3DPTA

Cor domain of rab family protein (roco)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
298
Chain Sequence
b'SWIKVKEKLVEATTAQRYLNRTEVEKICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLNTSALGYILNEEQIRKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIDNEPEITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLDVKEFIPLPGHPDELVEYKELLGLEKMGRDEYVSGKLEKVFSVSKMLDSVIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rab family protein
publication title Structure of the Roc-COR domain tandem of C. tepidum, a prokaryotic homologue of the human LRRK2 Parkinson kinase
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Signaling protein
total genus 87
structure length 298
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16095 COR C-terminal of Roc, COR, domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dptA01
1.10.10.2200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dptA02
3.30.310.200 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3dptA03
2ISYA 1TQPA 1SD7A 1P4AA 2HR3A 4HV6A 3ZMSA 4CO8A 3IHUA 5E8GA 2P6SA 3GFIA 3O3KA 4HLYA 1J75A 3G73A 2DTRA 2HYFA 4CZZA 2HTSA 2H6BA 1HW1A 3WTVC 1OKRA 1YTYA 2W57A 2XAFA 5K5QA 1KQ8A 5HOOA 4UV8A 3QU6A 2YPRA 3ZMVA 3BPXA 4G8XA 1ODDA 3DPLC 4M73A 4P9FA 3ROUA 4PDKA 1RI7A 4M9SA 4A5NA 3T5XA 3JAMK 2EK5A 3TKYA 5HLHA 2Q8KA 2B0LA 3BWGA 5LGTA 1W5SA 5FFZA 1FSEA 3R0JA 3WU1B 5TRDA 5LGNA 1BC7C 5JR3A 3KP3A 4LLLA 3U2RA 1ZLJA 1OYWA 4IRGA 4EJUA 1YW9A 4XLPF 1CF7A 2V1UA 1JE8A 4CHUA 2XASA 4AVPA 3O2PE 4CYDA 3H3UA 1KU3A 2KIMA 1ZGAA 3KP7A 2VOOA 2ZNZA 3JAMZ 1IW7F 2J5PA 4H0EA 4KIBA 1R23A 3MCZA 3TO7A 3VB2A 4ZYEA 2FRHA 2QM3A 4WCGA 3I4PA 1LEBA 3P7NA 1GXQA 5A2QK 1QNTA 2AXLA 2LKPA 3E5UA 1LNWA 2ADUA 1P6RA 3SHFA 1WSUA 1DP7P 5KVRA 2RNJA 4ENNA 3CUQA 2QVOA 3VOEA 1LVAA 1MGTA 3GEZA 4EJTA 4WK8F 2YX4A 3I53A 4UV9A 3QPHA 1J5YA 3DFGA 1YS6A 2PMHA 1VTNC 2V79A 5LBQA 5E1WA 4G94A 2FMYA 4L9JA 4GXOA 2NS0A 2Z9OA 1BC8C 2VBWA 4PGHA 4WX9A 5J8FA 2VC0A 1REPC 1MJ9A 5DCMA 1UB9A 3OV8A 3T8TA 2NNNA 5ERIA 1XGMA 2OD5A 4DNCA 3HOSA 5LGUA 5A2QZ 1FBQA 2VBZA 4ZYGA 1LQ1A 2O03A 2FEZA 2HDCA 1WKMA 1HW2A 3WTTC 4HF2A 2BBYA 2LDUA 2VONA 5J6XA 1AOYA 1USSA 3LA7A 4HQMA 4KNYA 1R7JA 4YIIA 3U9GA 3ISPA 1FOKA 1G3TA 1DPRA 3I59A 2STWA 5DCMB 3K2ZA 1LJ9A 3SZPA 1BN5A 3ZMTA 4RAZA 4Q47A 1FSHA 1L0OC 1G3YA 2KJCA 3HSFA 3AAFA 1FNNA 4KYWA 1FP1D 4BHBA 4KFCA 1FZPB 1SD5A 4O3MA 1WQ2A 2UXXA 3E97A 4Q5SF 2V1XA 5L3CA 2EWNA 4FHTA 4Y17A 3I71A 1XGSA 5ICEA 2XAJA 5BOXA 2UWMA 3V7SA 3PQJA 1B6AA 4M9ZA 2MLKA 1T98A 3TDZC 3E6MA 3DQVC 2HZTA 4L18B 1U78A 1JGSA 2STTA 2EV5A 5E1XA 4KIFA 3HSRA 1RZ4A 1XDUA 2Y75A 3FM5A 5D4SA 5L3DA 3BPVA 1J2XA 1IN7A 2EA4A 2ZNYA 1FWZA 2JT1A 1BIBA 2OU2A 3ZPLA 2DO7A 1D3YA 4I0BA 1R5HA 3TO6A 4A5MA 1F5TA 4DQ2A 1U6GA 2MA3A 2F5FA 2DQLA 3WTYC 3F8CA 5F64A 3FM3A 3KP2A 2FOKA 5AONA 3EQLF 5BS6A 1YYVA 4L9VA 4G7OF 2MLGA 3P9IA 4EGYA 2ESHA 3R4KA 5HS7A 2HKOA 2IA2A 2OBPA 4ESFA 4YIFA 2K27A 3HRUA 2ZBKA 4YFKF 2GA2A 2XV4S 1HKQA 1OYIA 1S3JA 4YG2F 5FD6A 5LEKA 2CG4A 4HX8A 1W5TA 4HDUA 1E2XA 1HXDA 1TNTA 2DI3A 3DKWA 1B9NA 3IWFA 2EB7A 2EFOA 2F5EA 4HOBA 2OQRA 2CWEA 4MTEA 2PFBA 4HBLA 2FSWA 3L2CA 3WODF 4ZZLA 2M5WA 2Y48A 5DUKA 1KGSA 5D5UB 2EFWA 1I5ZA 3LAJA 1W4MA 4M6YA 1R1TA 2CSOA 4EVIA 3W6KB 3GX4X 4FX4A 4OMZA 3TDUC 2G9WA 3J80K 3E3VA 1D5VA 4HLXA 3N4MA 5FO5A 4JQFA 2P5VA 1V4RA 4EM2A 2XAGA 2FMLA 5FLXK 3F21A 4I01A 2COMA 1XMAA 3RYRA 4LG0A 1RNLA 5J8CA 2PLYA 1U2WA 1O7LA 4HX7A 3HIFA 3WU0A 1USTA 3GW2A 3ERED 2ZJ2A 2EV0A 4YFXF 3QPTA 2FE3A 2RQPA 1Z6TA 3ECHA 2LNBA 2HEOA 5L3EA 1ZRCA 4UXNA 1FT9A 1MJAA 2RGVA 1O3SA 3ML6A 1FBSA 4Z2YA 3GLXA 4UNOA 1ZG5A 5JVTA 1R58A 3HOTA 3WTXC 1XDSA 2M8EA 3SFZA 3F23A 2QQBA 2Y0MA 5FLXZ 3COAC 2DPUA 1R1UA 2XKPA 4LB6B 1QBJA 3WE3A 2QLZA 2PEXA 5E17F 2XHKA 2NYXA 2A61A 2D1HA 2H6CA 2PJPA 1Z9CA 2K02A 5LHGA 2ELHA 1I1SA 3HYIA 3PQKA 5K1YA 3HHGA 1IXCA 5HDKA 4OIQF 1FYLA 4CDGA 3JSPA 4MTDA 1SFXA 3V8JA 4O5VA 1JXSA 3F8FA 3HRSA 1BI2A 2FQ3A 2DQRA 4A6DA 2P5KA 4EJOA 4BQAA 3FHZA 5ICCA 4WXCA 2O0YA 3I54A 1YIOA 1UHMA 2VT3A 4PGGA 1QQIA 3EYIA 5F1RA 1O3TA 2XROA 2PQ8A 1YO5C 3PFIA 3BJAA 1FC3A 4KDPA 1B9MA 3BOQA 2KKOA 5IT3A 2MC3A 1W7PD 2W85A 3ULQB 1YQAA 4MQVA 2A6HF 4OINF 1B59A 2HOEA 3ABUA 3NRVA 2OZUA 4WXHA 4LMYA 2GIVA 4RB1A 3CTAA 5D6FA 3S2WA 2ESNA 3C3WA 1XSVA 1J59A 2C6YA 3V7RA 4RGXA 2RKHA 4LK0F 4EV0A 1HSJA 3N97A 3JTGA 3ZMUA 2W25A 1ZRFA 3DV8A 4XSZF 3ZN1A 3GFLA 5CLSA 1H0MA 5HS9A 1T6SA 2NNYA 1B4AA 3LA2A 1DDNA 3W6JB 4KUMA 1E17A 4MHGA 2QENA 1F9NA 5BMZA 2VC1A 1K79A 2LF8A 4R8HA 4UVCA 3KEQA 4MEXF 4RB2C 5LEJA 1WRJA 3L9FA 1DPUA 4JBAA 3JW4A 1TBXA 2IVMA 3KCCA 4RGRA 2DAOA 3V4GA 1Z7UA 4UUVA 5D6EA 4HX4A 1HQCA 4EM1A 3DP7A 1J7KA 3JSOA 3BY6A 2H09A 2A3SA 3ZMDA 1ZLKA 1ZG1A 4KA4A 4LK1F 1XSXA 4U88A 3FMRA 4HW0A 1U8RA 2FXAA 3CDHA 2HQNA 1Z05A 3FXUA 3ECOA 3H3ZA 5EEHA 5FD5A 1K78B 2GZWA 5FGMA 1PP8F 4LFUA 1CGPA 2VE8A 6PAXA 1OYYA 5BQTA 3HHHA 2O6GE 3I0TA 2E1NA 2BE5F 3DPUA 1HSTA 3K1MA 1XN7A 4U0WA 2M30A 2RVCA 1KU9A 2ZKZA 3HSEA 3BDDA 3KLOA 4L0ZB 3DPTA 2EFNA 1BI0A 4L5JA 3DEUA 3LAPA 3M7GA 3KE2A 4OIPF 4ENKA 2EFPA 2KRFA 4JK1X 4HQEA 1MZBA 1V3FA 1BIAA 2IPQX 1YG2A 2XRNA 5JI6A 3RJPA 1HKSA 3V8LA 1Q1HA 1X3UA 1FP2A 4M74A 