3DPUA

Roccor domain tandem of rab family protein (roco)
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
519
structure length
485
Chain Sequence
PEIVKQGKEAVRQYFQSIEEARSKGEALVHLQEIKVHLIGDGMAGKTSLLKQLIGGLNVVTKQAPNIKGLENDDELKECLFHFWDFGGQEIMHASHQFFMTRSSVYMLLLDSRTDSNKHYWLRHIEKYGGKSPVIVVMNKIDENPSYNIEQKKINERFPAIENRFHRISCVESIAKSLKSAVLHPDSIYGTPLAPSWIKVKEKLVEATTAQRYLNRTEVEKICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLNTSALGYILNEEKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLDVKEFIPLPGHPDELVEYKELLGLEKMGRDRYVSGKLEKVFSVSKMLDSVIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Roc-COR domain tandem of C. tepidum, a prokaryotic homologue of the human LRRK2 Parkinson kinase
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Signaling protein
molecule keywords Rab family protein
total genus 150
structure length 485
sequence length 519
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
A PF16095 COR C-terminal of Roc, COR, domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2190 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dpuA01
1.10.10.2200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dpuA03
3.30.310.200 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3dpuA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dpuA02
4M1MA 3I73A 4FMBB 5JI3E 4TMKA 2BDTA 5HCIA 1KSJA 2VF8A 4TTQA 3SZRA 3TLXA 1G6OA 2QENA 4Q1DA 1J7KA 1KSHA 2BBWA 4BLPA 1E1RA 1Q1ZA 4MRNA 1HYQA 1OFTA 3KKNA 4CVNA 4NH0A 4EDHA 3A4MA 1BOFA 1XU4A 1ZYUA 2PT5A 1R5OA 3GQBA 2ODNA 2J5XA 2WOOA 5BN3A 4FMCF 2D62A 2ZYTX 1HEIA 2QTFA 3E2IA 3TBKA 4A2QA 4DLSA 4MGYR 4RJLA 3IEVA 5EXSA 2GJSA 3TVTA 4C0JA 1R5NA 3GFOA 1W36B 4RD4A 2H57A 3GLIA 1G17A 2IEZA 1K5GA 5FI1B 2BMEA 5FPKA 1KSGA 821PA 1IOZA 2ZJ5A 5CIWA 1EFUA 3RSOA 2JLQA 2WMNB 4BLSA 3CF0A 2RGBA 2A5FA 2REXB 3SOPA 1U0HC 3MCAA 4DLYA 4QL3A 2XOKA 4DHEA 1OXUA 3AH8A 4JL6A 4Q7KA 1AKEA 3AKCA 2QN6A 4ZPXA 4JIMA 2JJ1D 2QBYB 5IRCD 1NP6A 1ZU5A 2QT0A 5IF9A 3FDIA 2DHRA 3KJGA 3MG9A 2EFGA 2P67A 4OJQA 1QDEA 2QSZA 3W8RA 2R8RA 4LGMA 4G5GA 3T1VA 3U7GA 1Q57A 1SQ5A 1GWNA 4OK5A 4AD8A 4QM6A 3RVBA 2X1VA 4Q1FA 2RHMA 1DTSA 1Q1QA 4JVLA 2J9RA 5E7JA 1N2CE 3RRYA 3NEJA 1KTVA 1T9HA 1WQ1R 1YQTA 3PVSA 3PV0A 4F91B 4X8HA 2BMFA 2OAP1 4TYQA 4F93B 3BS4A 1LF0A 2FEMA 2FA9A 3JZAA 4Q1BA 5CYOA 5KDLA 5DHAA 1JPNA 2QGNA 1KJWA 1NKTA 1W4CA 3QBTA 5J47A 5KNBA 1E6CA 1X1RA 3F0TA 2NTYC 4I1VA 4B3GA 2C78A 3VFDA 1MO6A 4KODA 1XPRA 3SNHA 1CJKC 1G5PA 3AUYA 4BLQA 2XXAA 2B8TA 1ZNYA 4A0RA 4AKHA 3GLFA 4BEBA 3AV0B 5D3QA 2WWHA 3IKJA 1XB2A 2A5DA 4AI6A 