3DPUA

Roccor domain tandem of rab family protein (roco)
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
519
structure length
485
Chain Sequence
b'PEIVKQGKEAVRQYFQSIEEARSKGEALVHLQEIKVHLIGDGMAGKTSLLKQLIGGLNVVTKQAPNIKGLENDDELKECLFHFWDFGGQEIMHASHQFFMTRSSVYMLLLDSRTDSNKHYWLRHIEKYGGKSPVIVVMNKIDENPSYNIEQKKINERFPAIENRFHRISCVESIAKSLKSAVLHPDSIYGTPLAPSWIKVKEKLVEATTAQRYLNRTEVEKICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLNTSALGYILNEEKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLDVKEFIPLPGHPDELVEYKELLGLEKMGRDRYVSGKLEKVFSVSKMLDSVIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab family protein
publication title Structure of the Roc-COR domain tandem of C. tepidum, a prokaryotic homologue of the human LRRK2 Parkinson kinase
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Signaling protein
total genus 150
structure length 485
sequence length 519
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
A PF16095 COR C-terminal of Roc, COR, domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2190 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dpuA01
1.10.10.2200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dpuA03
3.30.310.200 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3dpuA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dpuA02
5A5GA 1XEXB 4PSAA 2JLZA 3D7MA 3AQ4A 2QPAA 3O8BA 1UDWA 2G77B 4XOIA 3DZ8A 1FW6A 3SE0A 4B3BA 4CYMA 1E2QA 2ZROA 2F1JA 2F55A 3THYA 3C14C 1X86B 1I2DA 2OHFA 4POAA 2BBOA 4TQ9A 5CJ2A 4LCBA 2CHVA 3KKMA 2WKRA 2AHOA 4CT4B 4Q4JB 1XD2B 3I62A 5FOWA 2B6HA 2IYWA 3LBNA 1ZU4A 5KSPA 1OIVA 2GAOA 1X8KA 4KODA 5FUYA 2GZAA 3BB3A 3LWNA 3GJ4A 5FTLA 2OZEA 1YRAA 4QHTA 4CEIB 5JEDA 1RYHA 3NWJA 1W44A 3WYAA 2Q3HA 2GJSA 2JJ2D 3R7WA 3VR4A 1BYUA 5CYPA 5CB6A 1VHLA 3DZDA 3SYKA 1QHSA 1KI4A 2PZGA 4MRPA 4DEYA 2OEPA 3SU8A 4W5JA 1Z8FA 2G0TA 4BZPA 2HT1A 2XZPA 3CRVA 3GJ3A 2MMGA 1P2TA 2FEMA 4XWOA 4IKEA 1OXUA 1PV4A 2ZREA 1TPZA 1DAKA 2IBMA 4MRRA 1G7TA 1EWRA 2AWOA 3SHFA 1B23P 3QI2A 2QQEA 3PIRA 4KBGA 1EXMA 2FG5A 4E22A 1XXHE 3EA5A 3W6NA 1Q3TA 4DLVA 4R7ZA 2UZ3A 3MGCA 4DWJA 1ZNYA 2WAXA 2F3TA 3A4LA 2GETA 4BFVA 2C2HA 2XEXA 4MYHA 4IW3B 2GEVA 2QUZA 3GEEA 4WW0A 1WB9A 3NIBA 1R8SA 3K9LA 3KQNA 1ESNA 3A4NA 3ND9A 2WJIA 3P4YA 2FF7A 3Q7PA 5HE9A 3B9PA 3I5XA 5IHPA 3MJHA 2QT1A 1VTKA 3QKSA 2KE5A 3CRRA 4TTRA 1E1RA 2J45A 4PAMA 1W36B 1R0ZA 1Z2CA 4P4SB 3EA0A 1F6BA 1G64A 2CEAA 1U94A 4BUJA 4PXAA 1R5OA 3TR5A 1GSIA 3VR1A 5JWHA 2NZ8A 1G7CA 1AA9A 3KJEA 5JHGB 3RS0A 2AK3A 3P1JA 1FFHA 1AIPA 2G6BA 2ZVPX 3EZ9A 3GPLA 5B64A 3W3AA 2ZTSA 3VR5A 1JPNA 1A5TA 1YZNA 4QL3A 5LBIA 3NC1C 2YV5A 4R2IA 1KI2A 2W83A 4BLSA 2OILA 3BFXA 3FMIA 4P0TA 1L4YA 3VNVA 2XJ4A 1OH6A 1A4RA 4NTZA 1PJRA 2ZJ5A 5D3QA 1DADA 1G19A 2VP6A 3Q8XB 2DWOA 2OM2A 2VBCA 5BN4A 2W2TA 3ZDQA 2ECKA 2ZI6A 2J0SA 3KDSE 1E6CA 3RRYA 2CL0X 2ZI3A 4YMTA 2XSZA 4B3XA 1GZSA 4TMXA 4M2LA 4OKSA 1DAEA 4DSTA 4EQ6B 5AUQA 3CIOA 2Q9AA 4TYYA 5DE3A 3WHKA 4KBFA 5LPNA 3K1JA 3ADBA 2PT5A 2WIAA 4ZIRB 3OAAD 4HI0E 4PC7A 5GJBA 4NH0A 1EX6A 1VYTA 1OLOA 1C9KA 1NLZA 1SVKA 5EE1A 2JLXA 1VCMA 2ZUDA 2QTHA 3TSOA 4LJ7A 1MRSA 2BHRA 5KPJA 1ZMXA 2GCOB 1GL7A 1Q1EA 4YDHB 2ZI9A 2R6FA 1ETUA 1JJ7A 3QJYA 2FEOA 3K0FA 3ZVRA 2EFHB 2XNDA 2BMJA 3BFKA 2Q0HA 4KFRA 1WXQA 4F92B 3WNDA 1XEWY 2P5SA 2PZEA 4ZDKA 1ZRHA 4IFBA 2JIZD 3R9IA 1U0LA 1TUEA 2BDTA 2WKQA 1OXTA 3FGNA 5JI3E 4MRVA 1KGDA 2AD1A 2RGDA 2ZUBA 4M53A 1R10A 4LHYA 2CJWB 1GNQA 3D8BA 1DAFA 4JLDA 4M8NE 3U5ZB 1COWD 4TTPA 5J4YA 4XIGS 1GWNA 3I73A 4I4LA 1H65A 2JLSA 2P67A 2GJAA 4IDOA 2R44A 3O8RA 3CNOA 3GLHE 3TQCA 3VKWA 5BW8A 1X1SA 1ZD1A 2QP4A 4LX0A 3T5GA 4JL6A 4PAQA 5IK2D 5H1YA 1FMJA 4BECA 2BV3A 1OH7A 1JPJA 5L3SA 2P6RA 4EFMA 1G8PA 2HYIC 4O2LA 5B58C 5GJCA 2ZRMA 1OB5A 3TIFA 4F38A 4XVRA 4JKIA 4ZV4A 2H7VA 1OPXA 4PQYA 1YR7A 3K9GA 4D4JA 4B73A 2R6GA 2QBYB 2E9SA 3RC8A 5AK0A 2WSMA 2ZE7A 4FINA 2N46A 4A1FA 3T1TA 2WSSD 5KO2A 4MGKR 4MUAA 2G0NA 2IHYA 3O8DA 1WDTA 1Z63A 1E2KA 3DHWC 3F8TA 5EUMA 2WAYA 1XCPA 2ZPTX 4URYR 1S3SA 3GJ5A 5EP2A 4MQBA 3GLGE 3ASZA 4G5QA 1KI6B 1FPMA 5KSOA 4HEJA 2PMDA 1UJ2A 4RVCA 2B7BA 2A5DA 4Q7MB 1G3RA 5AUPB 4FWTA 4GDFA 2RKOA 2QORA 3IIJA 4P31A 4DCVA 1GRQA 4V0MA 4GRAA 1MO5A 3RYTC 4AWXA 2ZE5A 1PLJA 1BH2A 4ZDIA 1NG1A 4IVRA 2IX3A 1ZP6A 4FWIB 1J99A 3HPQA 4PFSA 1S9DA 1WE2A 1NRJB 4CRWB 2EFCB 5DSZA 5E7IA 3FOZA 5KSYA 3E5HA 1KMHA 1S3GA 3K70D 2AKAB 1RW4A 2C9OA 2JAQA 3VR6A 1Y3AA 3PEYA 1VDZA 5CJPA 2ZJ2A 421PA 3RS3A 3U7HB 5C2JB 3HU3A 4QM7A 4JSTA 3GLFE 2EFEB 3C5CA 5BN3A 5J4HA 2QE7A 1M7BA 3TSWA 2VH5R 5EJEA 1K8RA 5E95A 5BYKA 1GUAA 2R2AA 1JAIA 4C0AC 1MABA 1D9XA 4NYIR 5FUVA 4IOLA 2G83A 4OI4A 1J70A 1OKKD 3A36A 2W0MA 3UK6A 2HUPA 4C7OA 1Q44A 4QHYA 2R6CA 4KSCA 4GOKA 3CH4B 4Q7JB 1ZYUA 5DNYB 3QVUA 1Z0FA 2W6IA 2RGNA 3VHXA 3TW8B 1TQ4A 3FMFA 4ITRC 1CLUA 1DEKA 1PLLA 4JMPA 5AJYA 2AWNA 3FHOA 1UBCA 4MDFA 2GXSA 3ND8A 4MA4A 3SJZA 3KTAA 4W5WA 1VPLA 2C8VA 3K53A 1E2FA 3R20A 1N5IA 4IOMA 1MKYA 3TMKA 1TU4A 1GDDA 2WWHA 4JSYA 2C9CA 3AVVA 4EPVA 4DT1B 1Z6TA 2I4IA 3ZQJA 3GLFA 1B0UA 3MRSA 3IEVA 4O0MA 1NY5A 3K0CA 3PQCA 4KFUA 4QBIA 2FV8A 1N2CE 4RZUA 4B34A 5JS8A 2CMKA 3KJGA 2YZ2A 3WBKA 3ICEA 1CJUC 4UNSA 3GJ0A 2R6AA 4XD7D 3HWSA 