3DPTA

Cor domain of rab family protein (roco)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
308
structure length
298
Chain Sequence
b'SWIKVKEKLVEATTAQRYLNRTEVEKICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLNTSALGYILNEEQIRKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIDNEPEITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLDVKEFIPLPGHPDELVEYKELLGLEKMGRDEYVSGKLEKVFSVSKMLDSVIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rab family protein
molecule tags Signaling protein
source organism Chlorobaculum tepidum
publication title Structure of the Roc-COR domain tandem of C. tepidum, a prokaryotic homologue of the human LRRK2 Parkinson kinase
pubmed doi rcsb
total genus 87
structure length 298
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16095 COR C-terminal of Roc, COR, domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3dptA01
1.10.10.2200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dptA02
3.30.310.200 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3dptA03
3BJOA 3QP6A 4Y15A 3I5UA 2M5WA 1FY7A 5EEHA 3KP5A 2RV8A 2QQBA 4IRGA 1K78B 1XB4A 1ZAOA 2EV6A 1FSEA 3CUQC 1I27A 2ESNA 3WTTC 1WI9A 1G3WA 3W6KB 4OMYA 1XD7A 3E5QA 2MH9A 4AIHA 3JAMK 2QBYA 5DCMA 3TKYA 3TOAA 2IRFG 4A0XA 4JK1X 3F8BA 1LNWA 4B09A 3Q9SA 1G6NA 2YX4A 4G6DA 3F8NA 3G73A 1T38A 1BIAA 2HGCA 1QNTA 2NYXA 2A61A 1IW7F 1SFUA 4Q5SF 3DPTA 1HW5A 1HW2A 2ZKZA 2AS5F 1XDSA 4BHBA 2FBKA 3U1DA 3FX3A 1O3SA 2ZMEB 4LB6B 1U5TA 2GZWA 5J6XA 3GFJA 4WXDA 1EH7A 2L54A 4WXHA 5BMZA 1FYMA 4I0BA 3V7RA 2STTA 1KU2A 5CVIA 1ZH5A 4O6JA 1P6RA 1W7PA 3GZ5A 1B6AA 3GEZA 2GAUA 4FHTA 2XROA 2B0LA 2DW4A 3CDHA 2GQQA 1HSTA 2VC1A 1O57A 1DP7P 1BI2A 3I59A 1OKRA 2MH2A 5HOOA 4EJVA 1U6GA 2EA2A 2A69F 4BXUA 5HS7A 1YS6A 2RN7A 1QZZA 4XSXF 1BI1A 4A6DA 4I2OA 4A5NA 2ZMEA 3MFKA 3CUOA 3IKVA 5J8FA 4G7HF 1IN8A 3VB2A 3SQNA 3K69A 1EV7A 2A68F 5KVRA 4HF0A 1TLHB 4F7ZA 4KYWA 4YIIA 3HSRA 3KE2A 2IT0A 3DF8A 1LVAA 4UHTA 1FBSA 1OYYA 1UHWA 4JQFA 3JAMZ 2X4HA 2W84A 3T8RA 5E8IA 3GFMA 3C7JA 5FD6A 5DUIA 2DQRA 2OD5A 5D5UB 1R1UA 4U0WA 3FZVA 3BPVA 4RB3C 4Q48A 1R36A 2QLZA 1FC3A 1D3YA 4QLCU 2W25A 1BC8C 1Z7UA 2IJLA 1FNNA 2CGPA 4GO1A 3AAFA 1TQMA 4LD5A 4OMZA 4EMSA 3WTUC 4UXNA 2Y48A 1F9NA 2G9WA 3LAJA 4P5OA 3ERED 3LA2A 4M6YA 3VODA 2A6EF 3F21A 3SZPA 3LFKA 3WU1B 1OMIA 5FD5A 2ZFWA 4CZZA 2VC0A 1F1ZA 1ULYA 4OOIA 1YIOA 3BY6A 4U7BA 3GXOA 2PMUA 2D2WA 1ONVA 1XN7A 4IHTA 2BGCA 1JHHA 4N0BA 4Z2YA 3FHZA 1HKTA 1QPMA 4Q47A 1ON1A 4QWQA 4ESBA 3V7SA 5JFRA 5A2QZ 1NHAA 3MEXA 2OU2A 2VBZA 2JZYA 3O2PE 3I4PA 1GXQA 4WCGA 3HTSB 3OV8A 3MQ0A 2XAFA 3COAC 1PDNC 3TDZC 1EH8A 5LEKA 5FO5A 2V9VA 1ZG3A 2FU4A 2XASA 4MTEA 2EJRA 2FNAA 2G7HA 3KP3A 4S05A 3E6MA 5IT3A 5CVRA 3P9KA 1LDDA 2RQPA 2DI3A 4EJTA 2F5FA 1Z05A 2H94A 1WRJA 4L5IA 3BPXA 4RGXA 5LGNA 4IF4A 3WE3A 5LHHA 5BOXA 2M30A 4ESFA 3WGGA 4KIFA 4LFUA 2M1BA 3T8TA 5DV5A 1OYIA 4KIBA 1YLFA 3MWMA 2FNPA 4I09A 3BZ6A 4RGUA 4BQAA 5CVUA 3R4KA 3ZMUA 2UXXA 3BP8A 1BOAA 4PGGA 3C18A 3ULQB 2KJBA 3I54A 2DPUA 4MEYF 1QGPA 2PI0A 3F6VA 1XCBA 3E6DA 2E7XA 5DEQA 2FF4A 4KIGA 1R58A 4OIPF 3GX4X 2QVOA 3T5XA 1DDNA 4KMUX 3IWZA 1GVJA 4YG2F 4IRIA 4OIOF 3ROUA 1XGOA 3E5XA 3P9CA 2PQ8A 5LGTA 4TV7A 5HLHA 2HTSA 1UCRA 2TDXA 3HHHA 2NNYA 4IHSA 2H6BA 2V6CA 5KK1A 2A6HF 3LA3A 5DYMA 4EGZA 2O8XA 1U78A 1KA8A 4LK0F 2KIMA 3MAJA 4EJOA 2ZXJA 2YU3A 2VOPA 1L0OC 2BBYA 2XAQA 2V1UA 2HKOA 2FQ3A 1SD6A 1SD4A 3FM5A 1XDUA 4YFKF 3KETA 1Z1DA 4M74A 2L02A 2ELHA 1S7AA 1TNSA 5JVTA 3RKWA 4Q4ZF 2XV4S 5CLSA 4CHUA 3R0AA 5EEGA 1FT9A 5HS9A 2W85A 4AD9A 1B9NA 1OR7A 5HLIA 4XSZF 2PFBA 3GYHX 2EV5A 2HYFA 5D8LB 2VONA 4A0YA 1BJAA 1BI0A 4UVBA 3W6JB 1Z91A 1R23A 3RJPA 1T2KA 1KGSA 5FLXZ 1L3LA 2DLLA 1GXPA 3SFZA 1ZGAA 1YS7A 4G9YA 1ZGJA 1H0MA 2Y0MA 4HX4A 1BN5A 4LG0A 3ZQ7A 3TO6A 4I02A 3ABUA 2HKXA 3GW2A 4OINF 1YFHA 2YR2A 1LDJA 3BOQA 1LQ1A 1O7LA 1DPUA 1YTYA 3VFZA 1WWXA 4Y17A 1TQIA 5HVQC 4A5MA 1I6XA 3LA7A 2CW0F 3NQOA 3J80K 1FSHA 4LLGF 5FGMA 3TO9A 4EJUA 4UV8A 5A2QK 1B59A 2XAGA 2E1CA 2LDUA 3M8EA 3DKWA 2JPCA 5BPIA 3WTZA 3EQLF 1J0RA 1MD0A 4OIQF 2D45A 2GXGA 2L3DA 2FXAA 3TDUC 1HSJA 2E1NA 5E1WA 1AWCA 2PEXA 4YFNF 5JI6A 2ETHA 1JE8A 4GYGA 2XUBA 4CGZA 1XGNA 1ZG5A 2IA2A 4FX0A 2YPRA 2K7LA 1W5TA 3NEUA 1FP1D 2P7VB 4CICA 2CYYA 3I64A 3TOBA 5K5RA 3HRMA 2ZBKA 4OU0A 3DP7A 3LQRA 5D5WB 2OZUA 1TQPA 4MNUA 2COMA 1USSA 3CO6C 1HQCA 1P2FA 4MEXF 2HQNA 2J5PA 1RNLA 3WE2A 5CVJA 3DPLC 3ELKA 4DQ2A 1YQAA 3RI4A 2FE3A 2VBXA 3GFIA 3MCZA 2ZJ2A 3KEQA 4HZFA 5D8KB 3C1DA 5K5QA 3RPQA 2QM3A 2OZ6A 1E2XA 1RUOA 2DFIA 4E70A 4O3MA 4RB0A 4BH9A 1WQ2A 4IRHA 2QUFA 1C0WA 4KFCA 4L0YB 3IRRA 3V8KA 3F22A 2HTJA 2M87A 3QAHA 4G6QA 4R1HA 3WTVC 4ZH4F 4I01A 4U0VA 1DPRA 2MLKA 2DTRA 4HX7A 3J81Z 3KCCA 4ASNA 3C3WA 1R1TA 3ZMTA 2ESHA 5HDKA 2H27A 4RAYA 1AOYA 2X0LA 5IT9K 4KICA 4GYIA 1XMAA 3HSEA 2MD5A 5DD8A 5D6FA 4L9TA 2RGVA 1LEBA 3CUQA 3KP2A 2LF8A 2G7UA 5D4SA 4LK1F 2K4JA 2RNJA 2CG4A 3M1EA 5LHGA 2P7CB 2A07F 4A2UA 2IVMA 2JT1A 1FLIA 3S2WA 1FYLA 2ZCWA 2OA4A 4M71A 3WTYC 4HF2A 3KP4A 5L3FA 5D4RA 2DPDA 1CF7A 1BM9A 4PCQA 1STZA 2ZO4A 3FXUA 2L01A 3FMQA 1TTYA 1OYWA 1S3JA 1FPQA 4IJAA 1RI7A 3RYRA 5FB2A 2QQAA 5ILVA 2JSCA 1D8JA 1PP8F 3ABTA 4XBFA 