3KZ1E 2H92A 2Z5FA 2P5TB 3OIVA 1FNNA 1T6NA 4HLQB 3WMFA 3F8TA 3QBVA 4Q7JB 4Z1MD 3SJAA 3VR2A 3G0HA 1H8HA 2LKDA 2I1QA 3MWYW 1U8YA 1QHHA 1W5SA 4PO1A 2YWGA 4Q66C 2IYQA 1HQYE 1W44A 1O3YA 1RIFA 3FTQA 3OIUA 1K8RA 2DWQA 4TQAA 5GJWC 1Z6GA 1T4GA 1W4AA 3JVUA 3BB4A 1PUJA 1SXJA 1Z06A 4F4IA 1DOAA 2GXUA 1I2DA 1WMSA 3HPQA 1YRAA 4MGZR 4A0GA 4B2PA 2VO1A 1G5RA 3F5FA 2ZYWX 5JS8A 4AKGA 3UK6A 4ZIRB 3LDAA 1ZD9A 2R62A 3CKLA 3EWAA 4V0KA 4A4DA 4NZYA 2ZANA 1GKIA 4U02A 3TR0A 121PA 3WBJA 3LBNA 4HDOB 4NONA 4YMSA 1R2QA 2XZPA 4HUTA 3KUCA 4RZUA 2J0QA 2XJ4A 1N5IA 4A36A 1KJYA 4CIDA 5KPJA 1VYVA 3PENA 3WYGA 5DHFA 1IY1A 1FP7A 1CR4A 2JLXA 1N0VC 1U99A 3TRFA 1W2HA 1RJ9A 2ODWA 3RANA 4C9BA 3HR8A 4ESVA 3ZVNA 4PAMA 4URWR 2JJ2A 2V4ZA 3CIOA 4QKQA 4NYMQ 3I8XA 2G0NA 3FKSD 4B3BA 4KFSA 1EK0A 3A8TA 5J40A 1X3SA 3HU2A 1R8QA 4CEJA 4URYR 2XNSA 3Q9LA 2BM1A 4TMVA 4BRUA 1NN0A 4MKGA 2WSSA 3ZJYA 1MV5A 3VHLB 3HWSA 3SEAA 4GT1A 1OKKD 5FOSA 3BJIC 3RS0A 1G3UA 1G4UR 2QP4A 1WCV1 1Q12A 4LV8B 5G53C 1XZPA 521PA 3SU8A 3T15A 4AWXA 4EQ6B 3K8YA 2Q9BA 2X2EA 2QSYA 2AR7A 3K70C 1W49A 3TR5A 4LJ5A 4ACBA 2BKUA 1VCOA 5F9HA 3RS5A 3L0IB 2J0VA 2HXSA 5KDDA 2PEZA 2RGXA 2GCPA 3R9IA 4IVRA 1OT3A 4MUAA 1AJEA 5FPYA 4MYCA 1N0WA 2WICA 1R5BA 3VMFA 2D74A 4RD6A 3ZVMA 2GCOB 1H8EA 1XRJA 1CJVC 1ZIPA 3DKPA 1N5JA 4HDQB 5EP1A 3D7MA 3GLHE 2O5VA 3KQUA 2HCJB 4LBWA 4QJ4A 1OXXK 3AKYA 1QHNA 3CB4A 5EXTA 4Q1AA 2WJHA 4R2HA 3NG1A 1RRCA 2GAOA 1IY2A 3K0EA 3MRSA 5CK5A 5DGXA 4A0HA 5B30A 3NIBA 4PX9A 5FPHA 1VG8A 3SDZA 4YC7A 3RSLA 2PEYA 5J4HA 4JL8A 3SYLA 3A1WA 1GUAA 1G9XA 2IXGA 1G5TA 2WKRA 1E32A 4B47A 3HDTA 4B3XA 3P32A 5BWMA 1AGRA 5CLQA 1COWD 4EFMA 1NY6A 1E9SA 2NZJA 2ZRDA 4ZO4A 5C4GB 2D06A 2MSCB 2Z4SA 2OM2A 3WMGA 3WXMA 3ICEA 2V6IA 1FMLA 1N6IA 1T8TA 1FUKA 2H8KA 1UBEA 2IYWA 4WA7A 4I99A 2IC5A 2ZXUA 1IY0A 2ZUDA 3EZ9A 5IK2D 2ZRIA 3AUXA 2BCJQ 4DSUA 1G3MA 3GJ3A 3GD7A 1R0ZA 2QPAA 3EX7C 3U4QB 5G3ZA 2ZQ5A 1QHIA 5J5CA 3B13B 3CM0A 3LV8A 3QG1A 4B3DA 3OIWA 2IYVA 4YMUA 2ATXA 3U7FB 4AK9A 4Z51A 2A7QA 4NU0A 3PXGA 1GM5A 2JASA 1CS4C 1P5ZB 3LVQE 2A9KA 2PMKA 1JAIA 1P72A 1V43A 1ZM7A 4QJ5A 1SVWA 1W0JA 3HJNA 4EJSA 4PZYA 2AK3A 4UXIA 3KQNA 1NMXA 1SZPA 5HCNA 1RW4A 5CB6A 3O8CA 3GLGE 1FNMA 1XTQA 4XOIA 4DDUA 2JLWA 4W5WA 2WM9B 1Z0AA 4DDVA 4OI0A 5JS7A 3UMFA 1KI6B 5JWHA 3THYA 4JSYA 5JFGA 2W6JD 3DKVA 5J4LA 2H5EA 3GLHB 2P65A 1XTRA 1W1WA 4BLTA 1R7RA 4PFSA 3PEVA 4BZQA 4EFNA 5FL3A 3IBYA 1G19A 2ORWA 3IILA 4CF7A 1Z08A 4KFRA 3FMPB 5FOVA 4U5XA 3WNCA 4RD3A 4Y0VA 4U00A 2ZR0A 4EJSB 3D3QA 1PVOA 2QI9C 4TT3D 3KKQA 2CEAA 4Q4LA 1IAQA 1Q20A 2VQSA 1S3GA 1LB1B 2BBSA 4B73A 3KKOA 4F4JA 