1JR3A 4ZCLA 4ESHA 1J90A 4TQUS 4DLYA 4H1VA 4JLPA 2IYQA 4QBHA 3EWAA 1UEJA 3LBHA 4DDUA 2J46A 4B33A 3QOFA 1U0HC 1W5SA 2QENA 5CLLA 2O8BB 3U6BA 2XB2A 4Q4HB 1XEFA 1ZM3A 2FFQA 2QY9A 2OE2A 1YRBA 3OESA 1SKQA 1M8PA 1LF5A 3QKTA 3QF4B 1E4VA 2VSXA 2QEQA 2ZRJA 3AVPA 4GFDA 5B57C 2O8FB 1Z22A 1OF1A 1TQDA 2OLKA 1YE8A 4C0SA 2VSFA 2XAUA 1VECA 3M0EA 2IF0A 5JZVA 4LJ9A 2YKGA 1CJMA 4GP7A 221PA 4HLQB 1QF9A 1G18A 4V03A 3ETLA 3LXRA 4Q9JA 1NLFA 2X1VA 1BYIA 3OIWA 3GLIE 2IA5A 5EP4A 1G1MA 3AM1A 1P9WA 1KK1A 1OFIA 2Z43A 3EZ7A 4LOAA 2QPOA 4C0BA 4JBYA 4JVSB 4A9AA 4RY2A 1LVGA 2HT6A 2PL3A 1GFIA 1ZBDA 1KKMA 3HDTA 4A0HA 2BBSA 2F3RA 1KTVA 2BMEA 4LPSA 4GBMA 4D6PA 4FCTA 1NKSA 2C9YA 2YOHA 1NIJA 3UKDA 3T15A 3L82B 3ZS9A 2IYSA 1E0JA 2WWIA 1XJ0A 4MYUA 4F4CA 4KCGA 1K6MA 2JCSA 1W2HA 1SHKA 5SZJA 1SVWA 1XCMA 3IPYA 5C18A 1MOZA 4ACBA 4CW7A 4TYPA 1YU9A 2FZ4A 2J5XA 1KDPA 3IO3A 3E70C 5GADl 3OFNA 4FXPA 4PC2A 4UNRA 1IY1A 1KK3A 2GF0A 2HJVA 4YONB 5G53C 3GJ7A 2GEDA 5CM8B 4B3GA 1OXVA 4WZ6A 3W3ZB 2AD5A 3LW7A 4NP6A 3S1AB 2ZS9A 1W7AA 1TU3A 4Q1AA 1U99A 1GAJA 3MWLA 1DARA 1ZINA 2F9MA 3IGFA 3T1VA 1W36D 4GL2A 2G1JA 4HAUA 1VHTA 4L5BA 3SI7A 3SDZA 3Q85A 4EUNA 3QF7A 3REGA 3CONA 5BQ5A 4P3YA 1DBSA 3M4YA 5JBQA 1NMXA 1QBKC 3ZVNA 1G20E 2WWXA 4YDSA 1BMFD 1Z0KA 4LBZA 2V7QD 4PHGA 1HYQA 2JLUA 4B74A 3QSYA 1A2KC 1YQTA 2WJYA 3TR0A 2RB4A 2R6DA 5DI3B 4YXWA 4XH9B 1GOTA 2P65A 3P26A 1Z0IA 2ZYTX 1N6RA 4I1VA 2ERXA 2VP0A 5LB2A 5J40A 1TMKA 4O3MA 1D2MA 3K09C 1V5WA 2ANBA 4CEJA 1E9SA 4NYJR 4A8JA 4M1OA 3TBKA 2ODWA 2C96A 1VYUA 4NCHA 2WKPA 2VSOA 3AP3A 1O3YA 2IYTA 2NTYC 2JJ1A 2A5JA 1Q1ZA 2FH5B 5H70A 2CHGA 2BMFA 1KDOA 3JVUA 4DLXA 2IK8A 5LD2B 5FOSA 1CTQA 2D4HA 3PEWA 3IBGA 4EFNA 5BN5A 4PO1A 4DSUA 4WVFA 3CPEA 1A2BA 3KKQA 3LLMA 2QN6A 3R7WB 4LJ4A 4AG6A 3KXLA 2OAQ1 3G5UA 3QPWA 5J4KA 4TTQA 2QAJA 3VMFA 5AR1A 4UQOA 4ZKEA 1CF4A 4A2PA 4S35A 5FOXA 1TF2A 1H8ED 5HKKD 1VCOA 3B1VA 3DL0A 1KYIA 3OIVA 3QEJA 3HR8A 3V4RA 4C0QC 4WXRA 1ZUNB 2QMUA 2IYZA 2ZU0C 3UMRA 3KQUA 4D26A 1XTIA 2XXAA 5FOTA 4GP6A 3UIEA 1MO6A 1CIPA 1EFCA 1PZNA 2GCNA 1KNXA 2PBRA 1LY1A 2JJ2A 4RFVA 4DVGA 2XTMA 3U3RA 2D62A 3EPJA 2W6JA 3HYRA 3QQ5A 1NN5A 3CNNA 3PVSA 1IN4A 1SXJE 2RAPA 4JYCA 4QFMA 4URZR 1XZQA 1LS1A 3DVLA 1NIPA 3X1WA 4C9BA 2IWHA 4PSVA 5DGXA 3AP2A 1N0UA 1WA5A 3WP1B 3FE2A 3NXSA 3QIAA 1KJYA 1ESMA 1NI3A 3UATA 2G9NA 1N6LA 2IEZA 1QDEA 2ZIAA 3RRZA 1DO2A 4NYIQ 3JVVA 4QOSA 5F3WB 3I72A 4A4DA 5FOVA 3KFVA 4AY2A 3W34A 1ZM2A 3FYHA 4M4SA 2B92A 4WXPA 3F0TA 2ZS8A 1P2UA 2KI5A 4F4JA 1SVOA 1UKEA 3KZ1E 2QP9X 1XJCA 2YWEA 4LJYA 4JBWA 1VYVA 2ZJOA 1L8QA 3C15C 2NO9A 4M9XA 4DUGD 5CK5A 1H8HD 1NN3A 3C41J 3H1TA 3IPXA 4Q18A 5JSZA 4Q9LA 5B30A 2NO7A 1P4SA 1NVWQ 3HJNA 3KQKA 4M1YA 4A6XA 1DAIA 1OHHD 5L3QA 2WPDD 2ORWA 1E2GA 3NC0C 3U3OA 1KI8A 1E0AA 2YC2C 3QUSA 3U7GA 1XTSA 4Q01A 1KAGA 4NDZA 1S1MA 2K5UA 1ZUIA 1KMQA 3LVQE 1P5ZB 2RCNA 5FPSA 4D0NA 2DCUA 4W9MC 2QMEA 1FOEB 2H57A 4C0KA 2YHSA 4ZI3A 4TQAA 3ZS8A 1EK0A 1SKYB 2R9VA 2ZE6A 4M1SA 5J5CA 2ZRHA 2QPTA 1DG1G 4K46A 2IC5A 2ZANA 3AVTA 1OXSC 1W0KA 1NBMD 1JXMA 5EE5B 5EUQB 3EW9A 1CP2A 4ASUD 1W4AA 2XX3A 4IOJA 1K5GA 3BH7A 4CZ2A 2C77A 3ZLJA 2HXSA 1W2GA 4ZI2A 5ELXA 3K0SA 1WBDA 4IDQA 3K0EA 3OEHD 5P21A 2GK7A 4C30A 1LF0A 3F5FA 3I8XA 5JCZA 1OFTA 2VP5A 3UPUA 3B82A 5KU1A 1ZCAA 3TRFA 1TX4B 2ZETA 3DMDA 4XVUA 2O8EB 3MLEA 2CLSA 5JHHB 4LI0A 4RCZA 4XSHA 3ZYCA 1CS4C 2F1RA 1CJTC 2A2ZA 5DN6D 2YYZA 2KBFA 821PA 1W5TA 1KSGA 1SVIA 1UADA 1KI1A 1S2MA 2C98A 1XMVA 3BRWD 3OAAA 2Q3MA 3QBVA 4JVNA 3SEAA 3FKQA 3RRMA 4E03A 3I3SR 2ZRFA 1E2DA 1II8B 4Q00A 4J0QA 3A37A 1BKDR 2HEIA 1MV5A 1NMYA 3U4QA 1G5RA 1NL3A 5KSZA 1HY3A 2ZSEA 1E2IA 1S9HA 1EFUA 4URUR 5F9FA 2AKYA 2CHQA 2RGNC 4ILEA 2ZYWX 3QXCA 4LYFA 5B2ZA 4DDVA 2OBNA 3LA6A 5L3SB 1IOZA 3BGWA 4LC1A 4Q9HA 5FR2A 1Y63A 1LFDB 4A82A 1XTRA 2JIZA 2REOA 5KNDA 1R0XA 1TNDA 2EU8A 2WM9B 1OFHA 2AFIE 1P2SA 4EKDA 4GMDA 1CR2A 4OQFA 3KKOA 4EIWA 2GNOA 2HLDD 3T61A 1ZU5A 3PJRA 1COWA 1R5BA 4PX9A 5EQTA 1T8UA 2VL7A 2J41A 3PUWA 4DHEA 1ZD9A 2F43A 3D6TB 2CNWD 4MYTA 5FTNA 3K0CC 4JL8A 4F7WA 4Q7LA 1Q3HA 1G3UA 5IK2A 1R0YA 2GK6A 2W2VA 5C4MA 4JZKA 3R9WA 1YHNA 3RDPA 5KNBA 1SZPA 1TTTA 1Z08A 2IUSA 1TEVA 3BE4A 3H2YA 5AUNB 1JEEA 1U2RA 4EJSB 4I1UA 4LJ8A 2CL7X 3TE6A 1NVVR 3Q5EA 4TSFD 3U44A 2C95A 4JT4A 1JB1A 3KQLA 1NVUQ 5SZHB 1AS3A 5AWFC 2IUUA 4QJ5A 4R71A 1Z5ZA 4AKGA 1DG3A 1E2EA 1KI9A 2XITA 1W0JD 1D2NA 4OQXA 1ZW6A 1Q20A 2IS4A 1HQYE 3RSLA 1E9EA 5K8IA 2ATVA 2MSEB 1YZQA 3NVAA 1U81A 3FTQA 1ZD8A 3BC1A 4ON9A 3NH6A 4TMWA 2WSSA 4GMXA 1J8MF 1F2TB 1SXJD 3OE7D 3GCGA 3CR7A 4QJ3A 4US1R 3FKSD 4NYJQ 4URXR 1KMHB 4LYAA 3ZQ6A 2F9LA 4N0EA 1XF9A 1GNRA 3C4JA 1G21E 5FTKA 2OBMA 4RKEA 3U3JA 2PJRA 2CDNA 3KJIA 1KSJA 2ONJA 2EWVA 1ZAKA 1P72A 1T3SA 2UZIR 2JLVA 3LX5A 1QHHA 1KSFX 1XXHA 2VA8A 4NL4H 3WBJA 1MABB 4KVAA 2GILA 1Z6GA 3K09A 4MITA 1U90A 5FTJA 2AXNA 3NH9A 1F2UB 2DY1A 4Z8XA 1M7GA 3BB1A 5M04A 2WOJA 1UM8A 2NPIA 1VG0B 3L0PA 4HUQA 1SULA 4C7OB 1KZ7B 4PANA 1CJVC 2F1HA 2DBYA 4G5SA 3QENA 3DEFA 3OEED 4PHHA 2P2LA 4XSGA 2ATXA 2XB4A 4AKEA 4JJKA 2WWYA 3TUZC 1HA3A 1L4UA 4HLUA 2FU5C 5JRZA 4OQLA 3SC3A 3LLUA 2W58A 4RFSA 1OYYA 4JLBA 5CK4A 1KHTA 5G40A 2ZRKA 1GP2A 3AGPA 4UNNA 1E0KA 2P3SA 3X1YA 4JLVA 1G5TA 2QAGA 3T5DA 1MT0A 2KJQA 