1S7OA 3ZPLA 3ECOA 2VN2A 3BROA 3HTUA 2LF7A 3SXYA 4YFXF 1DUXC 4WWCA 3BWGA 3IWFA 4HQEA 5D6EA 2EB7A 2P8TA 2L4MA 4FX4A 1G3TA 2DK8A 2O3FA 2Q2EA 3I58A 2D1HA 4UVCA 2V1DA 2HDCA 3RTRA 3K1MA 5ILUA 4CYDA 3U9GA 4BNCA 3FXRA 1YG2A 1RIOH 5E1XA 3JTHA 5ERIA 2H09A 5CJ9A 4RAZA 3KLOA 2GXBA 4KN7X 2FRHA 3L7WA 4I7HA 4RGRA 3ZN0A 2XGXA 2F2EA 1K79A 3K1NA 1BIBA 1HBXG 1ODDA 2DU9A 3IL2A 5CVVA 2P5KA 4BAYA 1K78A 5ICCA 2QYOA 2K4BA 3K0LA 2HQRA 1XSDA 5H20A 1SD7A 2NAZA 1SMTA 3CO7C 4KNYA 4LLLA 1USTA 1ZLJA 1I1GA 3HYIA 3M8FA 3LSTA 1BBYA 3BJAA 2ZNZA 1J9IA 1S6LA 4LB5A 4WK8F 2BE5F 2EFQA 3HRUA 1T39A 1KQ8A 4ZZDA 1R5HA 3HSFA 1H9GA 1R1VA 2GA2A 2IP2A 3N4MA 1KU9A 4KMFA 5FFZA 2P5LC 4ZYDA 4HX8A 2R7DA 3M7GA 2YSRA 3IKTA 4ZYHA 1XSXA 2PG4A 5DUKA 1A04A 3QU3A 5DD4A 4G7OF 5L3BA 1U3EM 1HKSA 4EM0B 5FFXA 3IC7A 4KN4X 2DQLA 4BYYA 1J5YA 3F8CA 1O7FA 1W7PB 3DV8A 4RB1A 2FSWA 3K2ZA 1G3YA 4EM1A 1IN5A 2EFPA 5ILSA 4S04A 3VEPA 2H6CA 5D5VB 3G3ZA 4L9NA 5FLXK 3MZHA 3WTSC 3REOA 2UZKA 1R00A 1ZREA 1PUEE 1B4AA 1ZARA 3RIRA 4HDVA 4HA8A 5K5OA 1LEAA 5AONA 3DPUA 3KLNA 4ZYGA 4YIFA 2VE9A 4EV0A 3L2CA 1ZRDA 2FEZA 4JBAA 4P55A 2Q8KA 3ZMVA 1UB9A 1IAWA 4RB2C 1P4XA 3HRTA 1FZPB 1YYVA 4ENJA 1SFXA 2DBBA 1TBXA 3FWEA 1IXRC 1F4KA 1KYWA 4AIKA 5L3GA 4HV6A 3RPUA 3L9FA 4EQQA 3SZTA 3JSOA 4HW0A 3T1BA 2KIUA 1O3TA 2K86A 4HAMA 2MC3A 1YW8A 1FWZA 3RDIA 3WGIA 3QPHA 2F5EA 4N9IA 1U8RA 3EDPA 4HYEA 2RKHA 1FOKA 1W7PD 3GF2A 4UV9A 1IN4A 2IPQX 1W5SA 2Z99A 3KFWX 1FYKA 3U2RA 4O5VA 3WG9A 2Z33A 3Q5FA 1JGSA 1B9MA 3R61A 2PN6A 2R7FA 1SFEA 2RC4A 3I0TA 3RKYA 1RZ4A 1SD5A 2VT2A 1RUNA 3F8MA 1JXSA 4LJZF 3GUDA 1FP2A 5LRSA 1HXDA 5LHIA 4CXFA 4P9FA 4AIJA 2A5YB 2BYVE 1J75A 2FBIA 3ZMSA 1HKQA 4MTDA 2RVCA 4WF2A 2NNNA 5JHUA 2VODA 4PZJA 5TJJA 2UWMA 4U88A 3O3KA 4L9JA 4U7DA 2PBIA 2BEOA 2HYGD 5DCFA 1W4MA 1XMKA 2P6TA 3EUHA 1ZYRF 2WV0A 4L18B 5ICEA 3V4GA 3E97A 5D5XB 2V79A 3IRQA 2VBYA 1B1BA 1F5TA 3R6SA 5BS6A 3ECHA 2HWVA 3GVAA 1KQ0A 4KDPA 1U2WA 1P4AA 2QWWA 3VOEA 3HOSA 3GWZA 5AIPA 3V8JA 1T98A 1IZ1A 1TNTA 4ENMA 1BI3A 3I71A 1KQ9A 1H9TA 2NS0A 2RDPA 1XSVA 4HOBA 3QOPA 3HOTA 5L3EA 1MJBA 1ZLKA 1QBJA 2OBPA 4XLPF 2M8EA 1YW7A 4AVPA 3DQVC 2KKOA 2CFXA 2LSOA 2HEOA 3EYYA 4G94A 3Q9VA 4M6XA 2Y75A 3LWFA 2W24A 3P9IA 1E17A 5IT9Z 1G4DA 3ML6A 1O3RA 2IA1A 1REPC 3E5UA 3R60A 4A0ZA 3F23A 2ADUA 2Z5UA 4I0AA 3BJ6A 5L3DA 4HBLA 2P4WA 2HS5A 1KU3A 2WTEA 4H0EA 4KUMA 4HQMA 3KP6A 4A12A 3D0SA 5CYVA 1Y0UA 3WGHA 4MHGA 1IN7A 3E6BA 3GLXA 1Z9CA 1UHMA 4EVIA 3FF5A 3JSPA 4EM2A 3HRSA 3QP5A 2DT5A 3ZN1A 4L5JA 3JTGA 1D5VA 1JHFA 3LQQA 3KEOA 2HZTA 2JTVA 5LEJA 2EFWA 4ZYEA 3CUQB 5H6RA 1IN6A 2FOKA 4MQ9F 4HV5A 5HDNA 3GO5A 1U5TB 1QQIA 5LRRA 1TW2A 4XRFA 2QQ9A 2STWA 4R8HA 1Z6TA 1IF1A 4B8XA 4M72A 2P6SA 1HW1A 3I59B 3FMRA 2E7WA 1P4WA 3RYPA 2O6GE 1K6OA 2OQRA 2OQGA 2EV0A 1QZYA 3F72A 3ZP5A 2ACJA 1MDMA 3KP7A 2ZNYA 2DAOA 2HFHA 5E20A 2F5CA 1FX7A 1MZBA 3P7NA 3CJNA 1QO0D 5L3CA 3SHFA 2JRTA 2V1XA 4G7ZF 4NQWA 2KIFA 4HLYA 3T0YA 2XKOA 1YO5C 1PP7U 3O6BB 2MLGA 3ZMDA 2VT3A 1SMYF 4MGRA 1P92A 4P9UA 1TW3A 2PJPA 5ICGA 4ZZLA 3D5LA 2O61A 3KZZA 5LBQA 3R0JA 2QBYB 3OOPA 2XAHA 4P96A 3M9AA 2YX7A 3LAPA 5JR3A 3FM3A 3TQNA 4BHPA 3L09A 2XAJA 2IW5A 3QPTA 3PFIA 1S8NA 1FBUA 4Y13A 1LB2A 4LLNA 5DCMB 4GGGA 4LMYA 3RKXA 3EETA 3ISPA 4PGHA 1ZRCA 2Z3YA 2QZ8A 2JPBA 2CWEA 2Q0OA 5HLGA 2KRFA 5F1RA 5ED4A 3WTXC 2A3SA 3ZMZA 1ZHFA 1Q1HA 4LG0B 2K27A 2MBFA 4EJWA 4GCVA 2NRAC 3H92A 4UVAA 4G8XA 1MKMA 2Z9OA 2O0YA 3HUGA 1ZN2A 2VOOA 5LGUA 3J81K 1R7JA 2ISYA 3IHUA 2AXLA 1R22A 1XCVA 4KA4A 2M45A 5J8CA 5BPDA 5K1YA 1XGMA 2HOEA 5LLQA 4WXCA 1MDMB 2D1VA 1MJAA 3I53A 2EFNA 2GIVA 4D0PA 3B02A 4RS8A 2GWRA 4ESJA 3F3XA 4PDKA 1WKMA 1G3SA 3CTAA 5TRDA 3V7CA 1S29A 4EGYA 5F64A 4BHCA 3PQJA 4HLXA 5BQTA 1T0FA 2XIGA 3CLOA 3NRVA 5H6QA 4ON0A 1I5ZA 4HF1A 1OPCA 2VE8A 3DFGA 4K2EA 1IUYA 4IPAA 4FT8A 3QU6A 1VTNC 4IVNA 1KYZA 3HHGA 4M9SA 1MGTA 1CF7B 1KU7A 2OAZA 4M9ZA 4M73A 2DK5A 4DNCA 3V8LA 3J7AO 2VXZA 5E18F 2LKPA 4ETSA 1V4RA 2IA0A 4XLNF 5DDGA 5HS8A 1XGSA 1ZRFA 3GFLA 1UFMA 2UXNA 2FMYA 3EYIA 4UUVA 2QENA 4IXAA 3TGNA 1J2XA 3HIFA 5E8GA 1SAXA 2CQKA 2XHKA 5ICFA 1LJ9A 1D8KA 2CSOA 2KJCA 1GHCA 3PQKA 3MZYA 5E17F 4AWXB 4I98B 4ENNA 2XKPA 1ZG1A 2FBHA 3QRFF 3J80Z 2WC2A 1BC7C 6PAXA 4NB5A 3JW4A 3E6CC 2ISZA 4CO8A 3FXQA 4LGWA 2EFOA 4UNOA 2GA1A 2CO5A 1T6SA 3WODF 1I1SA 4KT5C 5E1ZB 1J7KA 2R3SA 2C6YA 1EH6A 2W57A 5AIQA 1IXCA 5F6FA 3H3UA 2EA4A 2PMHA 4MQVA 4U0YA 4N9HA 1K7AA 1FBQA 2EWNA 3FMSA 3DXJF 1X3UA 2XVCA 1WSUA 3GZ6A 1J59A 2FMLA 2BV6A 2XRNA 3L00A 3KZYA 2P5VA 1O3QA 1V3FA 1R5GA 4NHJA 4CDGA 1U5TC 2O03A 3H3ZA 3K9TA 2PLYA 2DO7A 3WU0A 3B73A 3BDDA 2WWYA 2MA3A 4GXOA 3F6OA 5HDGA 2EK5A 4RGSA 4A6EA 3WTWC 1YW9A 2FA5A 4WX9A 3K1PA 4R79A 2F5DA 3N97A 1CGPA 1IRFA 3DEUA 1LDKB 4L0ZB 3F8FA 2K02A 3E3VA 4HDUA 2VBWA 2L4AA 1IRGA 4ENKA 4OIRF 1ON2A 4M9XA 2J5OA 2HR3A 3TO7A 1Z6RA 1IXSB 4L9VA 2LNBA 1MJ9A
chains in the Genus database with same CATH superfamily