1NKSA 4LBYA 2JIZD 4C0QC 3AP2A 2FFAA 1KI4A 4XWOA 4EIWA 4B74A 2JLZA 1GIAA 2GF0A 4ZCLA 2XTMA 3BOSA 5E95A 3HYRA 1WBBA 3FMOB 4Q1EA 2GCNA 4DJTA 4QRHA 1P9RA 1TMKA 1IN8A 3R7WB 1TUIA 2BCGY 1SVSA 1CXZA 4A2PA 3PUZA 2CE2X 4A0FA 1YR8A 1BMFA 1LF5A 4NYMR 4DLTA 4KXFB 1T8UA 2WMOB 2Z83A 2R6CA 3IGFA 2JA1A 1ZNWA 2EQBA 4OI1A 5DNYB 2J7PD 4B6FA 1RVDA 1TU3A 5KU1A 5JBQA 4PTLA 3AF4A 2QY9A 3NBZC 4FMCB 3PR1A 4PQYA 4HATA 5IDVA 1E2IA 1X6VA 1CJTC 1FUUA 2C95A 3NKVA 2BHRA 4HB4A 4HZIA 4KJZA 5HPYB 5CLLA 1W36C 5CM9C 1GKYA 1VIAA 2QQ0A 2ZRNA 5HKKA 3I5YA 2QUZA 4YXWA 2DWPA 3CRW1 4BFSA 5CB8A 2QMEA 4PHTA 4QM7A 4M2LA 1ZUIA 3FMFA 4IDQA 2CCKA 1BKDR 3CH4B 3CPJB 4AG6A 3ZD7A 4GNKA 4YLGA 1NLFA 2CLDX 2QAJA 1SHKA 3PITA 4WAUA 3LXXA 4HLUA 4Q18A 1MRNA 4D0NA 1S4QA 1X8JA 1JEEA 4NYIR 3UWKA 1E2EA 2VHTA 4HB2A 4MRRA 3BAFA 1P3JA 3G5UA 4EPYA 4E09A 1G3RA 1C4OA 5KPDA 1E69A 4ZIRA 3EIQA 1K6MA 5KYKA 4EUNA 1E9DA 4WXPA 1MR3F 5A0FA 2MSEB 2NO1A 4ABYA 2DBYA 1N3BA 4HEJA 3NXSA 4RSGA 4DCNA 1E2MA 3T06B 4P4TA 2D4HA 2CXXA 5L3RA 1WE2A 1Z6AA 2YZ2A 2ZRBA 3IO3A 3KB1A 3EASA 2J41A 5FUWA 4CGZA 2IK8A 2IF0A 3DM9B 1BYIA 3AEZA 4M8NE 2VF7A 4TSFA 2FZLA 5C4MA 4BFZA 2XXAB 1ZRHA 2EWVA 3KXLA 4ITRC 4IDNA 4N0EA 2ZSAA 1N6LA 2H18A 2WTUA 3U3RA 1KZGB 2GXSA 1J2JA 1TPZA 4I1UA 1C1YA 3FYHA 3ADKA 2I1VB 1KK2A 1E4VA 3QEJA 3LW7A 2VP2A 4BFUA 2RGNA 2Q9AA 4K46A 3AF2A 4DLZA 1KI7A 4WZ6A 2EFCB 1CRPA 1MKYA 1MO5A 4PSKA 1FOEB 1YZNA 2G77B 2RGAA 2XTZA 4B44A 2P6UA 4JBXA 2UKDA 1HE8B 1MO3A 4BZPA 4U7DA 3GJ6A 2H17A 1G7CA 3R8CA 4DIDA 1CR0A 1G8FA 3RYTC 3CRQA 1RRFA 4DSOA 1JR3D 1UKYA 4RVCA 1TQDA 1NG9A 3PUYA 3THXA 1N25A 4TL6A 2MSDB 4GP6A 3AF1A 3FVQA 4PC2A 1ZC4A 2G3YA 1G8YA 4NPHA 4D0GA 1VG1A 3X1YA 3I5XA 1E0KA 2ZS8A 3W3AA 1ESMA 3WNBA 4QJ3A 3ADDA 3KL4A 1NVVQ 1UFQA 4PSAA 4O25A 2GEDA 2ZRKA 5HZHA 2ZSEA 4PZLA 3SHWA 4QC2A 1XD2B 3CRMA 3SI7A 3Q8XB 2IHBA 1KMHA 3T1OA 1P61B 5A4JA 3CX8A 1OSNA 2D2FA 2FDCA 4RZXA 1AS0A 1Z22A 2PZEA 2H7VA 2HLDD 4XD7D 4EQ6A 1QG2A 2QROA 3JZMA 1X8KA 5DI3A 5IHPA 4MDEA 1W4BA 5EP4A 1DAFA 3P1JA 5DSZA 4LJ8A 4B35A 1ZM4A 3DZ8A 2QM8A 1NIJA 1MOZA 3QXJA 1IXZA 1RYFA 4LPKA 1I2MA 2PL3A 4G5RA 4BEJA 5FI0B 3SFVA 4N3NA 3BB1A 4P33A 5E7MA 3U4QA 1XXHB 1CR2A 3SFZA 1U2RA 4RZ2A 1DADA 4OL0A 5EE0A 3T5GA 5DO9A 2QT1A 5GJCA 3FPAA 2P0EA 3ASYA 2FH5B 3ND8A 2CJWA 3IPXA 1Z6TA 2OBMA 2XX3A 1KYIA 4JVMA 4TMZA 4TZ6A 1NL3A 1SXJD 3P26A 4RFVA 5DI3B 1UKEA 1JR3A 3AB3A 1UAAA 1KI8A 1RFLA 1OIXA 4DLXA 2JATA 3PG5A 1SVLA 1XJCA 1YZGA 4B48A 1KI6A 3THYB 4ZDKA 3NWJA 5FOTA 4DDTA 1XTJA 4Q5IA 2DCUA 3P27A 4GL2A 3M6AA 3GJ4A 1SVMA 2A5JA 3NTUA 3QF4B 2VP9A 2QEQA 3T61A 1F2UB 5CITA 4DSTA 