA 4UV8A 1D1BA 3LSJA 2LRDA 5E1XA 3ECOA 2GXGA 1BM9A 4QLCU 2CV2A 3V7RA 5H2FC 5JN5A 1Z9CA 3CQZJ 1G3SA 4MEYF 4UXNA 2H6BA 3I59B 3K4MA 2EH3A 3VYTB 2DCEA 1PUFB 4XMYA 3M7GA 2CU7A 2VBWA 3IC7A 4UVCA 4IX7A 3CLOA 2W4SA 3CVTA 2RNGA 5B5EC 2F4MB 1XGSA 4PJNA 2BY3A 1OLTA 2L9RA 1R6RA 2ZSHB 4GCVA 1ITYA 3CDHA 2DA3A 3HYIA 4JX4A 3LSRA 3KYDB 2D0AA 4A3JJ 2VPRA 2Y30A 5TRDA 3COAC 2Y69H 1B1BA 4MHGA 2M7BA 4HYEA 5E20A 4BQAA 2DAOA 2RQQA 4XQFA 1DU0A 1O4XA 1LPQA 3PO2J 3JREA 1SVOA 4D0PA 2V7FA 2XSJC 5M3MJ 2Q0OA 2A07F 1ZR4A 1R5ID 2D2WA 2E34A 3IV5A 1LE8A 3EQLF 4FISA 4RAFA 4Y17A 5CQGA 3D1NI 2OBPA 2DKDA 1I5ZA 3RYRA 1ZGJA 1YYVA 1R49A 1BA5A 3G1MA 3DLAA 2LYCA 5GTHC 3H5RA 3EDPA 1R23A 4ESFA 3TMOA 2TCTA 5D6FA 5IYBP 2QRCA 3AG3H 1OQYA 2AXLA 2OUMA 2VQHA 1NHAA 2XAHA 5BPDA 2W84A 4YRVA 2FA5A 1SFUA 2PX9A 1DP7P 3FBIB 4YFXF 1W5SA 2JK3A 3CMEI 1LNWA 1FYMA 3GZ5A 3CCRI 3BJ6A 3JRHA 1SFXA 1J2XA 2MG4A 1BW6A 4BH9A 5DTDA 2LKSA 4ZDLA 2RVCA 5ERIA 4L9TA 2QSHX 2G9WA 2XPUA 3CCUI 3ZQLA 1NK2P 1Z0XA 4P1WA 1BIAA 5K7HA 3ZMZA 4HNVA 2HL8A 1O57A 3GF2A 2B7EA 3LAPA 5C4XJ 3DTKA 1U8BA 5JVTA 2QUFA 3E6DA 2JMWA 2DT6A 1WJEA 1S7EA 1W7PA 3I4MJ 3K4KA 3O6BB 1T95A 2LF7A 3SYTA 2GIZA 1VZ0A 3WTVC 1N3CA 3BR1A 2O5RA 3SXYA 2JWTA 1SMTA 2HXOA 2GA2A 3AL0C 1G6NA 5EJCA 3H3ZA 2BY0A 5EZGA 2GLOA 3QU3A 2EQRA 3F6OA 3U1KA 2G7HA 2M4GA 2ISYA 2EHBD 5KL0A 1M3HA 2YUSA 2K9SA 2LOOA 3GBGA 1VQNI 1M3QA 3I0TA 3BCAA 1ERDA 2MA3A 2WB1A 1YQKA 2KFDA 3KPHA 4A3GJ 4BEHA 2DODA 2KDZA 1LQ1A 2A3SA 3HRSA 1YQLA 1BR4A 3HUGA 4LGWA 2F6CA 2LREA 2RDPA 3FK6A 3TGNA 5B66C 4XIDA 4AM3A 2Z2SB 5ICEA 4GGGA 3QYEA 3EYYA 4ANJA 4HRIA 4JK1X 4Z2YA 3VYSB 2VBZA 4JBAA 3IWFA 1QN6A 5A2QZ 4MLOA 2VE8A 1P4WA 1J0RA 2M3AA 2XGEA 3J80Z 2KDOA 3QYBA 2MABA 3H9JA 1WGXA 3BPXA 3WGHA 1XCVA 2FBHA 4HJHA 4P96A 4B44A 2HDDA 4I76A 1V54H 3K4BA 1ZR2A 1WJDA 2ZB9A 1V3FA 5D4RA 2CV1A 2G0EA 3BP8A 2P5KA 2FOKA 2R92J 2CW0F 5FJ8J 5EGOA 3L2QA 4HF0A 5A2QK 1R7JA 4E4HA 1MMSA 4U87A 3EUKL 2NLVA 1Z77A 1Z1DA 1SAUA 4FTHA 3OYFA 4HZFA 2QQ9A 3O8HA 3HS9A 4RGSA 3L2RA 1W36D 2W85A 4BE0A 1HDPA 1FYLA 2MJ7A 2QLVA 3FXMA 2DFFA 4ENNA 2ZXWH 2PN6A 3TKYA 5K7ZA 1QVTA 3L00A 5FKOA 2KRFA 3S1MJ 3BG3A 1KYWA 4KUMA 4L9JA 4X0GA 1PUFA 1LVAA 3K4NA 1ZRCA 2OU2A 4IL6C 3J7YJ 3P5JA 5HS8A 4HLXA 3JRGA 2DMUA 4XBFA 4UUSB 4OIOF 1MMNA 5DUIA 3GZNB 3BJAA 3CVSA 2FEZA 3GFIA 5E79C 3ZN1A 3HGYA 2E2IJ 2P4WA 3OR1C 1ZAOA 4ON0A 4JP0A 4S05A 1WI9A 2KRHA 5LGNA 3ABUA 4MRQA 1PP7U 2Q1ZB 3HXLA 3F8CA 3PFYA 1F5TA 1HW5A 1I3AA 4ENMA 4V19K 1FWZA 2NYXA 2K27A 5JR3A 2V9JA 1YS7A 5JHUA 4U7BA 1QZYA 1TBAB 5IYDP 3VB2A 4F55A 4XKBA 1K83J 2HOTA 1LDJA 1SVMA 4FX4A 5FLVA 1Y8QB 4GYGA 4XORA 2HQ5A 5CLSA 4ZDPA 2NNYA 2Q2EB 1W0UA 2CSOA 4XL9A 1K6OA 2FOWA 3PQKA 4UHTA 3DLLF 2PEXA 5KVRA 4EJZA 1Y0NA 2X1EA 3PSFA 3ZQHA 5AONA 5KCMA 1D1CA 1ETOA 4IHTA 2Y0MA 2QM3A 5K1YA 3OS2A 1YO5C 2AHQA 3HGGA 2B0LA 1G59A 2HI3A 1UAAA 2QSGX 3BR5A 1J59A 4Y15A 3ZQCA 2P6SA 3DWLE 3LAJA 1ON2A 2ID3A 1JJ6C 3ULXA 5KAFC 1QN3A 1R5HA 1Z05A 2COMA 5LLQA 2XKPA 2JPBA 1YFHA 4UB6C 3AKZA 4YG2F 3R0JA 1T98A 2LR8A 1XMKA 2H8WA 4M3DA 4ROEB 3F10A 1JE8A 3KETA 1SVLA 4XRSA 3DEUA 3WU0A 1HSJA 3BZCA 4CDGA 2QKLB 1KFQA 4KIGA 4WZSD 