2M87A 5HDGA 4Y15A 1SMTA 3C7JA 3VODA 5AIQA 3BP8A 3REOA 3MQ0A 2O61A 3HRMA 1SFUA 4RB3C 5DV5A 1ZG3A 4MEYF 5CVVA 2V6CA 4A12A 1JHHA 1G6NA 5L3GA 1GVJA 4I09A 3CUOA 3ABTA 4B8XA 2VN2A 1YW7A 2IP2A 4RB0A 1B1BA 2Z33A 3HTSB 2VE9A 1S8NA 1FX7A 2RN7A 1IN6A 1TNSA 3K1PA 1QPMA 2HYGD 3F8MA 2JZYA 3IC7A 3MAJA 5LRRA 3FF5A 4LJZF 1JHFA 4RS8A 2D45A 1BI3A 3V7CA 2E1CA 4NHJA 5DYMA 1U5TC 1RUNA 4EJWA 1G3WA 4KICA 4HV5A 1T39A 3M8FA 3J81K 4B09A 3LQRA 4XBFA 1Z91A 3I58A 1S7OA 2R7FA 5DUIA 4IRIA 1SFEA 2AS5F 1ZYRF 4UVAA 2GXGA 1SMYF 1XB4A 4F7ZA 3MFKA 3E6CC 2HWVA 4N9HA 1U3EM 3DXJF 4A0ZA 5CVIA 4R1HA 1IN8A 1BJAA 3C18A 1FY7A 4KMUX 1EH6A 2L02A 1LDDA 2FBIA 4R79A 2VT2A 2CW0F 2EV6A 2MBFA 1UCRA 5DD4A 1ZN2A 5LHHA 3J81Z 2DBBA 1H9GA 4EMSA 1KQ9A 1SD4A 2K4JA 1GXPA 1K6OA 4O6JA 3OOPA 1EV7A 5HLIA 2R7DA 2CO5A 1P92A 2W84A 3TQNA 2FBHA 2JPCA 2V1DA 2P8TA 1H9TA 3F22A 2IRFG 2CQKA 2JTVA 4P9UA 3LA3A 3WTSC 1TQMA 2PMUA 2GXBA 1OMIA 2GQQA 1O3QA 3TGNA 4EJVA 2E7WA 3T8RA 1F1ZA 5DDGA 1MDMB 2O3FA 3GZ6A 4KN4X 4I0AA 3J7AO 2A68F 4KT5C 2XVCA 4QWQA 3HUGA 1EH8A 4G6DA 4AIKA 3LFKA 2JPBA 2K4BA 4IXAA 1TTYA 3E5XA 3NQOA 3M9AA 2W24A 4MQ9F 1U5TB 4CICA 4OMYA 1YFHA 4QLCU 3K69A 3MWMA 1EH7A 3FXRA 1IN5A 4D0PA 1R5GA 4GCVA 3V8KA 1FYMA 4NB5A 2L01A 5D5VB 1IXRC 4M72A 4U0YA 4FX0A 3GO5A 4G6QA 2WTEA 4ENMA 4RGUA 1R36A 3R60A 2IW5A 3WGHA 1SD6A 2CFXA 4A0YA 1LEAA 3BJOA 4BYYA 4EQQA 5ICGA 5FFXA 2MH9A 2GA1A 5AIPA 5H6QA 2HGCA 2VXZA 4HYEA 2CGPA 5F6FA 1Y0UA 4OOIA 2ZMEB 2IT0A 4PZJA 4A6EA 1ZH5A 3F3XA 2WV0A 4L9TA 3RI4A 5ILUA 2CYYA 4M71A 5IT9K 3Q9SA 2FNPA 2Q2EA 3BROA 3FZVA 4OIOF 1AWCA 4XSXF 5D5XB 3E6DA 4HF0A 2ACJA 2M45A 1TQIA 5LRSA 1TW3A 2A5YB 4XLNF 1D8JA 2ZCWA 3CO6C 4ESJA 3KZYA 4I2OA 1J9IA 3EDPA 2G7HA 3RYPA 1HKTA 2OA4A 2YR2A 2ETHA 2JSCA 4U7BA 3WE2A 1QZYA 4ASNA 4WWCA 2DW4A 3WGGA 3R61A 4FT8A 2BV6A 3CUQC 2TDXA 2BEOA 1LDJA 4BAYA 5IT9Z 3EUHA 2VBXA 3ZN0A 3TOBA 4ZYDA 4NQWA 3QOPA 1S7AA 2DT5A 2FU4A 2P4WA 1P2FA 3F6VA 5DD8A 5HVQC 5BPIA 1IN4A 4L9NA 1SAXA 1HW5A 1W7PA 2D2WA 2F5DA 3K9TA 4K2EA 3WGIA 3GFMA 2E7XA 5LLQA 2A07F 1ZREA 2FNAA 3R0AA 3TOAA 4P96A 2G7UA 4XRFA 3EYYA 4EM0B 4GYIA 2WC2A 4TV7A 2R3SA 4BH9A 4LB5A 3QU3A 5BPDA 4IF4A 2QQ9A 5E1ZB 2PN6A 1XMKA 1ON2A 1C0WA 2VODA 1J0RA 2EFQA 3P9CA 5ED4A 1W7PB 1QO0D 2OAZA 3MEXA 2A69F 3K0LA 4LD5A 3RTRA 1K78A 4M9XA 3FMSA 2PG4A 2QYOA 4AIJA 3EETA 1HBXG 3TO9A 3IRRA 3WTZA 4E70A 4MNUA 4N9IA 4U0VA 3B02A 4WXDA 4IHSA 5ILSA 3BZ6A 1F4KA 1IXSB 4ZH4F 1S6LA 4HAMA 5D5WB 1G4DA 5CYVA 4GGGA 3IL2A 4OIRF 1CF7B 3K1NA 1QGPA 2XGXA 4U7DA 3KLNA 4P5OA 5CVRA 2NRAC 5HS8A 2UXNA 4G9YA 1UFMA 5CJ9A 1ZGJA 4KN7X 1IRFA 1STZA 2Z5UA 3QP5A 4S04A 3L00A 1S29A 4A0XA 4HA8A 2X4HA 5E20A 5L3FA 4ZYHA 3QRFF 4Q48A 4Y13A 1FPQA 3GFJA 1D8KA 2P5LC 3LQQA 2M1BA 3JTHA 2QWWA 1T0FA 3GWZA 3HTUA 2FA5A 2XKOA 3ZMZA 2RDPA 5D4RA 3LSTA 3RPUA 3WTUC 4BHPA 1KYZA 4HZFA 3CLOA 1Z6RA 3CUQB 2GWRA 1BBYA 4M6XA 1DUXC 4BHCA 2J5OA 4IJAA 3SXYA 2OQGA 1YLFA 3P9KA 5L3BA 1FLIA 1I6XA 3MZHA 2A6EF 4BXUA 3IKTA 1P4WA 2X0LA 2PI0A 5H6RA 1GHCA 2QBYA 1XD7A 4G7ZF 2H27A 3GYHX 4Q4ZF 2K7LA 2XAHA 2PBIA 2L3DA 3KP6A 3M8EA 2HKXA 4UHTA 5H20A 1NHAA 4AD9A 1KA8A 2HS5A 1OR7A 3F6OA 4ON0A 2P6TA 2XAQA 1T38A 1R00A 1G3SA 3KP4A 2ZO4A 5K5RA 1KQ0A 1ONVA 2L4AA 1KU2A 2H94A 3GVAA 2IA0A 5ILVA 2XUBA 3MZYA 3GF2A 5DCFA 3RKYA 3ZP5A 1FYKA 3C1DA 3GXOA 3I5UA 4L0YB 4CXFA 4PCQA 2QBYB 3ZQ7A 3KFWX 1IUYA 3KZZA 3SQNA 5TJJA 3F8NA 5D8LB 3F8BA 1L3LA 1ULYA 3I59B 3IWZA 5HDNA 1IAWA 2DK8A 2HTJA 2HFHA 1R1VA 5DEQA 2WWYA 4GYGA 4IRHA 1XCBA 1FBUA 2Q0OA 2KIFA 2MH2A 4HF1A 3B73A 4BNCA 1T2KA 4N0BA 2XIGA 2P7CB 3HRTA 3E5QA 4YFNF 2DPDA 1XGNA 4HDVA 4IVNA 3T1BA 1Z1DA 2LSOA 4ENJA 1BOAA 3F72A 5CVUA 4MGRA 1LDKB 2DK5A 2RC4A 3IRQA 2O8XA 3L7WA 2BYVE 3RDIA 3DF8A 2QZ8A 3NEUA 5KK1A 5K5OA 4KMFA 3R6SA 2YU3A 3VEPA 1I1GA 4A2UA 4AIHA 2YX7A 3D0SA 2YSRA 3FMQA 3G3ZA 1PUEE 3U1DA 1UHWA 2IA1A 4S05A 4I98B 1ZRDA 2DFIA 5FB2A 5HLGA 3T0YA 5JFRA 3CJNA 4EGZA 1OPCA 1IZ1A 3FXQA 3I64A 5E18F 2F2EA 3LWFA 1WWXA 4WF2A 3KP5A 5JHUA 5D8KB 1RUOA 2DU9A 2ZXJA 1O3RA 4RAYA 1PP7U 2NAZA 1BI1A 3FX3A 4RGSA 1A04A 5CVJA 3O6BB 3QAHA 2EA2A 2P7VB 4CGZA 3RKWA 3FWEA 5EEGA 2RV8A 1I27A 2HQRA 2OZ6A 1LB2A 3SZTA 1MDMA 4G7HF 2F5CA 3H92A 2FF4A 1RIOH 4I7HA 2JRTA 1KU7A 4I02A 3L09A 4OU0A 4IPAA 1IF1A 3BJ6A 1U5TA 3WG9A 3VFZA 5E8IA 3RKXA 2QUFA 1TW2A 3RPQA 1MJBA 4ZZDA 1R22A 2VBYA 3CO7C 1YS7A 1ZHFA 2IJLA 1O7FA 3KEOA 4UVBA 1XGOA 3E6BA 1TLHB 1PDNC 2GAUA 1P4XA 1O57A 3QP6A 2LF7A 5ICFA 3IKVA 2ISZA 1ON1A 1IRGA 2FBKA 2EJRA 2VOPA 4P55A 2D1VA 2ZMEA 4LLNA 3WTWC 2UZKA 2ZFWA 4KIGA 2MD5A 1YW8A 1BM9A 4AWXB 2L4MA 1QZZA 1XCVA 3M1EA 5LHIA 1WI9A 3KETA 2BGCA 4LGWA 2L54A 1MKMA 1XSDA 3RIRA 1MD0A 4GO1A 2KIUA 2DLLA 3ELKA 3J80Z 2K86A 2V9VA 3GUDA 4IHTA 2Z3YA 4ETSA 3D5LA 2QQAA 2Z99A 2KJBA 4LG0B 3GZ5A 1ZAOA 3Q5FA 1KYWA 1K7AA 4ESBA 3Q9VA 4LLGF 1ZARA 4L5IA
chains in the Genus database with same CATH superfamily