1Q3TA 2EFEB 4US0R 4LYHA 4AG5A 3QKRB 2RCNA 4IFBA 4KSBA 3EPJA 2F9MA 5JLJA 2HDNB 5L3SA 3A1UA 1YZKA 3QG5A 4MQBA 2IXFA 3WYFA 2FE4A 4TMWA 1VMAA 3X1DA 1DG3A 721PA 2ZE6A 1NNEA 3BXZA 5FOUA 4MGIR 3ONWA 3QVVA 4JLPA 4PO9A 3BH0A 3W3ZB 4LBZA 1Q3HA 4OK6A 4CT5A 4D4JA 3IO5A 3KUDA 1O87A 2F9LA 3KKPA 4TTPA 1D9ZA 3OFNA 4FW9A 1HURA 2WPDA 4QG7A 4KLZA 4O2LA 3C4JA 4DBLC 1DAGA 2F3RA 2XNDD 1F2UA 1P75A 3KXIA 4DRZA 4UNQA 2NG1A 4DUGD 3LX5A 3MUFA 5GVSA 4WOPA 3CBQA 1VYTA 5L3SB 1NLYA 1W4RA 3MJHA 3LW8A 3L82B 1HQCA 1KMQA 3SBEA 2EWWA 4V03A 1PLJA 2R2AA 4QHYA 4RCYA 3UPUA 1UJ2A 3DZDA 2IEYA 4QBIA 5FUVA 2YV5A 2QMOA 2DPXA 4M1OA 3KQKA 1P2VA 3HPRA 2ZVPX 2CL6X 1CRQA 2GVZC 5KNCA 3NVAA 4V0MA 1EFRA 1E9RA 1OV4A 1NVWQ 2DWOA 3KTAB 1KO1A 4XVRA 1E2NA 3VHXA 4LCBA 3ZZ0A 1NVXQ 1HT2E 4OQNA 5C1BA 4A6XA 1XEWY 4P0TA 1ZCBA 1EWRA 4KV9A 1TEXA 3T1TA 1N6OA 3GJ0A 4YXWD 3CWZA 1KJZA 1W0JD 1NSFA 3PEWA 1XDBA 3K53A 1GNQA 1TF2A 2AFHE 4KO8A 4CEIA 3JVVA 4HZUB 4BWYA 3MWLA 1EFTA 2QG6A 2XAUA 1KI3A 5JMTA 4LY6A 3OESA 4L9WA 2W58A 2PX3A 4FN5A 1JAHA 2DFLA 3IIKA 2QA5A 2CDNA 2WAXA 1QHYA 2IT1A 1DG1G 1VCNA 1W0KA 1LNZA 2WJGA 4PAQA 4R98A 5FR2A 4TL7A 3LVRE 3BK7A 1FPMA 2UVQA 1M34E 2R65A 3K1JA 1MRSA 2ZJYA 4OQMA 1G8GA 2XZLA 1Q1EA 2YVUA 5F98A 1E9AA 1JXMA 1NJGA 4C30A 4NBSA 1R8SA 2FG5A 2P6NA 2GZAA 4OHWA 3AVUA 4XD7A 4BASA 4C0KA 1A82A 4LHXA 1ZD8A 3B7GA 5K8LA 1KAGA 1VCIA 1YVDA 1GOTA 3EARA 2VSFA 5BW8A 1PV4A 4FD2A 2ZJZA 4C7OA 3C8UA 1SKYE 4JZKA 3MJRA 4BFTA 2GJ9A 1GP2A 1JQJC 1JECA 5HR5A 1IQPA 2OCYC 5TVKA 4P32A 3PCRB 4BUJA 4FI3C 3ZD6A 1W46A 3MMPA 3AVVA 1XJQA 1LVGA 1WP9A 2FFBA 3K70D 1M8PA 4PQFA 3KFVA 2OEPA 2N42A 1IBRA 4Q7MB 1H8ED 2J1LA 4BLOA 2ZJ8A 3OEED 4JKIA 1XJ0A 3ZS9A 3RS3A 3PEYA 1U94A 1GRNA 1ZUHA 3A4NA 4KAXA 3ADCA 5LPNA 2G6BA 2FWRA 3TSZA 2AXNA 3HU3A 5KSOA 2ZREA 2ZJBA 2WIBA 2F1HA 3K0AB 1X8LA 3QUSA 3ADBA 4Q4JA 5FFMA 4XWAA 1T3HA 2G0TA 4ZKDA 1DELA 3MGCA 4HSEA 1CULC 1TQ6A 2VEDA 3TJZA 1NBMA 1X86B 2JLVA 3B6EA 2A5YB 3IUYA 4N0DA 2KBFA 4GI7A 2J59A 1QHHB 1Z6YA 1KO5A 4GFDA 4Q4AB 4GMXA 3H1TA 3Q3JB 1QVRA 2FGKA 4LJ6A 3T12A 4B6EA 1E3MA 4A6PA 4Q21A 1KO4A 2VP5A 5BQ5A 3K0CA 1E79D 1BMFD 5JEEA 1JR6A 3VKHA 3QPWA 4OHVA 1R0YA 4PC7A 1II8A 3I8SA 2I4IA 4WIAA 4ACAA 1XNJA 2WBLC 2AWOA 4OI2A 3C5CA 2RGCA 1S3SA 4H1VA 1A2BA 1CJUC 1KK1A 4HLDA 4ON9A 3AGPA 2CLSA 2QU8A 3EZ2A 1AS3A 1E2KA 1LV7A 4IDPA 1E0SA 2WJYA 1Z0IA 5FL7D 1IN5A 3QSYA 4ZKEA 3TUZC 2PMDA 1KSFX 2F1JA 4II7A 4DCSA 4NCHA 1NN5A 2ZAOA 1VIYA 4MA4A 1HH4A 2CK3A 3REFA 1OHHA 4NE2A 3WY9A 2G9NA 2CVHA 2ATVA 1UDWA 2OILA 3DOEA 4FCTA 1MO4A 4L15A 1SXJC 2GETA 2CJWB 4V0ME 5LBIA 5BYKA 1II8B 1JB1A 4Q9KA 