4EPXA 1RPZA 4HAZA 4G01B 3KFXA 3LFUA 4JLKA 3L2OB 3ZD7A 1RRPA 2OLJA 1OKKA 2BCJQ 4LRWA 3QG5A 4BLQA 1CRPA 2QL6A 4PC3A 4Q66C 5D3MA 3VR3A 4M0LA 3UWKA 2OBLA 5IF9A 4A2QA 4AKIA 3QXJA 4FMDB 1JNYA 3FHTA 5L3VA 4LV6A 2NO1A 1G4AE 5IT5A 1CR1A 1NN1A 3CKLA 2Q21A 2O8DB 3V4FA 1SGWA 1FNMA 2Z5FA 1T6NA 2X19A 3PENA 1AGPA 2DWPA 3TH5A 1N6KA 2PEYA 3RWOA 3TGPA 5J4LA 1YZGA 4LHVA 3I5YA 1G41A 3X1XA 3QXHA 1E4YA 4IEEA 2OT3B 3CX6A 3EARA 4EFLA 1X8JA 3IHWA 1Z0JA 1U8YA 5EP3A 3TSZA 4A8JC 3OF5A 2J7PA 3B5JA 4QG7A 3QKRA 5LB4A 2OFWA 1E9BA 5DHFA 2OUKA 1US8B 3VX4A 2OG2A 3QVVA 1UKVY 3DKPA 3FHCB 2J7KA 4AI6A 4OI1A 2ERYA 3IIMA 1KI7A 1MO4A 5GJWC 1DAHA 4Z1MD 4XWKA 2QG6A 4A0GA 1VG9B 2QROA 2QTFA 1IONA 1RZ3A 4BLOA 4GI7A 3TUJC 3EPHA 1RFLA 3R9XA 5EP1A 3DOEA 1KJWA 3B1WA 2D3WA 2IS2A 4BASA 3SR0A 2D7DA 4IVQA 2OCBA 2FX3A 1XNJA 2BM1A 4Q4JA 1XD2A 4XTCS 4QJ4A 3IILA 1E2PA 4KFSA 1E94E 4U00A 3EXAA 5E7MA 4Q47A 1TF5A 1VMAA 2RGXA 1FNNA 1CRQA 2FOLA 2JDIA 2WICA 2LWIA 2VHTA 3F3YA 4CEIA 3CBQA 4LHWA 4YLGA 5KDDA 3RRNA 4R98A 4ZDWA 1EGAA 5FBVB 5KUTA 3GFPA 5L8VA 3HPRA 3H84A 1KO5A 1WF3A 1X1RA 2ZJAA 2XNSA 5JFGA 2A7QA 4M1TA 3GLHA 4RD2A 1FMLA 3L43A 3DOFA 3H86A 4X8LA 2H16A 3GP8A 2PCLA 1ZUHA 2QNRA 2NZJA 3UANA 3CF0A 1T3HA 2O0JA 3X2SA 2REBA 5FPYA 3WMGA 2NQ2C 4D4MA 3WNBA 3K9NA 3WP0A 4K81B 4IHQA 1E9RA 4KHZA 3ICQB 2YVUA 1HH4A 4AYWA 1ZJ6A 5FL7A 2AN9A 1QG2A 1T91A 1Q22A 4CVNA 4XWAA 4OYHA 1W47A 2IYRA 2Q9CA 4D80A 2PX3A 2KB0A 3L8ZA 3QPVA 1I2MA 3NG1A 2C99A 1N5KA 3BWDD 1XWIA 1N6OA 1A7JA 4EAQA 2I1VB 1XPUA 2RHDA 2GJ9A 4LJ6A 1MH1A 5FI1B 1P75A 4V0LA 1FP7A 5TV2A 1U9IC 5JWRA 2B21A 3A6PC 3V00A 4RD6A 1AM4D 3WYGA 3U3MA 3REFA 1ZM7A 5JWOA 2IW3A 1FUUA 3GLGA 1HQCA 2ODNA 3N5CA 4CEJB 3GJ6A 3TAUA 1G8HA 1YR6A 2BWJA 4DIEA 4GOXA 3PEUA 4QNMA 4LV5B 4P4SA 1D6JA 3GJ8A 4HLCA 4NCKA 4OJKA 4RJLA 4TLEA 2GKSA 3SHWA 2NG1A 4US2R 1G5PA 4FMCB 2GCPA 2ODEA 3E1SA 2XSZD 3EASA 4Q1BA 1BMFA 3GMTA 2V7QA 4F91B 2IXGA 5KTYA 4U7DA 3TUIC 1CU1A 4JLAA 4UJ3A 1FX0A 4IDPA 4QC2A 4A92A 1TF7A 2X2EA 4L9SA 2LKCA 2V1UA 4OK3A 2J59A 3B7GA 3CO5A 2JLWA 2JGNA 1BS1A 1UEIA 4XTRA 4ARZA 2CVHA 3IO5A 2OAP1 3IUYA 3W90A 2NGRA 2FFBA 3VTKA 1FQJA 1G16A 4MUBA 2H92A 4RCYA 2GJ8A 5HR5A 4M1MA 1VIYA 4KFTA 4L8GA 1UBEA 1TQ6A 1NVVQ 2I1QA 3EPKA 3H0KA 2YJTD 4FD2A 1RYFA 4D4KA 3M6AA 3HU1A 3FWYA 4FI3C 2IUTA 5EZ5A 1AKEA 1IAQA 2ZRIA 3PEVA 3W6PA 1UBGA 4DIDA 3BOSA 3PITA 5J4VA 3MD0A 5GVSA 2QGZA 5FBRB 4EQ6A 2NO6A 3U7FB 3T1QA 2XXAB 2PH1A 2O0KA 5DHAA 5H8WA 2O5VA 1XCGB 4NMMA 3QEOA 4OJQA 4WA7A 3VKHA 1T8TA 2FGJA 2J9RA 2RMKA 4ZIRA 3ZZ0A 2CK3D 5H68A 1OIWA 2W00A 4F93B 3O47A 4LJ5A 4P4TA 3O8CA 521PA 4BRWA 1N6PA 4L9WA 1VIAA 2OXRA 4JJZA 1HE8B 1E79A 3A1WA 4Z54A 1QG4A 2GCOA 1H8EA 1TAGA 5HKKA 2O8CB 4B43A 3CRQA 3TQFA 1E1QA 4JT2A 4TZ0A 2VP4A 4CEHB 4TMZA 2FA9A 3CR8A 1NMZA 4C4PA 4HAVA 1IY0A 4M1WA 2Q9BA 5JEEA 2V6IA 2GBLA 4LY6A 1W4CA 4PR0A 4OHYA 3IKJA 1ODFA 2J0UA 2OFOA 4LPKA 1Z0DA 4YQFA 1IN8A 2DYKA 2ZSAA 4B6EA 3BK7A 4M21A 2ZJZA 4KYUA 4V0OA 5K8TA 4H1UA 1IN6A 1R5NA 3SN6A 3ZD6A 4TN1A 1GRNA 4PPNA 1FUKA 4HAXA 2WJGA 4QBFA 1J8YF 3ECCA 3KB2A 4DLWA 3QG1A 2IYXA 1G6OA 2QT0A 4TT3A 5C4GB 4PHTA 2WV9A 1NSFA 3VR2A 4K8OA 1JXOA 2DFTA 2VF8A 4TLDA 1NY6A 4R9UC 3KB1A 3THWB 1IBRA 3SFVA 3AP1A 1VCIA 3AKCA 5L3QB 2CCJA 3EIHA 1P7CA 3CW2A 3MSXA 5FBQB 1Z6AA 3SJAA 1GIAA 3QBTA 4DZZA 1SHZA 4RKFA 4U5XA 1ZNWA 4D4LA 1S0UA 3CWZA 3JZMA 3M1IA 1NBME 3I32A 2OXCA 4M9ZA 1KDRA 4DLSA 4MGIR 2WWWA 2ZXUA 3ZVMA 2Z4SA 1KO1A 2BIFA 4KLZA 4Y0VA 5HCIA 4IJMA 2CVFA 1NSTA 2NIPA 4DUGA 3RC3A 2QBYA 1AGRA 1H8HA 2EYQA 3AVOA 1DAGA 3LV8A 1AK2A 1LW7A 3AVUA 3CUEF 3GLIA 1PLKA 4NCIA 1OHHA 1IY2A 2EW1A 1KY3A 4KV9A 4OI2A 4B44A 2ZR9A 4G5RA 3PCRB 1GNPA 4NU0A 4Q48A 2VHCA 2WJHA 1XX6A 2BBTA 4B2IA 3ZGXA 4Q1EA 1P9NA 4BE7B 1KDTA 1Q1BA 3PUVA 4NONA 3FMOB 3WNCA 4MKHA 4NCNA 3DMNA 3CH5A 5ANRB 3SBEA 1HTWA 4RD0A 2OESA 1M34E 3RVBA 1YJ5A 1TEXA 2ZE8A 4IFEA 3WHLA 3NBZC 4DXAA 3THYB 4JLJA 5E3HA 4MYCA 2YNMA 1YVDA 1YZTA 4Q1CA 1GKUB 2VHQA 2GXUA 4EDHA 4HB2A 2W6ID 1XD9A 1E98A 2Q3FA 3NEJA 5FTMA 3RHFA 5CDFE 4AKHA 5CITA 3G82C 4LYJA 1A82A 2AXPA 3OIUA 5CIWA 3WY9A 2NO0A 2QM8A 3K70C 2ONKA 3CF2A 2LKDA 3RS4A 5DN6A 4HLUC 2QMHA 1P60A 1XRJA 4E5UA 2CXXA 3FMPB 5CM9C 1GL9B 3ONWA 4KLNA 3A8TA 1KOFA 3AVXA 1E32A 2QAGC 3I1FA 4JL5A 2YC4C 1T0HB 4KJZA 5FPKA 1RRFA 4PO8A 2ZVQX 4DKXA 5AUOB 3B60A 2BOVA 5KDOA 4DB4A 1RJ9A 3ADKA 3ZIAD 3C8UA 4X8HA 5HTKA 4HDOB 4V02A 1ZIPA 2HF8A 4AIIA 1JECA 2IEYA 2QSZA 2LCFA 2R8RA 2F43B 2YOFA 1E2NA 3AKDA 4AD8A 2H17A 3SOPA 2ZI5A 3W6OA 1P73A 2HDNB 3DDCA 5DIFA 3LX8A 2IHBA 2ORVA 4E07A 4KVGA 4Q4LA 3GFOA 4ABYA 1YKSA 3SYLA 4RZ2A 4BEBA 1EG7A 3Q72A 2Z0MA 3SQWA 2L0XA 2PLRA 2ZAOA 2XGJA 1KSHA 3U44B 4ZO4A 5CYOA 5DYIA 4DT1A 4ERNA 3CNLA 5SZIA 4LHZA 2WHXA 4TZ6A 3L8YA 3FFAA 1YR8A 4I81A 1JALA 4G1UC 2FN4A 2WJVA 5E7JA 3TW4A 3THOA 2GXAA 4A0RA 1NKTA 2EWWA 3FVQA 3QKSB 4TMTA 2HV8A 2GDJA 1XZPA 2P6UA 2ZRDA 1XMIA 3KJHA 3WYFA 2VQSA 3CZPA 5JJKA 3EIEA 3K8YA 4BZQA 3KQHA 4V0NA 3L0IB 1JJVA 4Q4HA 1Z6YA 1IM2A 3EX7C 4PTLA 1HURA 1EFHA 3Q3JB 2QSYA 4UXIA 1A1VA 3AVWA 1U9IA 1YR9A 1VG1A 3I92A 4TSFA 3QF4A 4OHWA 3L0SA 1QHHB 2H1LA 4DJTA 2IYUA 4II7A 1HV8A 2GA8A 4HYYA 2A9KA 3EPLA 4OHXA 2O8FA 1CKEA 3NBXX 4A36A 4UNPA 3LQRA 1L7VC 5CB8A 3B8HA 1Q12A 1XBTA 