3BJOA 3ERMA 3QP6A 4Y15A 2QGUA 3HPGA 3I5UA 2M5WA 4ROCB 1FY7A 5EEHA 3KP5A 2R7SA 3ENOC 2CV0A 4YRVA 2RV8A 1M1EB 2QQBA 1GUUA 4BS9A 4IRGA 1MPGA 1K78B 3OH9A 1D0YA 1XB4A 1ZAOA 2EV6A 1FSEA 2WV1A 3CUQC 1I27A 2ESNA 3WTTC 5F9CA 3OYBA 1WI9A 1G3WA 3W6KB 2Y8LA 4HRIA 4OMYA 3LSMA 4WXAA 1XD7A 3E5QA 2MH9A 4AIHA 3JAMK 2QBYA 5DCMA 4LG3A 3GBGA 2FX0A 3TKYA 2Y69H 2F4MB 3TOAA 2IRFG 3IH4A 4A0XA 4F52A 4JK1X 3F8BA 2VKDA 3H36A 1MIJA 1LNWA 4B09A 3Q9SA 3ONQA 2BHZA 1G6NA 3QODA 2NOFA 2YX4A 4OWRB 2IS2A 4G6DA 3F8NA 3G73A 1DU0A 5F27A 3CESA 1EA3A 2LVSA 1T38A 5HLTA 3OWTA 2CW7A 1BIAA 4PUSA 1R9TJ 4PFOA 2X51A 2HGCA 2RQQA 5EEAA 1QNTA 4HSRA 2NYXA 2A61A 1IW7F 1SFUA 4Q5SF 4EAGA 3DPTA 2V9JA 1HW5A 4D7QA 1HW2A 2ZKZA 2AS5F 1OCRH 5H2FC 1XDSA 5FJ8J 4BHBA 2L7KA 2XGEA 5E3NA 2FBKA 4Y7NJ 3U1DA 2OTJI 2LREA 3FX3A 2DA4A 1VQMI 1O3SA 2ZMEB 1OLTA 4LB6B 2VQGA 1U5TA 2GZWA 3M1CA 5J6XA 4A3DJ 3PMGA 4BKXA 2LKSA 3GFJA 4WXDA 1EH7A 2L54A 4WXHA 3FK7A 4FETA 2QEXI 5BMZA 1FYMA 4GDFA 4XN3A 2W82A 4I0BA 3V7RA 2STTA 1KU2A 4G6TB 5CVIA 4O6JA 1P6RA 1W7PA 1NH3A 1ZH5A 3GZ5A 1E0EA 3PJRA 2Y8QA 1B6AA 1X2MA 2BVMA 3GEZA 2GAUA 4FHTA 2XROA 1HU0A 2B0LA 2DW4A 3CDHA 1NK2P 2GQQA 3S1QJ 1HSTA 1DIZA 2VC1A 1O57A 2KPMA 1DP7P 4CSWA 1BI2A 3NARA 1VOLB 3I59A 1OKRA 2CW8A 2MH2A 1LWYA 2DT7B 5HOOA 4EJVA 1U6GA 2HOSA 2EA2A 2A69F 1Z7LA 1S7EA 5J1RA 3L2RA 4BXUA 2QA4I 1U8BA 5HS7A 1MNDA 5IYDP 3CJRB 1YS6A 2Q2EB 1QZZA 2RN7A 4XSXF 4XN0A 1BI1A 2V7FA 2V92A 4A6DA 4I2OA 2Y0SA 4A5NA 2ZMEA 4Y4RA 3MFKA 2ECBA 1T0FC 1ZGWA 3CUOA 3IKVA 5J8FA 4G7HF 2NLVA 1IN8A 3VB2A 3S1NJ 3SQNA 3K69A 1X4OA 1EV7A 2A68F 5KVRA 4HF0A 4Z6YA 2PJRB 1TLHB 4F7ZA 3JRHA 3JRDA 3HZJA 4KYWA 4MFEA 2KDZA 2EQRA 4YIIA 1JDYA 1YOVB 3HSRA 3OS2A 1VI0A 4PJJA 3KE2A 2IT0A 3DF8A 4CCOA 1LVAA 4UHTA 2OUMA 1MH3A 1FBSA 3HC7A 2NOEA 3TL4X 1OYYA 1UHWA 4JQFA 1MBJA 4JP0A 3JAMZ 3S93A 4IEJA 1M3HA 2X4HA 3BR5A 2W84A 2R7VA 3T8RA 1VQ4I 5E8IA 1Y56A 3GFMA 3F9KA 3C7JA 3BZCA 1OQYA 5KCMA 3VSKA 1MBKA 5FD6A 2WAQN 2WY8Q 2EZLA 1TBPA 2R92J 1IO2A 5DUIA 2DQRA 5LD2C 3CCVI 1VKLA 3RKQA 3B6CA 4FCYA 2OD5A 3DU6A 4C3IJ 1R1UA 5D5UB 4U0WA 2X6WA 2VB6A 3FZVA 3BPVA 2HYJA 2OJED 1K61A 4RB3C 4Q48A 1R36A 2DA1A 2QLZA 4MFDA 3M8JA 4LOCA 1FC3A 3OGDA 2ZXWH 1TT0A 1D3YA 4QLCU 2DOEA 3FXKA 4C2TA 2W25A 1BC8C 1UMQA 1Z7UA 2FD5A 2IJLA 2NVXJ 1FNNA 4V2FA 2CGPA 3HM5A 1BR1A 4A3KJ 2COBA 3K10A 5J40A 2H1KA 4PSWA 4GO1A 2XPWA 2LBFB 3JRGA 1E3PA 3AAFA 3W2WA 2AQFA 1TQMA 4LD5A 4OMZA 4EMSA 3WTUC 4UXNA 2Y48A 2R5YB 1P5GX 1F9NA 2G9WA 3LAJA 1VQPI 1RPWA 2VL8A 4P5OA 3CCEI 3ERED 3LA2A 3CCQI 3IAM2 2LK2A 2DOFA 2DTZA 4M6YA 3OS0A 4XKWA 4UUTA 2LOOA 3VODA 4ZTJA 1Y6IA 2A6EF 2DMPA 4E7ZA 3F21A 3SZPA 3LFKA 3WU1B 2OPTA 1OMIA 4BJTA 3K4KA 2KRCA 1UL7A 1Z77A 2ME6A 2NVTJ 2V4JC 5FD5A 2ZFWA 4CZZA 2VC0A 1IDYA 3WHCA 2E60A 1F1ZA 3A1YA 2LH9A 2LYCA 3S32A 2HL8A 1ULYA 1M5Q1 1BL0A 2IV9A 4OOIA 1YIOA 3BY6A 4U7BA 2IV8A 5FRNA 3GXOA 1JKOC 2PMUA 4BEHB 1YX3A 3IUOA 4IL6C 2V8QA 1IUFA 2D2WA 2F5VA 3AG2H 1ONVA 1XN7A 4IHTA 5JHFA 2BGCA 1JHHA 4RDUA 4N0BA 2R5ZA 4HG2A 4Z2YA 2NVMA 3FHNA 3OIPA 2ICWG 3MMYB 5EGOA 3OYNA 3FHZA 2M0MA 2RREA 4KJZA 1HKTA 3FBIB 1PCZA 3HBLA 5LFAA 1QPMA 4Q47A 1ON1A 4QWQA 2MC4A 3LMMA 2YH5A 1TUOA 1EJ9A 3MD2A 2KLOA 1D1BA 4ESBA 3D1NI 3V7SA 5IP9J 3K4JA 5JFRA 3VN5A 2ZSHB 5A2QZ 1NHAA 3SJMA 2W00A 3MEXA 1GV2A 2OU2A 3VYTB 2VBZA 1W0TA 1QHHD 3ZQQA 2JZYA 1QN8A 2QCOA 3O2PE 3I4PA 1GXQA 3E0JB 4WCGA 3HTSB 3OV8A 3MQ0A 2XAFA 3COAC 1PDNC 3TDZC 4AYBA 1EH8A 5LEKA 5FO5A 1MSFC 4JOMA 2WA0A 2K3PA 1MBEA 2V9VA 4XKCA 1D1CA 1ZG3A 2FU4A 2IAIA 2XASA 4MTEA 4Q11A 2EJRA 2FNAA 2G7HA 3KP3A 4S05A 2K5CA 1WJWA 3C04A 3E6MA 5IT3A 5CVRA 3P9KA 1VZ0A 1LDDA 3DLAA 1Y39A 2RQPA 2Y9ZA 4QIWN 2DI3A 4EJTA 1MNEA 5CQEA 2F5FA 3CF5F 2X48A 2E2HJ 3S3NA 2XDVA 3HOWJ 1Z05A 5IYBJ 2A6TA 2H94A 2X6XA 1IV6A 1WRJA 4L5IA 3BPXA 1F43A 4RGXA 5LGNA 5HSHA 3QYBA 3ENCA 4IHXA 4P1WA 1DU6A 4UB6C 2JVHA 3O8GA 4IF4A 4Y33A 1JFIC 1PVEA 3K4CA 3WE3A 2LMDA 3K4LA 2B63J 4I76A 2NVQJ 1E3OC 5LHHA 5BOXA 1K4SA 2M30A 3IV5A 2TCTA 4ESFA 3L2UA 3WGGA 4KIFA 4M3GA 1LFBA 4LFUA 2M1BA 3T8TA 5DV5A 1OYIA 4KIBA 1YLFA 3MWMA 2FNPA 4I09A 2D0CA 3BZ6A 4RGUA 4BQAA 2DDAA 5CVUA 3R4KA 1RR7A 1Z67A 2LTPA 5IYCP 4C9YA 2VPRA 3BT9A 3ZMUA 3CW7A 2UXXA 3BP8A 1BOAA 4PGGA 1W36C 2M3AA 3C18A 3ULQB 2KJBA 2KL4A 3I54A 2DPUA 1OCTC 5FKLA 3H1CA 4BBRJ 2JA6J 3E1SA 4MEYF 3OOUA 1NG7A 4C3JJ 1DQUA 5J47A 1QGPA 2PI0A 2XF5A 2EPFA 4IKFA 3F6VA 1GV5A 2X1EA 1XCBA 3E6DA 2E7XA 5DEQA 5IY5H 2FF4A 4KIGA 1LXTA 1R58A 3K6GA 2JMWA 4OIPF 3ZOBA 2NOBA 2F7LA 4KITB 4DIQA 2QVOA 5F0CA 3GX4X 3HXLA 1I3QJ 3PSFA 3T5XA 3K70C 1I6HJ 1DDNA 4KMUX 3OYKA 3FXMA 4PJMA 3IWZA 4RM2A 1XPXA 3PO2J 1GVJA 2DMTA 3FKJA 3VYSB 4ANJA 4YG2F 4IRIA 4ROEB 4BJ6C 3ABLH 4ITVA 3ROUA 4OIOF 5F1JA 1XGOA 3E5XA 3OMYA 4ZDPA 3P9CA 4ZDOA 2PQ8A 5KNLA 1V5EA 5LGTA 4TV7A 4DW6A 5HLHA 1Q9UA 5EG0A 2HTSA 1UCRA 2TDXA 3HHHA 2NNYA 4FQGA 3I3WA 1MMAA 2GLOA 4IHSA 2H6BA 1YIJI 1WJAA 2V6CA 5KK1A 4DYRA 2HNHA 2HVQA 2A6HF 1QN4A 3LA3A 5DYMA 1R4XA 5E3LA 4EGZA 2O8XA 4ZYAA 1U78A 1KA8A 4LK0F 3CMYA 3H1ZA 2MJ7A 2KIMA 3MAJA 2H4LX 3NA5A 4EJOA 3EUHC 3DU5A 3AFHA 2ZXJA 2YU3A 2VOPA 5B66C 1JT6A 2BW3A 2PJRA 1L0OC 2BBYA 2XAQA 2V1UA 2HKOA 4E7LA 2R5XA 2WB1A 3CCSI 4QSHA 1FIAA 2FQ3A 1SD6A 3FXLA 1SD4A 1N3CA 3FM5A 1XDUA 3H9QA 1VQ7I 3N89A 2XF7A 3DTKA 1YQMA 3GTQJ 4YFKF 4XLAA 1LFPA 2E36A 1KYDA 2G0EA 3KETA 3TP3A 3LSIA 1JJ8C 1LVKA 3A01B 2OCEA 1Z1DA 4M74A 2L02A 1QN6A 2NOZA 2ELHA 1S7AA 2IEKA 2CUZA 1TNSA 5JVTA 4A3GJ 3RKWA 1M3QA 3CQZJ 3CF2A 4Q4ZF 2XV4S 4BJUA 1WPKA 5CLSA 4CHUA 1VQNI 3R0AA 5EEGA 1FT9A 