3THXB 2Q3FA 5D3MB 1OXVA 4L5BA 3CR7A 2VIIA 3EA0A 1CBUA 2AFIE 3ECCA 3WP0A 3CF2A 1GG2A 4Q01A 4L8GA 4TL9A 3DOFA 4AY2A 2FPMA 4YDSA 3AP1A 4GMDA 4KLNA 5EXPA 4I1OA 4M1KA 1FFHA 1CR1A 1JBKA 3A36A 1XCGB 1E94E 1EX7A 3FB4A 3QXHA 1J70A 3A58B 4MYHA 4PSVA 2QL6A 1GKUB 3FFAA 2CHVA 2GESA 2IL1A 1KMHB 1GRQA 4EKDA 2F6RA 1YZQA 5ELXA 3QF4A 3U44A 2ZSDA 4BFYA 3ZQ6A 3E70C 4NDZA 2PZFA 4TLAA 4OK3A 2A3RA 3ZZUA 1FTNA 4IJMA 1XXHE 1Z8FA 3GEHA 5LDDC 3VNVA 4LYAA 2A2ZA 4IEIA 1T0HB 4IVQA 3GLFE 2ZRFA 3K0FA 1DAEA 3N70A 4IRUB 4NCKA 2D3WA 3RDPA 3A1SA 3LBIA 4LC1A 4HYYA 4IEEA 1Q21A 4DLUA 5IT5A 3LLMA 4DUGA 1XXHA 2WIAA 5IK2A 4ZI3A 1XZQA 3E5HA 4IXMA 3THWA 2YC2C 4BECA 4AURA 4IW3B 2WPDD 3Q7QA 3VR3A 5A5GA 5FPTA 3P20A 3RC3A 1HUQA 1TQ2A 2VHCA 4I4LA 4JLKA 2C98A 2CHGA 3LD9A 2VLIA 5AUQA 1KKLA 4PPGA 1WXQA 1HY3A 3MSXA 4DEXA 2QAGC 1E1QA 3DHWC 4QGHA 2CL7X 2XOKD 4RKFA 5JCPA 3SQWA 4URXR 4GRAA 3RRNA 4LC0A 1WRBA 4G0NA 4WW0A 1UDXA 3VQTA 3B78A 2DY1A 2QNRA 2WWGA 2CE7A 3B1VA 1OPXA 5E3HA 3AP3A 4XSHA 4C0LA 4V0LA 2B7BA 2KE5A 2ZRAA 3LFUA 2B7CA 3ZYCA 2ZSFA 4BLRA 1KZ7B 4KVAA 4PPQA 3EAQA 2WWYA 3BERA 3KTAA 2GBLA 1VTKA 4O0MA 1IN4A 2RGDA 1ELOA 1TQ4A 4G5OA 5AUOB 1DARA 3O8BA 2FSFA 4QGFA 4XTCS 4PC3A 3RABA 4NL4H 1W36D 3OHMA 3S1AB 4GOXA 3THOA 1Z0KA 2VTKA 5E4FA 2P2LA 4IOKA 2OE2A 2FEOA 4PQRA 1KOFA 5FUYA 5SZIA 4Z54A 4JLVA 1NF3A 5DI9A 5HZKA 5UKDA 5TMPA 2VSXA 1MABB 2ZAMA 3X1WA 4Q02A 4CEIB 1II9A 1P73A 1PUIA 3GLHA 2NO0A 2IS1A 1CIPA 1FP6A 3GJXC 2ZI3A 5DISB 3RNLA 2KSQA 4JS0A 2BM0A 3VR6A 1E98A 5H1YA 1QRAA 3H0KA 2Q3MA 5EE9A 2E1RA 3S1AA 1SKQA 1G41A 4UQOA 2IYZA 4AC9A 3TAUA 1P60A 2HCBA 4ZCMA 4YMTA 3NH6A 1E96A 4ZDIA 1TAGA 3UMSA 3A1VA 4CZ2A 2C9CA 1J99A 3CPHA 4DB4A 1ZU4A 4J0QA 1S1MA 1HV8A 4CDGA 1WF3A 1XCMA 3TW4A 1G6HA 4G01B 2ZSBA 2WJVA 5GJBA 3FHCB 2IA5A 2CCGA 1US8A 1ODFA 4WZAE 1ZBDA 4C7OB 3KDSE 1BO6A 1GVNB 1LW7A 4C0HA 4MGKR 1ZD1A 2OESA 4GZMA 2D2EA 3I92A 3V4RA 2V7QA 1GZSA 1OE0A 4LZZA 4V02A 1F48A 2ONKA 3V4FA 2ZS9A 4D25A 3GLIE 1ZM3A 4PPFA 4A8JB 2HXYA 1GL7A 1S0UA 3AVOA 3C7KA 3A37A 3IHWA 3LQQA 4IOMA 5CJPA 4A9AA 4EFLA 4FMDB 2BWJA 2VP6A 1PLKA 1SKYB 4V0OA 2JDIA 1E2JA 4AYWA 2GEVA 4R2IA 2BKEA 1XMVA 4TYWA 2DR3A 2ORVA 5TB5A 3CZQA 4NTZA 3CLVA 5DH9A 2AN9A 2CVFA 2O8DA 1U9IC 4EPXA 2VPPA 1A4RA 4K8OA 1ETUA 3VU9B 2BIFA 4QBGB 1Z5ZA 4QGAA 4X8MA 3W5JA 1WB9A 3Q5EA 4LPSA 4JLMA 4QNRA 1NG1A 3U5ZB 1QG4A 3SJBA 4A8JA 3PQCA 1AK2A 2QQEA 1E1QD 3AKDA 4OBEA 2QGZA 3R9XA 1R10A 3B1XA 3B5JA 2BMJA 4UXJA 3U7HB 2OG2A 2QMUA 3X1XA 1KO8A 4TSFD 4R7ZA 3L0OA 4G3XA 4Z8XA 1DE0A 2FFQA 3FKSA 1XBTA 4LRWA 5EJEA 3AF3A 4MUBA 2J87A 3ZQJA 2ZE5A 2O8DB 2VL7A 3VR5A 