5E3MA 3SJMA 5D8LB 1UG2A 1RRJA 1EUVA 2IA2A 4AC0A 3DU5A 5IP6A 5E3NA 2V79A 2K5CA 4ZC3A 2BVLA 4DYCA 5KNLA 4PFOA 2L54A 2O61A 2XVCA 3RPUD 3Q9SA 1W4MA 1GXPA 5L3BA 1T2KA 1TL8A 1IG7A 1NGMA 1Y0UA 2KIFA 2IA0A 3KP5A 3DTEA 5J8CA 2KP6A 4AYBA 2R93J 1LDKB 4AUXA 2UWMA 4KMFA 3JSPA 2V1XA 3ENCA 1JHFA 4HX8A 3KZIC 1KFIA 2LC2A 4Y33A 4O3MA 5J1YA 5IYCJ 3HEFA 1UJ8A 4X1EA 4AD9A 2M5WA 1H88C 4IHXA 3OLPA 3DBRB 1R36A 2Q8KA 2FBKA 3TW7A 1OYIA 2DW4A 1I27A 2AXTC 3QPTA 3E5XA 1R9TJ 3AL0B 2IV9A 4A3IJ 4I09A 3V8JA 4XSZF 4BXXJ 3QOPA 3KZYA 2VUMJ 2V1UA 2CQKA 4RB3C 4CGZA 1S6LA 1MNDA 3ERED 2CH0A 4HPQA 2X6XA 3BY6A 2CFXA 4EATA 3DPLC 1R71A 1SFOJ 2IRFG 1AWCA 1T0FA 3HRMA 3DCFA 4BQOA 1M5Q1 2CO5A 2E1OA 4RLQA 1N25A 1MJAA 2Y0SA 2E7XA 4GO1A 1U2WA 1QGPA 4XOPA 4EQQA 3DQVC 4M3GA 4XR6A 3F8MA 3F6VA 1TGHA 1TC3C 4P9FA 3RCOA 3SZTA 3FM5A 1YJ9I 3GWZA 2XUBA 4ZYEA 1SD5A 2WV0A 4PY5A 3HOUJ 3JTHA 5IT9Z 4BDYA 4ITVA 4OAZA 4ZYGA 1YQMA 4IRGA 1XGMA 2ZMEA 3IH2A 1PZDA 4CYCB 1TQMA 1ZG1A 2DK5A 2QVOA 4IF4A 1FX7A 2XASA 2RREA 3OSTA 4M6VA 2FSWA 4I6ZA 3OOUA 1FZPB 2NOJB 2WBMA 2BOLA 2DFEA 2NOBA 1Z6TA 1TBXA 1AKHB 2NVXJ 4E7KA 3D4VA 4GXOA 4HSRA 3UNGC 1RNLA 4NB5A 2R7SA 3ZN0A 1UHSA 3BTLA 1TT5B 5IT9K 2KMUA 1ZELA 5B1BH 5DS9A 2VBXA 3SDBA 3NWTA 2PLYA 2VKVA 4BU2A 4UVBA 2WB1N 4XKCA 5DDGA 1Y6IA 2BHZA 2K3PA 3HHGA 3DKXA 2LD5A 1XN7A 1GUUA 1NTCA 2GAUA 2STTA 4RGUA 2X48A 1HW1A 4UUVA 5BNGA 3GX4X 3RYPA 4Y52J 3OYCA 3JRIA 4CFFA 2DT7B 4BKXA 3CWUA 4YIFA 1JHHA 5D5XB 4LIVA 3M8FA 3M1EA 3DPUA 1SAXA 4BBSJ 2XF5A 2EFQA 1LXTA 2BVMA 1YG2A 2DPDA 2Q2EA 4XN0A 3BC8A 1IC8A 2Z3YA 4BNCA 5GADJ 1ZG5A 2LF8A 2JPIA 5D5WB 2FNPA 4PSXA 3HC7A 1EA3A 4MTDA 2QBYA 2P5LC 4M73A 1P7IA 2R7QA 3I55I 1MSEC 5BS6A 1FBQA 3DF8A 5LRSA 2PJRA 2VC0A 4A0YA 4B47A 3GTQJ 3BG5A 4KIFA 1ZGWA 2NVMA 4IEJA 3LWFA 1OCZH 4LITA 4MTEA 3L2WA 3B02A 3CUOA 1VTNC 1OCPA 5EYRA 4F93B 3S3OA 5F9CA 1SD6A 4AU7A 1B72A 1WCMJ 1RUNA 4XM3A 3MZYA 5HLTA 3OYIA 4NHJA 1K4SA 2VXZA 2FKMX 1LE8B 1XS9A 5ILVA 4C2TA 1A6QA 2RGVA 2HOSA 4WK8F 4A93J 3CWTA 1ZH5A 2Y2ZA 2LDUA 3EIKA 1H9GA 2V8QA 4DQ2A 3W6KB 4FETA 1QA6A 2PFBA 2R7DA 2P8TA 1EKEA 4Y3OA 1R4MB 4KA4A 1G8XA 4C2UA 3ZMSA 2ID6A 3FXJA 4LG0A 5FLXZ 2JA7J 5J1RA 2W24A 4II2A 5EG0A 1FNNA 3OIOA 1I3QJ 3DKYA 3V42A 4A69C 1GT0C 1QTPA 2LLKA 2HKXA 3I4NJ 2Y8QA 2CUEA 5HDGA 3AFHA 2D45A 1VQ4I 3BZKA 4P55A 4G12A 2KRCA 2Z5UA 1A36A 3OYHA 2MH2A 4RM3A 2HZMA 3TBIA 3D7QA 1AHDP 4PJJA 4B8XA 2MFZA 5LHIA 4I2OA 4A3MJ 1EV7A 2LTPA 4CUGA 2GIVA 2WAQA 4PUSA 3A1YA 3A0HC 2GWRA 3VYUB 4IHVA 1W7PB 2CW7A 5LEKA 1SMYF 1MBGA 2J5OA 3V8KA 3KLOA 1B9MA 3IUOA 5HDKA 3E97A 3ZMDA 2Y48A 3K69A 3K6GA 4O5VA 3VFZA 2JRMA 2PBIA 3OC3C 2E5NA 2K4BA 2L9NA 3E0JB 3GTPJ 1IW7F 5KK1A 1P4XA 1WQAA 3WGIA 4PK4A 3LSHA 2QYOA 3DXJF 2ELKA 4U88A 1U0JA 3MKYB 4D7RA 1ZN2A 4DGWB 3HRUA 2DA1A 1I50J 4JX5A 1TT0A 2ECBA 4R8HA 2ACJA 3OYDA 3ZGKA 2RKHA 1E3HA 2V1DA 3GMEA 2VBYA 1B9NA 2CRGA 3HJEA 2NVTJ 3T0YA 3PJRA 3IWZA 2GQQA 3RZDJ 2JUGA 4F7ZA 1BL0A 4UV9A 4A3DJ 1T0FC 3HUGB 3I5UA 4DYRA 1YS6A 1J5YA 4Q4ZF 3FHNA 1Z3YA 2VPLA 3CESA 1IDZA 3KTUA 5HOOA 5FD5A 2NS7A 2NNNA 1G3YA 1T39A 2DA2A 2DBBA 5EF6A 2HOEA 3WTTC 1YITI 1BC7C 1REPC 1Y56A 4ZDOA 2QQ8A 4AYBN 