2JUGA 3M4OJ 3A4CA 1AISA 2DFEA 3J7ZI 5HS9A 2W85A 4AD9A 1ZKGA 1B9NA 1ORKA 1OR7A 3ZQGA 3HJEA 5HLIA 4XSZF 2PFBA 3OYCA 2QRDA 3GYHX 3OS1A 2EV5A 2HYFA 2V26A 5D8LB 1SVLA 5CQGA 2VONA 3I3LA 4DOZA 4A0YA 4E4HA 4NBQA 1VFCA 1QVUA 1BJAA 1BI0A 4UVBA 1UT7A 2JHJA 1N25A 3F0CA 3W6JB 2Z0FA 1PJRA 1N39A 3CWSA 1Z91A 1R23A 2DYRH 3RJPA 1T2KA 1KGSA 2VQLA 5FLXZ 3S3OA 3RPUD 1L3LA 5KHDA 2DLLA 4A69C 1GXPA 2NOHA 2GM4A 2X6OA 1AKHA 2IGKA 5GADJ 1IV8A 3SFZA 1ZGAA 5EPCA 4XIDA 1YS7A 4H4KC 2KRHA 3CCRI 4G9YA 1ZGJA 1Z0XA 1H0MA 2HL9A 2R5YA 3CC2I 3DKYA 2Y0MA 1BJZA 1XMXA 2D5VA 4HX4A 4BQNA 1BN5A 1R4MB 2DJNA 1TL8A 4RLFA 3PIOF 2QSHX 1MMDA 4LG0A 4AIDA 3ZQ7A 3TO6A 4I02A 2QSFX 3ABUA 2E5NA 2HKXA 3GW2A 4FASD 4OINF 2UUZA 3KRMA 5KL0A 1YFHA 1D0XA 1GT0C 2YR2A 3CDLA 1LDJA 3BOQA 1LQ1A 1T8IA 5BMNA 1O7LA 5K7HA 1B72B 2XSJC 1DPUA 3CZ6A 3RPJA 3UNGC 1YTYA 3VFZA 1WWXA 4Y17A 1TQIA 2R7UA 2E35A 1MH4A 3BLYA 5HVQC 4A5MA 1UZCA 2EIMH 3RCOA 4E7KA 1XX5A 1I6XA 2QSGX 3LA7A 2ELKA 2DMNA 2XRLA 2CW0F 2QQ8A 3NQOA 3J80K 1FSHA 4LLGF 5FGMA 2E34A 3TO9A 4XOTA 4EJUA 4UV8A 2GXAA 2L0KA 3TDHA 5A2QK 1B59A 2XAGA 2E1CA 2LDUA 3M8EA 3DKWA 1N75A 2JPCA 5BPIA 1XS9A 5FLMJ 1LE8A 3WTZA 1N78A 3BTJA 1J0RA 3EQLF 1MD0A 4OIQF 2DMUA 1WH7A 2D45A 1V5SA 1QNEA 1NVPA 1ETQA 2GXGA 1FOYA 2JOIA 2DA6A 2L3DA 4CA0A 4DZPA 2FXAA 5FKOA 4XRSA 3TDUC 4DYCA 4E7HA 1HSJA 2E1NA 5E1WA 1AWCA 2PEXA 2VKHA 4CCLA 4YFNF 5JI6A 3OYHA 1Z3YA 2ETHA 4CCKA 1VTLE 1JE8A 4GYGA 3EIKA 2XUBA 4CGZA 3A0HC 1XGNA 3A01A 1ZG5A 2IA2A 5DM6F 2HKPA 4FX0A 3S15J 2YPRA 2K7LA 3VWBA 1POGA 1W5TA 3NEUA 2M7BA 1FP1D 1O4XA 1ITYA 2P7VB 4F92B 3OYIA 1MMNA 2NVUB 4J00A 1ZELA 2VXDA 2KHMA 4CICA 3OYLA 2L5QA 1R71A 4CCJA 5AN4A 2Y30A 2CYYA 2IBDA 3I64A 1AHDP 1OJLA 3TOBA 5K5RA 3HRMA 2R5ZB 2ZBKA 1J09A 3D5RC 2OCCH 5M5WJ 4OU0A 3DP7A 3LQRA 5D5WB 1YRNB 3PNVA 2OZUA 1TQPA 3HS8A 1OR7C 2VJJA 2F4IA 1WJ5A 4MNUA 1JI8A 2COMA 2M8GX 2MSYA 2XGCA 2JPIA 1USSA 3HOZJ 2FUVA 3DWLE 1HQCA 3CO6C 1P2FA 4C2UA 4MEXF 1VNDA 3NAUA 2HQNA 2J5PA 3DEWA 3AKZA 1RNLA 4IOAF 3WE2A 2KP6A 5CVJA 5K7FA 3DPLC 3ELKA 4DQ2A 2JA7J 1YQAA 3RI4A 2CV2A 4XMYA 3DLLF 2FE3A 2VBXA 2EIJH 3TEDA 2N8GA 3P5JA 3GFIA 3MCZA 2ZJ2A 3KEQA 3ZRGA 4HZFA 5D8KB 1T33A 3C1DA 3OSMA 3K7AJ 3HG9A 5K5QA 1QNBA 3RPQA 2QM3A 2OZ6A 1E2XA 1IGNA 1RUOA 2DFIA 2GBYA 1BR2A 4B3AA 4CCNA 1WJEA 4E70A 4O3MA 2NXNB 3BTCA 4RB0A 1V5FA 4BH9A 2DA2A 4J19A 2K85A 2BXYA 3KYDB 4IZZA 1WQ2A 2GOXB 1Q1VA 4IRHA 2L9VA 2HDDA 1VQ5I 5B5EC 2RAEA 1MSEC 2QUFA 3I4NJ 1V55H 1C0WA 3OC3C 4BDZA 2OOYA 1ZR4A 5IOZA 4KFCA 4CYCB 4L0YB 3IRRA 3V8KA 1BW6A 1HCRA 3BQZA 1YTFA 5GPCA 3LL7A 2HTJA 3F22A 3BKQX 3CLQA 1F36A 2D0AA 1QN7A 2M87A 3BR6A 3QAHA 1SFKA 2CV1A 3TBIA 4G6QA 3JRIA 2HPMA 2KIQA 4R1HA 3U21A 2DKDA 1SANA 2Y9YA 3WTVC 3QPSA 4ZH4F 4I01A 4U0VA 3BR2A 4BBSJ 3QPLA 2WAQA 1JGGA 1DPRA 3A03A 4S0HB 3PL8A 2MLKA 3G1MA 1N3AA 2DTRA 4HX7A 3J81Z 3KCCA 1YE9A 1YX5A 4ASNA 1KO9A 3C3WA 1R1TA 1G8XA 2JRMA 2DFFA 2ESHA 3ZMTA 5HDKA 2H27A 1GDTA 2JJ7A 2HQ5A 4RAYA 1AOYA 2X0LA 2IS1A 2Q1ZB 1I39A 5IT9K 3SZGA 1BA5A 4MRQA 4KICA 1PUFA 4GYIA 2H1LA 3CP2A 4XK4A 2ID3A 1XMAA 1QTPA 2PX9A 2MD5A 3BTIA 3HSEA 5D6FA 5DD8A 4L9TA 2RGVA 1LEBA 1B9KA 3CUQA 3KP2A 3CCJI 5JLXA 2LF8A 3AG3H 2G7UA 5D4SA 3G1OA 4LK1F 1IJWC 5FKMA 1W5CC 2K4JA 2RNJA 2CG4A 3M1EA 3H3VK 5LHGA 2P7CB 2A07F 4A2UA 2IVMA 2JT1A 2XGDA 2I10A 4B3XA 3EPZA 1FLIA 2MD0A 3S2WA 1FYLA 2ZCWA 2KT0A 1K6YA 2OA4A 4M71A 3WTYC 3A2KA 3PSIA 4HF2A 1A6QA 3KP4A 3LSJA 1TT5B 5DM7F 5L3FA 5TISC 4BXXJ 5D4RA 4C2MJ 2DPDA 1CF7A 3SNSA 1BM9A 4PCQA 2Y31A 3FDYA 1KYFA 1EBMA 1STZA 4RA2A 4NQWB 5J3LA 2ZO4A 2JA2A 2E2JJ 3FXUA 3VSLA 4UY8I 3HS9A 1WJDA 3ZR8X 2L01A 3FMQA 1TTYA 1OYWA 5M3FJ 1S3JA 1FPQA 5DS9A 3IH2A 4IJAA 1RI7A 3CD6I 4AC0A 4D7RA 3RYRA 1K2YX 5FB2A 2Y2ZA 1A35A 1WVRA 4L5EA 2QQAA 5ILVA 2JSCA 1ZTRA 2Z2SB 1QN5A 2FUG2 1LKXA 1P7IA 2K9MA 3BG6A 4XM3A 1YRNA 1PP8F 1D8JA 3ABTA 3AG1H 5C4XJ 4X1EA 3ZQHA 4XBFA 2FOWA 1Z21A 2CUEA 3OYFA 2JK3A 1YI2I 3GTLJ 5C3EJ 1LFUP 1QN3A 3Q0VA 1S7OA 3ZPLA 3ECOA 1KFQA 5FKNA 2VN2A 3BROA 5HNFA 3S8PA 1WGXA 1JKPC 4DJAA 1VQLI 1HC8A 3HTUA 1S5LC 2LF7A 3Q0WA 1JUMA 1FTTA 3SXYA 3FBNB 3J7YJ 4YFXF 1X1AA 1DUXC 4XLHA 4WWCA 3BWGA 2KMUA 4I8OA 3IWFA 4WZSD 3KZIC 4HQEA 5D6EA 2EB7A 2P8TA 2L4MA 4FX4A 3JR9A 2AO9A 3I0XA 4BEHA 1G3TA 4M3EA 1QNAA 2DK8A 2O3FA 2Q2EA 2JA5J 3I58A 1UG0A 2D1HA 3C2GA 3A02A 4UVCA 5GTHC 3KEYA 4XKVA 2R4GA 1QU3A 2V1DA 2CRGA 1XSZA 2HDCA 1XG1A 5M5XJ 3RTRA 3QOEA 3KIOA 2XHIA 4C30A 2ID6A 3G6EI 3K1MA 2KZVA 2DFHA 1X1DA 2XPUA 2VI6A 5ILUA 4UUSB 4E7JA 3G4SI 4XL9A 4CYDA 3U9GA 4JX4A 4BNCA 3F10A 4E7SA 3FXRA 1MMGA 4EEFG 1FIPA 1YG2A 4XLCA 3JREA 3H0DA 3OR1C 1Y1WJ 3ZGKA 3I55I 1RIOH 2CS3A 1J3MA 2HXIA 3JTHA 5E1XA 1NK3P 1UELB 4BQQA 3UKGA 4M3BA 5ERIA 2H09A 4II3A 5CJ9A 2QKLB 3KLOA 4RAZA 2L7MP 2H8WA 2PMZA 4KN7X 2FRHA 4F91B 3L7WA 2GXBA 1D1AA 2LLKA 3CC4I 1ETOA 1E42A 2G30A 4I7HA 4RGRA 1ETXA 3ZN0A 2K9NA 2XGXA 2GIZA 2DOAA 2F2EA 2HU9A 3K1NA 1K79A 1G2HA 3H35A 1BIBA 3CMMA 3BCBA 1HBXG 1ODDA 1AA7A 2DU9A 2R0QC 3IL2A 2QF7A 5IYCJ 5CVVA 1EF4A 2P5KA 2I8DA 4B43A 4B1RA 1P5DX 5JLWA 2VJ5A 4NUBA 4BAYA 2HXOA 2IXSA 3D5SC 1K78A 4BJ5C 3QYEA 5ICCA 2QYOA 2K4BA 3K0LA 2HQRA 1XSDA 2MFZA 2KISA 4EAKA 5H20A 1SD7A 4RM3A 2NAZA 1SMTA 2NWVA 3CO7C 4KNYA 4GFBA 3H9GA 4LLLA 