3KJHA 3EIEA 3VAAA 3SR0A 3BORA 3QKSA 4JLOA 2GTPA 3X2SA 2C96A 5DLQC 1N0UA 3BC1A 4IFEA 2IXEA 3PJRA 1K5DA 2GDJA 2C03A 5CIQA 2A5GA 5FTMA 4YMWA 2WZQA 4AKEA 4MDFA 2ZYVX 2HYIC 1OYYA 3NBXX 1AZSC 3OIYA 5J4KA 1OH5A 3DM5A 4POAA 3KJIA 5LB2A 1G7RA 221PA 2ZRMA 3SS8A 3ZVLA 1BYUA 3LA6A 3K0AA 4Q4JB 2EU8A 4DLVA 2BVNA 5D3MA 3RS2A 1S96A 4UJ5A 2J45A 4MRPA 3NHBA 1E0JA 4ZDJA 2EFDB 2EFHB 3KXKA 2ZITA 2O8EA 3KB2A 1DPFA 3C41J 1SGWA 5AR1A 2OFXA 4WZBE 4XVQA 1VKJA 3B1ZA 1CF4A 4W7SA 3BWDD 4XSGA 3TSOA 1YZTA 3U3MA 3CH5A 4D2IA 4TZ0A 4Z1MA 1Z29A 2JLRA 1VHLA 4TLCA 3CO5A 1TNDA 4FXPA 1U98A 4LJ7A 2R6GA 1E2QA 4L16A 3GP8A 4NCJA 3U44B 3EPHA 4LHZA 1XTKA 1Z0FA 1D8TA 5TV2A 2J7PA 3K09C 5EUMA 4B3CA 2V7QD 2WSMA 3AVYA 5TARA 4DXAA 1DAIA 4QGGA 1U81A 2ZRJA 1DS6A 1MH1A 3N5CA 1HA3A 1UADA 4HLCA 3TE6A 3GCGA 3W6NA 1G291 1JPJA 3K0FB 2DFNA 1I4TD 1KDTA 1H65A 3VR4A 1DEKA 1LFDB 2B92A 1NRJB 1Z2AA 1ZCAA 2C99A 3QEOA 4GBMA 3VTKA 4DCVA 1N6HA 2BMDA 1P9WA 1W47A 2RAPA 2PLRA 5L3VA 4IVPA 4P4UA 2FMXA 2NMVA 4TN1A 2GA8A 3BD9A 1XD2A 2YJTD 4IDHA 3WBKA 5HE9A 2F43A 2IUTA 4NCIA 1XPOA 4Z8YA 3TUJC 5E7IA 2PJZA 3IBGA 3W34A 1W2GA 2IYRA 4KFTA 3EPKA 2W6ID 4A1FA 1GL9B 2B6HA 1T3LA 2FOLA 4N1AA 4M1YA 4EPVA 1N6RA 4HI0E 4IOJA 1ZVQA 4Q48A 5KSZA 1KDRA 1XWIA 3TIFA 1L4UA 3AVXA 3DMNA 1GFIA 3N2IA 4KYIB 2BJWA 4M53A 2ZTSA 1ZAKA 2ZIAA 3IIMA 1B0UA 4JT4A 4HAUA 3TW8B 2Y8EA 3W9YA 1LY1A 3LWNA 1IN6A 3Q5DA 3R20A 1II0A 2GWHA 4JVSB 2F43B 4JBWA 5BYJA 3GJ7A 4IKEA 4L4UA 4TLEA 5C18A 5FTNA 4LSGA 2R6DA 4D4LA 2KWIA 4C2TA 2W6JA 3OEHA 4UXHA 3FHOA 1DVRA 1JEDA 1EG7A 2YOFA 3CX7A 5K8IA 1AQYA 2FPKA 4AYTA 4RKEA 4OHYA 2XB2A 1KNXA 1JQLB 3Q72A 2XSZD 4B2IA 3AVPA 3DL0A 5CK4A 2H16A 5KSPA 5J4YA 4HUQB 1IN7A 3EC2A 3FGNA 4NMMA 1Z28A 5EZ6B 5EE1A 4M1TA 5LD2C 3K0SA 5CDFA 2W0SA 1AZTA 3QOFA 3E1SA 4NYIQ 4E03A 3NC1C 1G18A 2WWXA 4FMDF 2KI5A 3UG7A 1RZ3A 2CNWD 4B3FX 3QI2A 1XEFA 3DPUA 4RY2A 5ANRB 2AWNA 2IYUA 4RZ3A 2CBZA 3QQ5A 2OXRA 2QRZA 4KCGA 1W48A 1Q1BA 1XEXA 3I61A 4XH9B 1NSTA 5LB4A 1XEWX 1D2MA 3QPUA 2B8WA 4NHOA 4W5HA 2C5LA 1ZM9A 2V8OA 2R6AA 3I72A 2W6IA 1HTWA 2IWRA 1XD8A 4FWIB 4DKXA 2FZ4A 3QJYA 1KI1A 4FINA 5EZ5A 2ZVQX 3ZIAD 3D31A 1G7TA 2HYDA 1ZINA 2GZDA 3L0PA 3NBYC 4HUQA 4M0LA 4ILEA 4NP6A 4TLBA 4QNMA 5EP2A 1OH7A 3O47A 3T34A 2QORA 2LCFA 1XD9A 1S9DA 1XF9A 3MFYA 2YKGA 1W7AA 3BBPA 3BRWD 1QVAA 4RFSA 3KKMA 4M1WA 5DIFA 4DCTA 1CP2A 1EGAA 2NQ2C 1OW3B 1S8FA 2ZU0C 3AQ4A 2JIZA 3MWJA 2W00A 2J0SA 1A1VA 2O0HA 1E79A 2RMKA 4B75A 8OHMA 4Q00A 2HT1A 3LBHA 2CLCX 3U6BA 4YMVA 2ZU6A 1RYHA 2IWHA 2XTNA 3K9LA 3CF6R 1D9XA 2ZJAA 3B82A 2IBMA 2XZOA 4XJXA 1TEVA 5AJVB 2CNWA 2QZ4A 4LYFA 