2ME0A 5F27A 4EV0A 3KYLA 2GM4A 1GVDA 5L3GA 5F6FA 3TL4X 5DEQA 2ZMEC 2JA5J 4A3EJ 2NVQJ 3GW2A 4WX9A 4A3CJ 4CHUA 1IGNA 4XOTA 4M72A 1SC7A 1LFUP 2JRTA 5CPRB 3WU2C 5J47A 5TJJA 2QRDA 3MN2A 1RC9A 1X4OA 2MD5A 3WG7H 3HOTA 3RSNA 2IXSA 1ZG3A 3CLQA 3QQAA 3QAHA 4ESBA 2LMDA 3K2ZA 3N89A 1P5GX 1NG6A 3GO5A 4R1HA 5AN4A 1IUFA 3F0CA 2A68F 2CV0A 3REOA 1RPWA 2QF7A 3MFKA 1K4TA 3QYFA 2L5QA 2DQLA 3F72A 3ZR8X 2WWYA 3CMAI 2OV7A 2EBIA 1YE9A 1D0ZA 3S3MA 1WI3A 1VQ5I 3N05A 2PMZA 3IAS2 1X1CA 4G6TB 4RAGA 5J40A 3U21A 3KP2A 3U1DA 2E19A 4D9JA 2K40A 3WE3A 1IF1A 5IY5H 5IYCP 2E1MB 5AIPA 4IZZA 4RBOA 4DBQA 1AU7A 2B9SA 1TWHJ 2XRLA 2HZDA 3PM1A 1W1WE 2Y0SN 1JUPA 1IJWC 2VXDA 2WV1A 3BR2A 1LKXA 2EIJH 1Z7UA 4JQFA 4KN4X 4HNTA 3HHHA 1GXQA 2AQEA 5CKTA 5FKNA 2GXAA 2XGXA 2DO7A 2LAEA 2HEOA 2H27A 1A6IA 3R60A 2HQRA 5HVQC 2VN2A 3S2HJ 1AISA 2VKHA 3DBLB 2CFOA 3A2KA 1RUOA 1U6GA 3HSEA 3LOCA 3KEQA 5HNFA 5LHGA 2JPCA 3VODA 4MFDA 4I98B 2LKPA 2A6EF 2DA7A 2QQAA 3CCQI 2R5XA 3LQRA 1XMXA 1S7AA 1JFIC 1WSUA 4IOAF 4C3JJ 1FOXA 2ZCWA 5FRNA 2OPTA 1TUOA 3PDKA 3DPTA 3I3LA 3SFIA 4FT8A 2XB5A 3PNVA 2JT1A 5CVVA 1VQ7I 2EWNA 3L2UA 1FP1D 2OQGA 3QPHA 3BROA 3ECHA 2F2EA 1O3QA 3OH6A 1Y8RB 4UY8I 1RM1A 1YJWI 1BR2A 4M3EA 4A0ZA 2EA4A 2X4HA 3C2HA 2X1DA 3NAUA 2R5ZA 2WAFA 3D5SC 1JDYA 3ONQA 2M0CA 4HX4A 1F4KA 2KPMA 2QSFX 1JXSA 1USSA 2MC4A 2WC2A 5HDNA 2YA3A 2WTEA 3A4CA 3RPQA 3G73A 5M3FJ 3SZPA 4Q11A 1TWCJ 4RA2A 2L7MP 1ON1A 3OIQA 4WXAA 2CMPA 2VL8A 3JTGA 2WAEA 3GTLJ 4B43A 4EMSA 4TV7A 3CO6C 5BOXA 4CCMA 1JTYA 1XX5A 2A6HF 4RB0A 3DP7A 3ABKH 2NOFA 4BY7J 1PDNC 3WODF 2QQBA 2DXIA 4I01A 5CJ9A 1X3ZB 2OD5A 3ZQ7A 1NH3A 4EAJA 5E18F 1SANA 5L3CA 4OU0A 1T56A 5C4JJ 5F0CA 3I58A 2Y9ZA 2MC3A 3OYMA 2H09A 1G3TA 2ADUA 1JKQC 2BHYA 1SD4A 3Q3SA 2CJJA 3OSGA 5L3DA 4ETSA 5TGTA 1JKOC 1ZYRF 4BHBA 1DDNA 3HSRA 1P9QC 2M30A 4CXFA 3T8RA 3HIFA 5EEGA 4EM2A 3ZQQA 1YQRA 3R4KA 1ONVA 4I8OA 3JAMZ 4PCQA 4RDUA 1XGNA 2WY7Q 4JX6A 1R1UA 5FB2A 4EGYA 2D0CA 1ZTRA 1Z91A 1OYWA 2BYVE 2JVHA 1Q9UA 2OQRA 2QKMB 3Q5FA 1UELB 2K4JA 4AIDA 1S5LC 2ZFUA 2K9NA 1C4GA 2EINH 3W6VA 1QVUA 3S8PA 1J09A 4R79A 3A01A 4CH7A 4AIKA 2HVSA 4ZJZA 4A3KJ 4ESJA 3BJOA 3JAMK 2F4OB 3ZMUA 1TTYA 2E5ZA 4HBLA 1GLNA 2EZHA 4NBQA 1V5GA 4Q48A 3TDZC 3VYRB 2NRAC 1HBXG 4S0HB 5GAGJ 3J81K 3HB9A 1DIZA 1ZHFA 3FMRA 1P2FA 1KZHA 3EUHA 2WAQN 4BL0B 1ACIA 5FO5A 4M9ZA 5BPIA 3GZ6A 3M1CA 2XAFA 2KL4A 3KLNA 2FMLA 2GA1A 2XAQA 4HQMA 3ASMA 2ZMEB 3EUAA 4KMUX 3OY9A 5D5VB 3D5LA 3IAM2 2O7OA 1VQLI 1X1PA 1WJCA 2ELJA 3JW4A 3KEYA 4XKWA 3OYJA 1X2NA 1YLFA 5DD8A 2DU9A 2IPQX 2CQ7A 3AG2H 3HBLA 1DU6A 5K5QA 1TWGJ 4ZYDA 3NQOA 4NC6A 1HF0A 4BJTA 5FROA 3BR6A 3QP6A 3L2CA 3ZQFA 4KDPA 1WVRA 1CF7A 2H1KA 5GAHJ 1FBSA 2HZSA 1UT7A 2CUFA 4A12A 1DGWY 1KONA 1EJ9A 2AS5F 1ZGAA 2CQQA 2F7LA 1USTA 3HSFA 1J7KA 1QTSA 3QRFF 2ECCA 2FKFA 3HG9A 5JMVD 3HOYJ 4WF2A 3S15J 3V7SA 2DMQA 3F8BA 3JCUC 4FE7A 1DPUA 2DKCA 1N3AA 4FHTA 3P9IA 4F3QA 1J75A 2E36A 3S93A 1IN6A 4L0YB 1R00A 4WXDA 1K79A 3K7AJ 1S3JA 3S32A 5EEAA 3PIPF 4I0BA 2KKOA 3U2RA 1R4XA 4DZPA 2JSCA 4C3HJ 5EPCA 2XDVA 1HQCA 3KFWX 1Y1WJ 3P9KA 1MZBA 1ORKA 2XRNA 4XLAA 5IT3A 4CZCA 4RB1A 3H1ZA 2QBYB 2ZSIB 1E2XA 2QCOA 