2BEKA 3MFYA 3TLXA 1UKZA 2QZ4A 5HPYB 3CF6R 3UMSA 1SXJA 1IJEA 1D9ZA 4PZLA 3MWYW 4I1OA 4DRZA 2ZSBA 2WOOA 4DCTA 2OV2A 4A0FA 5EE3A 3OFND 2DWQA 3K9HA 4QM6A 4BFSA 1ZVQA 3RAPR 1E9FA 2HF9A 1Q0UA 2IXFA 3AB3A 2GEUA 1GTVA 3U7EB 3RWMB 2CE7A 3DO6A 4TYWA 5FPHA 1XU4A 4Q1FA 4LYHA 4ZDJA 2RHMA 3FDIA 4HAYA 4TMVA 2ZM5A 1GRRA 1T5IA 4RSGA 4HB4A 5DYGA 1IN5A 2OCAA 2Z6VA 5D3MB 2IYLD 2JASA 1FTSA 5F2EA 4ZPXA 3R8CA 4YMWA 4LBWA 2FZLA 1AS2A 721PA 4CT5A 3B2EA 4UJ5A 1NNEA 1V43A 3J81k 3K0FB 2A5YB 4B3DA 3ZH9B 5FPTA 1XPRA 4DLTA 3T06B 2AFHE 2NOAA 1E99A 3BB4A 3LD9A 4YC7A 2VLIA 4Q7KA 1E3MA 4QGFA 2ZI7A 2KBEA 4Q9IA 2JA1A 3LDAA 1ONBA 2WWGA 5TXGA 1RRGA 2G1KA 2REXB 3W8RA 5HCNA 2IT1A 2ZI4A 3BH0A 3PXGA 4JVLA 5DO9A 4NCJA 1KO8A 2WWFA 4D82A 3BS4A 1LV7A 1UBFA 2ZRPA 1W36C 3B13B 4WIAA 1WP9A 4OK5A 3CPJB 4DLRA 4LUCA 2YWHA 1N6IA 2VTKA 4DLUA 3SQXA 2A5GA 1R7RA 2HCJB 4C0HA 1GM5A 4B71A 5TB5A 5DI3A 4OQNA 1JI0A 2V54A 1WCV1 4D25A 4DSNA 1GKYA 3RNLA 2N1BA 4KITB 2A30A 2IF2A 1EWQA 4LK2A 1T9HA 4AYXA 1D2EA 5F98A 4JVMA 4QXAA 5EXXA 1P2VA 2MSDB 3BAFA 2YWFA 4KO8A 3OZXA 2V3CC 1ZM4A 4Q4AA 5BYJA 2O0HA 1J7KA 1OIXA 4B35A 4B6FA 4LJAA 2P6NA 4M1KA 5GJVC 2DR3A 2V4ZA 1FL9A 1CBUA 3A1UA 5JLJA 1KNQA 4JKYA 3B6EA 3B78A 2GZHA 3EZ6A 1XDBA 4E09A 1Z83A 5AJVB 4F4IA 2GWHA 5FH9A 2GAAA 2G3YA 1GVNB 4WOPA 2VYFA 1WRBA 4Z1MA 3MAAC 4HZUA 3N2EA 2RGGA 2W6JD 4TL8A 1ZM9A 2J0VA 1MO3A 4MGZR 1Z29A 3B1XA 1LNZA 4AURA 3SJCA 1KKLA 3GLHB 3IQWA 3UMFA 1W46A 3IHLA 2WTUA 3ZVLA 4C2UA 3U6KA 3DM5A 4NKRA 1XMJA 2D7CA 1E69A 3KUCA 1OSNA 2QI9C 1NJGA 3KXKA 3B9QA 3KX2A 3RS2A 2IS6A 1I4LD 1ZC3A 3GEIA 2QRNA 1W4RA 2XZOA 5A0FA 4Z51A 1OE0A 4PPFA 2IS1A 3K0AA 4HATA 4IEIA 1EESA 1BOFA 3MUFA 3KKNA 2GBLC 4GSYA 1D8TA 3EAQA 2W0SA 4C0LA 4FW9A 1W4BA 3JZAA 2PEZA 3LBIA 2WVJA 2QP3A 4H9GA 4LV8B 3VQTA 1SVSA 4I1SA 1CR4A 2J1LA 4B75A 4HZIA 1OH5A 4B48A 3IDQA 2RGCA 1DVRA 2XOKD 4EPTA 3GLGB 1GILA 2HCBA 2V55B 2C78A 3PFIA 4XVQA 4OHZA 3VU9A 4BFWA 1GL6A 3THXA 1SKYE 1Q1QA 3QY0A 1R6BX 4MKIA 4MRSA 1XTKA 3SYNA 2FPLA 4TMKA 2A3RA 4CDGA 4MGYR 2VHJA 4W5HA 1J2JA 4L4UA 1II0A 1NF3A 5EXPA 2B8WA 1EFRD 4BFTA 4IXMA 4ESVA 4PC1A 4FN5A 4B47A 2GHIA 1FX0B 4HLDA 2D06A 4WBSA 1W0KD 1QHXA 1F48A 3KTAB 5JRJA 3MWJA 1QHIA 4ARZB 5BWMA 1IQPA 1N5JA 1BO6A 2BJWA 3C7KA 3ZJYA 4A15A 3UG7A 1QZXA 3AF2A 2GF9A 4Q1DA 1AQUA 4NYMQ 2VF7A 3GLFB 1O87A 3V9PA 4FMDF 4PPQA 1FQKA 2DFLA 4Q5IA 1I4DD 1XB2A 4W7SA 3AKYA 4WZAE 2FDCA 1XFAA 5FUXA 1DS6A 2PX0A 3CB4A 4MKFA 3NDPA 4LDJA 5DH9A 1R0WA 1LTQA 3DM9B 3EC1A 4HB3A 3PUYA 1F3OA 1QHYA 2UKDA 1QVRA 8OHMA 1Z6XA 4KYIB 3GD7A 2F7SA 4O2RA 1OW3B 4HDQB 4N3NA 1SQ5A 4D0GA 1TL7C 1CJKC 3RSOA 2PZFA 5TDHA 5J47A 5L3RA 2EVWX 3KXIA 1DE0A 4PZYA 4AK9A 1UFQA 3N2IA 2HXYA 1RRCA 4NPHA 3GFTA 4UXHA 4DDWA 5FUWA 2O8EA 2R65A 3T34A 2VHUA 1KIMA 3T12A 2P5TB 2ZJBA 1S8FA 1RE0A 1KK2A 1Z07A 3UXMA 4Q02A 1XEXA 2H5EA 2JJ8A 1G3QA 1D5CA 1GITA 2XTNA 2H8KA 5KYKA 3DPUA 2GVDC 2Q6TA 2J0UB 4XD7A 4B3CA 5FBLB 2DFNA 3VKGA 2CLCX 4ACAA 1C1YA 3Q9LA 4FMBB 3BFVA 2CK3A 3HYTA 4BGDA 4Q9KA 4RZ3A 3EIQA 5SZKB 1II8A 5TY0A 1JBKA 4B2LA 1TQ2A 2RH5A 2QMOA 4TLCA 1WBBA 5KPDA 4RZXA 4Y0AA 2CCKA 2DB3A 1WQ1R 2JLQA 1ZNXA 2J87A 1YZUA 3NBYC 3NDBB 2WIBA 2OSBA 2BJVA 3AUXA 2VP2A 1KY2A 1Z2AA 3QXSA 2F6RA 1MR3F 3TNFA 4V0ME 1AJEA 2VO1A 3P27A 4MRNA 3I61A 1G17A 1ELOA 1VCNA 1T3LA 1UF9A 3CRMA 4BZXA 1RVDA 4TLBA 2OFXA 5JI2E 2F1IA 3PUZA 1RKBA 2CL6X 3P4XA 1UAAA 4XJXA 3KKPA 4WZBE 1HT1E 1OXXK 5EZ6B 1UDXA 2WJJA 4LSGA 3BXZA 2ZITA 1P62B 3A1TA 3AKEA 4JBXA 5HZKA 5UKDA 5FI0B 2PLFA 5G3ZA 3U2QA 3GLIB 4M9SA 5AJXA 3W5IA 2V8OA 4KXFB 3LQQA 3X1ZA 621PA 1E1RD 1CULC 1XTJA 2B7CA 4IOKA 4BRUA 3BJIC 3ASYA 4PO9A 1X3SA 5GVRA 4Q03A 3RABA 5TMPA 4KU4A 2G88A 3TVTA 2ZRCA 4EJSA 4P32A 1MRNA 4DC9A 2GTPA 5EE9A 1QHNA 2E87A 3VHLB 2VP9A 3SJBA 1KK0A 4I99A 4CIDA 5JCPA 2DHRA 2DFKB 3EWSA 4X8MA 1E2LA 1M1YE 3PV0A 4N1AA 1KI3A 1WMSA 1F60A 3CZQA 1JR6A 1AZSC 2AR7A 1QRAA 2V9PA 5IDVA 3RS7A 3NKVA 3FFBA 1E2MA 1W1WA 1F2TA 3FPAA 5KNCA 2PJZA 4A8JB 5C46F 1I4TD 1NN0A 1E9AA 2CLDX 4BLPA 4BEJA 1M6NA 3IIKA 3BIFA 4AG5A 3MJRA 1SXJC 4FMCF 4G0NA 1DELA 2VIIA 3LH5A 4BWYA 2O52A 1R8QA 4NE2A 4ZKDA 3T35A 5JMTA 2IYYA 2CE2X 1PUJA 2C03A 3IEUA 1N0VC 2ZRLA 4P33A 3SNHA 1OT3A 3AUYA 3QE0A 1C4OA 2HYDA 4Z8YA 2RGEA 4HUTA 1T5LA 2ZSDA 2NMVA 1LB1B 4G3XA 3ADCA 2EQBA 3MMPA 2ZU6A 3D3QA 4KI0A 4YMSA 1F2UA 1E9DA 3AF3A 2V1XA 2Y8EA 3EZFA 2ZRGA 1N3BA 4BFZA 5K8LA 1IXZA 1JR3E 4X8OA 3AVYA 2ZEJA 1EX7A 3ADDA 1CEEA 1G7SA 2ZYUX 1IJFA 1RJ9B 4PZZA 3SBDA 5C1BA 3UG6A 1M7HA 4JLMA 1T4GA 3KL4A 4RD1A 3H4MA 4DCNA 1AQYA 4LBVA 1II9A 2XNDD 4Q19A 4UXJA 2XZLA 3DPTA 1XEWX 2BVNA 3LXXA 3Q5DA 4LBYA 2IWRA 4AYTA 2WZQA 1SVMA 1ZNZA 4TL7A 3OHMA 3SS8A 5AJWA 2FPKA 4HSEA 4LC0A 3AF1A 4IRUB 4TWZA 1TADA 2X8AA 2ZUCA 4TYQA 2JATA 3RS5A 2J7PD 2ZS7A 3B1ZA 1G3IA 4DLZA 2BKEA 1YZLA 1G8GA 3CM0A 1R2QA 3PUXA 3W9YA 1E96A 3ZIAA 4CGZA 3QXXA 4JIMA 1JQJC 3L0OA 1E0SA 2ZQ5A 2XTZA 2JEOA 4GZLA 3QKUA 1AKYA 2XJ9A 1M74A 3G0HA 2O8DA 4GPTA 1G291 5IRCD 2GZDA 1IHUA 1YZKA 3I8SA 3SFZA 4V0KA 5G3YA 4IDHA 1XTQA 1XMSA 1JEDA 4QGAA 3E2IA 3LNCA 1DPFA 3N70A 3NTUA 4JLOA 2EFDB 4DSOA 4B76A 1DO0A 1GKIA 2ZSFA 3ZZTA 4B32A 4QKQA 4FCWA 3CX7A 1QHGA 2CJWA 2FSFA 2GJKA 3RLFA 4OHVA 1P3JA 1US8A 5JSZB 1CR0A 1R4AA 2JDID 1Q57A 5DLQC 4HDCA 