2ISYA 3G1MA 4RMNA 1TQPA 3IH3A 1SD7A 1P4AA 2HR3A 4HV6A 3ZMSA 4CO8A 3IHUA 1Z7LA 5E8GA 1ENHA 4BQQA 2P6SA 3GFIA 2MSYA 3OR1C 5FRNA 4GRIA 4L5EA 3O3KA 5IP9J 4HLYA 1PCZA 1J75A 3G73A 1R49A 5JN5A 4DULA 2DTRA 2HYFA 3CLQA 3W2AA 4RBOA 3HG9A 4BL0B 2JVGA 3EPZA 2DA6A 1W5CC 4CZZA 4G12A 2W7NA 1TT0A 2HTSA 2H6BA 3LOCA 2HPIA 3D5SC 1HW1A 2PMZA 3G71I 3WTVC 2R7VA 1OKRA 1MBKA 4YEJA 3VDXA 2VQLA 2HZMA 3NARA 3DTIA 5JMVD 1RKTA 5EGOA 3A2KA 1YTYA 2G30A 2W57A 2XAFA 5K5QA 1KQ8A 5HOOA 2GIZA 1OCCH 4UV8A 4WZSD 3DBLB 1X1BA 1NH3A 2QKMB 1X1DA 4JX5A 3CDIA 1IO2A 2JQ7A 3QU6A 2YPRA 2FKMX 4D7MA 2X48A 1QN4A 3ZMVA 3BPXA 2OCEA 2L5QA 4G8XA 2D0CA 1ODDA 3DPLC 2VKDA 3OYGA 3CVTA 1S72I 3A0HC 2QRCA 4M73A 1QNBA 4P9FA 3ROUA 2ZSHB 4CYCB 4PDKA 1U8BA 1RI7A 4M9SA 4A5NA 4X0GA 3T5XA 3JAMK 2Y2ZA 2EK5A 3TKYA 5HLHA 1WQAA 2Q8KA 2R5ZA 4IL8A 3ZQLA 2F4OB 5IP7J 2B0LA 4A3EJ 3BWGA 3QOEA 2HKPA 5LGTA 3SFIA 5JHFA 3WU2C 2D0AA 2E34A 2RQQA 1W5SA 5FFZA 1MNEA 1FSEA 2LD5A 2L0KA 2KRHA 3R0JA 2KRCA 3WU1B 2ZXWH 4F52A 3RZOJ 1QN8A 5TRDA 5LGNA 2XAUA 3PSFA 3K4CA 1BC7C 2QSFX 4XORA 3DLLF 3CCLI 3HEFA 4QPQA 3CC4I 5JR3A 3KP3A 1QTSA 4LLLA 1R5ID 3U2RA 2Y0SN 1ZLJA 2XPUA 4E7ZA 1OYWA 4RAGA 4IRGA 4EJUA 1MSFC 2BVLA 1YW9A 1X4OA 3DTEA 3RCOA 4XLPF 1JE8A 1CF7A 2V1UA 3S14J 4J00A 3IUOA 4CHUA 2R5ZB 2XASA 4AVPA 3O2PE 4CYDA 3CESA 3H3UA 1KU3A 2MYSA 1QVUA 5GPCA 4CFFA 1RRJA 1BL0A 2KIMA 1ZGAA 5FKLA 3KP7A 2VOOA 2JA8J 3SEZA 2ZNZA 1VQKI 2DT6A 3C2GA 3JAMZ 2ECBA 1IW7F 1IRZA 3DKYA 2XGDA 2J5PA 2AQEA 2VJIA 2Y9YA 4H0EA 4PJ0C 4KIBA 2DJNA 5HLTA 1R23A 3MCZA 2M8GX 5IY5H 3TO7A 1Q9UA 4ZJZA 3VB2A 4NBQA 1YQMA 4ZYEA 1WJ5A 2FRHA 2QM3A 3HBLA 5GAHJ 4IHVA 2FGTA 4WCGA 3I4PA 3VSLA 1LEBA 3P7NA 4QG5A 1N39A 3CCJI 1GXQA 2NOIA 1OCPA 5A2QK 4ZDOA 2H5AX 2TRTA 2DXIA 1QNTA 2AXLA 3KTUA 4DZPA 2LKPA 3E5UA 3OS2A 1LNWA 2ADUA 1P6RA 3SHFA 1WSUA 1ZTRA 2CUZA 1DP7P 2VJ0A 5KVRA 1RESA 2RNJA 3CUQA 4ENNA 2QVOA 3VOEA 1LVAA 3ZR8X 3JREA 1MGTA 3GEZA 4EJTA 4WK8F 4BY1J 1OCZH 2FUG2 3LSIA 5F0CA 3FISA 2YX4A 3I53A 4UV9A 3QPHA 3TP0A 3W6VA 1SFKA 1J5YA 3H1ZA 3DFGA 1YS6A 2PMHA 2ZXIA 1VTNC 1OQYA 2QSHX 3AL0B 2V79A 2COBA 5LBQA 5E1WA 4G94A 2FMYA 3BC8A 1DU0A 4L9JA 4JOMA 3JRDA 2QLVA 4DBQA 4GXOA 3ASOH 3LL7A 2NS0A 2Z9OA 1BC8C 5FRMA 2VBWA 2KISA 4PGHA 3CMYA 2BHYA 3CC7I 3MN2A 4WX9A 3DBRB 4ZYAA 5C44J 4A3KJ 5J8FA 2VC0A 3HJEA 1REPC 1QN5A 1MJ9A 2QEXI 4RODB 5DCMA 1UB9A 3OV8A 3T8TA 2NNNA 1SVOA 2PJRA 2K3FA 1V5GA 2LY2A 5ERIA 1XGMA 2OD5A 1TWHJ 4DNCA 3HOSA 4BUPA 2OPTA 1FBQA 5LGUA 5A2QZ 1YQLA 1JJ8C 1XPXA 2E2JJ 1WJCA 2VBZA 4ZYGA 2R7RA 2O03A 4B4CA 1LQ1A 2FEZA 5B1BH 1WKMA 2HDCA 2Y8QA 1HW2A 3WTTC 4HF2A 2BBYA 2LDUA 4C3JJ 4D7QA 2VONA 3D4VA 1V5SA 5J6XA 1AOYA 4QSHA 4H4KC 4XRMA 1UJ8A 1USSA 1PUFA 2W82A 3LA7A 4HQMA 4XNFA 4KNYA 3LFUA 1R7JA 4YIIA 3U9GA 4ABZA 2VJJA 3ISPA 5M5WJ 1FOKA 2O9LA 3PJRA 4A3LJ 1G3TA 3UW2A 3PUBA 2V6EA 1RETA 1SANA 1DPRA 1A36A 3I59A 2XB5A 2STWA 1JI8A 3EUAA 2ZB9A 5DCMB 3D1NI 3K2ZA 3JRCA 1LJ9A 3SZPA 2DA5A 3ASMA 1B8IB 1BN5A 3ZMTA 5HODA 3OSMA 2EZHA 4RAZA 4Q47A 2JA2A 3BR0A 1OLTA 1FSHA 1L0OC 3OSGA 1D3UA 1G3YA 3RKQA 2R93J 1RKWA 1TP4A 2WV1A 3FK6A 1QPIA 3HKZN 1R4XA 2KJCA 3HSFA 4FCYA 4A3GJ 3X2QH 4A3FJ 1I3QJ 3AAFA 2CQNA 5E3LA 1FNNA 4E7IA 4KYWA 1MBJA 1NGMA 1FP1D 4BHBA 4NC6A 2E19A 4KFCA 1E3OC 1FZPB 1SD5A 4O3MA 1WQ2A 2R4GA 1RM1A 1YI2I 4XLHA 2UXXA 4XKCA 4LITA 3E97A 4Q5SF 3CJQB 3ESWB 1TC3C 1FOWA 1APLC 2VXDA 2HVSA 2V1XA 1UAAA 2R7UA 3VSKA 3GTKJ 5L3CA 2EWNA 4FHTA 1HC8A 1VKLA 4CCOA 1Z0XA 4Y17A 4NC8A 1B9KA 3I71A 1XGSA 5ICEA 2XAJA 2X6YA 2EZKA 4F92B 5BOXA 2UWMA 3V7SA 3BR6A 2Y0SA 4MRQA 5FKKA 3PQJA 1XX5A 1B6AA 4M9ZA 1K83J 2MLKA 1T98A 3TDZC 2NVUB 3E6MA 3DQVC 1ACIA 2HZTA 2HPMA 3TW6A 2W48A 3SDGA 2ICWG 4L18B 3IH2A 2JSPA 5LD2C 1BJZA 3M4OJ 4ROEB 1U78A 1YTFA 1JGSA 2STTA 2EV5A 1VZ0A 5E1XA 1T95A 4KIFA 4D7NA 3HSRA 3K4LA 1OCOH 4JX4A 3OS1A 3I4NJ 1PCJX 2VKHA 1RZ4A 5FKOA 4KITB 3QQAA 3CP2A 1LPQA 3EUKL 4D5CA 1XDUA 2Y75A 3RSMA 3FM5A 5FLVA 1WH5A 3FXLA 2K9QA 3G6EI 1Y1VJ 3IP4B 3F0CA 2K40A 5D4SA 5L3DA 3K7AJ 3BPVA 4YRVA 1J2XA 3HS8A 1IN7A 4OWRB 2QSGX 2EA4A 2ZNYA 1FWZA 3OYFA 2JHJA 2JT1A 3FKIJ 2BXYA 1BIBA 2JA7J 2OU2A 1VQLI 2KMUA 4DJAA 5J3LA 5BMNA 3ZPLA 1E3PA 2DO7A 3CMMA 3VYUB 4XKWA 2XPVA 1VOKA 4BQOA 1D3YA 1FJLA 2X6WA 2XF6A 3CD6I 4I0BA 2NOZA 3M3YJ 1R5HA 3PFYA 3TO6A 1LWVA 2DYSH 4A5MA 3FKJA 1F5TA 2JHNA 1G59A 4MLOA 1YITI 1QHGA 1YQRA 4DQ2A 3LSPA 1U6GA 2M3AA 2DA7A 1QNEA 4CCKA 1M3QA 2MA3A 4IQ4A 2F5FA 5J40A 1YIJI 2PX9A 1JFIC 3VYSB 2DQLA 3WTYC 3F8CA 3J7AY 5F64A 1RR7A 2HOSA 2IV8A 3FM3A 3KP2A 4ZC3A 4F93B 2FOKA 5AONA 1K35A 2F4MB 3EQLF 3KRMA 5BS6A 1EBMA 4J01A 1YYVA 2NVQJ 4L9VA 3ZQGA 1WGXA 4G7OF 5IP6A 2MLGA 3FDYA 2CW8A 3H0DA 3S93A 3OOUA 2VPLA 3P9IA 4PJMA 4EGYA 2ESHA 4EAIA 2M7AA 3A01B 3IH4A 3R4KA 5HS7A 3J7YJ 3P5JA 2NVXJ 4ZDLA 2HKOA 3PDKA 2IA2A 2OBPA 4BJ5C 4ESFA 1OJLA 2Z1DA 3ABLH 4YIFA 2K27A 5FJ8J 2GXAA 3HRUA 2VKEA 2ZBKA 2LAEA 4YFKF 3C2BA 2GA2A 3CWAA 2XV4S 1HKQA 2R7SA 2DOFA 1MNMC 4QTRA 2GBYA 2VQHA 1OYIA 1S3JA 4YG2F 2Y31A 5FD6A 5EZGA 1X3WB 5LEKA 2CG4A 4HX8A 1W5TA 4HEA2 3ZCOA 1ETVA 2K9MA 4HDUA 4C3IJ 1E2XA 5EG0A 2BZTA 5EF6A 1HXDA 1TNTA 2DI3A 2VPRA 3DKWA 1B9NA 3HZJA 3IWFA 2EB7A 2EFOA 2XHIA 2F5EA 4HOBA 2CQ7A 2OQRA 3PUFA 2CWEA 2M0CA 4XN3A 5CQGA 4MTEA 2PFBA 4UB8C 4HBLA 3CWSA 2FSWA 3L2CA 3WODF 2P0WA 3A1YA 4XRSA 4ZZLA 2M5WA 4XRSG 1V54H 2XSDC 2Y48A 5DUKA 4FASD 4B0AA 1KGSA 5D5UB 3I55I 2QGUA 2BW3B 3JCUC 2EFWA 3TP3A 2JA6J 1I5ZA 3LAJA 1W4MA 2ZXHA 4M6YA 2LC2A 1R1TA 2CSOA 3H36A 4Y3OA 4EVIA 3W6KB 3OYHA 3TEDA 4C2TA 1KY6A 3GX4X 4FX4A 1Y8QB 3HKZA 3CWUA 4OMZA 3TDUC 4CH7A 4TPSA 