4EM0B 3HOVJ 2IGNA 1FYKA 5ICGA 3IL2A 4OMZA 3DTIA 1GV2A 2DDAA 2PJRB 4XLNF 4B0AA 1HKTA 3DV8A 2DDBA 1I6HJ 3K2AA 3QWLA 1WZ2A 3O3KA 5J6XA 3S1NJ 1WH5A 4M9XA 3NARA 4QPOA 4HV5A 2E60A 1UHMA 1VNDA 1W5TA 3TO9A 4DYQA 1E17A 4Q47A 3HL2A 2X1CA 3WTZA 4XN3A 1B72B 2FUVA 2KIQA 4LIUA 3UW2A 1KO9A 2EFNA 4NQWA 2M2EA 2IGMA 4L18B 2RNJA 2KISA 3CCSI 2IAIA 1I1GA 4BACA 2F5VA 1V5SA 2LFBA 1UHWA 3CCMI 1PCZA 2M8EA 2LK2A 2JA8J 3EAYA 2EK5A 1SEUA 2PMZN 1XD7A 3TE5A 1FOWA 2XROA 4V2FA 3PQJA 1FEXA 3ZOBA 2L02A 2VIXA 1KYFA 5HS7A 4EVIA 1ETVA 1FMWA 3G1OA 4A6DA 3LQQA 1ZLKA 1RESA 3ULQB 2IS1A 2H8RA 3BG7A 2VKDA 4LFUA 3CMYA 1LWWA 1IN5A 1VQ9I 4LG0B 2FNAA 4BUPA 3MKWB 2LSOA 1FT9A 2F48A 3T5XA 3BR3A 1H89C 2OJED 3I0XA 1SFEA 2MW8A 2VASA 2VODA 5EG0B 4D7NA 4BYYA 3GTKJ 1MBJA 2M4KA 2P81A 3H35A 4IOCF 4XRMA 2HWVA 3AG1H 2M8GX 1YX5A 1X3UA 2AQFA 2DMNA 1T6SA 3K9TA 3OYLA 2PMHA 3ABLH 2JTVA 1WWXA 3C3WA 1BIBA 1HXDA 2EFOA 1F1ZA 2ZBKA 3E1SA 2DOFA 5CYVA 3WHCA 1FIAA 4XLEA 2R7WA 4J00A 3CJTB 2LY9A 2Z1DA 4XLFA 1RI7A 3JR9A 3EPZA 5BMZA 4ENJA 2DN0A 6PAXA 5JLXA 2FXAA 4FE4A 5B3SH 2OZUA 4U0YA 2O6GE 3TO7A 3PFIA 1JUSA 1MH3A 2ELHA 1DUXC 2JA2A 1PVSA 2Y8LA 1T38A 1PYVA 4OMYA 3OYAA 1T33A 4PJ0C 5H20A 2OCEA 3IH4A 4XLCA 2BXYA 2VQLA 5FKMA 2VJ0A 4WXCA 1K35A 2QWWA 4U7DA 2F5EA 2FRHA 4DW6A 2D0BA 3TOAA 2R0QC 3Q9VA 3PUBA 1QNAA 4ASNA 5F04A 3CD6I 5IOYA 1EH6A 3KYCB 1NG7A 5HLIA 1BI2A 4KFCA 4A0XA 1TLHB 2DLLA 1B4AA 2LY1A 4KIBA 3J7AO 9ANTA 2XF7A 2O3FA 4YELA 4DZJA 2KJBA 1UMQA 1MMAA 2HYJA 3TDUC 3H3VK 1FTZA 4OAYA 1LFBA 2HYGD 4RODB 4RB2C 5CVUA 4M71A 3ZRGA 4C7PA 2L7ZA 3JRCA 4UB8C 3OYKA 3RKWA 2GBYA 1UG0A 2I8DA 2VQCA 4IJAA 2I5WA 4BBRJ 1O3RA 2C6YA 2HZTA 1S7OA 2P7VB 5D4SA 3GYHX 3M9AA 5IYBJ 4BHCA 4I7HA 1XSZA 2ZNZA 1X4PA 2EZLA 1Z21A 2A05A 1FLIA 3EUHC 2XKOA 3MKZA 2HFHA 3E6BA 3CC2I 2UUZA 3BOQA 4N9IA 4AVPA 4N9HA 3GLXA 1H9TA 3GTGJ 2LG4A 5E3OA 1LFPA 5L3EA 4RM2A 3FM3A 4C30A 1EF4A 4I0AA 2HKPA 1C47A 2LP0A 2E1MC 1GHCA 2X51A 5K5RA 1Z67A 1JT6A 2NS0A 1NK3P 2E1NA 4UUTA 4LLLA 1JT0A 3V4GA 4PFPA 1STZA 2HGCA 3A03A 2DOEA 3CP2A 1LWVA 3PUFA 2CW8A 2RN7A 4NC8A 3HPHA 1W7PD 1OYYA 3CUQB 2IS4A 5J4VA 1X1BA 2ESHA 3FXUA 1C0WA 1N77A 2OOYA 1MP9A 3FDYA 2CQNA 5JFRA 2K7LA 4O6JA 1DGRM 4IHYA 3WTWC 2GOXB 3FIWA 1MDMA 2ZXHA 2OTLI 3NWSA 1MBEA 1MJBA 1QNEA 4LB5A 3E5UA 5M5WJ 2Z8UA 1ZREA 1TW2A 2YX7A 1GDTA 1AOYA 2NXNB 4WXHA 1ODDA 4A5MA 4EAGA 2XAJA 5FKKA 4CCNA 4KN7X 3R6SA 1VTOA 4LK1F 1RKWA 2DJIA 2OF7A 1U8RA 3A02A 1KYDA 2XV4S 4EJYA 2XF6A 4MQ9F 1V5FA 4AIHA 1LB2A 2HXIA 2HVRA 1WJWA 2L9SA 2R7UA 2CWEA 2LVSA 1VQPI 1U78A 1F9NA 2ZXIA 1I6XA 1TW3A 3OL3A 1GVJA 4V2GA 4HAMA 1YOVB 5CVJA 1X19A 4OIPF 3GXOA 4J01A 1G2HA 3BTJA 4XK4A 5GTIC 3F23A 2MLKA 4Y4RA 1APLC 2FUG2 4RGXA 3OSMA 4FX0A 1YI2I 3PMGA 3VN5A 4H4KC 2MLGA 3QU6A 1E3OC 2FX0A 4E7IA 1IO2A 4IO9F 1B59A 3K4LA 2K9LA 1IDYA 3OSFA 1OFCX 4LK0F 4CCJA 4B48A 1BJZA 2ME6A 5HS9A 3SEQA 2DTZA 4ABZA 3C7JA 5IP7J 2W7NA 2NOGA 1OCRH 2VQGA 3KX2A 3F8FA 2BV6A 2VJ5A 2UXNA 5HLGA 1LWYA 4BHPA 1G4DA 1MNEA 3L9FA 3K10A 1LEAA 5HSHA 4JOMA 5FKLA 4E7ZA 3H0DA 4E7LA 3FXLA 4KICA 1IAWA 1IRZA 1MMGA 3MZHA 1ZRDA 1N39A 2R5ZB 2XHKA 4HEA2 4DBRA 3E5QA 3CF2A 3E7LA 4ZTFA 5HNHA 