1DAMA 3R8FA 2ORIA 2CCGA 4PAOA 2ZR7A 1N25A 4O25A 5LD2C 1KJZA 1XD8A 4GNKA 1SXJB 3IBYA 2TMKA 4DEXA 2ANCA 1G3MA 3VX3A 2ZRNA 3CLVA 2QQ0A 3Q7QA 2YWGA 4JLNA 2VRWA 3AV0B 1K5DA 5FR1A 3AF4A 5G41A 1TUIA 1S96A 1Z47A 3GJXC 4A6PA 2YOGA 3BD9A 3T1OA 4PPGA 2QGNA 2E1RA 3WMFA 5EXSA 4FCVA 4PC6A 4URVR 1ZC4A 4KSBA 4CF7A 1G8YA 1AZTA 2BM0A 5FL7D 2FJUA 3LW8A 1Z3IX 1KZGB 3AEZA 1X8LA 2ZRBA 3AGQA 3RANA 121PA 2WPDA 4DDTA 1XJQA 1OH8A 1XP8A 3VAAA 1LS6A 1OV4A 1NVXQ 1E2JA 3BBPA 2RGBA 3D31A 4FIDA 1KI6A 4DCSA 1G4UR 2NPFA 2KSQA 4Q21A 1L2TA 2PCJA 3NHBA 2OCYC 1IXSB 2C5LA 2I3BA 4M9QA 5E4FA 1G7RA 2YINC 5BXQC 1P9RA 2QE7D 4TL6A 2IXEA 2BKUA 2JLYA 2FMXA 3I4LA 1VG8A 3GQBA 4NBSA 3NHAA 4BPBA 1NBMA 3U3KA 5TVKA 4ASUA 4C2TA 4A2WA 4BFXA 5JS7A 2WMNB 4TL9A 3VFDA 2BC9A 5FOUA 5KHOC 4BFUA 1JAHA 5K8UA 4UNQA 2FFAA 3TJZA 3OEHA 3WXMA 4GZMA 2BMDA 4G5OA 4NHOA 4PHFA 4ZCMA 2JLRA 1U8ZA 1PVOA 3LAWA 3U4QB 3MG9A 1W48A 4MKGA 3A4MA 3EZ2A 5EXTA 2ZYVX 1OYWA 3OIYA 4IXNA 4NZYA 4OK6A 4BLRA 1RC8A 5EE0A 3EG5A 3WRXC 1X6VA 1E2HA 4N0DA 1HE1C 2R62A 2J3EA 2UVQA 1T0JB 3IQXA 2AX4A 1KO7A 2A5FA 1SVLA 3TK1A 4QGHA 4OQMA 3PG5A 2W2XA 3ZZUA 2IL1A 3B85A 5JJLA 4QHSA 4Q4AB 2FNAA 4DCUA 4GOJA 1JQLB 2D2FA 4L15A 5CLQA 1GG2A 1E9CA 3W8NA 3NBFA 4JYBA 6Q21A 1HEIA 2D74A 2GRJA 2RGAA 3AF0A 4OBEA 4AC9A 3P20A 2VEDA 4MDEA 1JR3D 4ZCIA 4HAWA 2KWIA 4EPWA 2WMOB 4HZUB 2FWRA 4DB2A 3X1DA 5CDFA 2FPMA 4UKDA 1NLYA 3TAHA 1ZCBA 4QRHA 2HJGA 1HUQA 4B2PA 2J0QA 1E79D 2ODBA 4NYMR 2ZRAA 1DTSA 2QU8A 1N6NA 3WRYC 2OO7A 1NG9A 2HLDA 1E1QD 3CPHA 3LRPA 3A58B 4QNRA 3U60B 2X77A 3QPUA 1OJLA 3CRW1 4HB0A 2BBWA 1DOAA 2BCGY 4D81A 2FSIA 4OI0A 3LO5A 1U8AA 3K0AB 4IDNA 2CNWA 4QGGA 3HU2A 4D0LB 2FGKA 2MMCA 5LDDC 2P0EA 4EPRA 3VNUA 2AL7A 1G8FA 1FTNA 1VKJA 2SHKA 4BLTA 2VPPA 1QVAA 1PUIA 1CXZA 4TYNA 2O8BA 3A1VA 1Q21A 1N0WA 2X2FA 5KOYA 5AJZA 4D2IA 1AN0A 4KAXA 4TT3D 4QBGB 2O8CA 3DKVA 1XXHB 2ASEA 1U0JA 4US0R 2PT7A 2IYVA 4LGMA 4YMVA 1ANKA 3HP1A 2Z4RA 1W0JA 1XPOA 4DBLC 4CEHA 2PMKA 1FZQA 2GESA 5TARA 3VU9B 1S1CA 3THXB 2FE4A 3BH6A 4OL0A 4HUQB 3MCAA 2Z83A 1N5LA 5FFMA 4C0JA 5KDLA 2ZJ8A 2FFHA 4MH0R 1Z28A 2BEJA 1W49A 3NEYA 3OE7A 4C3ZA 4BFYA 1NP6A 3FKSA 3U61B 2FSGA 2GXQA 3CWQA 3K70B 1KO4A 4BQSA 2A78A 1S4QA 3KUDA 1N6HA 3HR7A 2WBLC 1RIFA 4URWR 3LVRE 4LWZA 2ZR0A 4JS0A 3BORA 3C16C 2V6JA 4RFSB 1AS0A 3TKLA 5HZHA 4PQRA 2GVZC 4PQFA 3AVQA 2XOKA 3UWOA 2QAGB 3THWA 2N42A 1IN7A 4TLAA 4YMUA 1G9XA 5F9HA 4RD4A 3LY5A 5JECA 2OCPA 1FP6A 1U98A 5FBWB 1EFTA 3CX8A 4PSKA 4U02A 4L16A 2D2EA 5DI9A 2EYUA 2QRZA 3P32A 4RD3A 5CIQA 3OEEA 1EFRA 4EPYA 1UPTA 3PR1A 3W5JA 4M22A 3SZRA 4EJSC 4B3FX 5HE8A 4P4UA 1OB2A 3C5HA 1BIFA 4WAUA 3A1SA 2CBZA 5DISB 4YXWD 1G6HA 2QM7A 1Z06A 4S2EA 1IXRC 3TVDA 3WMEA 1HT2E 1UKYA 5JJIA 2QTVB 2C04A 3S1AA 1ZIOA 2FSHA 4R2HA 5A4JA 5FL3A 2QA5A 1NJFA 2DPXA 2H18A 2ZAMA 1M2OB 4G5GA 1P61B 3EC2A 4GT1A 3AH8A 3GEHA 1F5NA 2EFGA 1P6XA 2JJ1D 3B1YA 4LZZA 3FB4A 2B8TA 1Z0AA 3QKRB 3QNUA 2AK2A 4LHXA 3MWKA 3BERA 1OFUX 2ZJYA 1KAOA 2MSCB 4IVPA
chains in the Genus database with same CATH superfamily
2JLZA 2DQYA 1E7RA 3SE0A 1FLNA 2ZROA 2XUBA 2FKAA 1SOWA 4CV2A 2BEOA 1Z62A 2EKPA 2H06A 2CHVA 4IHWA 4OFWA 4CT4B 1ZGCA 2YBDA 4LZOA 2B6HA 2D1HA 2IH4A 3CW8X 1FYKA 5LZ9A 3Q0EA 2P6TA 2GN4A 3SIXA 4ZAZA 5HMMA 3DKWA 1C29B 3NT5A 3C6KA 5H16A 2NAFA 1L5QA 1DBVO 2FG5A 3D7RA 1E4OA 2WAXA 1FPQA 3ICOA 3E6MA 3DJFA 3NIBA 2PE5A 1R8SA 1V96A 3KQNA 4MUNA 4F45A 3MJHA 4EUKA 3R61A 4QPOA 5LA6A 1LH0A 1CUWA 3WNZA 2RHHA 2VRNA 4BNTA 2YS6A 5FNZA 4EYEA 1YV9A 1FFHA 1UPFA 4GWGA 4U8GA 4XSVA 1BWRA 1W9MA 3VSCA 2ZTSA 3VR5A 4C07A 4I7EA 2L18A 2ZIVB 1ZR2A 2OILA 4CF6A 1D04A 3VNVA 3FW1A 4NTZA 1T5SA 5EJ5A 1LVHA 4P58A 4BHPA 4RWEA 1J2RA 1ULAA 3JSOA 2J0SA 2VZEA 4IHJA 4R5HA 3D5SC 5JAIA 5AHKA 2XSZA 4EQ6B 2LDXA 1XA0A 4GX5A 4CR8A 1QSGA 5F1PA 4Q3NA 3JAWA 4HMOA 4A3JJ 1SVKA 2ZUDA 1RADA 3NHPA 2QTHA 4LJ7A 3IAS2 4BMYA 1VKOA 1B0PA 4FILA 4XQFA 4R8RA 3BMOA 2HQAA 5AI9A 1FXUA 1KVQA 4KFRA 5EMHA 1V11B 3H42B 3B3QA 4GLBA 3I5AA 2PSSA 2CDCA 1U0LA 3OHPA 4A3MJ 3RSNA 4O33A 2AD1A 2HX1A 1KYQA 4J1TC 4B5KA 4WZAA 3MCWA 3EULA 4TTPA 4OG2A 2P67A 2NZVG 2E6UX 3CNOA 2O2DA 3AETA 5ENZA 4BECA 4O8ZA 3GW2A 2O7SA 3BR3A 2ZWIA 1CQJB 1V6AA 4F38A 2CJYA 5DGHA 4X91A 1QK3A 1JIIA 3E61A 4MTCA 1JPVA 2BKLA 5IJXA 4A91A 4MGKR 3DUFA 5JCJA 1MGTA 2WAYA 5HS6A 4IJ6A 1KI6B 4E51A 2O7VA 4UQPA 1G3RA 4II3A 1NTOA 3D2AA 5TISC 1F8GA 1SXIA 4I66A 2PZMA 1WE2A 2GO7A 5JI6A 1QRDA 1YZYA 1DQNA 1RWWA 3VAZA 3AUTA 4D96A 3GLFE 4HYEA 1YOVA 4TKMA 1D9XA 3RZDJ 3JRBA 1J70A 2C5SA 3UK6A 4L5EA 2ATEA 3RKQA 2O6LA 4XFJA 4HYTA 4U2DA 3TQTA 2R96A 2BN4A 4GF5A 4XEUA 1W73A 1CLUA 1DEKA 1OYVA 3H2IA 1VQ7I 5BOSA 3ND8A 1VPLA 1PWYE 5EDNA 5IVKA 3MEQA 4MVJP 5ICSA 3TPZA 3HADA 3GLFA 5HRCA 1K6IA 4MR7B 2QUIA 5ECYA 2FV8A 4BGIA 1MXHA 4M98A 5K4AA 1XL0A 2R6AA 4XGRA 4HAIA 1NJSA 1XDUA 3CY6A 2CLHB 5I8WA 1MJAA 5B36A 3ZKWA 3QOYA 1Q5PA 3DBRA 5B57C 2O8FB 4TXLA 3NW9A 1TJPB 1VECA 3F6PA 4CCWA 3GOHA 4HAMA 2YKGA 4W5RA 4GP7A 3RVNA 3U37A 2GN2A 4UUBA 2BGJA 3GDHA 1Y82A 3KU1A 2QTWB 1SBTA 4N49A 3AM1A 1R8YA 2DPDA 2WZDA 2F3RA 4L5CA 3GL9A 3IC5A 3LOPA 2QYOA 1XMKA 3L82B 2IYSA 2OM6A 1W2HA 1LLCA 1SHKA 1INLA 4Y1EA 4YGXB 4DNFA 3J81K 2Q1TA 5D6OA 2GPBA 5T8KC 1IPHA 4FCCA 2XXJA 1B6AA 2VPQA 2M6KA 4KHPB 