1USTA 1ZLJA 1I1GA 5F0HA 1IDZA 3HYIA 3ZCOA 3M8FA 4EJZA 3LSTA 1EKEA 1BBYA 1K35A 4KT6A 5BMPA 5GPAA 2ELJA 3BJAA 2ZNZA 1J9IA 1S6LA 4LB5A 4WK8F 2BE5F 2EFQA 3HRUA 2HZDA 1T39A 1KQ8A 4CH7A 1HDDC 3I9V2 4ZZDA 1R5HA 3HSFA 1H9GA 1A6IA 1R1VA 2GA2A 2IP2A 4I99C 2VJ4A 2M7AA 3N4MA 2R7TA 1KU9A 3BR3A 3RQ4A 4KMFA 2IGNA 5IP6A 5FFZA 3VDXA 3BG3A 3OYEA 3FIWA 1YJ9I 2P5LC 1PUFB 4ZYDA 4HX8A 4RBOA 2R7DA 3M7GA 4DYQA 4I6ZA 1CQTA 2YSRA 3IKTA 3QQAA 4PJ0C 4BDYA 2BXZA 4ZYHA 4HSTA 1XSXA 1RKWA 2PG4A 2WBMA 1X58A 5DUKA 4XICA 4BL0B 1A04A 2DDBA 3QU3A 2XB0X 5DD4A 1WJFA 2NOIA 4G7OF 1OISA 5L3BA 4J01A 3QYFA 3FXJA 1U3EM 1HKSA 2MYSA 2Z16A 1PZDA 4EM0B 1WJBA 5EYRA 3CCMI 5KAIC 1TGHA 4GRIA 5FFXA 3IC7A 3PM1A 4KN4X 4IHVA 2DQLA 2ZJPF 2HPIA 1J5YA 4BYYA 2EINH 1R49A 3F8CA 2E19A 1O7FA 1W7PB 3DV8A 4RB1A 4IX7A 2FSWA 1H89C 3W3CA 3K2ZA 2PWWA 1UHSA 2CUFA 1SVOA 2FQ4A 2QR1A 1WH5A 1G3YA 2HI3A 2HOAA 1WJCA 4EM1A 1IN5A 2EFPA 2EZIA 4BU2A 5ILSA 4EATA 1I50J 3A0BC 3VEPA 4S04A 2H6CA 4YIRX 4D5FA 5D5VB 3G3ZA 5GTIC 1K83J 1TWAJ 4QTRA 4L9NA 4XLFA 3BR1A 5FLXK 4MLOA 3MZHA 3WTSC 3REOA 3IP4B 2UZKA 3PNYA 1R00A 1ZREA 1FTZA 3KTUA 1PUEE 2BHYA 4BY1J 1B4AA 1ZARA 3BZKA 2EBIA 3CCUI 3RIRA 3LSPA 4HDVA 4HA8A 5K5OA 2R7WA 5FLVA 1QZEA 3WG7H 1LEAA 5AONA 3DPUA 2BY0A 3KLNA 2BY1A 4ZYGA 4YIFA 1MW7A 2VE9A 4EV0A 3L2CA 1D5YA 1GVDA 1ZRDA 2L9NA 2FEZA 4JBAA 4P55A 2Q8KA 1BW5A 3ZMVA 4RAFA 3SEZA 2VKVA 4OAZA 1S9HA 3KYLA 1TZLA 1UB9A 4D7MA 3W2VA 2LY9A 1IAWA 3GTGJ 4RB2C 1RR8C 1P4XA 3OIQA 2DA7A 4ZDLA 3HRTA 3MKWB 2LY2A 1FZPB 2LD5A 1YYVA 4ENJA 1V5GA 1SFXA 2DBBA 3VYUB 1QPIA 1JJ6C 3S1MJ 3K70D 1TBXA 3FWEA 4D7NA 1IXRC 1X3WB 1F4KA 1KYWA 4AIKA 5L3GA 1YHQI 4HV6A 3RPUA 1AKHB 5DTDA 3L9FA 4EQQA 3SZTA 3JSOA 4Y3OA 3TW6A 3WHBA 4HW0A 3T1BA 3G71I 3N05A 2KIUA 2K3FA 1O3TA 2K86A 1ETVA 2OV7A 3FKIJ 4HAMA 2BW3B 2MC3A 1YW8A 1FWZA 4QPOA 3RDIA 3I4MJ 3WGIA 2ZJRF 2DXIA 1D3UA 4F55A 3C2BA 3QPHA 2F5EA 4N9IA 1U8RA 1XTAA 3CDIA 4HPQA 4HJHA 1R5ID 3FXOA 2OTLI 3EDPA 4HYEA 4JX6A 4CUGA 2RKHA 1VQOI 3S1RJ 3TW7A 1NG6A 3EUAA 4AVZA 1WI3A 1FOKA 4EJYA 1W7PD 3GF2A 5KAFC 4UV9A 1IN4A 2IPQX 1W5SA 2Z99A 3IH3A 3KFWX 1FYKA 5C44J 2R93J 3ESWB 4TPSA 3U2RA 4O5VA 4DZJA 4G12A 3WG9A 4PJLA 1X19A 3H5NA 4UB8C 2Z33A 3RZDJ 3Q5FA 4YEJA 2JUCA 1VQ6I 1UT4A 1JGSA 3DBHB 3MN2A 3UR3C 2A5WA 1B9MA 3R61A 2PN6A 3DCFA 5J1UA 2R7FA 1NGMA 4RLQA 1OCZH 1IRXA 1SFEA 2RC4A 3I0TA 4IOCF 3RKYA 1K4TA 3W2AA 1W1WE 1QA6A 2ZXHA 3CP8A 1RZ4A 1SD5A 2VT2A 3F8MA 1HF0A 4PJNA 1B8IB 1RUNA 2HQAA 2O9LA 1JXSA 4LJZF 4XONA 1APLC 3GUDA 1FP2A 3HOYJ 3GTMJ 2NOLA 2FKMX 2E1MB 1ETYA 2BOLA 3KYCB 4DGWB 1UAAA 3LFUA 2CQNA 5LRSA 4ZTFA 1HXDA 5LHIA 3BTLA 1ERDA 5TGTA 3CCLI 2F48A 4CXFA 4P9FA 2P81A 4AIJA 3PO3J 2XSDC 2LY1A 2A5YB 2BYVE 2V6EA 1VTOA 1J75A 2FBIA 2HZMA 2CQXA 3ZMSA 1JTYA 1HKQA 4MTDA 5EZHA 1TWGJ 1W0UA 2CQ7A 1JUSA 3BCAA 5JVGF 2RVCA 4WF2A 2R7ZJ 2NNNA 3LSGA 5JHUA 2VODA 4PZJA 5TJJA 3X2QH 3IH7A 1I3AA 1TWHJ 4XORA 2UWMA 4AUXA 3S3MA 1SAUA 4U88A 3O3KA 4L9JA 5GAEJ 4U7DA 2OC6A 1TC3C 4C3HJ 2PBIA 2BEOA 2HYGD 5DCFA 1W4MA 4BXFA 3HOVJ 1XMKA 2P6TA 3GTPJ 3EUHA 1ZYRF 2WV0A 2QLVA 4A3BJ 4L18B 3PUFA 5ICEA 4N4OB 3V4GA 4BE2A 3E97A 3KX2A 4EALA 5D5XB 2KQRA 2V79A 3IRQA 1FOXA 2VBYA 3HPHA 1B1BA 1F5TA 3BR0A 3R6SA 2I5WA 2LFBA 5BS6A 4DBQA 3ECHA 1OCPA 4HNTA 1JUPA 4RMNA 2HWVA 3GVAA 3HGYA 1KQ0A 4KDPA 1U2WA 3OR2C 1P4AA 2QWWA 1QN9A 3VOEA 3HOSA 1IG7A 3GWZA 5AIPA 2AHQA 5EF6A 3V8JA 1T98A 2ZMEC 3PNTA 3G1LA 1IZ1A 3DBRB 2O5RA 2ZFDB 1TNTA 1C9BB 1VQ9I 2KZGA 1MNMC 2ZB9A 2CU7A 4LITA 2VUMJ 4YELA 4ENMA 1BI3A 3BG9A 1ZR2A 3I71A 2DKAA 2NS8A 1KQ9A 2B7EA 2R7XA 1E3HA 2NS0A 1H9TA 4N4NB 2RDPA 1XSVA 4HOBA 3QOPA 3C2HA 3B6AA 3H9JA 4LIVA 1JT0A 1OFCX 3HOTA 5L3EA 1SFOJ 1DP3A 1MJBA 4HNVA 3OSGA 3HB9A 5CKTA 5C4JJ 1Y0NA 1ZLKA 3J7AY 1QBJA 2L9SA 4D5CA 2OBPA 4XLPF 2M8EA 1B72A 1YW7A 4AVPA 3HDDA 3DQVC 2KKOA 2CFXA 2IGOA 2LSOA 5EZGA 4XRMA 2HEOA 3EYYA 4G94A 1T95A 3Q9VA 1QHGA 4OAYA 4M6XA 2Y75A 3LWFA 3ULXA 5CPRB 3RSMA 2BY3A 2W24A 2DMQA 2Z1DA 3P9IA 1E17A 5IT9Z 1G4DA 5E79C 5J4VA 3ML6A 1O3RA 2IA1A 1UJ8A 1REPC 5IOYA 4FISA 2NS7A 3E5UA 3R60A 4JYKA 4A0ZA 4ZC3A 3JCUC 5EG0B 3F23A 2ADUA 4IHWA 1OCCH 2Z5UA 2VKEA 2DCEA 4I0AA 3BJ6A 5L3DA 2TRTA 4HBLA 2P4WA 2FJ1A 2EIKH 2VJ0A 3ABKH 2AQEA 3K2AA 3M3YJ 3JRAA 3CWUA 2HS5A 1KU3A 1X1CA 2WTEA 3ZQFA 5IPAA 4H0EA 3K4BA 4KISA 4KUMA 3DTEA 2K9LA 1GLNA 4HQMA 3KP6A 4NC6A 4A12A 3D0SA 5CYVA 1A31A 2L7FP 1Y0UA 3PIPF 4XKBA 2QRCA 3S2HJ 1TBAB 2CFOA 3WGHA 4F93B 1JKRC 1WHUA 4MHGA 4C7PA 3CWTA 1IN7A 5F0FA 3DEEA 3E6BA 3GLXA 1Z9CA 1UHMA 5FKKA 3OL3A 2A05A 4EVIA 3FF5A 2X85A 2H8RA 3JSPA 2WAFA 4EM2A 1MBFA 4B4CA 2V9KA 5EGOB 1U9OA 3V42A 3OYAA 3HRSA 3QP5A 2DT5A 1KZHA 3ZN1A 3LSKA 4L5JA 3JTGA 2DJIA 1D5VA 5IYBP 4UUSA 2M2EA 3HEFA 1JHFA 3LQQA 2FGTA 2EZHA 1W80A 2VLAA 5HODA 4V19K 2ZXIA 3KEOA 2M4KA 2HZTA 2JTVA 2V1NA 5LEJA 2UV1A 4B0AA 2EFWA 4ZYEA 1Y1VJ 4W1UA 3IAS2 2MZ8A 2LAEA 2XPVA 3CUQB 5H6RA 1IN6A 2FOKA 1ETWA 4MQ9F 4HV5A 5HDNA 2CMPA 2ME0A 3H5AA 2QKMB 4XR6A 1FN7A 4PSXA 3TE5A 3GO5A 1P9QC 1U5TB 1DGRM 1QQIA 4IQ4A 2E2IJ 3BC8A 3AL0B 3BQYA 1T6AA 5LRRA 4B47A 1TW2A 4BACA 3OH6A 4XRFA 3CWAA 3SDBA 2AXTC 2QQ9A 2STWA 4R8HA 1Z6TA 1IF1A 4B8XA 5GP9A 4M72A 2H5AX 2P6SA 1HW1A 3T4NA 2HOTA 1YQLA 3CVTA 3I59B 3FMRA 2XB5A 5B1BH 1R6RA 