2X1DA 2G9WA 3J80K 1YRNB 2DCEA 3E3VA 1D5VA 2ZJRF 3OC3C 4HLXA 4BBRJ 4AU7A 3N4MA 2L9SA 3BKQX 5FO5A 2M9HA 4JQFA 3OYBA 2P5VA 5EG0B 1R9TJ 3BR2A 1TBAB 2VQCA 1V4RA 3JRFA 4EM2A 3QYEA 2XAGA 3I0WA 3WG7H 2FMLA 3BT9A 5FLXK 3PO3J 3F21A 1ETXA 4I01A 3OSFA 3I9V2 2NVYJ 4PY5A 2COMA 1XMAA 4C9YA 1W0UA 3RYRA 4LG0A 3VYRB 1RNLA 5J8CA 5K7HA 1HF0A 1KYFA 3BZKA 2PLYA 1U2WA 1O7LA 2L7FP 4HX7A 1CDWA 1GUUA 4B3XA 2L7MP 2XC7A 3HIFA 3AKZA 4LOCA 1MMDA 2A5WA 3GTQJ 2DMQA 2DDBA 3WU0A 1UZCA 5IYBJ 2X85A 4LIUA 4A69C 1USTA 3BTJA 3GW2A 1XS9A 3JR9A 3AG2H 3ZQIA 4A3JJ 2VL8A 3BLYA 3ERED 1JUSA 2ZJ2A 4BKXA 2VASA 3QPLA 2EV0A 2NVTJ 4YFXF 1PZDA 2A05A 3QPTA 2FE3A 4QIWN 2RQPA 3OSEA 1Z6TA 3ECHA 1N78A 2LNBA 4DOZA 2HEOA 5L3EA 1X2MA 1ZRCA 3QODA 4UXNA 1FT9A 1MJAA 2EH3A 2RGVA 5E79C 5EEAA 1O3SA 3ML6A 4OAZA 1FBSA 4Z2YA 4BQNA 3GLXA 4UNOA 2KL4A 1U9OA 1ZG5A 1T6AA 5JVTA 1R58A 3HOTA 1UMQA 3WTXC 3GTOJ 1XDSA 2M8EA 3FXJA 3SFZA 2DN0A 5DTDA 4BDZA 4BS9A 3F23A 3HUGB 2QQBA 2Y0MA 1FTZA 5EYRA 1UT4A 2NXNB 5FLXZ 4CZCA 3ZQFA 3COAC 5F04A 4Q11A 1AKHB 3S3NA 2DPUA 1R1UA 2R7OA 2XKPA 5C3EJ 4LB6B 2CU7A 1QBJA 3F10A 3WE3A 1QN3A 2QLZA 3OYNA 2QRDA 2PEXA 2I10A 5E17F 2OJED 2XHKA 3HGYA 2NYXA 4XQFA 3VWBA 4CYCA 2A61A 2D1HA 2H6CA 2DODA 2PJPA 1Z9CA 3HC7A 2MGQA 2K02A 5LHGA 2JA5J 2ELHA 1I1SA 3KYDB 3BG5A 3HYIA 3PQKA 5K1YA 3HHGA 1IXCA 5HDKA 4OIQF 4RA2A 1FYLA 3IH7A 4CCMA 4CDGA 2DFFA 3DWLE 3UKGA 1AU7A 4AVZA 1TWGJ 3JSPA 4MTDA 1XC5A 4B43A 1SFXA 3V8JA 4O5VA 4FQGA 4UY8I 1JXSA 3F8FA 3HRSA 3K10A 4UB6C 1BI2A 1QN6A 2FQ3A 2VIXA 2DQRA 4A6DA 3LNQA 2E2HJ 2P5KA 2HDWA 1M5Q1 2CFOA 4EJOA 1UG0A 4BQAA 3FHZA 2FQ4A 5ICCA 3GBGA 4D7RA 2LR8A 3BCAA 4U87A 2AXTC 4WXCA 2QCOA 1NG6A 2O0YA 3I54A 2OUMA 4CSWA 1YIOA 2Y9ZA 1HLVA 2TCTA 1MNDA 1UHMA 3UR3C 2M0MA 2LFBA 2VT3A 2LG4A 2Q2EB 4PGGA 1QQIA 2O7OA 4F55A 3CVSA 3EYIA 1UG2A 5F1RA 2FX0A 3VPRA 1O3TA 4FTHA 2R7XA 3L2QA 2XROA 1TUOA 3A02A 1LWYA 2PQ8A 3FXOA 1YO5C 1NTCA 3PFIA 5K7FA 3BJAA 1FC3A 4MFEA 4KDPA 1B9MA 1EF4A 2NWVA 3BOQA 2KKOA 5IT3A 2Z16A 4B44A 4XOPA 1JKOC 1MH3A 2MC3A 1ZKGA 1W7PD 2W85A 3ULQB 1JTYA 3CCVI 2DOAA 3K4BA 1YQAA 4MQVA 1ORKA 2A6HF 4OINF 1B59A 2HOEA 3ABUA 3NRVA 2V26A 2OZUA 4I6ZA 4WXHA 1WJDA 4LMYA 2GIVA 4RB1A 4ZTJA 2MG4A 3CZ6A 3CTAA 4BBSJ 5IYBP 5D6FA 3S2WA 2H8WA 5BMPA 2ESNA 5J1YA 1NK3P 1T0FC 1BW6A 3C3WA 3J7ZI 1XSVA 4XOTA 1J59A 2C6YA 3V7RA 4RGXA 2RKHA 4LK0F 4EV0A 1DGRM 1HSJA 4DYQA 1VQOI 3N97A 3JTGA 1MSEC 1A31A 2DKCA 1N25A 3ZMUA 2W25A 1ZRFA 5IYDJ 4ZTFA 3DV8A 2CRGA 3CW7A 4XSZF 3ZN1A 1IG7A 1J3MA 2E5NA 1F36A 1OISA 3GFLA 4XLEA 5CLSA 1H0MA 4N4OB 1T6SA 5HS9A 2NNYA 4EJZA 1B4AA 3LA2A 3KYLA 2VJ5A 3OS0A 2E1OA 1DDNA 3W6JB 4KUMA 1E17A 4MHGA 5AN4A 3G4SI 5KAIC 2X6OA 2NOLA 2QENA 3V42A 1F9NA 1UHSA 2W4SA 3RSNA 1FIPA 4HG2A 4EALA 3H5NA 5BMZA 2VC1A 1K79A 2LF8A 4R8HA 1K2YX 3VN5A 4UVCA 3KEQA 1H88C 2QA4I 4MEXF 4RB2C 1JUMA 1Y39A 5LEJA 1WRJA 2LH9A 1ETYA 3DCFA 1GV2A 5F1JA 3L9FA 4AIDA 2CV2A 1DPUA 4JBAA 2QQ8A 3JW4A 4IOCF 2QREA 3JRHA 1TBXA 1GVDA 2IVMA 3KCCA 3CC2I 4RGRA 2R7TA 1IDZA 1OR7C 2KLOA 2DAOA 3V4GA 3TE5A 1Z7UA 3MMYB 4UUVA 4JYKA 5D6EA 5IOZA 3K2AA 1KY7A 1I3AA 2H8RA 4HX4A 1HQCA 2XF7A 4EM1A 3DP7A 1J7KA 4MIMA 5CKTA 3W3CA 1MMAA 3JSOA 2BVMA 3BY6A 1MMNA 2H09A 5FKMA 2A3SA 2IS6A 4XMYA 3ZMDA 5FKNA 5FROA 1ZLKA 1LUJB 1LFPA 5B1AH 4PFPA 3M1CA 1ZG1A 2DMPA 4BEHB 4KA4A 2Q1ZB 2KDOA 4LK1F 1X1AA 1XSXA 4U88A 3FMRA 4DW6A 4HW0A 5J4YA 1U8RA 2FXAA 3CDHA 1EJ9A 2HQNA 1Z05A 3FXUA 3ECOA 3H3ZA 1QZEA 5EEHA 2X9DA 4W97A 5TGTA 5FD5A 1K78B 3KEYA 2GZWA 1A5JA 5E3OA 5FGMA 4IX7A 1PP8F 1JKPC 3E1SA 3OLPA 1M1EB 4LFUA 3OYCA 3OYAA 1B8IA 1C9BB 2QKLB 3OIQA 3S2DJ 3S1QJ 1IRXA 1JUPA 1CGPA 2VJ4A 2IXSA 4CCLA 2VE8A 6PAXA 3DKXA 4C2MJ 3GMEA 1OYYA 5BQTA 5KHDA 3HHHA 2O6GE 1ZQ3P 3I0TA 1VQ6I 2E1NA 3RPUD 3HPHA 3S1RJ 2BE5F 3DPUA 2JOIA 3QYBA 4D9JA 2DT7B 1VQNI 1HSTA 1XSZA 2KZVA 1FTTA 5J4VA 3K1MA 1XN7A 2EHBD 1IV6A 2JUGA 3KIOA 4U0WA 3SDBA 2BOLA 2M30A 2RVCA 3TBIA 4QPOA 1C4GA 2X1EA 1KU9A 3ZQCA 2ZKZA 5E3MA 3OL4A 2NOBA 2LKXA 2HOTA 4PSWA 3HSEA 1N77A 3BDDA 3KLOA 4XKVA 3FBIB 3DPTA 4L0ZB 3DBHB 1P7JA 3BG9A 4CCJA 2EFNA 4PJLA 1BI0A 4L5JA 3DEUA 3LAPA 3U1KA 2KFDA 4BGDA 3M7GA 1YX3A 3KE2A 4NDLA 1QNAA 1JT0A 4OIPF 4E4HA 4ENKA 3QYFA 2E1MC 4GFBA 2EFPA 4I99C 2KRFA 5HNFA 2MD0A 2BXZA 4JK1X 4HQEA 4EAJA 1MZBA 3BTCA 4IO9F 1V3FA 2O8KA 1BIAA 2NS7A 5M5YJ 3M8JA 4FISA 2IPQX 1YG2A 2CUFA 2XRNA 5JI6A 3OYIA 3RJPA 4NC7A 1VQ5I 5IYDP 3Q0VA 1HKSA 3RQ4A 3V8LA 2E71A 2XGEA 1Q1HA 2R5YA 3F9KA 1X3UA 3CJTB 1FP2A 4Y4RA 2JK3A 1HA8A 4M74A 3FXKA 2M87A 4DYCA 1EA3A 5HDGA 4Y15A 1SMTA 2V7FA 3C7JA 3VODA 5AIQA 4XR6A 3BP8A 3GTJJ 3REOA 3BTLA 2DFHA 3MQ0A 2O61A 3HRMA 2XPWA 1SFUA 3S8PA 4RB3C 5DV5A 4F91B 1ZG3A 4MEYF 5CVVA 2V6CA 2XF5A 2YA3A 4A12A 1GT0C 3ZRGA 1JHHA 3HM5A 2LMDA 1G6NA 5L3GA 1GVJA 4I09A 1MMGA 3CUOA 3ABTA 3Q0WA 1WJBA 4A93J 4B8XA 2MZ8A 2VN2A 3CJRB 4C3HJ 1YW7A 4CUGA 4RLFA 5KL0A 2IP2A 4RB0A 3L2WA 3CCUI 1B1BA 3HOVJ 1BR2A 2Z33A 1HCRA 2R5YB 2V1NA 3HTSB 2VE9A 4RDUA 1S8NA 3MD2A 1FX7A 2RN7A 3N05A 4Y7NJ 1KFIA 1IN6A 1TNSA 1OCTC 5DM7F 2EQRA 3K1PA 1QPMA 2LBFB 2HYGD 3F8MA 3W2VA 2GOMA 2IS1A 1VF9A 1ZELA 2JZYA 3IC7A 3MAJA 5LRRA 4DBRA 2VLAA 2WY7Q 4MFDA 1ITYA 2M4KA 3FF5A 2NOJB 3ABKH 4LJZF 3BR5A 1JHFA 2LY1A 1E42A 2Y8LA 4EJYA 3A4CA 