1M1EB 2F9MA 1ZINA 4BJ1A 2JANA 2W2LA 4CH7A 3G71I 1TO1E 4WKGA 2P2NA 1A4XA 2CMHA 3HOTA 3AHEA 1CQXA 3KSDO 3ZWMA 2A07F 1D2GA 2PL5A 4CEJA 4NYJR 4A8JA 4OBXA 4QDXA 5T3UA 4NCHA 3HYLA 4HVCA 1O3YA 1VM6A 1Q1ZA 1Z5PA 3TTVA 4HX8A 4A8TA 1CS0B 1JUDA 1KC1A 3TVYA 5K3OA 3LOQA 1QVTA 1GR0A 4ZVLA 2IGNA 1H8ED 1VCOA 2DA4A 3IAUA 1KYIA 3FZQA 3SNKA 2WV0A 3T3HA 1QK4A 3X3HA 1HYEA 2OECA 1ULSA 3KQUA 5C4JJ 4DQVA 1VA5A 5JNWA 2XGOA 2Q3JA 3C7TA 3D2LA 4KN9S 4OGGA 4D4HA 1E1MA 2I33A 1U5TA 1UPCA 4CJXA 3UAZA 3FSJX 4D9FA 2LH9A 1UKEA 4QQRA 1Q0QA 1XJCA 3KOMA 1XAGA 2DN0A 4JBWA 2NAZA 5FEMA 2C58A 3OY9A 2IZ6A 1ODIA 3PFFA 4EG1A 2O6HA 1QP0A 2HDHA 1WUYA 5BN4B 2TMGA 3HVJA 3AJ8A 4BJHB 3ME5A 3OKAA 4DV2B 1G2OA 1R4NA 1BG6A 4JQCA 3CG4A 2PX5A 3FNEA 2WB1N 1HMYA 3FG9A 4CQLA 5BY2A 3TLJA 5KU1A 1TX4B 2O8EB 1KH1A 1HF3A 3JWJA 5HIJA 1FIUA 1CJTC 1WPRA 4UARA 1GV1A 4CXFA 4FYJA 1PGOA 2AG6A 821PA 2FW9A 2PIDA 1CC1S 1XMVA 4YV2A 1U0RA 3H1CA 1UM9A 4WFIA 2JGEA 1BKDR 1MV5A 4KR2A 3P52A 3H87A 3DFZA 3QXCA 4S12A 4YFVA 2EV5A 3A4IA 4BNFA 2PY6A 5ALLA 4X6UA 1LC0A 4G6TB 2WM9B 2AFIE 3ZYZA 3FCSB 2FKFA 1CR2A 4IWXA 2VUIB 1T2KA 5AQEA 4LF5B 5BR8B 2OCGA 2DBQA 3ULQB 2GK6A 1NP7A 4JZKA 3R9WA 1SOMA 4WCFC 2XECA 2WFZA 3G7SA 4BNGA 2Z9DA 1BC7C 3MS2A 3ZXIA 3D0SA 5DX0A 1L8OA 4LJ8A 3V8PA 3AHIA 4C6HA 3U44A 1R71A 4DJ5X 2X42A 5KAFC 1B74A 2IS4A 5T4HA 1E9EA 4RV9A 2XAHA 3FKSD 4V0RA 2CHUA 4U0VA 1WULS 4DS3A 2CDNA 4NCAA 2ONJA 2EWVA 2JLVA 1KP3A 4PYNA 1K4KA 2AYYA 2VASA 4B9EA 1E6LA 3WTVC 4B3MB 3HP7A 3K0KA 3GUCA 5EPUA 1FTWA 2H1SA 4N48A 4BO8A 5JSKA 2F1HA 2FLVA 1L1QA 5HQ3B 1JFIC 4XSGA 4FDAA 4HSRA 3P9RA 4RFSA 4XA8A 3AGPA 3U49A 3MZHA 3BJOA 1BIAA 4IFTA 4WNYA 4ARVA 1JHHA 3ASVA 3HUGB 3ZV5A 1YI0A 2Y1CA 2OTJI 1R66A 4MXDA 3E35A 3OQIA 4YRDA 5AVTA 3IE2A 2JFFA 4NQWB 1E9BA 5EKSA 2ZK7A 1N1DA 2O6GE 5KZMB 5A5VA 1HLFA 1G8AA 1WZ2A 3KJNA 1PP8F 2LXNA 3LQ2A 4FNGA 2D3WA 1E3QA 3AT1A 2BM1A 5D6FA 1H6AA 4XTCS 4PLVA 2QUAA 3BN3A 4KFSA 5GAJA 1UZNA 2VHTA 1COZA 1YUMA 2WUEA 4HDAA 3RKRA 1JZSA 1W1WE 4X60A 2DG2A 3PTZA 4RD2A 3NM4A 5L9AA 2FEXA 3DYVA 3BSSA 5TPZD 3ELWA 1DBWA 2HU2A 2OCCH 2GPNA 3EGXB 1QQAA 3IQHX 2GAFA 4MV8A 3J81Z 1GZ5A 4LYYA 3Q6IA 4HDSA 4Y2TA 1MH1A 3UW2A 1QGPA 4IUCS 4DIEA 3ROFA 4RJLA 1G4DA 1KBZA 2NXJA 3MCUA 5D8LB 1QNEA 1ULHA 1LEAA 3JQ8A 4UJ3A 1TA0A 4ARZA 3OSMA 4L4ZA 1G16A 1BS9A 4XAQA 2PKWA 1FSEA 3PRHA 5I7WA 3F4LA 4QECA 1BA2A 2L54A 3RPEA 1M2WA 4YWJA 3QEOA 1T8TA 1ZK2A 4JFAA 1QCDA 3GGPA 3F73A 4JJZA 1NXXA 3CLSD 4YXFA 1H8EA 1GTMA 2BPOA 1UFOA 4CEHB 2HQOA 4HAVA 2YIMA 3P9ZA 2HR3A 5BT8A 2LPMA 4KTTE 1IN8A 3G6EI 4M21A 1PNOA 2R00A 3DE1X 3M82A 1UMBA 1VGQA 3T4PA 3SEZA 4TT3A 1RAAA 4CKYA 4MPDA 5FBQB 1Z6AA 2XWQA 4D4LA 3M1IA 3CG0A 2J30A 4JYPA 1RQLA 4F9EA 3RFUA 1N2SA 6CHYA 4PSCA 1AGRA 3AVOA 2IUYA 3JRCA 3OWXA 1GYRA 4M3FA 4NU0A 4I8DA 2FOIA 5E9AA 1P9NA 1D2RA 1UPBA 3P2YA 4RD0A 4Y6QA 1QE0A 5T67A 3WHLA 4DCCA 3TOSA 1T5HX 3IJEB 2WB1A 3B6CA 3MILA 3OYBA 3DLHA 3LYUA 1K66A 3COZA 2EW8A 1OI4A 1AA6A 2RHWA 1YTUA 2LKDA 3O6VA 1DAPA 1H6CA 4KXLA 1E5XA 3CD6I 2AI2A 1Q77A 2BOVA 1P33A 4M0KA 3IOEA 1SKBA 5HF6A 1B6TA 5DNWA 4AD8A 2QR5A 4M8IA 4BNNA 5LMUB 3B73A 3ET4A 1HKQA 1A2OA 3B51X 1QTNA 3LTEA 5CYOA 4KQMA 1FOYA 4FE7A 4HBLA 2WJVA 3LWDA 3TD2A 1MOSA 1UXIA 2YY5A 2R6ZA 1SUPA 3RRFA 4TMTA 2FK8A 1OFVA 4I55B 3GTQJ 4V39A 3BWVA 2V7TA 3GT4A 3K8YA 2R1TB 1V7ZA 4EHAA 3WR5A 3VZBA 1QHFA 2OYSA 2FA5A 1JDVA 5IAAA 5AXAA 3FLMA 2ZDGA 2JAUA 4DCTA 4A0FA 2PN1A 3QY9A 1E9FA 5KOIA 4P9UA 5DN9A 3UEOA 4P7GA 4TYWA 4Q1FA 2ZM5A 4F4HA 1PZHA 3OZFA 3K0FB 4QGFA 1QYDA 4RHFA 2A1UA 2ZI4A 3HRMA 3OD1A 4XWGA 2OG1A 3ZC3A 1UBFA 2ZRPA 2ATIA 4YJKA 2FXVA 3UV7A 2MGQA 1X70A 4IYRA 3D8HA 2VJYA 4AJJA 4B71A 3R9KA 2BP7A 3ERCA 1MKMA 4YQYA 4JX6A 5JW6A 3F6SA 4GPIB 4MWTA 4BNWA 1KA9H 4W99A 1O3RA 4ZK6A 3ECHA 3MUNA 1KNQA 3L09A 2IGKA 4BMZA 1GVNB 3RSGA 2B1GA 1WEHA 4F85A 1GCOA 1MO3A 1LNZA 4PTZA 4NC6A 3GLHB 3MQ2A 1HW2A 1DWQA 3DM5A 1ID8A 1G6NA 3ZV7A 2EP5A 2NU6A 5KOJB 1I4LD 1W4RA 1NNI1 1Z77A 3G02A 3H83A 4IXDA 4Q24A 3L40A 1E5LA 4O8CA 4LV8B 1USVA 1AHDP 2O3QA 4E7SA 5LHGA 5TPZA 4NENA 4DMGA 3ZCRA 1JZTA 1TZBA 3JYOA 4MQUA 2A3RA 1JKPC 1AB5A 1N5OX 2JIOA 1ERDA 4IJUA 2E5ZA 5DEQA 2I99A 4I9GA 5IULC 4IXMA 3DF9A 1M6YA 4MUEA 5I9MA 1DEAA 2XRZA 1SB9A 4OSOA 4BB9A 2EIKH 1G21A 5DOVA 1BU5A 2BFBB 3CKYA 4ER3A 5ALNA 1O87A 2P2CA 3BWGA 4CODB 3H5AA 2HMYB 3RSMA 5M5WJ 1KAMA 2H2GA 3WGIA 3T0IA 2C1ZA 3HSFA 1DE0A 3N2IA 4YCLA 2ZTMA 3C43A 4EWLA 4AZ0B 4FYMA 1KK2A 1XEXA 2JJ8A 4B3CA 5LKAA 3VR4D 4C04A 5EMNA 2V6CA 3DE5X 4RZ3A 1QO0D 4Y0AA 3D64A 2J87A 4ZEMA 3HP4A 5LQAA 2BJVA 2B36A 1CGPA 2R11A 2VO1A 3TM4A 5JALA 2MSWA 2ZWVA 2ODPA 1ELOA 2HF7A 3IODA 2LIPA 4I9FA 3EFOA 2J07A 5JI2E 5D5XB 4XJXA 1G5QA 1HT1E 3BXZA 1D03A 3O6BB 1T0BA 3UR3C 5GIOE 4EO9A 2F00A 5CFPA 1E6MA 4AN4A 3OBIA 4P32A 2B4AA 2E87A 2HGCA 5LJIA 2E89A 2WM3A 3CX3A 1D8KA 1JHRA 1C30B 2Y8LA 1WMSA 1XLTC 4GBED 4K9RA 1XMAA 1V4BA 2IZ1A 1R8QA 4ZKDA 2C54A 1PUJA 4P33A 3SNHA 1EHCA 3DT6A 4UB6C 3KQYA 4KI0A 2MSNA 5K8LA 3AVYA 2V9CA 3QA3E 1I9CA 1RJ9B 4C9YA 1GYPA 3Q3GE 4ALJA 1XEWX 4DV6B 5IKXA 4S24A 3OHMA 1Y5IA 3CIFA 1Q0ZA 4DNXA 3CINA 1W4ZA 1EYZA 1RLOA 4JCCA 3JWGA 2CUZA 2OV3A 3ABKH 3L41A 3W9YA 1D4FA 4DPLA 4GZLA 2DAPA 4HF2A 2D8MA 2GZDA 3TDUC 4V0KA 1XTQA 3VYVA 1CVLA 