2QR1A 1JI8A 1D3UA 4CYDA 1U9OA 4BXUA 2HNHA 3Q0UA 1BOAA 3HPGA 3FX3A 3W2WA 2H5AX 3FXOA 1UCRA 4K2EA 1BBYA 3O8GA 3WTUC 3OS0A 5ICCA 1FSEA 2W00A 3MZ8A 3KP7A 3ZQGA 1OMIA 1TQIA 3H36A 4OIRF 2JOIA 1D0YA 1X58A 4YIRX 4A2UA 1M1EB 2V9PA 3IP4B 3W6JB 2ZKZA 4BAYA 1FOKA 4OIQF 3E3VA 2XGDA 3CC4I 2R7VA 3H9GA 4BDZA 3GVAA 4KITB 4BJUA 4IQ4A 3OYBA 2J5PA 1QN5A 4D5CA 1V55H 1XDUA 4M6YA 3H5NA 5LD2C 1E3PA 4KNYA 1WH7A 2DK8A 4A3LJ 3ZP5A 4DOZA 1XSVA 3GTMJ 3TP3A 2IS2A 3GLLA 1S9HA 2JUCA 2M34A 3CJQB 2OA4A 2LY2A 3FXKA 2IGOA 4QSHA 3P7NA 1WPKA 2PMUA 2K9MA 2DI3A 3U9GA 2P5VA 2VB6A 3R61A 3B6CA 4P9UA 2FD5A 2FQ4A 2VJIA 1KU3A 5K5OA 1YIJI 2TRTA 1Y39A 1OISA 3P9CA 4QTRA 1VQ6I 2LBFA 4XNFA 4Q5SF 5CVRA 5C44J 1JGSA 2RC4A 3BQYA 4EJUA 1ZRFA 5E17F 3T1BA 2OOXA 3WU1B 3M8EA 3MVPA 1MSFC 3L2VA 4CZZA 3Q0WA 3AG4H 1FN7A 1T08B 1UB9A 5GPAA 2MBFA 2OZ6A 1R5GA 1OR7A 2Y31A 1W80A 3N4MA 2QLZA 4G94A 2JJ7A 2AO9A 3NEUA 2O9LA 2L2OA 1QQIA 2ZJ2A 3A01B 3ABMH 3CCYA 1IV8A 2X6OA 2V6EA 3OCIA 4HOBA 2JQ7A 3BQZA 3RPUA 5F0HA 5DM6F 4ZH4F 4PGHA 4D7MA 3CUQA 3RKYA 2DQRA 3K4JA 1KYUA 3BKQX 2H1LA 2W57A 1J9IA 2HR3A 3I0WA 1P7JA 3GTOJ 2BW3A 2A6TA 1PCMX 2Z99A 3H0GJ 3J7ZI 3CW7A 1FIPA 3MD2A 1VTLE 2LKXA 2CUJA 4WCGA 1MNMC 4EJTA 3JRBA 4MFEA 3LL7A 3RIRA 1QNCA 2MH9A 2HTSA 3RJPA 2DA6A 3RQIA 1FOYA 3VEPA 1HC8A 1YHQI 1X2MA 3OSEA 4PZJA 5FFZA 3D0SA 1KU9A 2VT3A 2DMTA 1CF7B 2A69F 3QPSA 3W3CA 1JJ8C 1Z3XA 3MMYB 1IXCA 3ZMTA 1UT4A 3OGDA 2HYFA 3C2BA 1QNTA 2E2JJ 3CDIA 2EIMH 2XIGA 3SHFA 1P5DX 1BW5A 3GFMA 1MD0A 2NOIA 3LSTA 1S29A 3BPVA 4DJAA 2VE9A 2GOMA 4U0VA 1RIOH 2HPMA 2EV5A 3GFJA 2EA2A 4EAIA 4NUBA 2L7FP 2EPFA 2ZXJA 4HW0A 3IHUA 1X1AA 2V9VA 3CCEI 1TZLA 2Y75A 2ICWG 4P5OA 4UNOA 2W1OA 4Y13A 4BE2A 3LA2A 2VOPA 2R7ZJ 1YTFA 3ZCOA 3IRRA 4GRIA 1POGA 2MZ8A 4BS9A 3CZ6A 4A6EA 1ZARA 2WADA
chains in the Genus database with same CATH topology
5EEHA 4L5JA 2O8XA 1K78B 5H6RA 4KT5C 3G2BA 1XB4A 1O7FA 1ZLJA 3GFLA 4ZTJA 1U3EM 3LFKA 2L4MA 2XC7A 1IN4A 3BG6A 3RQ4A 1DQUA 2E1CA 2MYSA 3ISPA 3RTRA 1SFKA 1WKMA 1W36C 3HTSB 2KQRA 3OWTA 1K6YA 1N75A 1IXSB 2BE5F 4HG2A 2K86A 4NQWB 2P6TA 2R7OA 3FXQA 3BZ6A 2UV1A 3HKZA 4LG3A 2H6CA 4PJLA 4L0ZB 1KYZA 1ULYA 5LBQA 4NC7A 4G9YA 4NNJA 1QN8A 2OC6A 2ETHA 4AVZA 1IRGA 1XCBA 2IT0A 3VSLA 2VJJA 4HX7A 1FMVA 1XSDA 1DPRA 3TO6A 5DUKA 2D1VA 4HDUA 1XMAA 3CTAA 4BQNA 5JHFA 3HS8A 1KQ8A 2HTJA 3K1NA 4DULA 2X0LA 1KY7A 2F5CA 1U5TB 1AA7A 4AIJA 2JSPA 1MJ9A 3KE2A 3OIPA 1KU7A 1B6AA 3UR3C 1WJBA 1TBPA 2IS6A 1YQAA 4HDVA 3GUDA 1VOKA 2M45A 3MWMA 3ZXSA 1YW7A 4HQEA 3SEZA 2KIUA 1IRFA 3OL4A 3B73A 1NH2A 1R1TA 3J81Z 2IGKA 3K1MA 3KCCA 1RZ4A 3V7CA 2YSRA 2K02A 3GEZA 4RLFA 1D5VA 4A5NA 3FF5A 1BI3A 1L3LA 4LLNA 1HKQA 1TQPA 1N78A 4AWXB 5L3FA 4E7SA 2NOHA 1A04A 4LLGF 1K7AA 2P0WA 2R7TA 3E6MA 4XRFA 2STWA 2ZO4A 1OR7C 4D1QA 1Q1HA 2GZWA 2G7UA 1WRJA 2IVMA 4QWQA 2PQ8A 4G7HF 2O03A 4U0WA 4YFNF 5ILSA 2F4IA 5DD4A 1PUEE 1IUYA 3PSIA 4E7HA 1D8JA 2VJ4A 1KU2A 4RGRA 3OR2C 3ZMVA 2VOOA 3W2VA 4EJOA 5DCMB 3J80K 1QBJA 3FKJA 2F5DA 1DP3A 1KA8A 2L3DA 5FRMA 1WJFA 3L7WA 3CUQC 4BE1A 1HKSA 5E8GA 1QN4A 3MAJA 1S8NA 3F21A 1V5EA 4B09A 3I59A 3I4PA 5FGMA 3F9KA 4IVNA 5D8KB 3RPJA 3VWBA 2IV8A 