4RS8A 3TDHA 1TL8A 2NOGA 4BJ6C 4A3CJ 2D45A 2WB1N 1O4XA 1BI3A 3V7CA 2E1CA 4NHJA 5DYMA 1LXTA 1U5TC 3A01A 3JRGA 1RUNA 1ZR4A 4E7JA 2IGKA 4EJWA 2DOEA 3HL2A 1G3WA 4KICA 4IOAF 2RREA 2JPIA 4HV5A 3OR2C 1D1BA 1T39A 1T8IA 3KZIC 4C30A 2KQRA 4B47A 4JP0A 4GDFA 3M8FA 1FEXA 3J81K 4CCNA 2LREA 4B09A 3LQRA 4UUTA 2Z0FA 4BDYA 4XBFA 1Z91A 3DEEA 4B3AA 2FD5A 2R7WA 4Y33A 3DEWA 1B72B 3I58A 2OC6A 1S7OA 2R7FA 5DUIA 3EAYA 4IRIA 1SFEA 2ZJQF 2AS5F 1ZYRF 3BTIA 2PWWA 3BG3A 3H9GA 2GXGA 4UVAA 4E7LA 3OYMA 1SMYF 1YJNI 1Z3XA 1VOLB 4M3FA 1XB4A 2K3PA 4F7ZA 3MFKA 3E6CC 2HWVA 4N9HA 1WJEA 1U3EM 1MW7A 3DXJF 2HXIA 2F7LA 3RQIA 4A0ZA 4BE0A 5CVIA 4R1HA 1IN8A 1BJAA 2OTJI 2K5CA 3C18A 2KDZA 1R6RA 1W1WE 2ZMEC 3OWTA 2W00A 2BW3A 4V2FA 3ZXSA 1FY7A 2L7KA 4KMUX 1EH6A 1N75A 2L02A 3LSGA 5CQEA 4ZDPA 1LDDA 4MO7A 1LFBA 1ETOA 5F27A 2FBIA 1FMWA 4R79A 2R0QC 1QNCA 1BOBA 2BHZA 4PSXA 1WZ2A 2VT2A 1HOMA 2FUVA 2R7QA 2CW0F 3DU5A 1VQMI 1YRNA 2EV6A 3PIPF 4WX8A 1F43A 2MBFA 2XRLA 1EUVA 1OFCX 1UCRA 5DD4A 1ZN2A 4YELA 5LHHA 3OYEA 2GLOA 3S17J 3J81Z 1MBEA 2DBBA 1H9GA 2LOOA 5LFAA 2XB0X 4EMSA 1N3CA 1SD4A 1KQ9A 4HJHA 2K4JA 1GXPA 1IJWC 1SVMA 1XMXA 1K6OA 1RC9A 4BE2A 4O6JA 3O8HA 4XKBA 4KJZA 2JN6A 3L2RA 3OOPA 1EV7A 4M3DA 4J19A 3NWTA 4M6VA 1DQUA 2R7DA 5HLIA 2CO5A 2R7ZJ 4HRIA 2HU9A 1P92A 2W84A 2CH0A 3TQNA 1LE8A 4C2UA 2DTZA 2H1KA 1Y0NA 2IGMA 2FBHA 5H2FC 2Z8UA 4ANJA 2JPCA 2V1DA 5J1RA 4PUSA 3DTKA 3H35A 2BY2A 2LLKA 2AO9A 2P8TA 2DMUA 4LIVA 1H9TA 1NH2A 5FLMJ 3F22A 2IRFG 2CQKA 2JTVA 4P9UA 2R5XA 3MZ8A 2HQ5A 4V2GA 5B66C 1H8AC 3LA3A 3WTSC 1TQMA 2PMUA 4IEJA 4ITVA 2ME0A 2GXBA 4PK4A 5J1UA 2R92J 1OMIA 3MKLA 3PNTA 2E5ZA 2GQQA 5HSHA 1W0TA 3OCIA 5J47A 1O3QA 3TGNA 4EJVA 2E7WA 2CMPA 3T4NA 1FMVA 3T8RA 4RAFA 1F1ZA 5DDGA 1E3HA 5GTHC 1MDMB 1YTBA 3RPJA 2ZJPF 2O3FA 1QTPA 1DGWY 3GZ6A 4A3MJ 4KN4X 4I0AA 3J7AO 2A68F 4KT5C 2XVCA 4QWQA 3HUGA 1EH8A 4G6DA 4AIKA 1LE8B 3LFKA 2JPBA 2XSJC 2K4BA 1TTYA 4IXAA 3WHBA 2CUEA 2WY8Q 2JRMA 3E5XA 1PJRA 3I4MJ 3NQOA 3M9AA 1ETQA 2W24A 1AKHA 4IZZA 4MQ9F 1U5TB 4CICA 1FN7A 3K4NA 4E6KG 4OMYA 2AHQA 3G1OA 4QLCU 3K69A 3MWMA 1EH7A 3FXRA 1YFHA 1IN5A 1SFOJ 2JVHA 4D0PA 1R5GA 3M07A 3BR1A 4GCVA 1X58A 3DU6A 4P1WA 2KZGA 3V8KA 3PSIA 5GTIC 2B63J 1FYMA 2QF7A 4NB5A 2L01A 3GTGJ 1HU0A 2JMWA 5D5VB 1IXRC 3EUHC 3GLLA 3OGDA 1EKEA 4M72A 4U0YA 1K4SA 3SYTA 3FXMA 3GO5A 4FX0A 4G6QA 4XM3A 2WTEA 4XLCA 4ENMA 1HDPA 3GTLJ 4RGUA 1R36A 2OOXA 4XICA 3R60A 2IW5A 3WGHA 1SD6A 3CP8A 2LRDA 1P5GX 3EIKA 2CFXA 1S9HA 4A0YA 1LEAA 3BZCA 2KIQA 3FIWA 2IBDA 2MFZA 3CCMI 1QHHD 3BJOA 4BYYA 1WPKA 4EQQA 5ICGA 5FFXA 2MH9A 3HOUJ 2M2EA 2YH5A 2CV1A 1MH4A 4I76A 2WB1A 2GA1A 5AIPA 5H6QA 3IV5A 1W36C 3BQYA 2HGCA 2VXZA 4HYEA 2I5UA 2CGPA 5F6FA 1Y0UA 4OOIA 2ZMEB 2IT0A 4PZJA 4A6EA 1POGA 1ZH5A 1BR1A 3AG3H 3F3XA 2WV0A 4L9TA 3RI4A 2G0EA 3Q3SA 3GCMA 1DIZA 1VQPI 4UUSB 5ILUA 2CYYA 4M71A 3K4MA 1LFUP 3ULXA 1YQKA 5IT9K 3Q9SA 2FNPA 2Q2EA 3BROA 3FZVA 1A6IA 4OIOF 1A35A 1AWCA 4XSXF 1Y56A 1WCMJ 2ELJA 3B6CA 1C47A 5IPAA 1TWFJ 2EZLA 5D5XB 3E6DA 1VQ4I 4HF0A 1VTOA 3JRBA 2ACJA 2M45A 5E3NA 1TQIA 4BY7J 3DLAA 3SEQA 2HYJA 2DA2A 3BR3A 1TW3A 5LRSA 4V19K 5CPRB 2CV0A 2A5YB 4IHYA 4XLNF 2MC4A 2BY3A 5B3SH 1QA6A 1D8JA 2CQXA 2ZCWA 2NOEA 1VTLE 2W1OA 3AL0C 3KPHA 3CO6C 4ESJA 5C4JJ 5KAFC 2OCCH 3KZYA 4I2OA 2B7EA 1J9IA 3EDPA 2G7HA 3LSKA 2M4GA 3I3LA 1NK2P 3RYPA 1HKTA 2OA4A 3L2VA 2YR2A 2V9KA 2JWTA 3CCYA 5DM6F 2ETHA 1OCRH 5C4XJ 3CCQI 1WJFA 2JSCA 2KPMA 4U7BA 3HDDA 3WE2A 1QZYA 4ASNA 4WWCA 3Q0UA 2GM4A 4A3IJ 2DW4A 3K4JA 2ME6A 5GAGJ 3WGGA 1MMSA 3R61A 4FT8A 2BV6A 4HNVA 3CUQC 2TDXA 2BEOA 1LDJA 4IKFA 4FETA 1YE9A 4BAYA 5IT9Z 3EUHA 2VBXA 3ZN0A 3TOBA 1VQ8I 4ZYDA 4NQWA 1PVSA 5EDNA 4EAKA 1BA5A 3MKWB 1U0JA 3QOPA 1S7AA 2DT5A 2FU4A 3CCSI 2P4WA 1P2FA 3F6VA 5DD8A 5HVQC 5BPIA 2V4JC 4IHXA 1IN4A 4L9NA 4IL6C 1SAXA 1HW5A 1W7PA 2D2WA 2F5DA 1WH7A 3K9TA 4AUXA 1JGGA 2HZDA 3H0GJ 3W2WA 1P7IA 4K2EA 3S15J 3TW7A 3WGIA 3HOXJ 1W36D 2K9LA 3GFMA 3H9QA 2E7XA 5LLQA 2A07F 1ZREA 2FNAA 1QN9A 3R0AA 5EGOB 3TOAA 3H9JA 1VQ9I 1MPGA 4P96A 3S16J 2G7UA 4XRFA 3EYYA 5DS9A 4EM0B 2L9NA 2ZSIB 3OMYA 3PNVA 1D0ZA 4GYIA 2WC2A 4X1EA 1X3ZB 4BXFA 2DKAA 4BJTA 4TV7A 1IC8A 4I8OA 2R3SA 3ASNH 4BH9A 2VUMJ 3MKYB 2NLVA 4LB5A 5M3FJ 2Z2SB 2NOHA 2VI6A 3D7QA 3OH6A 3HOZJ 3QU3A 5BPDA 4IF4A 2QQ9A 4M3EA 4NQWB 5E1ZB 2DMTA 3BG7A 4II2A 1AA7A 2HVRA 2PN6A 1XMKA 1ON2A 5EJCA 2LVSA 1C0WA 2VODA 1J0RA 2EFQA 3P9CA 4BEHA 2IGOA 5ED4A 1W7PB 1QO0D 1H89C 2HDDA 4Z6YA 2OAZA 5M5XJ 3WHCA 1MBGA 4BE1A 2HOAA 2M34A 1GLNA 3CCRI 3MEXA 2HZSA 3UNGC 3ONQA 4B48A 2A69F 3K0LA 4LD5A 3RTRA 1K78A 1D5YA 3O8GA 1TWCJ 4M9XA 1Y1WJ 3K6GA 3AG4H 1ETWA 1RPWA 2PG4A 3FMSA 3HPGA 3S1MJ 3HS9A 2QYOA 4AIJA 3GTMJ 1R4MB 2GOXB 3EETA 1HBXG 1WFXA 3HOWJ 4FE4A 3ABMH 3TO9A 2DKDA 3IRRA 3WTZA 4XLAA 1R4NB 4E70A 4MNUA 4N9IA 4U0VA 3HOYJ 3B02A 4WXDA 4IHSA 1WI3A 1UL7A 2VB6A 2CW7A 2UUZA 5ILSA 3BZ6A 1F4KA 4N4NB 1IXSB 3GZNB 1S6LA 4HAMA 2L7ZA 4ZH4F 3CWTA 4EAGA 3OYKA 5D5WB 1G4DA 2FKFA 5CYVA 5F0FA 1CQTA 4GGGA 3OYJA 3IL2A 5JVGF 4OIRF 4DIQA 1CF7B 3K1NA 1QGPA 1IGNA 5GADJ 4YIRX 1X19A 2VKVA 2I8DA 4G6TB 2XGXA 4U7DA 2Y69H 2YUSA 3KLNA 4P5OA 5CVRA 1V5FA 2BY1A 3KX2A 5HS8A 2NRAC 1ZGWA 2UXNA 4G9YA 1UFMA 5CJ9A 3OSTA 1JDYA 1ZGJA 4KN7X 2K9SA 1IRFA 1STZA 