3UKJA 3LNCA 3NTUA 4QIHA 2XF6A 1I3NA 3IPRA 3KYBA 2L9SA 2CJWA 2RI1A 4YASA 1UAYA 3WTXC 4KZKA 3ZE7A 4DQ2A 1IZ8A 1MZPA 2I8AA 1XD8A 3H1PA 4I4CA 2HA0A 5FR1A 3I1JA 1RYNA 3PO3J 5IWCA 3EGIA 5EPOA 4PC6A 3OUUA 5FL7D 1FYWA 4PTYA 4NZOA 1LS6A 3G2OA 5KYYB 4BGVA 3ZU4A 4UHFA 1KEEB 2VJMB 2X0FA 3QNMA 2NSHA 3VYSB 5EC8A 1IB0A 5EJFA 2H2WA 1YZFA 5G4LA 3CJTB 5BQPA 2IQIA 3VFDA 3FPSA 3FPFA 4FU0A 3ISPA 4B6GA 4WE3A 1PVOA 2ZB9A 1GDHA 4UTNA 3IT0A 2AMVA 2BR5A 4C89A 2O61A 4DBQA 2I6UA 3C8HA 1V1RA 5JPCA 3T9EA 1RC8A 4KNVA 2HADA 5LQSA 3GUUA 2UVQA 2OORA 2NOLA 3T8YA 4QVGA 1SANA 3ZZUA 2IL1A 5JJLA 4BGUA 1SJ9A 5F7ZA 3G2NA 4IH9A 1Q16A 3HYCA 3CKKA 1AGYA 2W2KA 4NYMR 2QU8A 3R3XA 2R5XA 3FCUB 4K9OA 1CJBA 4B6SA 4DQDA 4OX9Y 2KMUA 1CJCA 5AJTA 1TUBB 3K0AB 3HU2A 2YWBA 1CYDA 5KEIA 4M8SA 1G3WA 2ZJPF 1DUIA 3SP1A 2EZ9A 4ENUA 1AKWA 1H2XA 4DBVO 4DLAA 4H3HB 3Q3EA 1WXDA 1UL1X 4DBLC 1O94C 7ADHA 2XCTB 4X93A 2QJWA 4LAFA 2Z83A 3NEYA 1ODCA 1NM5C 2VKVA 2GXQA 4HWKA 3OQJA 1K6EA 3BORA 2V6JA 5HZHA 1KRWA 2XPVA 3RSZA 2GVZC 3AVQA 4CKBB 3WIUA 4EUEA 4RY9A 3RUEA 1XLVA 3QU5A 3J7AO 2UUCB 2PKQO 3CZ9A 3HDDA 2R0QC 1ZSVA 2EYUA 3P32A 3IB6A 2TMYA 3OEEA 2HQSA 4PJJA 4B3FX 4PRYA 4FTHA 3IA7A 3DV0B 5LQUA 2A5LA 2DPXA 4PG4A 1M2OB 1HFKA 5M29A 2ETHA 3GVAA 2DERA 1AQ6A 2DT8A 3ZQHA 5EIXA 1FYDA 4RDXA 3D0KA 3O74A 3WYCA 3AWIA 3KVNA 1UMKA 3V1MA 3DS8A 4TQ9A 3I3LA 1L7XA 3DMHA 3DDHA 4KXVA 2DTEA 5IARA 3LT0A 4F6RA 3TIVA 3ZY2A 2VUTA 4LZPA 1WKCA 3LBNA 2J5PA 4KODA 1TNTA 4HVLA 1E3DA 4O1IA 3OE4A 4B6JA 2JJ2D 3VR4A 3KVVA 3RKXA 4S0ZA 2AJDA 1QO0A 2G0TA 1LDNA 4JENA 4EGFA 1OXUA 3QYEA 4RK6A 3K7EA 3W2AA 1JG2A 3AW8A 4KBGA 3FUXA 4E31A 5TF4A 3TI7A 4MV0A 1A8IA 5KC8A 2EFPA 4C6SA 5ED4A 1ZH0A 3NBQA 3PT5A 1CRZA 2H7YA 3OOHA 3LVFO 3CVXA 1RM5A 1QG0A 3IQZA 2A0FA 2VKHA 1ITYA 4UZEA 1G7CA 1CHDA 2FXAA 3L1VA 1Y8RA 1L4MA 2XV4S 4GQAA 3DLIA 2DMRA 4Z99A 3UH1A 2ZATA 4EW1A 4DJJA 1DPRA 3HWX1 2JH8A 1UCFA 4U5QA 1JEAA 1ULTA 3RUFA 4W5OA 4Z4CA 1E6CA 3M6XA 3ZQCA 4M2LA 5B66C 5D6NA 2NNYA 2C5HA 1ZN2A 4ZP1A 5EE1A 2CLFB 1Z2NX 1EM8A 2Z8YM 1VLVA 3ZG6A 2JBAB 5ECGC 2ZWAA 2PQ0A 1WXQA 4R4JA 1WL8A 1P17A 3QYJA 3N2KA 5E3JA 4JY7A 5B4VA 3RVOA 3D6VA 2V0GA 2WU3A 2OXEA 4LHYA 2Y1LA 4PIPA 3S1NJ 2F4OB 4MINA 5KBYA 2R44A 2EX1A 4Z1OA 2JPIA 4YHBA 4LX0A 3NHRA 3SIWA 3SZTA 5C7OO 4ZQCB 5TQ0B 4HTFB 3PWKA 3I54A 3KZMA 3BCAA 2F6CA 4KR3A 1I80A 4K8RB 1IDN1 1LQUA 4U2FA 3QP9A 2XF2A 2N46A 4A1FA 4L2IA 3QX8A 1PR0A 3ZQ7A 5A7HA 3IALA 1Y8QB 3QWLA 4M71A 4EGAA 1E1CB 3W6UA 1H22A 1CY6A 1BH2A 3D3JA 3FPLA 3GHHA 1JHQA 1HQKA 4KV7A 4HPXB 5HLGA 3FOZA 1VPWA 4YAEA 3NHMA 3KV1A 3NAMA 4PZPA 2ZJ2A 1U28A 3K9BA 2JI9A 3C5CA 3OPQA 2AXLA 1OZ0A 4UDXX 1MA0A 5FUVA 2PWAA 2VIXA 5E8IA 1A8QA 4KSCA 5EZYF 5FFXA 2K5CA 4V0SA 1KYVA 2BY2A 4FTWA 4U2BA 2R7QA 4DIUA 4F6CA 2EATA 3VOTA 3UY4A 4W5WA 4D8UA 4DRXB 3LAPA 5K5EA 1GGEA 1MKYA 1EFPB 1G98A 3NRVA 3BPXA 3KSUA 4O4IB 2OZLB 4D3FA 4KPUA 3ZE1B 3PQCA 5JVTA 1AOYA 1Q0PA 1U8CB 2NS8A 3GJ0A 4B4WA 1JIVA 4ESHA 3HUFA 3BWBA 3PTLA 1S7GA 4O5OA 1W5SA 1XEFA 3T7RA 1JSRA 5DLEA 4ZVUA 4K87A 1GUBA 2VSXA 5K0NA 5EAIA 4ATNA 4L78A 2X9LA 1C1DA 2Q0QA 2XAUA 2E18A 4EJZA 4ESEA 3F10A 4MQEA 3ETLA 3KR2A 2WW8A 2PBZA 1Z0XA 1TLLA 3KHKA 1I6HJ 3TINA 1IZ9A 3GUHA 1HT0A 1OCEA 2IA2A 2HOQA 2HHJA 2DBZA 2EP7A 3IPYA 4UBOA 4CW7A 1HTBA 1AO0A 2OV1A 4INZA 2OAGA 3U56A 4F86A 2HOAA 4FP9A 2FQQA 1RJEA 3OVMA 1QB7A 4WK4B 3W3ZB 1JG1A 4ABTA 2FETA 4KN8A 3G0CA 1XGSA 3Q85A 1Z8NA 1A5JA 5BQ5A 2GBIA 2IZ5A 3KHTA 3AK4A 2Z2SB 2V7QD 1HYQA 5FGMA 3HKZN 3T7TA 1FTQA 5BUZA 4UXNA 1N6RA 1TMKA 3I2FA 2ZB2A 2BMFA 1Y8ZA 4P34A 5FKMA 4NFYA 5JC1A 1SIWA 1Z2EA 5CT6A 2A9JA 3KAPA 3WLKX 3RVKA 4GR4A 5AD1A 1Z6RA 2JA5J 1JL3A 3OIQA 4IHVA 2QMUA 4D26A 1X7XB 2Z2ZA 3ONNA 1FS5A 3UIEA 4ZU6X 3UJNA 2JJ2A 5DNVA 1X9IA 3NRBA 1W1UA 1NN5A 3UOWA 2QLVA 4H1HA 2XR1A 2ZIWB 1U3WA 2NPOA 4C9BA 4RETA 1ESMA 4RB1A 3DEHA 1QWSA 3WNQA 4WRRA 1GAXA 3K9FC 4ZAGA 4K1XA 3B70A 3F2VA 2IHVA 4FHCA 4EKIA 2ZS8A 4E2ZA 1JLMA 4IDBA 4UPDA 2L3DA 3CZMA 3R0QA 5EY5B 1ZD3A 4EFKA 3BP8A 1H8HD 3WBFA 3EUWA 2NO7A 3BL5A 4M1YA 4JOSA 1R9NA 1KFQA 3U3OA 1U7WA 5ERXA 1V7QA 3ABOB 1XRNA 4NESA 2X23A 1P5ZB 3UOAB 2DCUA 2DLDA 4W9MC 4IG4A 4ZI3A 1FIAA 4M1SA 3QFTA 5CFRA 1L4GA 3F4KA 3KD2A 2MH9A 3AMVA 2C5BA 2C7OA 3QQAA 4BACA 3ZWXA 3CNHA 3WIDA 1VE1A 3DMDA 5AN4A 1SEUA 2KBFA 1W5TA 1SZJG 2X9GA 3TSCA 3VKFA 2COMA 3E5NA 2KYRA 4X1YB 5CQGA 4EG4A 4KFCA 3OPYB 1S9HA 4BP3A 3AILA 2OBNA 2VDVE 3LQKA 2HTSA 4H7HA 1LFDB 4MVCA 2XKOA 5A2QA 2O1SA 4Y2VA 1FMCA 5KJFA 2IP2A 2G9WA 1TECE 2WB4A 1HX7A 3RYFA 3ZCQA 5ALKA 5FTNA 4CDNA 5MFPA 3BGOS 4I3FA 3HKBB 2W2VA 2WTXA 3BD6A 4WFJA 5L6MB 5ALSA 2BE5F 1CY2A 3M9WA 3TEJA 3PNKA 3KQLA 2FUG6 2DK5A 3SE7A 1O3TA 2W6MA 4Y17A 1U1EA 4WA8A 3HEMA 1U7HA 3O0TA 4LA4A 1F2TB 4E88A 5AVOA 3EXHA 4DULA 3FXRA 1C1HA 1NW6A 2EOAA 3ZQ6A 4AS3A 1LBHA 4D3YA 1E2UA 3OYNA 3GZJA 4ROTA 4RF3A 2PL1A 4EX7A 4XB2A 4MITA 5JQGB 5FTJA 2NPIA 4U6QA 3GZ5A 2DBYA 4R9VA 3ASNH 2A4KA 4Z5XA 4KN7X 1FUEA 1M1YB 2ATXA 4PV7A 4YAFA 4GXQA 3EIFA 4HLUA 4OQLA 1RJDA 2K3FA 1P5DX 2GLUA 1G3SA 3G2PA 2QAGA 5EEHA 3BZBA 3QLEA 4EALA 4JLKA 1CZUA 1I7SB 4OHPA 3VPGA 2GKGA 4AKIA 4J4BA 1ZQ3P 4EAAA 4IJQA 4J7AA 1M5Q1 2HOSA 1U2DC 2O8DB 2VATA 2W6QA 1DV1A 3K9TA 3RTGA 1WB4A 4HLYA 3CQZJ 1MZBA 1YK1A 1KOLA 4MVYA 3E84A 