2V54A 5EE3A 5P21A 3RAPR 3KQHA 2MMGA 2OCPA 1OXSC 3O8RA 2NO9A 2ZRGA 1MABA 1NBMD 2ERXA 4Q4HA 1H8HD 1IXSB 4OQLA 3QKUA 5CJ2A 5KSYA 3EWSA 4KFUA 2VRWA 1T5IA 1I4DD 4BRWA 4S35A 4PR0A 1JNYA 1KO7A 2KBEA 1YR6A 1GAJA 2O8FB 2Z0MA 2BBOA 2GILA 4Q9IA 2ORIA 2AKAB 2Q21A 1ZNZA 3ZDQA 2YINC 3WYAA 3GFTA 2REOA 2PCJA 4HAVA 3OF5A 1SXJE 1YE8A 4TQ9A 1QZXA 2GK7A 2FSHA 1CEEA 1I4LD 2RH5A 3BIFA 4TTRA 2O8BA 5G41A 5KTYA 2IYTA 621PA 1TF5A 1IHUA 3QXSA 2H1LA 1KI9A 3IDQA 3VU9A 4Q7LA 4E5UA 1GDDA 1NVVR 2NOAA 4CYMA 4D4KA 4DB2A 4JSTA 2ANCA 4LYJA 2ZJ2A 3WHLA 1GITA 2QPTA 4Q4HB 2HV8A 5H70A 3B8HA 3M4YA 4HZUA 4UKDA 4K81B 4TYNA 1GRRA 3TGPA 1SHZA 4JVNA 5EP3A 2DFTA 4P4SB 1AIPA 5CYPA 1SULA 5L3QB 1Z07A 1US8B 1OH6A 1M7GA 1AA9A 2OAQ1 1KK3A 1PJRA 5L8VA 4CEHB 5F3WB 1EFCA 3W6OA 4TQUS 5FOWA 3TMKA 1E99A 2YNMA 3IHLA 1PLLA 3U61B 1YZLA 4HAXA 2OHFA 2ZRCA 3NHAA 3VR1A 1FX0B 1JJVA 4DT1B 4LV6A 3QY0A 1G1MA 3TH5A 3Q85A 4BPBA 1U9IA 2HF8A 5FTJA 1P2TA 4D26A 4YQFA 3UMRA 5B2ZA 4D4MA 1QF9A 2TMKA 4UNRA 3RRMA 1TX4B 5JSZA 4JT2A 4ZDWA 2FNAA 2BC9A 1F2TA 5KNDA 4QXAA 5H8WA 1OYWA 5JRJA 4QFMA 1N5KA 2F1RA 1NJFA 5AUNB 1FQKA 2WKQA 1D5CA 2G88A 5JHGB 5JJIA 2AKYA 1UEJA 2ZPTX 1E0AA 3IQWA 3WNDA 4RD1A 3GLGB 4R71A 2IF2A 2OLJA 2X77A 5KOYA 1R4AA 2OFWA 2JAQA 1DBSA 1YHNA 5K8UA 1BH2A 1E4YA 1KI2A 4M22A 1S2MA 4M1SA 5C2JB 1OH8A 2WV9A 2I3BA 4JJKA 2REBA 3OEHD 5JSZB 2N46A 2RGGA 3EC1A 1E2HA 1F2TB 4WVFA 3IPYA 4I81A 4P31A 2A30A 4Q47A 2OCBA 4GZLA 2NIPA 1UBFA 1NIPA 1JI0A 4DEYA 4LX0A 1NMZA 1V5WA 3LO5A 2PH1A 3W6PA 4Q1CA 2VSOA 3M0EA 4D82A 4ZI2A 1E2FA 1QHSA 2WOJA 2ZE7A 1OB2A 2ZR9A 5AWFC 3NEYA 3P4XA 2BBTA 4Q4AA 3I1FA 4B71A 2EW1A 4S2EA 1FW6A 2Q6TA 2PLFA 3U6KA 2V3CC 1Y63A 3L43A 3DMDA 3L8ZA 5FL7A 2WKPA 2XJ9A 4YDHB 4B33A 5DYGA 1YR9A 3K9HA 4KITB 3KQLA 1U0LA 2QE7D 1R0WA 1E9BA 4MH0R 3WHKA 2R44A 2VP4A 1AM4D 1COWA 3WRYC 1AN0A 1F6BA 1M2OB 3AKEA 5GADl 4H9GA 2FPLA 2X8AA 5BXQC 4D81A 2IUSA 3FMIA 2KJQA 4L9SA 4D0LB 3QKTA 5JEDA 3GLFB 1SVIA 1IJFA 1OXTA 1TL7C 2IYXA 3QVUA 3DVLA 3QXCA 3SQXA 1FMJA 5AJWA 3LH5A 1UEIA 1ZIOA 2NPFA 3GJ5A 3HR7A 3SJZA 1N5LA 4GDFA 3PFIA 3CNNA 3TSWA 1S9HA 2AHOA 2W83A 5SZJA 2ZETA 2ONJA 2V9PA 4EJSC 3W5IA 1E2DA 5AJYA 3C16C 4JLBA 2VBCA 2ZR7A 3B9QA 2BJVA 3WRXC 1P62B 1RC8A 2ASEA 3PEUA 2WWIA 3B85A 4GSYA 2UZIR 2BEKA 4ARZB 4US2R 3FOZA 2GK6A 3RWOA 3UKDA 5C46F 1RKBA 1G16A 1J90A 4C3ZA 1ONBA 3C14C 5AUPB 5JI2E 1N6PA 1DO2A 1NBME 4TLDA 2VA8A 4XIGS 1GILA 4B32A 1EXMA 3ZGXA 2P6RA 4US1R 3RC8A 3GPLA 3CWQA 4KHZA 3TNFA 5G3YA 1OFIA 3UIEA 3V00A 4EPRA 1OKKA 2QTHA 3OE7D 4LJAA 2G1JA 1Z2CA 3TKLA 5FBVB 2R9VA 2WSSD 1XFAA 3W8NA 2LKCA 1RJ9B 3NBFA 2EYQA 