2Z5UA 1GV5A 3H5AA 3QP5A 4S04A 3L00A 2DFEA 2E36A 1S29A 4A0XA 4D1QA 4HA8A 2X4HA 1Z3YA 5E20A 5L3FA 4RM3A 4ZYHA 3PO2J 2QR1A 3PM1A 4Q48A 4XN0A 3QRFF 4Y13A 1FPQA 3GFJA 1D8KA 3ZGKA 2P5LC 3LQQA 2M1BA 3JTHA 2QWWA 5EZHA 2EZIA 1T0FA 1TT5B 1JKQC 2KHMA 3GWZA 2DMNA 3HTUA 1TBPA 1VI0A 2FA5A 2RAEA 3SZGA 2XKOA 3ZMZA 2RDPA 2E2IJ 2ECCA 3LSJA 2N8GA 5D4RA 2IAIA 2WA0A 3LSTA 3RPUA 3WTUC 1V5EA 1ETKA 4BHPA 1KYZA 1QRYA 4HZFA 4M3BA 3CLOA 1Z6RA 2O5RA 3CUQB 2GWRA 2EINH 2H4LX 1BBYA 2DYRH 4M6XA 1DUXC 2LY9A 4BHCA 2OV7A 2J5OA 4AM3A 4IJAA 3SXYA 3LSMA 1T33A 3OYDA 2OQGA 1WJWA 1YLFA 3P9KA 5L3BA 4B1RA 1FLIA 1I6XA 3MZHA 3G2BA 2X1CA 1X1CA 4RLQA 2A6EF 4ROCB 4AYBN 4BXUA 1YX5A 5F08A 3IKTA 1P4WA 2ZC2A 3LMMA 3K4KA 4WXAA 3E7LA 2E35A 2X0LA 4IHWA 2PI0A 2CS3A 5H6RA 1GHCA 3CCEI 1QU3A 2LKSA 2QBYA 1XD7A 4HNTA 1GDTA 3QPSA 5KNLA 1RR8C 1BW5A 3S1NJ 4G7ZF 2H27A 1T56A 3GYHX 4Q4ZF 2K7LA 2XAHA 3CMAI 2EIMH 2PBIA 1Z67A 1I39A 2L3DA 1M3HA 3B6AA 3KP6A 3M8EA 2HKXA 3OL3A 4UHTA 4RM2A 5H20A 1NHAA 4AD9A 2E60A 2WADA 1A6QA 1KA8A 2HS5A 1FOYA 1OR7A 3F6OA 1YOVB 4ON0A 1SVLA 1KO9A 2P6TA 3A0BC 2PJRB 2XAQA 1T38A 1KYDA 1R00A 1G3SA 3KP4A 2ZO4A 5K5RA 3CF2A 1KQ0A 1ONVA 2L4AA 4W1UA 1AHDP 1KU2A 1I50J 2H94A 3GVAA 5GP9A 2IA0A 5ILVA 1W80A 2CQQA 2XUBA 3MZYA 4XL9A 3GF2A 5DCFA 2HXOA 3C04A 3RKYA 3ZP5A 3K70C 2X51A 2LBFA 4HPQA 1BR4A 3C1DA 3GXOA 1FIAA 3I5UA 1FYKA 1KONA 4L0YB 3ERMA 4CXFA 4PCQA 2EPFA 2QBYB 2EIJH 3ENOC 1PUFB 1WJAA 3KFWX 2F48A 3ZQ7A 1IUYA 4BU2A 2LTPA 3KZZA 5F9CA 3SQNA 2WAQN 5TJJA 3F8NA 3ZQQA 5D8LB 3U21A 2LP0A 2YU9J 1WHUA 3F8BA 3H1CA 5IYCJ 1L3LA 1ULYA 3I59B 3IWZA 3VYTB 5HDNA 4DYRA 1IAWA 2FJ1A 2DK8A 2HTJA 2HFHA 1R1VA 5DEQA 1KYUA 1PYVA 3ZQHA 2WWYA 3AFHA 4GYGA 4IRHA 2NS8A 1XCBA 1FBUA 2Q0OA 2KIFA 5K7ZA 2MH2A 2IV9A 4HF1A 2F5VA 3B73A 4BNCA 1T2KA 4N0BA 2MJ7A 2XIGA 2P7CB 3L2UA 2L9VA 3HRTA 3E5QA 1B72A 1PVEA 5JLXA 4YFNF 2DPDA 2DA3A 1XGNA 4XIDA 2HL8A 3PNYA 3LSHA 4HDVA 2NOFA 2K85A 2WBMA 4IVNA 3N89A 4HSTA 1G2HA 3T1BA 1Z1DA 1KZHA 1LWWA 5F0HA 2LSOA 4ENJA 1BOAA 1JJ6C 1MBFA 3F72A 5CVUA 4KT6A 1D0YA 1LVKA 1I6HJ 4MGRA 1NVPA 5M3MJ 3CQZJ 1DP3A 1LDKB 2DK5A 2RC4A 3IRQA 2O8XA 4BJUA 3L7WA 2D5VA 2BYVE 3RDIA 4A3DJ 3DF8A 4Y52J 1IV8A 3CMEI 2QZ8A 1YHQI 2IGNA 3G1LA 3NEUA 2DJIA 5GPAA 5KK1A 5K5OA 4KMFA 3R6SA 1HDDC 4NNJA 2YU3A 1P9QC 4DZJA 3VEPA 3RZDJ 5IOYA 2RNGA 1I1GA 4A2UA 4AIHA 2YX7A 3D0SA 3OH9A 1SC7A 2YSRA 3FMQA 3G3ZA 3S32A 3JRAA 3HXLA 3SJMA 1X2NA 3U1DA 1PUEE 1G8XA 1UHWA 3K70D 2IA1A 4S05A 3CDLA 3A03A 4I98B 1ZRDA 3I0XA 2DFIA 5FB2A 5HLGA 3BG6A 4IQJA 3MVPA 2Y30A 3T0YA 5JFRA 3FBNB 1Z77A 1R71A 3CJNA 4EGZA 2CJJA 1ERDA 2IEKA 1OPCA 4EATA 5GAEJ 2DDAA 1IZ1A 3FXQA 2BY0A 2PMZN 3I64A 1P5DX 5E18F 1WVRA 2E1MB 2F2EA 4HSRA 1XTAA 9ANTA 3LWFA 1WWXA 4XLFA 4WF2A 3NA5A 2D0BA 2AQFA 5JLWA 2F4IA 3KP5A 3PIOF 5JHUA 5D8KB 2EIKH 4XONA 1JKRC 1RUOA 2V9JA 2DU9A 1MBHA 2ZXJA 4AC0A 2A6TA 3JRIA 3IAM2 1O3RA 4RAYA 2HI3A 1PP7U 2NAZA 4PJNA 3H3VK 1BI1A 3FX3A 4RGSA 1A04A 1VQ7I 4BXXJ 2NVMA 5CVJA 3OIPA 4II3A 2MW8A 3O6BB 3QAHA 1T08B 3ENCA 2EA2A 2P7VB 4CGZA 3RKWA 2OTLI 2ZFDB 3FWEA 5EEGA 1K6YA 2RV8A 2UV1A 1QVTA 3H5RA 2VQGA 3HGGA 2ZFUA 1I27A 2HQRA 1ZR2A 2OZ6A 1X4PA 2L9RA 1LB2A 1IDYA 3SZTA 4AYBA 2MABA 3FHNA 1SEUA 1MDMA 2K9NA 2I5WA 1E0EA 4G7HF 2HL9A 4C7PA 2F5CA 1S5LC 1U9NA 4E7SA 3OYLA 1ZK8A 3H92A 2FF4A 2JUCA 3S3OA 1RIOH 4I7HA 1J09A 1Z21A 2JRTA 3BQZA 3NAUA 1UELB 3IAS2 5BNGA 2EILH 4I02A 1SAUA 1KU7A 3L09A 4OU0A 2O3OA 3TL4X 3HB9A 4X6AJ 3AG1H 4IPAA 1D0XA 1IF1A 3QWLA 5IYCP 1QN7A 2DA1A 3BJ6A 3PL8A 4M3GA 2F6CA 1U5TA 1XG1A 3WG9A 3VFZA 3L1PA 4A3BJ 5E8IA 3RKXA 4E7KA 2QUFA 4JX6A 1TW2A 1K4TA 2HVQA 3RPQA 3OY9A 1JT6A 4S0HB 1IUFA 2ELKA 3S3MA 1MJBA 4ZZDA 1R22A 2VBYA 2LYCA 2WAEA 5TISC 3CO7C 1JTXA 1KFQA 1YS7A 1ZHFA 3OIOA 3TMOA 2LK2A 2HQAA 2IJLA 2P81A 3NWSA 4HNUA 3PMGA 3E0JB 1O7FA 3KEOA 4XK4A 3SNSA 1MIJA 4PFOA 4UVBA 1YJWI 1XGOA 1S7EA 3E6BA 3MKZA 1TLHB 4LG3A 1PDNC 1NG7A 1UT7A 2GAUA 1P4XA 4F3QA 4E7HA 2OOYA 2V9PA 1LKXA 2H1LA 1O57A 2HNHA 3QP6A 2LF7A 3I56I 2DA4A 2ID6A 2XGCA 3IKVA 5ICFA 2ISZA 1ON1A 4BACA 2X6XA 2IS4A 2CUJA 1IRGA 1N3AA 2WAQA 1V55H 2FBKA 2EJRA 2M7BA 2VOPA 4EEFG 2OF7A 2D1VA 4P55A 1VFCA 1PCMX 2ZMEA 4LLNA 3WTWC 2UZKA 2ZFWA 1FOXA 4KISA 1Q1VA 2V8QA 1D1AA 2ID3A 4UUSA 4KIGA 2MD5A 1YW8A 1BM9A 4AWXB 2L4MA 5HNHA 1QZZA 1XCVA 4NUBA 3M1EA 5LHIA 3GTPJ 1WI9A 3KETA 2BGCA 2XDVA 4D5FA 3LSRA 4PJJA 4LGWA 3ZOBA 3FK7A 5EPCA 4OAYA 2L54A 1MKMA 1YJ9I 1XSDA 1MP9A 5KCMA 1K61A 1TZLA 2V92A 2JJ7A 1DU6A 3I3WA 3RIRA 1MD0A 1VNDA 4GO1A 3F0ZA 2KIUA 2DLLA 3ELKA 4CA0A 5B5EC 3C2HA 1X1PA 3J80Z 3S2HJ 2K86A 2V9VA 3GUDA 4IHTA 2Z3YA 3BCBA 4ETSA 3D5LA 2B9SA 2FOWA 2QQAA 2Z99A 4DGWB 2KJBA 4LG0B 2YS9A 2WAFA 1AISA 2L2OA 1Y6IA 3GZ5A 3KYCB 1ZAOA 1TWAJ 2KP6A 1TGHA 3Q5FA 1KYWA 1D1CA 1K7AA 4ESBA 3Q9VA 2EBIA 2KT0A 2IS2A 3D5RC 4LLGF 4FE7A 3CF5F 1Y8RB 1ZARA 4L5IA
chains in the Genus database with same CATH topology