3C18A 4HV6A 1CDWA 2V26A 2VT2A 4MGRA 2HVQA 4TPSA 2DT5A 2V1NA 2IA1A 1CGPA 4XKVA 1YW8A 1EBMA 3FBNB 4ENKA 2YU3A 2CS3A 4M6XA 4B3XA 1YIOA 4S04A 1EH8A 3LMMA 4QPQA 5AIQA 1MDMB 1BR1A 2X85A 4ZZLA 4G6DA 3QODA 4XLHA 3DFGA 4L5IA 1OPCA 1K78A 2L4AA 1E0EA 1FY7A 2V6CA 1FBUA 4F91B 2DOAA 3SFZA 4OINF 1BJAA 2R7RA 4IPAA 3I71A 3H3UA 4HF2A 4CICA 3LSKA 1TNSA 5ED4A 2DPUA 3EYIA 1IZ1A 5E1ZB 2UXXA 3VOEA 3CMMA 3WTYC 3E6CC 1R22A 2BBYA 5F64A 4MEXF 2A61A 1IN8A 4L9VA 4XLPF 2FE3A 1NVPA 2YX4A 3ML6A 2L01A 1D3YA 5E8IA 4PSWA 3W2AA 2FBIA 2YR2A 3BCBA 3N97A 4YIIA 4E7JA 4DIQA 2HQNA 3OV8A 3F0ZA 5ILUA 2LH9A 4LMYA 1Z7LA 1LEBA 4LB6B 3OYEA 5LGTA 1O7LA 1LVKA 2FF4A 3LSGA 1X1DA 1QPMA 1WQ2A 2PG4A 2ISZA 1L0OC 2IJLA 2ESNA 4GYIA 3OS1A 2EV6A 2FGTA 1U5TA 4XONA 2Z33A 3S2WA 2OAZA 2BGCA 5CVIA 1OKRA 1FP2A 3OOPA 1UFMA 1O3TA 1BN5A 3MCZA 3FXRA 1KQ0A 2EJRA 1KGSA 3FMSA 1WJAA 2X6WA 5HLHA 1MW7A 4N0BA 2CUZA 4EJWA 5DYMA 4N4NB 1P6RA 2HPIA 2NOEA 2A5WA 1V4RA 3BDDA 4CO8A 4KJZA 1D8KA 4BXFA 3DKWA 2JZYA 1H0MA 5JI6A 3R0AA 2W25A 3SQNA 3ELKA 3EETA 1QU3A 4G7OF 2QENA 3MQ0A 1QN9A 1IRXA 4EGZA 2R3SA 2V9KA 2XAUA 3C2GA 2IW5A 3MEXA 5D6EA 5H6QA 4IKFA 1MMDA 4HA8A 2GXBA 4E6KG 1YX3A 1YW9A 5DCFA 5DCMA 5FFXA 2KLOA 2YPRA 2LBFB 4EM1A 2EFWA 2IP2A 3I9V2 3IKVA 2KIMA 4HNUA 3TQNA 2HDWA 3OMYA 4XSXF 2VLAA 1QHHD 3CJNA 4IXAA 1MKMA 3WTXC 3ROUA 1IXRC 3HOSA 2KHMA 4KYWA 4RAZA 4H0EA 2RQPA 2XAGA 1HSTA 4UVAA 5D5UB 2EB7A 4BQQA 1QO0D 2X6YA 4ZZDA 4G7ZF 3PNYA 3I53A 1SD7A 3QOEA 4BGDA 1R1VA 3CP8A 2HQAA 4IRHA 4OWRB 1BI0A 1BC8C 3J7AY 2WY8Q 2DFIA 1XSXA 3WTSC 3KZZA 2KJCA 3M8JA 4BJ5C 4ZYHA 2HDCA 2KZVA 2O3OA 3WE2A 2BW3B 4YFKF 3OYGA 2QZ8A 3K70C 1LDDA 4BJ6C 3I54A 3LSIA 4MQVA 2D1HA 2EFPA 3G3ZA 2M1BA 3FHZA 5J8FA 2L7KA 3JSOA 2PJPA 3RI4A 4EJVA 5DV5A 2EV0A 3FMQA 2NOZA 2JVGA 1YTYA 1FSHA 4M9SA 2R7XA 2O0YA 2HS5A 4CCOA 4F52A 3HTUA 2HKOA 3KRMA 1QNBA 4N4OB 4E70A 1P92A 3QP5A 4M74A 3H9QA 4ZYAA 3DEEA 1P4AA 3RKXA 3LA7A 2M7AA 3LSMA 3K1PA 1B9KA 1D1AA 5LFAA 4C9YA 4OOIA 1TNTA 1MGTA 1XGOA 2P7CB 4KT6A 3VSKA 1EH7A 4HLYA 4PJMA 2M87A 1BI1A 3BWGA 5E1WA 5KHDA 3WG9A 3F8NA 2R4GA 1WFXA 4G8XA 3KP4A 5FD6A 1WJ5A 2R7FA 2CYYA 3H5AA 2YH5A 3LFUA 4F92B 4G6QA 4RMNA 3NRVA 4MNUA 2NOLA 3T8TA 1U5TC 2TDXA 2LNBA 4RS8A 3IKTA 3BLYA 3O2PE 5BQTA 4L9NA 5FLXK 2CG4A 4DNCA 3SZGA 3PNTA 3OYNA 2RV8A 3L09A 4I02A 2XHIA 1QHGA 1G3WA 4ROCB 4PGGA 1QZZA 2H94A 2Z9OA 3PL8A 4CSWA 3K70D 3S3NA 5CQEA 2G30A 1C9BB 1KQ9A 2E7WA 2FU4A 1HU0A 1E42A 3ZPLA 1XDSA 5F1RA 3K0LA 1LJ9A 5LHHA 4IHSA 4RAYA 1IN7A 4WWCA 3AAFA 4IRIA 4LD5A 2PI0A 1R58A 3H92A 2UZKA 3C1DA 1FPQA 1PJRA 4LJZF 3K4CA 2V4JC 3TOBA 3VDXA 1PP8F 4IQJA 3IRQA 5ICFA 1BOBA 4HSTA 3F3XA 4BEHB 1FC3A 1HA8A 2Z16A 2NAZA 2BEOA 2CGPA 3KEOA 2M0MA 4HF1A 1KY6A 1O3SA 3WGGA 2WA0A 3FWEA 3SNSA 3V8LA 5LGUA 1Z6RA 4FASD 3DU6A 1HW2A 4YEJA 1YTBA 4II3A 1VOLB 3LA3A 2ZNYA 4CA0A 3CJRB 4CCLA 3IH7A 2ZFWA 2F5FA 2DTRA 3HRTA 2FQ3A 3I64A 2W82A 3D5RC 3CO7C 2HU9A 3F22A 4KISA 1D0XA 3FZVA 3KP3A 2VONA 2A5YB 5LEJA 1I1SA 1QN7A 5LRRA 2VC1A 2FMYA 3KP6A 3ABTA 4PDKA 3RDIA 2MD0A 4CCKA 4UV8A 1D1BA 2LRDA 5E1XA 3ECOA 2GXGA 1BM9A 4QLCU 2CV2A 3V7RA 1Z9CA 1G3SA 4MEYF 4UXNA 2H6BA 3I59B 3K4MA 3VYTB 