3VEPA 1FSHA 5AIPA 2OFWA 1US8B 3QVVA 3GTPJ 2CJJA 2XA2A 3BIOA 2JJMA 2J7KA 4BO1A 2JGAA 1C9EA 1MO4A 2YMLA 3F0ZA 2QTFA 3CZRA 3DOEA 1RLJA 1YA4A 3D6AA 4TSRA 5IXJA 5DHPA 2D1RA 4XLHA 3PXDA 4BDSA 2Q2WA 4PLYA 3R6TA 4N5HX 3Q8WA 4NCXA 2WD7A 1SD7A 4E2YA 4BC0A 3CLRD 5JN5A 3K0HA 4WCGA 4MLDA 2NQ2C 1XQ1A 1JMVA 1D5WA 4LQ4A 1CUIA 2AUTA 1KEUA 1T91A 1WXXA 2IYRA 1E63A 1IOVA 1YDHA 5E0KB 4CTMA 4DF3A 5KYXA 3NBMA 1RZVA 1DI0A 4CLDA 3GX1A 5FBHA 5JWRA 3VR5D 1U3GA 4RD6A 2IT0A 2E7XA 2CUFA 1Z9CA 1Y1TA 3L9XA 2HNAA 2PMWB 1R6UA 4GOXA 4MQ5A 5KSWB 4OAYA 4OJKA 4NCKA 1MNMC 3BGDA 2XSZD 1D6MA 2C29D 2VK4A 3EASA 2QR2A 2UXDB 3RYIB 3T5XA 2V7QA 3HKZA 3S81A 2P2DA 3K1AA 4IDPA 4XKJA 3D5RC 1DX9A 3UXHA 1EJ9A 1FYLA 1YK0A 4L8GA 3L2QA 2YJTD 3CLHA 4E7KA 4IRIA 2ZWMA 2I4MA 2B37A 5AKJA 2IPOA 5KIAA 3DFMA 2OYRA 2FGJA 4E2WA 5H68A 4F93B 2IOYA 3P2KA 1IZYA 1Z18A 2LY2A 1NVPA 5BRJA 2Z2XA 4CYCB 2J9GA 5HUJA 3FVTA 3USCS 4IQJA 1AKHA 1Z0DA 1Z2DA 2ZSAA 3W2WA 2ZJZA 1QIJA 3INGA 1WSWA 2PHZA 5F1KA 3CE6A 4TQGA 5F23A 3ZQFA 2WYOA 2WV9A 3M5DA 3QPHA 3SFVA 2VAVA 3LBYA 4HGYA 3ZD9A 5C8XA 3CW2A 3SJAA 4GOMD 5FROA 3DMRA 4PSWA 5LXTF 3ZHCA 4MZDA 5ILUA 2R7ZJ 2XCSB 4UVGA 1FMTA 1Z0ZA 1H8HA 1YTYA 2PWZA 5AW2A 1Q17A 3WG9A 4E3WA 2E4XA 3WLRA 1CEYA 4A3KJ 1RYBA 3K4MA 5DDGA 1FBNA 1GVJA 3W2IA 1YE9A 3GPIA 3A9RA 3DMNA 5HLHA 3OH8A 1RRJA 1JHDA 3RVBA 3IR7A 2HK6A 3ZLVA 2YNMA 1YVDA 1YZTA 4L0DA 4MW5A 1JILA 5CITA 4QFBA 4MW9A 2AXPA 1B3RA 5CIWA 2NO0A 2QLLA 5TIIA 3CF2A 2A9OA 3ND5A 3M4ZA 2JHFA 4MHTA 4E5UA 3FMPB 1GL9B 4GC9A 1C4XA 4KLNA 4ZVPA 4LWOA 3ZCVA 1JTVA 5K6TA 3V7FA 2LCQA 3ILVA 1CUJA 3CNBA 4XOUA 3KYIB 5AYVA 3SVLA 5K5RA 4XPZA 4E07A 4TTTS 4B79A 3L7WA 4AO6A 1JKQC 5COAA 3RD5A 1OISA 3FXJA 2WHXA 1ORDA 1DP7P 4M7RA 4NJEB 4YV7A 2JK0A 3ZQKA 1XGKA 3VO1A 4OXIA 1P5JA 1IEXA 4QGBA 4ENPA 3O21A 3TRHA 1R6TA 1TK2A 3V1UA 1D7OA 1Z3XA 1EFHA 4DVJA 3AO0B 3P7MA 1QHHB 5IKOA 1WU8A 2ZB7A 1NP3A 1X7YA 1YSCA 2ODAA 2QZ4A 2OQRA 2Z3ZA 3H9UA 4JEUA 1RQXA 3VOBA 2Z9OA 4YO7A 3K71B 1ONVA 4QTYA 3H6KA 5IVDA 3JYHA 1PHRA 2ZXHA 2MSYA 2PGOA 1Z4KA 1J6UA 4M86A 2CW0F 3R5JA 2AOTA 3L1KA 2F48A 5F64A 4YMWA 8ADHA 5LXTA 4B7AA 2Z04A 4E6EA 1VJ0A 1DHRA 1N32B 3FWKA 1KETA 5CA1B 2QLJA 1Z39A 4I99C 4Q7KA 2JA1A 4D9CA 1F36A 1OREA 3CVSA 3IQDB 2E1MC 3A4VA 3H9EO 2XADA 2GYUA 4ZVQA 3Q10A 4DLRA 5HFJA 3RF7A 1K4SA 2PX9A 3AEQA 2XAGA 1K3TA 1TYBE 4LK2A 1DC4A 1T9HA 4AYXA 5F98A 1PW7A 1EGHA 2WD9A 4Q4AA 2IKQA 1S2DA 5FV4A 4B35A 1DU0A 2PZLA 3VHRA 4QUDA 3B3FA 1E6KA 3OR1C 2PUJA 1ZM9A 5AOVA 4AURA 1A8HA 3CCCA 1NJGA 2MINB 1LLQA 4RZIA 2E85A 3FROA 4XLNF 2DKDA 3EWNA 3MUFA 3IUPA 3ABLH 4X3PA 4FZ5A 1JI8A 5BMOA 5FD5A 2FPXA 3LBIA 4S3MA 3OO0A 4BCBA 4HDNA 3TNLA 4I1SA 1QRUA 2FG6C 1L4NA 3C8DA 4EHBA 1EI9A 1UT7A 1U3FA 1ZRNA 4B5LA 2R1UA 1W59A 4IP0A 1D0YA 1YQWA 2B94A 4FN5A 1ETWA 3QV2A 3DBHB 4A6DA 1AQUA 3BHJA 2P6OA 4ZYAA 4IPTA 4UD6A 3ZLUA 4WZAE 3JTEA 1T8IA 5IJ9A 2D2VA 3EC1A 4UFNA 2LFBA 1HA8A 1MN6A 1GPUA 3AUKA 1P5RA 1XKXA 1UJBA 2HA5A 5J47A 1PR3A 4G7OF 1U0BB 3T34A 4ZTBA 5KTOA 3T7JA 1JGTA 1UELB 1R0SA 3BTCA 1RRKA 2H1CA 4JLUA 2CLCX 4EQZA 4FMBB 4PM4A 1IK6A 1WBBA 4RZXA 1XVAA 3F7TA 2CY0A 1BC5A 3L1UA 1MR3F 2FN7A 2ZNYA 8LDHA 4S0XA 1MEJA 3MWMA 1ZN7A 4MDYA 2PUAA 3NIWA 2OTCA 1O4XA 5JV5A 1EIZA 4PAWA 3ACCA 5AJXA 5KC9A 4PO9A 4ZAXA 4UOEA 2J31A 3BZKA 3AM4A 4BDZA 3TVTA 2HNHA 1MD0A 2YWJA 3WHPA 1SH7A 3USES 5B7GA 2Y0SN 5DT9A 5EQFA 1FJXA 3L7IA 2LBPA 4NG5A 2PJZA 3F72A 2JVIA 4YNBA 4EGZA 4QWMA 4QLAA 4MQFA 4KPYA 1YNOA 3LH5A 3R5SA 4S1OA 4NE2A 5JMTA 4JUIA 4IJWA 3JCZA 3H16A 3HJUA 3PKZA 1QGAA 3MMPA 1ZRMA 4BV3A 3FPHA 4D0SA 1D4AA 4BIMA 1C7QA 3M2PA 2H31A 1F2DA 4UXJA 2BSQA 2ZRQA 3RJ9A 2Z8YA 2ZBQA 1MSFC 4LBYA 2NXWA 1L0BA 1P7PA 2Q1YA 2HVRA 1XR3A 2JATA 3PXAA 4X97A 1YZLA 4OU5A 2Z8UA 4I0WB 2XMCA 2ZIXB 4QYWA 3EG9B 4AJ1A 1V11A 3QKUA 3K1PA 3G9QA 1G291 4RZSA 4DCJA 5C37A 1NRXA 4QGAA 4ZV7A 4QKQA 2K9QA 4NFLA 3V33A 3FVVA 2I4LA 3CCJI 1LBTA 4C29A 4AX4A 4LK3A 3DTYA 4J0CA 1GLGA 2OBBA 3KUXA 4EYQA 1KJZA 3HTUA 1N34B 1XQYA 3MFKA 2TMKA 3WK8A 4U6SA 2LYCA 3RVSA 3BA1A 4X95A 2DOFA 4RKRA 1LRKA 4G94A 1PBTA 5EXSA 1FVOA 3QEKA 1AZTA 1Z3IX 5DMHA 4QPCA 1KI6A 4D8VA 2NPFA 2PCJA 3VPDA 1JAYA 5BXQC 1QS0A 5ALDA 3DAHA 2FMXA 1XP5A 4ZAYA 4D9MA 3ISTA 3GYGA 1DL5A 3TJZA 4G5OA 2XPUA 3LT2A 4WDRA 2Q2VA 3W9BA 1RBMA 4J43A 2M9HA 4ZYLA 5F2OA 4NRDA 4MI1A 1X6VA 3C5VA 3IQXA 1SVLA 4D8YA 2G67A 4ZCPA 2WSBA 4GOJA 2P81A 4JYBA 4ZCIA 2Y0PA 4EPWA 2H1OA 4MV4A 4ZVNA 4RJ2A 2C7PA 4CV0A 1V48A 1NH3A 3KG2A 2J6HA 5F5XA 2XKBA 3WRYC 1R74A 1TYZA 2OO7A 3U60B 4G6QA 2K4JA 1DOAA 3NWOA 3X1KA 5LVAA 1LJUA 4IH4A 2CNWA 3K4NA 1F06A 2AMJA 3ZWNA 3DNPA 2PIAA 4MYSA 5FWNA 4RJIA 4TT3D 4DR2B 4HX4A 2PMKA 2V97A 2BHSA 3THXB 2PI0A 1YQEA 1N5LA 1X7WB 1D1QA 4PSDA 2FSGA 1MBHA 4H1WA 3W5CA 2DFEA 5JOQA 4URWR 2FSVC 3IEPA 3TKLA 4PQRA 1PK9A 1B3BA 3FTNA 3UMGA 3TCXB 1QIDA 1VFCA 1CIVA 3K92A 4KGXA 4E15A 3IUQA 4EPYA 2DFPA 3PR1A 3SZRA 1ZL0A 3C5HA 1M66A 1THGA 1G6HA 3SEFA 4U3JB 3TVDA 4YCSA 4W7IA 2H18A 2EFGA 3DPIA 2YPRA 1KU7A 4ENNA 4FE4A 3NUGA 4BBRJ 3K30A 2Z1NA 2JHAA 2F1JA 4R5MA 2OJED 4KQIA 2OHFA 2B4YA 3RT1A 3RIYA 5CJ2A 3H9QA 2AI1A 4OMUA 5AK6A 3WRWA 1VTNC 2WKRA 4Q4JB 5DGIA 3BBLA 4UU1A 2L02A 4PXYA 3TO5A 3UJ8A 4IPAA 2I7TA 4E5SA 1GLNA 4DRYA 4AL4A 3WYAA 1CS0A 3D6FA 3QHPA