2ISYA 4RMNA 1TQPA 1SD7A 1P4AA 2HR3A 4HV6A 3ZMSA 4CO8A 3IHUA 1Z7LA 5E8GA 4BQQA 2P6SA 3GFIA 3OR1C 5FRNA 4GRIA 3O3KA 4HLYA 1PCZA 1J75A 3G73A 4DULA 2DTRA 2HYFA 3W2AA 3HG9A 4BL0B 2JVGA 3EPZA 4CZZA 2W7NA 1TT0A 2HTSA 2H6BA 2HPIA 3D5SC 1HW1A 2PMZA 3WTVC 2R7VA 1OKRA 4YEJA 3VDXA 2VQLA 2HZMA 3DTIA 3A2KA 1YTYA 2G30A 2W57A 2XAFA 5K5QA 1KQ8A 5HOOA 4UV8A 4WZSD 1X1BA 2QKMB 1X1DA 3QU6A 2YPRA 1QN4A 3ZMVA 3BPXA 2L5QA 4G8XA 2D0CA 1ODDA 3DPLC 2VKDA 3OYGA 4M73A 1QNBA 4P9FA 3ROUA 2ZSHB 4PDKA 1RI7A 4M9SA 4A5NA 4X0GA 3T5XA 3JAMK 2EK5A 3TKYA 5HLHA 2Q8KA 2B0LA 3BWGA 3QOEA 5LGTA 5JHFA 2D0AA 2RQQA 1W5SA 5FFZA 1MNEA 1FSEA 2KRHA 3R0JA 2KRCA 3WU1B 4F52A 1QN8A 5TRDA 5LGNA 2XAUA 3PSFA 3K4CA 1BC7C 4XORA 4QPQA 5JR3A 3KP3A 1QTSA 4LLLA 3U2RA 1ZLJA 4E7ZA 1OYWA 4IRGA 4EJUA 2BVLA 1YW9A 1X4OA 4XLPF 1CF7A 2V1UA 1JE8A 3DTEA 3RCOA 4J00A 3IUOA 4CHUA 2XASA 4AVPA 3O2PE 4CYDA 3H3UA 3CESA 1KU3A 2MYSA 2KIMA 1ZGAA 3KP7A 2VOOA 3SEZA 2ZNZA 2DT6A 3C2GA 3JAMZ 1IW7F 3DKYA 2J5PA 2AQEA 2VJIA 4H0EA 4KIBA 5HLTA 1R23A 3MCZA 3TO7A 4ZJZA 3VB2A 1YQMA 4ZYEA 2FRHA 2QM3A 1WJ5A 2FGTA 4WCGA 3I4PA 3VSLA 1LEBA 3P7NA 1N39A 1GXQA 2NOIA 5A2QK 4ZDOA 2DXIA 1QNTA 2AXLA 3KTUA 2LKPA 3E5UA 3OS2A 1LNWA 2ADUA 1P6RA 3SHFA 1WSUA 2CUZA 1DP7P 2VJ0A 5KVRA 2RNJA 4ENNA 3CUQA 2QVOA 3VOEA 1LVAA 3ZR8X 1MGTA 3GEZA 4EJTA 4WK8F 2FUG2 3LSIA 2YX4A 3I53A 4UV9A 3QPHA 1SFKA 1J5YA 3H1ZA 3DFGA 1YS6A 2PMHA 2ZXIA 1VTNC 3AL0B 2V79A 5LBQA 5E1WA 4G94A 2FMYA 3BC8A 4L9JA 4JOMA 4DBQA 4GXOA 3LL7A 2NS0A 2Z9OA 1BC8C 5FRMA 2VBWA 4PGHA 4WX9A 4ZYAA 5J8FA 2VC0A 1REPC 1QN5A 1MJ9A 4RODB 5DCMA 1UB9A 3OV8A 3T8TA 2NNNA 2PJRA 1V5GA 2LY2A 5ERIA 1XGMA 2OD5A 4DNCA 3HOSA 5LGUA 5A2QZ 1FBQA 4BUPA 1YQLA 1WJCA 2VBZA 4ZYGA 1LQ1A 2O03A 2R7RA 2FEZA 2HDCA 1WKMA 1HW2A 3WTTC 4HF2A 2BBYA 2LDUA 2VONA 5J6XA 1AOYA 4H4KC 1USSA 2W82A 3LA7A 4HQMA 4XNFA 4KNYA 3LFUA 1R7JA 4YIIA 3U9GA 2VJJA 3ISPA 1FOKA 3PJRA 1G3TA 3PUBA 2V6EA 1DPRA 3I59A 2STWA 1JI8A 3EUAA 5DCMB 3K2ZA 1LJ9A 3SZPA 3ASMA 1BN5A 3ZMTA 3OSMA 4RAZA 4Q47A 2JA2A 1FSHA 1OLTA 1L0OC 1D3UA 1G3YA 1R4XA 2KJCA 3HSFA 3AAFA 4E7IA 1FNNA 4KYWA 1NGMA 1FP1D 4BHBA 4KFCA 1FZPB 1SD5A 4O3MA 1WQ2A 2R4GA 1RM1A 4XLHA 2UXXA 4XKCA 4LITA 3E97A 4Q5SF 3CJQB 2VXDA 2HVSA 2V1XA 1UAAA 2R7UA 3VSKA 5L3CA 2EWNA 4FHTA 4CCOA 4Y17A 4NC8A 1B9KA 3I71A 1XGSA 5ICEA 2XAJA 2X6YA 4F92B 5BOXA 2UWMA 3V7SA 2Y0SA 3PQJA 1B6AA 4M9ZA 2MLKA 1T98A 3TDZC 3E6MA 3DQVC 2HZTA 2HPMA 4L18B 2JSPA 5LD2C 4ROEB 1U78A 1YTFA 1JGSA 2STTA 2EV5A 1VZ0A 5E1XA 1T95A 4KIFA 3HSRA 3K4LA 3OS1A 2VKHA 1RZ4A 4KITB 3CP2A 3EUKL 1XDUA 2Y75A 3FM5A 3IP4B 5D4SA 5L3DA 3BPVA 4YRVA 1J2XA 3HS8A 1IN7A 4OWRB 2EA4A 2ZNYA 1FWZA 3OYFA 2JT1A 1BIBA 2OU2A 2KMUA 4DJAA 3ZPLA 2DO7A 3CMMA 3VYUB 4XKWA 1VOKA 4BQOA 1D3YA 2X6WA 2XF6A 4I0BA 2NOZA 1R5HA 3PFYA 3TO6A 4A5MA 3FKJA 1F5TA 1G59A 4MLOA 1QHGA 1YQRA 4DQ2A 1U6GA 2M3AA 1QNEA 4CCKA 1M3QA 2MA3A 4IQ4A 2F5FA 1JFIC 3VYSB 2DQLA 3WTYC 3F8CA 3J7AY 5F64A 2IV8A 3FM3A 3KP2A 4ZC3A 4F93B 2FOKA 5AONA 3EQLF 3KRMA 5BS6A 1EBMA 4J01A 1YYVA 4L9VA 4G7OF 2MLGA 3FDYA 2CW8A 3H0DA 3S93A 3OOUA 2VPLA 3P9IA 4EGYA 4PJMA 2ESHA 2M7AA 3R4KA 5HS7A 4ZDLA 2HKOA 2IA2A 2OBPA 4BJ5C 4ESFA 4YIFA 2Z1DA 2K27A 3HRUA 2ZBKA 2LAEA 4YFKF 2GA2A 2XV4S 1HKQA 2R7SA 2VQHA 1OYIA 1S3JA 4YG2F 5FD6A 5LEKA 2CG4A 4HX8A 1W5TA 4HEA2 3ZCOA 2K9MA 4HDUA 1E2XA 1HXDA 1TNTA 2DI3A 3DKWA 1B9NA 3IWFA 2EB7A 2EFOA 2XHIA 2F5EA 4HOBA 2OQRA 4XN3A 2CWEA 4MTEA 5CQGA 2PFBA 4HBLA 2FSWA 3L2CA 3WODF 2P0WA 3A1YA 4ZZLA 2M5WA 2Y48A 5DUKA 4FASD 4B0AA 1KGSA 5D5UB 2BW3B 2EFWA 1I5ZA 3LAJA 1W4MA 4M6YA 2ZXHA 2LC2A 1R1TA 2CSOA 4EVIA 4Y3OA 1KY6A 3W6KB 3OYHA 4C2TA 3GX4X 4FX4A 3HKZA 4OMZA 3TDUC 4CH7A 4TPSA 2X1DA 2G9WA 3J80K 2DCEA 3E3VA 1D5VA 3OC3C 4HLXA 4AU7A 3N4MA 2L9SA 5FO5A 4JQFA 3OYBA 2P5VA 1TBAB 2VQCA 1V4RA 4EM2A 3QYEA 2XAGA 3I0WA 2FMLA 5FLXK 3F21A 4I01A 3I9V2 4PY5A 2COMA 1XMAA 4C9YA 3RYRA 4LG0A 3VYRB 1RNLA 5J8CA 1KYFA 2PLYA 1U2WA 1O7LA 4HX7A 1CDWA 4B3XA 2XC7A 3HIFA 3AKZA 1MMDA 2A5WA 3WU0A 2X85A 4LIUA 1USTA 3GW2A 2VL8A 3BLYA 3ERED 2ZJ2A 2VASA 2EV0A 4YFXF 1PZDA 3QPTA 2FE3A 2RQPA 1Z6TA 3ECHA 1N78A 2LNBA 4DOZA 2HEOA 5L3EA 1ZRCA 3QODA 4UXNA 1FT9A 1MJAA 2RGVA 1O3SA 3ML6A 4OAZA 1FBSA 4Z2YA 4BQNA 3GLXA 4UNOA 1ZG5A 2KL4A 5JVTA 1R58A 3HOTA 3WTXC 1XDSA 2M8EA 3SFZA 4BDZA 4BS9A 3F23A 3HUGB 2QQBA 2Y0MA 1UT4A 5FLXZ 4CZCA 3COAC 4Q11A 3S3NA 2DPUA 1R1UA 2R7OA 2XKPA 4LB6B 1QBJA 3F10A 3WE3A 1QN3A 2QLZA 3OYNA 2PEXA 5E17F 2XHKA 2NYXA 4XQFA 3VWBA 2A61A 2D1HA 2H6CA 2PJPA 1Z9CA 3HC7A 2K02A 5LHGA 2ELHA 1I1SA 3HYIA 3PQKA 5K1YA 3HHGA 1IXCA 5HDKA 4OIQF 1FYLA 3IH7A 4CCMA 4CDGA 3DWLE 4AVZA 3JSPA 4MTDA 4B43A 1SFXA 3V8JA 4O5VA 1JXSA 3F8FA 3HRSA 3K10A 1QN6A 1BI2A 2FQ3A 2VIXA 2DQRA 4A6DA 2P5KA 2HDWA 4EJOA 2CFOA 1UG0A 4BQAA 3FHZA 5ICCA 3GBGA 3BCAA 4U87A 4WXCA 1NG6A 2O0YA 3I54A 2OUMA 4CSWA 1YIOA 1MNDA 1UHMA 3UR3C 2M0MA 2VT3A 2LG4A 2Q2EB 4PGGA 1QQIA 4F55A 3EYIA 5F1RA 1O3TA 2R7XA 3L2QA 2XROA 1LWYA 2PQ8A 1YO5C 3PFIA 3BJAA 1FC3A 4KDPA 1B9MA 3BOQA 2KKOA 5IT3A 2Z16A 4B44A 4XOPA 2MC3A 1W7PD 2W85A 3ULQB 2DOAA 3K4BA 1YQAA 4MQVA 2A6HF 4OINF 1B59A 2HOEA 3ABUA 3NRVA 2V26A 2OZUA 4WXHA 1WJDA 4LMYA 2GIVA 4RB1A 4ZTJA 3CZ6A 3CTAA 5IYBP 5D6FA 3S2WA 2ESNA 3C3WA 1T0FC 1XSVA 1J59A 4XOTA 2C6YA 3V7RA 4RGXA 2RKHA 4LK0F 4EV0A 1HSJA 1DGRM 3N97A 3JTGA 3ZMUA 2W25A 1ZRFA 4ZTFA 3DV8A 4XSZF 3ZN1A 2E5NA 3GFLA 4XLEA 5CLSA 1H0MA 5HS9A 1T6SA 4N4OB 2NNYA 4EJZA 1B4AA 3LA2A 3KYLA 2VJ5A 3OS0A 1DDNA 3W6JB 4KUMA 1E17A 4MHGA 5AN4A 2NOLA 2QENA 3V42A 1F9NA 2W4SA 3RSNA 4HG2A 3H5NA 5BMZA 2VC1A 1K79A 