2E7WA 2R7QA 1P4WA 4XLEA 3RYPA 1RM1A 4F3QA 2O6GE 1K6OA 2OQRA 1YITI 2OQGA 4A93J 3L2WA 3K4NA 1ZQ3P 4X6AJ 2EV0A 2QREA 2FKFA 1QZYA 4M6VA 2JN6A 1PVSA 1VOKA 1ACIA 3F72A 5E3MA 4IL8A 2MG4A 1TP4A 4NNJA 3ZP5A 3NWSA 2ACJA 2OOXA 1D0ZA 4M3FA 4A3LJ 2CH0A 2K9SA 5JN5A 1MDMA 3KP7A 2ZNYA 2M0CA 3WU2C 2DAOA 2HFHA 5E20A 1UG2A 2DODA 2F5CA 1FX7A 1MZBA 3P7NA 4EAIA 3OY9A 4IO9F 3CMEI 1KY7A 2MW8A 3CJNA 1QO0D 2W7NA 3SYTA 5L3CA 2DKCA 2JSPA 3SHFA 2JRTA 2V1XA 4G7ZF 1C4GA 3CJQB 3Q3SA 4NQWA 2KIFA 3TMOA 4HLYA 2Y0SN 1LE8B 4ZJZA 3T0YA 4A3JJ 3MVPA 2XKOA 1YO5C 3S17J 1LWWA 2DA3A 3HL2A 1PP7U 3O6BB 2MLGA 3ZMDA 2VT3A 1SMYF 4E7IA 1X2NA 1FMVA 1RC9A 1P92A 3OIOA 4MGRA 1SC7A 3OYDA 4P9UA 1TW3A 3JRBA 2PJPA 5ICGA 4ZZLA 1LWVA 3D5LA 2O61A 3KZZA 3L2QA 5LBQA 3TP0A 3R0JA 4MIMA 2QBYB 3OOPA 3GZNB 2XAHA 4P96A 3M9AA 2PMZN 1FOWA 2YX7A 3LAPA 5JR3A 3FM3A 3TQNA 2K40A 3K4MA 3LOCA 4BHPA 1MP9A 4QG5A 5M3MJ 3M07A 2VQCA 3L09A 4A3EJ 2MGQA 1OCOH 2LG4A 3PUBA 2WB1N 3BG5A 2XAJA 3OCIA 1QNCA 2IW5A 1KYUA 2MABA 3QPTA 4CYCA 3PFIA 4MO7A 2LR8A 3G2BA 1S8NA 3S14J 3GTJJ 3HUGB 4XOPA 2XF6A 1FBUA 2OF7A 4Y13A 2JHNA 3OLPA 4PY5A 2L9RA 4JX5A 1LB2A 4LLNA 5DCMB 3H0GJ 4GGGA 4LMYA 3RKXA 2HZSA 5J1YA 2O3OA 3I0WA 1P7JA 3EETA 3GCMA 1QTSA 3OYJA 3ISPA 1RRJA 1PYVA 4PGHA 2CQQA 2LBFA 4U87A 4II2A 1ZRCA 3GTKJ 3RSNA 2Z3YA 2QZ8A 2JPBA 3E7LA 4CZCA 2CWEA 1C47A 2Q0OA 5HLGA 3RZOJ 2KRFA 3OYMA 5F1RA 1H88C 1KY6A 2LKXA 5J4YA 5ED4A 3WTXC 4XRSG 2A3SA 5FRMA 3ZMZA 2BVLA 3GTOJ 1ZHFA 5K7ZA 1Q1HA 4LG0B 1TWFJ 2K27A 2MBFA 1SVMA 4EJWA 5E3OA 4GCVA 3ABMH 2NRAC 3H92A 4UVAA 4G8XA 1MKMA 1VQ8I 2Z9OA 2O0YA 1BOBA 3HUGA 3ZXSA 4QPQA 4BUPA 1T08B 2GOMA 1ZN2A 2VOOA 5LGUA 3J81K 3FISA 4NDLA 1R7JA 1JTXA 2ISYA 4BGDA 1ZK8A 3IHUA 1Z3XA 2AXLA 1JKQC 3CVSA 1R22A 3U1KA 3SFIA 1XCVA 4KA4A 3AL0C 1YQKA 2X1DA 2IS4A 2ZSIB 2M45A 5J8CA 3LSHA 2IS6A 5BPDA 5K1YA 1LUJB 4BY7J 1XGMA 2HOEA 5LLQA 4WXCA 1MDMB 4D1QA 2D1VA 1MJAA 3I53A 2EFNA 1IRZA 2GIVA 4D0PA 1YJWI 3B02A 3LNQA 3CJTB 4RS8A 1HA8A 4B44A 2YA3A 5B1AH 2GWRA 3HOUJ 1YJNI 2VQHA 3AG4H 2VJIA 4ESJA 3F3XA 4PDKA 4W97A 1WKMA 1RESA 2X9DA 4BE1A 1G3SA 3CTAA 5TRDA 1A36A 2KDOA 3V7CA 1S29A 2DYSH 4EGYA 2P0WA 2W4SA 5F64A 4BHCA 3MKYB 4A3CJ 3PQJA 1WCMJ 4HLXA 3SDGA 5BQTA 1T0FA 2XIGA 2YUSA 3CLOA 3NRVA 5H6QA 2XC7A 4ON0A 1QRYA 1X4PA 1I5ZA 4HF1A 1OPCA 2VE8A 3DFGA 4K2EA 3ASMA 5GAHJ 1MMSA 1NTCA 4FE4A 1IUYA 2M4GA 5IP7J 3HOXJ 3HKZA 1VQKI 4IPAA 1WFXA 1LPQA 4FT8A 3QU6A 1VTNC 4IVNA 1KYZA 4IQJA 3HHGA 9ANTA 1RETA 2X1CA 2LRDA 4M9SA 5JMVD 1QVTA 1IC8A 4DBRA 3OYGA 1MGTA 2WADA 3JRCA 1CF7B 2NOJB 1X1PA 3SEQA 1KU7A 2OAZA 4M9ZA 4M73A 2DK5A 4DNCA 4AYBN 3FK6A 5F04A 3V8LA 1YTBA 3ZQCA 3J7AO 2VXZA 5E18F 3ASOH 2B9SA 1HOMA 5M5YJ 2M9HA 4NC8A 2LKPA 4ETSA 1V4RA 1H8AC 3ZQLA 2IA0A 4XLNF 3W6VA 5DDGA 2HVRA 2BY2A 5HS8A 2Z8UA 1XGSA 1ZRFA 3O8HA 3GFLA 1UFMA 2UXNA 1KONA 3EUKL 2E1MC 2EZKA 3DBLB 1HLVA 2VPLA 3UW2A 2FMYA 3EYIA 4UUVA 2QENA 4IXAA 4NC7A 1FEXA 1NH2A 3TGNA 1J2XA 4D9JA 3HIFA 3DKXA 2W48A 5E8GA 1SAXA 4FE7A 2W1OA 2CQKA 4V2GA 3KPHA 2XHKA 3JRFA 2JWTA 5ICFA 1LJ9A 1D8KA 4E6KG 2CSOA 3BG7A 2KJCA 1GHCA 3PQKA 3VPRA 3MZYA 3OSEA 5E17F 2ZFUA 4AWXB 4I98B 1G59A 1BR4A 4ENNA 2XKPA 4X0GA 5BNGA 1ZG1A 4HNUA 5FROA 1X1BA 2FBHA 3QRFF 3J80Z 1U0JA 2WC2A 1BC7C 1VF9A 6PAXA 3QWLA 1ETKA 4BQOA 4NB5A 4A3IJ 3JW4A 2O7OA 4XNFA 1U9NA 1WZ2A 3HKZN 3E6CC 3L2VA 2E71A 4AU7A 2ISZA 4CO8A 3FXQA 4LGWA 1V54H 2EFOA 4UNOA 4XQFA 2GA1A 4EAJA 4A3MJ 3VYRB 2XAUA 1CDWA 2NOGA 2CO5A 1WQAA 1T6SA 1PCMX 2JA8J 3WODF 1Y8QB 1I1SA 2E5ZA 2BZTA 2HDWA 3H5RA 1KFIA 4KT5C 2VIXA 5E1ZB 4CFFA 1J7KA 2NVYJ 1TWCJ 2R3SA 1EH6A 2W57A 4HEA2 2F4OB 2C6YA 1T56A 1EUVA 5EJCA 4ABZA 5AIQA 2O8KA 4WX8A 1IXCA 5F6FA 3MKLA 3H3UA 3F0ZA 2EA4A 3DTIA 2PMHA 4MQVA 4U0YA 2ECCA 4N9HA 2RNGA 4M3DA 1MBGA 3RQIA 1K7AA 5IYDJ 1FBQA 1RKTA 2F6CA 2HVSA 2EWNA 3FMSA 3PDKA 3DXJF 2ZJQF 1SEUA 4A3FJ 2K9QA 3ASNH 1X3UA 1XC5A 2IGMA 2XVCA 1WSUA 3GZ6A 1J59A 2FMLA 2X6YA 2I5UA 2YU9J 1DGWY 1MBHA 2BV6A 2YS9A 3MZ8A 2JVGA 1PCJX 3Q0UA 2XRNA 3L00A 2CJJA 2DN0A 3KZYA 2EILH 3L1PA 2P5VA 1O3QA 5HNHA 4AM3A 1V3FA 2DA5A 1R5GA 2L7ZA 2D0BA 1R4NB 1ENHA 3PFYA 4NHJA 4CDGA 2JQ7A 2R7RA 1U5TC 3S2DJ 2O03A 3LSRA 3H3ZA 3ZQIA 5EDNA 3K9TA 2EHBD 5GAGJ 3I56I 4BE0A 2PLYA 2DO7A 3WU0A 3B73A 3BDDA 2R7OA 2WWYA 3GLLA 3D4VA 2MA3A 5B3SH 4IHYA 1X3ZB 2WY7Q 2LP0A 2VASA 4GXOA 1HDPA 1A5JA 3F6OA 5HDGA 2V9PA 2EK5A 4RGSA 4A6EA 3D7QA 5F08A 3WTWC 1W36D 1YW9A 1Y8RB 2FA5A 3OL4A 4B48A 2L2OA 3MKZA 4WX9A 3K1PA 3OSFA 4PFPA 2M34A 4LIUA 4R79A 2F5DA 3N97A 1CGPA 1IRFA 3EAYA 2LC2A 3DEUA 2CUJA 1LDKB 3CC7I 4L0ZB 4DULA 3F8FA 4PK4A 2EH3A 1YQRA 2K02A 3E3VA 4HDUA 2DT6A 2VBWA 1FJLA 2L4AA 3CMAI 1AU7A 1IRGA 3NWTA 4ENKA 4OIRF 4RODB 2ZC2A 1ON2A 1FMWA 4M9XA 4CCMA 4RAGA 3HGGA 4FTHA 3GMEA 1S72I 2J5OA 2HR3A 3TO7A 2E1OA 2WAEA 1B8IA 1Z6RA 3OSTA 2KFDA 3CCYA 4Y52J 1IXSB 3S16J 4L9VA 2LNBA 1N77A 1MJ9A
chains in the Genus database with same CATH topology