2DCEA 4XMYA 3M7GA 3IC7A 4UVCA 2VBWA 4IX7A 3CLOA 2W4SA 2RNGA 1XGSA 4PJNA 1OLTA 1R6RA 2ZSHB 4GCVA 3CDHA 3HYIA 2D0AA 5TRDA 3COAC 1B1BA 4MHGA 4HYEA 2M7BA 5E20A 4BQAA 2DAOA 2RQQA 4XQFA 4D0PA 2V7FA 2XSJC 2Q0OA 2A07F 2D2WA 3EQLF 4Y17A 5CQGA 2OBPA 1I5ZA 3RYRA 1ZGJA 1YYVA 3DLAA 2LYCA 3H5RA 3EDPA 1R23A 4ESFA 3TMOA 5D6FA 5IYBP 2AXLA 2OUMA 2VQHA 1NHAA 2XAHA 5BPDA 2W84A 4YRVA 2FA5A 1SFUA 1DP7P 3FBIB 4YFXF 1W5SA 1LNWA 1FYMA 3GZ5A 3BJ6A 1SFXA 1J2XA 4BH9A 4ZDLA 2RVCA 5ERIA 4L9TA 2G9WA 4P1WA 1BIAA 3ZMZA 1O57A 3GF2A 3LAPA 3DTKA 5JVTA 2QUFA 3E6DA 2DT6A 1WJEA 1W7PA 3O6BB 3K4KA 1T95A 2LF7A 3SYTA 3WTVC 1VZ0A 1N3CA 2O5RA 3SXYA 1SMTA 2GA2A 3AL0C 1G6NA 3H3ZA 3QU3A 3F6OA 2G7HA 2M4GA 2ISYA 1M3HA 2LOOA 3GBGA 1M3QA 3I0TA 3BCAA 1ERDA 2MA3A 2WB1A 1YQKA 4BEHA 1LQ1A 2A3SA 3HRSA 1YQLA 1BR4A 3HUGA 4LGWA 2F6CA 2RDPA 3TGNA 2LREA 2Z2SB 5ICEA 4GGGA 3QYEA 3EYYA 4ANJA 4HRIA 4JK1X 4Z2YA 3VYSB 2VBZA 4JBAA 3IWFA 1QN6A 5A2QZ 4MLOA 2VE8A 1P4WA 1J0RA 3J80Z 2M3AA 2KDOA 3QYBA 2MABA 3H9JA 3BPXA 3WGHA 1XCVA 2FBHA 4P96A 4B44A 3K4BA 1WJDA 1V3FA 5D4RA 2CV1A 3BP8A 2P5KA 2FOKA 2CW0F 3L2QA 4HF0A 5A2QK 1R7JA 4E4HA 4U87A 3EUKL 1Z1DA 1SAUA 3OYFA 4HZFA 2QQ9A 3HS9A 4RGSA 3L2RA 1W36D 2W85A 1FYLA 4BE0A 2MJ7A 4ENNA 2PN6A 3TKYA 3L00A 2KRFA 1KYWA 4KUMA 4L9JA 4X0GA 1LVAA 1ZRCA 3K4NA 2OU2A 5HS8A 4HLXA 4XBFA 4OIOF 1MMNA 5DUIA 3BJAA 2FEZA 3GFIA 3ZN1A 2P4WA 3OR1C 1ZAOA 4ON0A 4S05A 1WI9A 2KRHA 5LGNA 3ABUA 1PP7U 2Q1ZB 3HXLA 3F8CA 1F5TA 3PFYA 1HW5A 4ENMA 1FWZA 2NYXA 2K27A 5JR3A 1YS7A 5JHUA 4U7BA 1QZYA 1TBAB 5IYDP 3VB2A 4F55A 4XKBA 1LDJA 4FX4A 4GYGA 4XORA 5CLSA 4ZDPA 2NNYA 2Q2EB 2CSOA 4XL9A 1K6OA 3PQKA 4UHTA 2PEXA 5KVRA 4EJZA 2X1EA 3PSFA 5AONA 5KCMA 1D1CA 4IHTA 2Y0MA 5K1YA 2QM3A 1YO5C 3OS2A 2B0LA 1G59A 1UAAA 1J59A 4Y15A 2P6SA 3DWLE 3LAJA 1ON2A 3ULXA 1QN3A 1R5HA 1Z05A 2COMA 5LLQA 2XKPA 2JPBA 1YFHA 3AKZA 4YG2F 3R0JA 1T98A 1XMKA 4ROEB 3F10A 1JE8A 3KETA 3DEUA 3WU0A 1HSJA 4CDGA 2QKLB 4KIGA 4WZSD 5D8LB 2IA2A 3DU5A 2V79A 2K5CA 4ZC3A 2BVLA 5KNLA 4PFOA 2L54A 2O61A 2XVCA 3RPUD 3Q9SA 1W4MA 1GXPA 5L3BA 1T2KA 1NGMA 1Y0UA 2KIFA 2IA0A 3KP5A 3DTEA 5J8CA 2KP6A 4AYBA 1LDKB 2UWMA 4KMFA 3JSPA 2V1XA 1JHFA 4HX8A 2LC2A 4Y33A 4O3MA 4AD9A 2M5WA 1R36A 2Q8KA 2FBKA 1OYIA 2DW4A 1I27A 3AL0B 3QPTA 3E5XA 2IV9A 4I09A 3V8JA 4XSZF 3QOPA 3KZYA 2V1UA 2CQKA 4RB3C 4CGZA 1S6LA 1MNDA 3ERED 2CH0A 4HPQA 2X6XA 3BY6A 2CFXA 4EATA 3DPLC 2IRFG 1AWCA 1T0FA 3HRMA 4BQOA 2CO5A 4RLQA 1MJAA 4GO1A 2E7XA 2Y0SA 1U2WA 1QGPA 4XOPA 4EQQA 3DQVC 4XR6A 3F8MA 3F6VA 1TGHA 4P9FA 3SZTA 3RCOA 3FM5A 3GWZA 2XUBA 4ZYEA 1SD5A 2WV0A 4PY5A 3JTHA 5IT9Z 4BDYA 4ZYGA 4ITVA 4OAZA 1YQMA 4IRGA 1XGMA 2ZMEA 1PZDA 1TQMA 1ZG1A 2DK5A 2QVOA 4IF4A 1FX7A 2XASA 2RREA 3OSTA 2FSWA 3OOUA 1FZPB 2NOJB 2WBMA 2BOLA 2NOBA 1Z6TA 1TBXA 4E7KA 4GXOA 4HSRA 3UNGC 1RNLA 4NB5A 2R7SA 3ZN0A 5IT9K 2KMUA 1ZELA 2VBXA 3SDBA 2PLYA 3NWTA 4BU2A 4UVBA 4XKCA 5DDGA 1Y6IA 3HHGA 2K3PA 3DKXA 1XN7A 2GAUA 2STTA 4RGUA 1HW1A 4UUVA 3GX4X 3RYPA 3OYCA 2DT7B 4YIFA 1JHHA 5D5XB 4LIVA 3M8FA 3M1EA 1SAXA 3DPUA 2XF5A 2EFQA 2BVMA 1YG2A 2DPDA 2Q2EA 4XN0A 3BC8A 2Z3YA 4BNCA 1ZG5A 2LF8A 5D5WB 2FNPA 4PSXA 3HC7A 