2LF8A 4R8HA 3VN5A 4UVCA 3KEQA 4MEXF 4RB2C 5LEJA 1WRJA 2LH9A 3L9FA 2CV2A 1DPUA 4JBAA 3JW4A 1TBXA 2IVMA 3KCCA 2R7TA 4RGRA 1OR7C 2KLOA 2DAOA 3V4GA 1Z7UA 3MMYB 4UUVA 5D6EA 1KY7A 4HX4A 1HQCA 4EM1A 2XF7A 3DP7A 1J7KA 5CKTA 3W3CA 3JSOA 1MMAA 2BVMA 3BY6A 1MMNA 2H09A 2A3SA 2IS6A 4XMYA 3ZMDA 5FROA 1ZLKA 1LFPA 4PFPA 3M1CA 1ZG1A 4KA4A 4BEHB 2Q1ZB 4LK1F 2KDOA 1X1AA 1XSXA 4U88A 3FMRA 4HW0A 1U8RA 2FXAA 3CDHA 2HQNA 1Z05A 3FXUA 3ECOA 3H3ZA 5EEHA 5TGTA 5FD5A 1K78B 3KEYA 2GZWA 5FGMA 4IX7A 1PP8F 3E1SA 1C9BB 4LFUA 3OYCA 3OYAA 2QKLB 3OIQA 1IRXA 1CGPA 2IXSA 2VJ4A 4CCLA 2VE8A 6PAXA 3DKXA 1OYYA 5BQTA 5KHDA 3HHHA 2O6GE 3I0TA 2E1NA 3RPUD 3HPHA 2BE5F 3DPUA 2JOIA 3QYBA 4D9JA 2DT7B 1HSTA 2KZVA 3K1MA 1XN7A 2JUGA 4U0WA 3SDBA 2BOLA 2M30A 2RVCA 3TBIA 4QPOA 2X1EA 1KU9A 2ZKZA 3OL4A 2NOBA 4PSWA 3HSEA 1N77A 3BDDA 3KLOA 4L0ZB 3FBIB 3DPTA 4XKVA 4CCJA 2EFNA 4PJLA 1BI0A 4L5JA 3DEUA 3LAPA 4BGDA 3M7GA 1YX3A 3KE2A 1QNAA 4OIPF 4E4HA 4ENKA 3QYFA 2E1MC 2EFPA 2KRFA 5HNFA 2MD0A 4JK1X 4HQEA 1MZBA 1V3FA 1BIAA 3M8JA 2IPQX 1YG2A 2XRNA 5JI6A 3OYIA 3RJPA 4NC7A 5IYDP 1HKSA 3V8LA 3RQ4A 1Q1HA 3F9KA 1X3UA 4Y4RA 1FP2A 1HA8A 4M74A 2M87A 1EA3A 5HDGA 4Y15A 1SMTA 2V7FA 3C7JA 3VODA 5AIQA 4XR6A 3BP8A 3REOA 3MQ0A 2O61A 3HRMA 1SFUA 3S8PA 4RB3C 5DV5A 4F91B 1ZG3A 4MEYF 5CVVA 2V6CA 2XF5A 4A12A 3ZRGA 1JHHA 1G6NA 5L3GA 1GVJA 4I09A 3CUOA 1MMGA 3ABTA 1WJBA 4B8XA 2MZ8A 2VN2A 3CJRB 1YW7A 4CUGA 4RLFA 2IP2A 4RB0A 3L2WA 1B1BA 1BR2A 2Z33A 2V1NA 3HTSB 2VE9A 1S8NA 3MD2A 1FX7A 2RN7A 3N05A 1IN6A 1TNSA 3K1PA 1QPMA 2LBFB 2HYGD 3F8MA 3W2VA 2GOMA 2IS1A 1ZELA 2JZYA 3IC7A 3MAJA 5LRRA 4DBRA 2VLAA 2WY7Q 3FF5A 2M4KA 2NOJB 4LJZF 1E42A 1JHFA 2LY1A 4EJYA 3A4CA 4RS8A 4BJ6C 2D45A 1BI3A 3V7CA 2E1CA 4NHJA 5DYMA 1U5TC 1RUNA 4E7JA 4EJWA 2IGKA 3HL2A 1G3WA 4KICA 2RREA 4HV5A 3OR2C 1D1BA 1T39A 4C30A 2KQRA 4B47A 3M8FA 3J81K 4CCNA 2LREA 4B09A 3LQRA 4BDYA 4XBFA 1Z91A 3DEEA 2R7WA 4Y33A 3I58A 2OC6A 1S7OA 2R7FA 5DUIA 4IRIA 1SFEA 2AS5F 1ZYRF 4UVAA 3H9GA 2GXGA 4E7LA 3OYMA 1SMYF 1VOLB 1Z3XA 1XB4A 2K3PA 4F7ZA 3MFKA 3E6CC 2HWVA 4N9HA 1U3EM 1WJEA 1MW7A 3DXJF 4A0ZA 4BE0A 5CVIA 4R1HA 1IN8A 1BJAA 2K5CA 3C18A 1R6RA 3OWTA 2W00A 2BW3A 3ZXSA 1FY7A 2L7KA 4KMUX 1EH6A 2L02A 1N75A 3LSGA 5CQEA 4ZDPA 1LDDA 2FBIA 1FMWA 4R79A 1QNCA 1BOBA 4PSXA 2VT2A 2R7QA 2CW0F 3DU5A 2EV6A 2MBFA 1UCRA 5DD4A 1ZN2A 4YELA 5LHHA 3OYEA 3J81Z 2DBBA 1H9GA 2LOOA 5LFAA 4EMSA 1N3CA 1KQ9A 1SD4A 2K4JA 1GXPA 1K6OA 4BE2A 4O6JA 4XKBA 4KJZA 3L2RA 3OOPA 1EV7A 3NWTA 5HLIA 2R7DA 1DQUA 2CO5A 4HRIA 2HU9A 1P92A 2W84A 3TQNA 2CH0A 4C2UA 2IGMA 2FBHA 2Z8UA 4ANJA 2JPCA 2V1DA 4PUSA 3DTKA 3H35A 2P8TA 1NH2A 1H9TA 4LIVA 3F22A 2IRFG 2CQKA 2JTVA 4P9UA 3LA3A 3WTSC 1TQMA 2PMUA 4ITVA 2GXBA 4PK4A 1OMIA 3PNTA 2E5ZA 2GQQA 3OCIA 1O3QA 3TGNA 4EJVA 2E7WA 2CMPA 1FMVA 3T8RA 1F1ZA 5DDGA 1MDMB 1YTBA 3RPJA 2O3FA 1QTPA 3GZ6A 1DGWY 4KN4X 4I0AA 3J7AO 2A68F 4KT5C 2XVCA 4QWQA 3HUGA 1EH8A 4G6DA 4AIKA 3LFKA 2JPBA 2K4BA 4IXAA 1TTYA 2XSJC 2WY8Q 3E5XA 1PJRA 3NQOA 3M9AA 2W24A 4IZZA 4MQ9F 1U5TB 4CICA 1FN7A 3K4NA 4E6KG 4OMYA 1YFHA 4QLCU 3K69A 3MWMA 1EH7A 3FXRA 1IN5A 2JVHA 4D0PA 1R5GA 4GCVA 3DU6A 4P1WA 3V8KA 3PSIA 1FYMA 4NB5A 2L01A 1HU0A 5D5VB 1IXRC 3EUHC 4M72A 4U0YA 3SYTA 4FX0A 3GO5A 4G6QA 4XM3A 2WTEA 4ENMA 4XLCA 4RGUA 1R36A 3R60A 2IW5A 3WGHA 1SD6A 3CP8A 2LRDA 3EIKA 2CFXA 1S9HA 4A0YA 1LEAA 2MFZA 3BJOA 4BYYA 4EQQA 1QHHD 5ICGA 5FFXA 2MH9A 2YH5A 2CV1A 2WB1A 2GA1A 5AIPA 5H6QA 1W36C 2HGCA 2VXZA 4HYEA 2CGPA 5F6FA 1Y0UA 4OOIA 2ZMEB 2IT0A 4PZJA 4A6EA 1ZH5A 1BR1A 3F3XA 2WV0A 4L9TA 3RI4A 5ILUA 2CYYA 4M71A 3K4MA 3ULXA 1YQKA 5IT9K 3Q9SA 2FNPA 2Q2EA 3BROA 3FZVA 4OIOF 1AWCA 4XSXF 1Y56A 2ELJA 5D5XB 3E6DA 4HF0A 1VTOA 2ACJA 2M45A 1TQIA 3DLAA 3SEQA 5LRSA 1TW3A 5CPRB 2CV0A 2A5YB 4XLNF 2MC4A 1D8JA 2NOEA 2ZCWA 1VTLE 2W1OA 3AL0C 3CO6C 4ESJA 3KZYA 4I2OA 1J9IA 3EDPA 2G7HA 3LSKA 2M4GA 3I3LA 3RYPA 1HKTA 2OA4A 3L2VA 2YR2A 2V9KA 2ETHA 1WJFA 2JSCA 2KPMA 4U7BA 3WE2A 1QZYA 4ASNA 4WWCA 2DW4A 3K4JA 3WGGA 3R61A 4FT8A 2BV6A 3CUQC 2TDXA 2BEOA 1LDJA 4IKFA 4FETA 1YE9A 4BAYA 5IT9Z 3EUHA 2VBXA 3ZN0A 3TOBA 4ZYDA 4NQWA 3MKWB 1U0JA 3QOPA 1S7AA 2DT5A 2FU4A 2P4WA 1P2FA 3F6VA 5DD8A 5HVQC 5BPIA 2V4JC 1IN4A 4L9NA 1SAXA 1HW5A 1W7PA 2D2WA 2F5DA 3K9TA 2HZDA 3W2WA 4K2EA 3WGIA 1W36D 2K9LA 3GFMA 3H9QA 2E7XA 5LLQA 2A07F 1ZREA 2FNAA 1QN9A 3R0AA 3TOAA 3H9JA 4P96A 2G7UA 4XRFA 3EYYA 4EM0B 2L9NA 2ZSIB 3OMYA 3PNVA 1D0ZA 4GYIA 2WC2A 4I8OA 4BXFA 4BJTA 4TV7A 2R3SA 4BH9A 3MKYB 4LB5A 2Z2SB 2NOHA 3QU3A 5BPDA 4IF4A 2QQ9A 4NQWB 5E1ZB 3BG7A 2HVRA 4II2A 1AA7A 2PN6A 1XMKA 1ON2A 1C0WA 2VODA 1J0RA 2EFQA 3P9CA 4BEHA 2IGOA 5ED4A 1W7PB 1QO0D 2OAZA 4BE1A 1GLNA 3MEXA 2HZSA 3UNGC 3ONQA 4B48A 2A69F 3K0LA 4LD5A 3RTRA 1K78A 4M9XA 3K6GA 3FMSA 2PG4A 3HPGA 3HS9A 2QYOA 4AIJA 2GOXB 3EETA 1HBXG 1WFXA 3TO9A 3IRRA 3WTZA 4XLAA 4E70A 4MNUA 4N9IA 4U0VA 3B02A 4WXDA 4IHSA 2VB6A 2CW7A 2UUZA 5ILSA 3BZ6A 1F4KA 4N4NB 1IXSB 4ZH4F 1S6LA 4HAMA 3OYKA 5D5WB 1G4DA 5CYVA 4GGGA 3OYJA 3IL2A 4OIRF 1CF7B 4DIQA 3K1NA 1QGPA 1X19A 4G6TB 2I8DA 2XGXA 4U7DA 3KLNA 4P5OA 5CVRA 1V5FA 2NRAC 5HS8A 3KX2A 2UXNA 4G9YA 1UFMA 5CJ9A 3OSTA 1ZGJA 4KN7X 1IRFA 1STZA 2Z5UA 3H5AA 3QP5A 4S04A 3L00A 1S29A 4A0XA 4D1QA 4HA8A 2X4HA 5E20A