3BJOA 3QP6A 4Y15A 3HPGA 3I5UA 2M5WA 4ROCB 1FY7A 5EEHA 3KP5A 2R7SA 2CV0A 4YRVA 2RV8A 2QQBA 4BS9A 4IRGA 1K78B 1D0YA 1XB4A 1ZAOA 2EV6A 1FSEA 3CUQC 1I27A 2ESNA 3WTTC 3OYBA 1WI9A 1G3WA 3W6KB 4OMYA 4HRIA 3LSMA 1XD7A 3E5QA 2MH9A 4AIHA 3JAMK 2QBYA 5DCMA 4LG3A 3TKYA 3GBGA 3TOAA 2IRFG 4A0XA 4F52A 4JK1X 3F8BA 2VKDA 1LNWA 4B09A 3Q9SA 3ONQA 1G6NA 3QODA 2NOFA 2YX4A 4OWRB 2IS2A 4G6DA 3F8NA 3G73A 3CESA 1T38A 1EA3A 5HLTA 3OWTA 2CW7A 1BIAA 4PUSA 4PFOA 2X51A 2HGCA 2RQQA 1QNTA 4HSRA 2NYXA 2A61A 1IW7F 1SFUA 4Q5SF 3DPTA 1HW5A 1HW2A 2ZKZA 2AS5F 1XDSA 4BHBA 2L7KA 2FBKA 3U1DA 2LREA 3FX3A 1O3SA 2ZMEB 4LB6B 1OLTA 2VQGA 1U5TA 2GZWA 5J6XA 3M1CA 3GFJA 4WXDA 1EH7A 2L54A 4WXHA 4FETA 5BMZA 1FYMA 4XN3A 4I0BA 3V7RA 2STTA 2W82A 1KU2A 5CVIA 1ZH5A 4O6JA 1P6RA 1W7PA 4G6TB 3GZ5A 1E0EA 3PJRA 1B6AA 2BVMA 3GEZA 2GAUA 4FHTA 2XROA 1HU0A 2B0LA 2DW4A 3CDHA 2GQQA 1HSTA 2VC1A 1O57A 2KPMA 1DP7P 4CSWA 1BI2A 1VOLB 3I59A 1OKRA 2CW8A 2MH2A 1LWYA 2DT7B 5HOOA 4EJVA 1U6GA 2EA2A 2A69F 1Z7LA 3L2RA 4BXUA 5HS7A 1MNDA 5IYDP 3CJRB 1YS6A 2RN7A 1QZZA 4XSXF 2Q2EB 4XN0A 1BI1A 2V7FA 4A6DA 4I2OA 2Y0SA 4A5NA 2ZMEA 4Y4RA 3MFKA 1T0FC 3CUOA 3IKVA 5J8FA 4G7HF 1IN8A 3VB2A 3SQNA 3K69A 1X4OA 1EV7A 2A68F 5KVRA 4HF0A 2PJRB 1TLHB 4F7ZA 4KYWA 4YIIA 3HSRA 3OS2A 4PJJA 3KE2A 2IT0A 3DF8A 4CCOA 1LVAA 4UHTA 2OUMA 1FBSA 3HC7A 2NOEA 3TL4X 1OYYA 1UHWA 4JQFA 3JAMZ 3S93A 1M3HA 2X4HA 2W84A 2R7VA 3T8RA 5E8IA 1Y56A 3GFMA 3F9KA 3C7JA 5KCMA 3VSKA 5FD6A 2WY8Q 1TBPA 5DUIA 2DQRA 5LD2C 2OD5A 3DU6A 5D5UB 1R1UA 4U0WA 2X6WA 2VB6A 3FZVA 3BPVA 4RB3C 4Q48A 1R36A 2QLZA 3M8JA 1FC3A 1TT0A 1D3YA 4QLCU 4C2TA 2W25A 1BC8C 1Z7UA 2IJLA 1FNNA 2CGPA 1BR1A 3K10A 4PSWA 4GO1A 2LBFB 3AAFA 3W2WA 2AQFA 1TQMA 4LD5A 4OMZA 4EMSA 3WTUC 4UXNA 2Y48A 1F9NA 2G9WA 3LAJA 2VL8A 4P5OA 3ERED 3LA2A 3IAM2 4M6YA 3OS0A 4XKWA 3VODA 2LOOA 4ZTJA 1Y6IA 2A6EF 4E7ZA 3F21A 3SZPA 3LFKA 3WU1B 1OMIA 4BJTA 3K4KA 2KRCA 2V4JC 5FD5A 2ZFWA 4CZZA 2VC0A 2E60A 1F1ZA 3A1YA 2LH9A 2LYCA 3S32A 1ULYA 2IV9A 4OOIA 1YIOA 3BY6A 4U7BA 2IV8A 5FRNA 3GXOA 2PMUA 4BEHB 1YX3A 3IUOA 2D2WA 2F5VA 1ONVA 1XN7A 4IHTA 5JHFA 2BGCA 1JHHA 4N0BA 4HG2A 4Z2YA 3FHNA 3OIPA 3MMYB 3OYNA 3FHZA 2M0MA 2RREA 4KJZA 1HKTA 3FBIB 1PCZA 5LFAA 1QPMA 4Q47A 1ON1A 4QWQA 2MC4A 3LMMA 2YH5A 3MD2A 2KLOA 4ESBA 1D1BA 3V7SA 5JFRA 3K4JA 3VN5A 2ZSHB 5A2QZ 1NHAA 2W00A 3MEXA 2OU2A 3VYTB 2VBZA 1QHHD 3ZQQA 2JZYA 1QN8A 3O2PE 3I4PA 1GXQA 3E0JB 4WCGA 3HTSB 3OV8A 3MQ0A 2XAFA 3COAC 1PDNC 3TDZC 4AYBA 1EH8A 5LEKA 5FO5A 4JOMA 2WA0A 2K3PA 2V9VA 4XKCA 1D1CA 1ZG3A 2FU4A 2XASA 4MTEA 4Q11A 2EJRA 2FNAA 2G7HA 3KP3A 4S05A 2K5CA 3E6MA 5IT3A 5CVRA 3P9KA 1VZ0A 1LDDA 3DLAA 2RQPA 2DI3A 4EJTA 1MNEA 5CQEA 2F5FA 3S3NA 2XDVA 1Z05A 2H94A 2A6TA 2X6XA 1WRJA 4L5IA 3BPXA 4RGXA 5LGNA 3QYBA 4P1WA 2JVHA 4IF4A 4Y33A 1JFIC 3K4CA 3WE3A 3K4LA 5LHHA 5BOXA 2M30A 4ESFA 3L2UA 3WGGA 4KIFA 4LFUA 2M1BA 3T8TA 5DV5A 1OYIA 4KIBA 1YLFA 3MWMA 2FNPA 4I09A 2D0CA 3BZ6A 4RGUA 4BQAA 5CVUA 3R4KA 5IYCP 4C9YA 3ZMUA 2UXXA 3BP8A 1BOAA 4PGGA 1W36C 2M3AA 3C18A 3ULQB 2KJBA 2KL4A 3I54A 2DPUA 4MEYF 3E1SA 3OOUA 1NG7A 1DQUA 1QGPA 2PI0A 2XF5A 4IKFA 3F6VA 2X1EA 1XCBA 3E6DA 2E7XA 5DEQA 2FF4A 4KIGA 1R58A 3K6GA 4OIPF 2NOBA 3GX4X 4DIQA 2QVOA 4KITB 3HXLA 3PSFA 3T5XA 3K70C 1DDNA 4KMUX 3OYKA 4PJMA 3IWZA 4RM2A 1GVJA 4ROEB 4YG2F 3FKJA 4IRIA 3VYSB 4ANJA 4OIOF 4ITVA 3ROUA 4BJ6C 1XGOA 3E5XA 3OMYA 4ZDPA 3P9CA 4ZDOA 2PQ8A 5KNLA 5LGTA 1V5EA 4TV7A 5HLHA 2HTSA 1UCRA 2TDXA 3HHHA 2NNYA 1MMAA 4IHSA 2H6BA 1WJAA 2V6CA 5KK1A 2HNHA 2HVQA 2A6HF 1QN4A 3LA3A 5DYMA 1R4XA 4EGZA 2O8XA 4ZYAA 1U78A 1KA8A 4LK0F 3H1ZA 2MJ7A 2KIMA 3MAJA 4EJOA 3EUHC 3DU5A 3AFHA 2ZXJA 2YU3A 2VOPA 2BW3A 2PJRA 1L0OC 2BBYA 2XAQA 2V1UA 2HKOA 4E7LA 2WB1A 2FQ3A 1SD6A 1SD4A 1N3CA 3FM5A 1XDUA 3H9QA 3N89A 2XF7A 3DTKA 1YQMA 4YFKF 4XLAA 1LFPA 1KYDA 3KETA 3LSIA 1LVKA 1Z1DA 4M74A 2L02A 1QN6A 2NOZA 2ELHA 1S7AA 2CUZA 1TNSA 5JVTA 3RKWA 1M3QA 3CF2A 4Q4ZF 2XV4S 5CLSA 4CHUA 3R0AA 5EEGA 1FT9A 2JUGA 3A4CA 1AISA 5HS9A 2W85A 4AD9A 1B9NA 1OR7A 5HLIA 4XSZF 2PFBA 3OYCA 3GYHX 3OS1A 2EV5A 2HYFA 5D8LB 2VONA 2V26A 5CQGA 3I3LA 4DOZA 4A0YA 4E4HA 1BJAA 1BI0A 4UVBA 1UT7A 3W6JB 1PJRA 1N39A 1Z91A 1R23A 3RJPA 1T2KA 1KGSA 5FLXZ 2VQLA 3S3OA 3RPUD 1L3LA 5KHDA 2DLLA 1GXPA 2NOHA 2IGKA 3SFZA 1ZGAA 1YS7A 4H4KC 2KRHA 4G9YA 1ZGJA 1H0MA 3DKYA 2Y0MA 4HX4A 4BQNA 1BN5A 4RLFA 1MMDA 4LG0A 3ZQ7A 3TO6A 4I02A 3ABUA 2E5NA 2HKXA 3GW2A 4FASD 4OINF 2UUZA 3KRMA 1YFHA 1D0XA 2YR2A 1LDJA 3BOQA 1LQ1A 1O7LA 2XSJC 1DPUA 3CZ6A 3RPJA 1YTYA 3UNGC 3VFZA 1WWXA 4Y17A 1TQIA 2R7UA 3BLYA 5HVQC 4A5MA 3RCOA 4E7KA 1I6XA 3LA7A 2CW0F 3NQOA 3J80K 1FSHA 4LLGF 5FGMA 3TO9A 4XOTA 4EJUA 4UV8A 5A2QK 1B59A 2XAGA 2E1CA 2LDUA 3M8EA 3DKWA 2JPCA 5BPIA 1N75A 3WTZA 1N78A 3EQLF 1J0RA 1MD0A 4OIQF 2D45A 1QNEA 1NVPA 2GXGA 2JOIA 4CA0A 2L3DA 2FXAA 3TDUC 4E7HA 1HSJA 2E1NA 5E1WA 1AWCA 2PEXA 4YFNF 5JI6A 2VKHA 4CCLA 3OYHA 1Z3YA 2ETHA 4CCKA 1VTLE 1JE8A 4GYGA 3EIKA 2XUBA 4CGZA 1XGNA 1ZG5A 2IA2A 4FX0A 2YPRA 2K7LA 3VWBA 1W5TA 3NEUA 2M7BA 1FP1D 2P7VB 4F92B 3OYIA 1MMNA 4J00A 4CICA 1ZELA 2KHMA 2VXDA 3OYLA 2L5QA 4CCJA 5AN4A 2CYYA 3I64A 3TOBA 5K5RA 3HRMA 2ZBKA 1J09A 3D5RC 4OU0A 3DP7A 3LQRA 5D5WB 3PNVA 2OZUA 1TQPA 3HS8A 1OR7C 2VJJA 2F4IA 1WJ5A 4MNUA 1JI8A 2COMA 1USSA 3CO6C 1HQCA 3DWLE 1P2FA 4C2UA 4MEXF 2HQNA 2J5PA 3AKZA 1RNLA 3WE2A 2KP6A 5CVJA 3DPLC 3ELKA 4DQ2A 1YQAA 3RI4A 2CV2A 4XMYA 2FE3A 2VBXA 3GFIA 3MCZA 2ZJ2A 3KEQA 3ZRGA 4HZFA 5D8KB 3C1DA 3OSMA 3HG9A 5K5QA 1QNBA 3RPQA 2QM3A 2OZ6A 1E2XA 1RUOA 2DFIA 1BR2A 4CCNA 1WJEA 4E70A 4O3MA 4RB0A 