4MTDA 2QBYA 1EA3A 2P5LC 4M73A 2R7QA 5BS6A 1FBQA 3DF8A 5LRSA 2PJRA 2VC0A 4A0YA 4B47A 4KIFA 3LWFA 4MTEA 4LITA 3L2WA 1VTNC 3B02A 3CUOA 4F93B 3S3OA 1SD6A 4AU7A 1RUNA 4XM3A 3MZYA 5HLTA 3OYIA 4NHJA 2VXZA 5ILVA 4C2TA 2RGVA 4WK8F 1ZH5A 2LDUA 3EIKA 1H9GA 4DQ2A 3W6KB 4FETA 2PFBA 2R7DA 2P8TA 4Y3OA 4KA4A 1G8XA 4C2UA 3ZMSA 4LG0A 5FLXZ 2W24A 4II2A 1FNNA 3DKYA 3V42A 1QTPA 2HKXA 5HDGA 3AFHA 2D45A 4P55A 2KRCA 2Z5UA 3OYHA 2MH2A 4RM3A 2HZMA 3TBIA 4PJJA 4B8XA 2MFZA 5LHIA 4I2OA 1EV7A 4CUGA 2GIVA 2WAQA 4PUSA 3A1YA 2GWRA 3VYUB 1W7PB 5LEKA 2CW7A 1SMYF 2J5OA 3V8KA 3KLOA 1B9MA 3IUOA 5HDKA 3E97A 3ZMDA 2Y48A 3K69A 4O5VA 3VFZA 3K6GA 3OC3C 2PBIA 2K4BA 2E5NA 2L9NA 3E0JB 1IW7F 5KK1A 1P4XA 3WGIA 4PK4A 3LSHA 2QYOA 3DXJF 4U88A 3MKYB 1U0JA 1ZN2A 4DGWB 3HRUA 1TT0A 4R8HA 2ACJA 3OYDA 3ZGKA 2RKHA 2V1DA 2VBYA 1B9NA 3T0YA 3PJRA 3IWZA 2GQQA 4F7ZA 2JUGA 4UV9A 1T0FC 3HUGB 3I5UA 1YS6A 1J5YA 4Q4ZF 3FHNA 1Z3YA 2VPLA 3CESA 3KTUA 5HOOA 5FD5A 2NNNA 1G3YA 1T39A 2DBBA 2HOEA 3WTTC 1BC7C 1REPC 1Y56A 4ZDOA 4EV0A 3KYLA 5L3GA 5F6FA 3TL4X 5DEQA 3GW2A 4WX9A 4CHUA 4XOTA 4M72A 2JRTA 5CPRB 5TJJA 1X4OA 2MD5A 3HOTA 3RSNA 2IXSA 1ZG3A 3QAHA 4ESBA 3K2ZA 3N89A 1NG6A 3GO5A 4R1HA 5AN4A 2A68F 2CV0A 3REOA 3MFKA 3QYFA 2L5QA 2DQLA 3F72A 3ZR8X 2WWYA 2OV7A 1YE9A 1D0ZA 3S3MA 3N05A 2PMZA 3IAS2 1X1CA 4G6TB 3U21A 4D9JA 3KP2A 3U1DA 3WE3A 1IF1A 5IYCP 5AIPA 2E1MB 4IZZA 4DBQA 2HZDA 2VXDA 4JQFA 4KN4X 1Z7UA 1LKXA 4HNTA 3HHHA 1GXQA 2AQEA 5CKTA 2XGXA 2DO7A 2LAEA 2HEOA 2H27A 3R60A 2HQRA 5HVQC 2VN2A 1AISA 2VKHA 2CFOA 3A2KA 1RUOA 1U6GA 3HSEA 3KEQA 5HNFA 5LHGA 2JPCA 3VODA 4I98B 2LKPA 2A6EF 2QQAA 3LQRA 1S7AA 1JFIC 1WSUA 2ZCWA 5FRNA 3DPTA 3I3LA 4FT8A 3PNVA 2JT1A 5CVVA 2EWNA 3L2UA 1FP1D 2OQGA 3QPHA 3BROA 3ECHA 2F2EA 1O3QA 1RM1A 1BR2A 4A0ZA 2EA4A 2X4HA 3C2HA 2X1DA 2WAFA 3D5SC 3ONQA 4HX4A 1F4KA 2KPMA 1JXSA 1USSA 2MC4A 2WC2A 5HDNA 2WTEA 3A4CA 3RPQA 3G73A 3SZPA 4Q11A 1ON1A 3OIQA 3JTGA 2CMPA 2VL8A 2WAEA 4B43A 4EMSA 4TV7A 3CO6C 5BOXA 4CCMA 2A6HF 4RB0A 3DP7A 2NOFA 1PDNC 3WODF 2QQBA 2DXIA 4I01A 5CJ9A 2OD5A 3ZQ7A 5E18F 5L3CA 4OU0A 3I58A 2MC3A 3OYMA 2H09A 1G3TA 2ADUA 1SD4A 5L3DA 4ETSA 5TGTA 1ZYRF 4BHBA 1DDNA 3HSRA 2M30A 4CXFA 1P9QC 3T8RA 3HIFA 5EEGA 4EM2A 3ZQQA 1YQRA 3R4KA 1ONVA 4I8OA 3JAMZ 4PCQA 1XGNA 2WY7Q 1R1UA 5FB2A 4EGYA 2D0CA 1Z91A 1OYWA 2BYVE 2JVHA 2OQRA 2QKMB 3Q5FA 1UELB 2K4JA 2ZFUA 3S8PA 1J09A 4R79A 4CH7A 4AIKA 2HVSA 4ZJZA 4ESJA 3BJOA 3JAMK 3ZMUA 1TTYA 4HBLA 2E5ZA 1GLNA 4Q48A 1V5GA 3TDZC 3VYRB 2NRAC 1HBXG 3J81K 1ZHFA 3FMRA 1P2FA 3EUHA 4BL0B 5FO5A 4M9ZA 5BPIA 3GZ6A 3M1CA 2XAFA 4HQMA 3KLNA 2FMLA 2GA1A 2XAQA 2KL4A 3ASMA 2ZMEB 4KMUX 3EUAA 3OY9A 5D5VB 3D5LA 3IAM2 1WJCA 3JW4A 2ELJA 3KEYA 4XKWA 3OYJA 1YLFA 5DD8A 2DU9A 2IPQX 5K5QA 4ZYDA 3NQOA 4BJTA 5FROA 3QP6A 3L2CA 4KDPA 1CF7A 1FBSA 2HZSA 1UT7A 4A12A 1DGWY 1KONA 2AS5F 1ZGAA 1USTA 3HSFA 1J7KA 1QTSA 3QRFF 3HG9A 4WF2A 3V7SA 3F8BA 1DPUA 1N3AA 4FHTA 3P9IA 1J75A 4F3QA 3S93A 1IN6A 4L0YB 1R00A 4WXDA 1K79A 1S3JA 3S32A 4I0BA 2KKOA 3U2RA 1R4XA 2JSCA 2XDVA 1HQCA 3KFWX 3P9KA 1MZBA 2XRNA 5IT3A 4XLAA 4RB1A 4CZCA 3H1ZA 2QBYB 4EM0B 1E2XA 2ZSIB 1FYKA 2IGNA 5ICGA 3IL2A 4OMZA