4BH9A 1V5FA 4IZZA 1WQ2A 2GOXB 4IRHA 2QUFA 1C0WA 3OC3C 4BDZA 4KFCA 4L0YB 3IRRA 3V8KA 1YTFA 3F22A 2HTJA 3LL7A 2D0AA 1QN7A 2M87A 3QAHA 1SFKA 2CV1A 3TBIA 4G6QA 2HPMA 4R1HA 3U21A 3WTVC 4ZH4F 4I01A 4U0VA 2WAQA 1DPRA 3PL8A 2MLKA 1N3AA 2DTRA 4HX7A 3J81Z 3KCCA 1YE9A 1YX5A 4ASNA 1KO9A 3C3WA 1R1TA 1G8XA 3ZMTA 2ESHA 5HDKA 2H27A 4RAYA 1AOYA 2X0LA 2IS1A 2Q1ZB 5IT9K 3SZGA 4KICA 4GYIA 3CP2A 1XMAA 1QTPA 3HSEA 2MD5A 5DD8A 5D6FA 4L9TA 2RGVA 1LEBA 1B9KA 3CUQA 3KP2A 2LF8A 2G7UA 5D4SA 4LK1F 2K4JA 2RNJA 2CG4A 3M1EA 5LHGA 2P7CB 2A07F 4A2UA 2IVMA 2JT1A 4B3XA 1FLIA 3EPZA 3S2WA 2MD0A 1FYLA 2ZCWA 2OA4A 1K6YA 4M71A 3WTYC 3A2KA 3PSIA 4HF2A 3KP4A 5L3FA 5D4RA 2DPDA 1CF7A 3SNSA 1BM9A 4PCQA 3FDYA 1KYFA 1EBMA 1STZA 4NQWB 2ZO4A 2JA2A 3FXUA 3VSLA 3HS9A 1WJDA 3ZR8X 2L01A 3FMQA 1TTYA 1OYWA 1S3JA 1FPQA 4IJAA 1RI7A 3RYRA 5FB2A 2QQAA 5ILVA 2JSCA 2Z2SB 1QN5A 2FUG2 1LKXA 3BG6A 2K9MA 1D8JA 4XM3A 1PP8F 3ABTA 4XBFA 1Z21A 3OYFA 1QN3A 1S7OA 3ZPLA 3ECOA 2VN2A 3BROA 5HNFA 3S8PA 4DJAA 3HTUA 2LF7A 3SXYA 3FBNB 4YFXF 1X1AA 1DUXC 4XLHA 4WWCA 3BWGA 2KMUA 4I8OA 3IWFA 4WZSD 4HQEA 5D6EA 2EB7A 2P8TA 2L4MA 4FX4A 3I0XA 4BEHA 1G3TA 1QNAA 2DK8A 2O3FA 2Q2EA 3I58A 1UG0A 2D1HA 3C2GA 4UVCA 3KEYA 4XKVA 2R4GA 1QU3A 2V1DA 2HDCA 3RTRA 3QOEA 2XHIA 4C30A 3K1MA 2KZVA 1X1DA 5ILUA 4E7JA 4CYDA 4XL9A 3U9GA 4BNCA 3F10A 4E7SA 3FXRA 1MMGA 1YG2A 4XLCA 3H0DA 3OR1C 3ZGKA 1RIOH 2CS3A 5E1XA 3JTHA 1UELB 4BQQA 5ERIA 2H09A 5CJ9A 4II3A 4RAZA 3KLOA 2GXBA 2PMZA 4KN7X 2QKLB 2FRHA 4F91B 3L7WA 1E42A 1D1AA 2G30A 4I7HA 4RGRA 3ZN0A 2XGXA 2DOAA 2HU9A 2F2EA 1K79A 3K1NA 1BIBA 3H35A 3CMMA 3BCBA 1HBXG 1ODDA 1AA7A 2DU9A 3IL2A 5CVVA 2P5KA 2I8DA 4B43A 2VJ5A 4NUBA 4BAYA 2IXSA 1K78A 3D5SC 4BJ5C 5ICCA 3QYEA 2QYOA 2K4BA 3K0LA 2HQRA 1XSDA 2MFZA 5H20A 1SD7A 4RM3A 2NAZA 1SMTA 3CO7C 4KNYA 4LLLA 3H9GA 1USTA 1ZLJA 1I1GA 3HYIA 3ZCOA 3M8FA 4EJZA 3LSTA 1BBYA 4KT6A 2ELJA 3BJAA 2ZNZA 1J9IA 1S6LA 4LB5A 4WK8F 2BE5F 2EFQA 3HRUA 1T39A 2HZDA 1KQ8A 4CH7A 3I9V2 4ZZDA 1R5HA 3HSFA 1H9GA 1R1VA 2GA2A 2IP2A 3N4MA 2VJ4A 2M7AA 2R7TA 1KU9A 4KMFA 3RQ4A 2IGNA 5FFZA 3VDXA 3OYEA 2P5LC 4ZYDA 4HX8A 2R7DA 3M7GA 2YSRA 3IKTA 4BDYA 4ZYHA 4HSTA 1XSXA 2PG4A 2WBMA 5DUKA 4BL0B 1A04A 3QU3A 5DD4A 1WJFA 2NOIA 4G7OF 5L3BA 4J01A 3QYFA 1U3EM 1HKSA 2MYSA 2Z16A 1PZDA 4EM0B 1WJBA 1TGHA 4GRIA 5FFXA 3IC7A 4KN4X 2DQLA 4BYYA 1J5YA 2HPIA 3F8CA 1O7FA 1W7PB 3DV8A 4RB1A 4IX7A 2FSWA 3W3CA 3K2ZA 1G3YA 4EM1A 1WJCA 1IN5A 2EFPA 4BU2A 5ILSA 4S04A 3VEPA 4EATA 2H6CA 5D5VB 3G3ZA 4L9NA 4XLFA 5FLXK 4MLOA 3MZHA 3WTSC 3REOA 2UZKA 3IP4B 3PNYA 1R00A 1ZREA 3KTUA 1PUEE 1B4AA 1ZARA 3RIRA 4HDVA 4HA8A 5K5OA 2R7WA 1LEAA 5AONA 3DPUA 3KLNA 4ZYGA 4YIFA 1MW7A 2VE9A 4EV0A 3L2CA 1ZRDA 2L9NA 2FEZA 4JBAA 4P55A 2Q8KA 3ZMVA 3SEZA 4OAZA 1S9HA 3KYLA 1TZLA 1UB9A 3W2VA 1IAWA 4RB2C 1P4XA 3OIQA 4ZDLA 3HRTA 3MKWB 2LY2A 1FZPB 1YYVA 4ENJA 1V5GA 1SFXA 2DBBA 3VYUB 3K70D 1TBXA 3FWEA 1IXRC 1F4KA 1KYWA 4AIKA 5L3GA 4HV6A 3RPUA 3L9FA 4EQQA 3SZTA 3JSOA 4Y3OA 4HW0A 3T1BA 3N05A 2KIUA 1O3TA 2K86A 4QPOA 2OV7A 4HAMA 2MC3A 2BW3B 1YW8A 1FWZA 3RDIA 1D3UA 3WGIA 2DXIA 4F55A 3QPHA 2F5EA 4N9IA 1U8RA 4HPQA 3EDPA 4HYEA 4CUGA 2RKHA 1NG6A 3EUAA 4AVZA 1FOKA 4EJYA 1W7PD 3GF2A 4UV9A 1IN4A 2IPQX 1W5SA 2Z99A 3KFWX 1FYKA 4TPSA 3U2RA 4O5VA 3WG9A 4PJLA 2Z33A 1X19A 3H5NA 3Q5FA 4YEJA 1UT4A 1JGSA 3UR3C 2A5WA 1B9MA 3R61A 2PN6A 1NGMA 2R7FA 4RLQA 1IRXA 1SFEA 2RC4A 3I0TA 3RKYA 3W2AA 2ZXHA 3CP8A 1RZ4A 1SD5A 2VT2A 1RUNA 3F8MA 4PJNA 1JXSA 2HQAA 4LJZF 4XONA 3GUDA 1FP2A 2NOLA 2E1MB 2BOLA 4DGWB 1UAAA 3LFUA 5LRSA 4ZTFA 1HXDA 5LHIA 1ERDA 5TGTA 4CXFA 4P9FA 4AIJA 2LY1A 2A5YB 2BYVE 2V6EA 1VTOA 1J75A 2FBIA 2HZMA 3ZMSA 1HKQA 4MTDA 3BCAA 2RVCA 4WF2A 2NNNA 5JHUA 2VODA 3LSGA 4PZJA 5TJJA 3IH7A 4XORA 2UWMA 3S3MA 4U88A 1SAUA 3O3KA 4L9JA 4U7DA 2OC6A 2PBIA 2BEOA 2HYGD 5DCFA 1W4MA 4BXFA 1XMKA 2P6TA 3EUHA 1ZYRF 2WV0A 4L18B 5ICEA 4N4OB 3V4GA 4BE2A 3E97A 3KX2A 5D5XB 2KQRA 2V79A 3IRQA 2VBYA 3HPHA 1B1BA 1F5TA 3R6SA 2I5WA 5BS6A 4DBQA 3ECHA 4HNTA 4RMNA 2HWVA 3GVAA 1KQ0A 4KDPA 1U2WA 3OR2C 1P4AA 2QWWA 1QN9A 3VOEA 3HOSA 3GWZA 5AIPA 3V8JA 1T98A 3PNTA 1IZ1A 2O5RA 1TNTA 1C9BB 4LITA 4ENMA 4YELA 1BI3A 3I71A 1KQ9A 2R7XA 1H9TA 2NS0A 4N4NB 2RDPA 1XSVA 4HOBA 3QOPA 3C2HA 3H9JA 4LIVA 3HOTA 5L3EA 1DP3A 1MJBA 5CKTA 1ZLKA 3J7AY 1QBJA 2L9SA 2OBPA 4XLPF 2M8EA 1YW7A 4AVPA 3DQVC 2KKOA 2CFXA 2IGOA 2LSOA 2HEOA 3EYYA 4G94A 1T95A 3Q9VA 1QHGA 4OAYA 4M6XA 2Y75A 3LWFA 3ULXA 5CPRB 2W24A 2Z1DA 3P9IA 1E17A 5IT9Z 1G4DA 3ML6A 1O3RA 2IA1A 1REPC 3E5UA 3R60A 4A0ZA 4ZC3A 3F23A 2ADUA 2Z5UA 2DCEA 4I0AA 3BJ6A 5L3DA 4HBLA 2P4WA 2VJ0A 2AQEA 2HS5A 1KU3A 1X1CA 2WTEA 4H0EA 4KISA 3K4BA 4KUMA 3DTEA 2K9LA 1GLNA 4HQMA 3KP6A 4A12A 3D0SA 5CYVA 1Y0UA 4XKBA 1TBAB 2CFOA 3WGHA 4F93B 4MHGA 1IN7A 3DEEA 3E6BA 3GLXA 1Z9CA 1UHMA 3OL3A 4EVIA 3FF5A 2X85A 3JSPA 2WAFA 4EM2A 2V9KA 3V42A 3OYAA 3HRSA 3QP5A 2DT5A 3ZN1A 4L5JA 3JTGA 3LSKA 2DJIA 1D5VA 5IYBP 1JHFA 3LQQA 2FGTA 1W80A 2VLAA 2ZXIA 3KEOA 2M4KA 2HZTA 2JTVA 5LEJA 2V1NA 2UV1A 4B0AA 2EFWA 4ZYEA 3IAS2 2MZ8A 2LAEA 3CUQB 5H6RA 1IN6A 2FOKA 4MQ9F 4HV5A 5HDNA 2CMPA 3H5AA 2QKMB 4XR6A 1FN7A 4PSXA 3GO5A 1U5TB 1P9QC 1QQIA 1DGRM 4IQ4A 3BC8A 3AL0B 5LRRA 4B47A 1TW2A 4BACA 4XRFA 3SDBA 2QQ9A 2STWA