1SVKA 1DAHA 4AKIA 2YHSA 4OHXA 2Q9CA 2WWWA 4ARZA 2FFHA 3MWKA 4PO8A 5DN6A 4IHQA 4B76A 3BFKA 3B60A 1KNQA 5FUXA 1T3SA 3U3JA 3NH9A 4JBYA 1G8PA 4JYBA 3RWMB 5DN6D 3LXRA 4ASUD 4B43A 2WAYA 3PIRA 3TAHA 4OJKA 5HTKA 3LY5A 4PAOA 4RFSB 3V9PA 3THWB 4MKFA 3QNUA 3ICQB 5JJLA 5DE3A 4A2WA 4JLDA 2JLUA 2J0UA 1NVUQ 3TVDA 5TY0A 3CX6A 3VNUA 4Q19A 4AYXA 4NYJQ 2OSBA 2W2TA 2Z43A 3TUIC 3T5DA 2R6FA 1LS6A 4MYTA 2WJIA 2PBRA 1VHTA 2GVDC 3VX3A 1TTTA 4Q03A 2EVWX 2ZM5A 3HU1A 3QIAA 2DB3A 2VH5R 3BGWA 3DPTA 2E9SA 1HT1E 1N6KA 4F4CA 3TQFA 4C4PA 5LD2B 2Q3HA 4TMTA 4HDCA 4P3YA 2V6JA 2RKOA 3DDCA 1E9CA 4HAZA 2MMCA 3C5HA 4JYCA 1G64A 1NN1A 4M9QA 4RD0A 1KKMA 4X8OA 3PUVA 4FCVA 1Q22A 1KK0A 3ASZA 4A15A 1TU4A 2E87A 4BQSA 1VPLA 3F3YA 2ZI6A 3U3OA 4OKSA 2VP0A 2OXCA 2AD1A 2QAGA 2O8CB 3HYTA 4WBSA 4A92A 2C9OA 3AGQA 1KHTA 3O8DA 1R6BX 3NC0C 3W90A 4DLWA 3TQCA 1MT0A 1WDTA 4IXNA 3OAAA 4KU4A 4DCUA 1FQJA 1TUEA 1M7BA 2L0XA 2YOHA 4Y0AA 1RPZA 4EPTA 4TWZA 1VYUA 1F60A 1X1SA 3WP1B 4LJYA 1CU1A 4PHGA 4BE7B 3QF7A 4OQFA 4PXAA 2QP3A 3NDBB 2HLDA 4UNSA 2WHXA 1IXRC 4G1UC 2ZRLA 1NY5A 2QMHA 3T35A 2OCAA 2WJJA 3FHTA 2CCJA 4JMPA 1FX0A 5CM8B 2FN4A 3UWOA 2D7CA 2V55B 2A78A 5F9FA 1ZUNB 1JJ7A 1OIWA 1VG9B 2O8BB 3VKWA 2JLSA 4MKIA 4QHSA 2ZS7A 4CW7A 1W5TA 5K8TA 3OE7A 4E22A 4BZXA 2FV8A 4TMXA 1D2NA 3GEIA 3CONA 5EE5B 3TK1A 2O8FA 3OZXA 2VHJA 4BFXA 1YJ5A 2C2HA 2FSIA 6Q21A 2NO6A 3U7EB 3AM1A 3LLUA 3ZH9B 2PCLA 2G1KA 4W5JA 2IYLD 1EFHA 1P9NA 5F2EA 2XGJA 1M6NA 4ZV4A 2NO7A 3FE2A 3CNOA 1T0JB 1ANKA 1G7SA 1PZNA 3CR8A 2PX0A 1ESNA 2FX3A 3UATA 1D2EA 3DEFA 4OYHA 4P4SA 4HAWA 4I1SA 3P4YA 2KB0A 4XVUA 2C77A 2NZ8A 2ZJOA 1OB5A 4CEHA 2RB4A 1A5TA 1LS1A 1R0XA 2WVJA 3SE0A 4E07A 5SZHB 4R9UC 3KJEA 4URVR 1AQUA 4QBFA 1GTVA 3EIHA 3DO6A 2OBNA 1E1RD 2JEOA 2ANBA 3FKQA 5AK0A 4B34A 1XMSA 4D80A 1ZJ6A 3VX4A 1FZQA 5KO2A 4O3MA 1XTIA 4DT1A 3IEUA 4ERNA 3GLIB 3PUXA 2ZI4A 5FH9A 2ODBA 5B64A 1KAOA 3FWYA 2OT3B 2AL7A 1KIMA 2K5UA 2AD5A 1YZUA 1L4YA 2GZHA 2PT7A 2IYYA 3UANA 2AXPA 2GAAA 4PZZA 4OI4A 5HE8A 1XCPA 4KBFA 4UNNA 4DLRA 1OJLA 3R7WA 2F7SA 1M74A 1P2SA 2JCSA 3C15C 4M9ZA 4Q9JA 4DDWA 3H86A 4G5SA 4LK2A 3ZIAA 3SC3A 4LUCA 4X8LA 1J8MF 2CHQA 2LWIA 2HUPA 1G3IA 2AK2A 3QPVA 5FR1A 3GLGA 3MLEA 2GJAA 4MITA 4CT4B 4PHFA 2CL0X 4EPWA 1W0KD 3BH6A 4JKYA 1OIVA 3I4LA 3QKSB 1ZM2A 4TT3A 2C8VA 3CNLA 3U3KA 2ZE8A 4MYUA 3SYNA 3UXMA 4DVGA 2OO7A 1CKEA 4GOKA 4ZCIA 2BEJA 2YOGA 5JJKA 4QBHA 2O0JA 1BS1A 4H1UA 1XP8A 1YKSA 3B1WA 1EWQA 1UKZA 1UKVY 3D6TB 1FTSA 5KDOA 3H84A 3AVWA 1IM2A 2GEUA 4LJ4A 1U0JA 1JXOA 4LI0A 1QHXA 4LJ9A 4C0AC 4FCWA 2PZGA 1A7JA 3LX8A 4O2RA 3ZVRA 2ZRPA 1RE0A 2O8EB 3CZPA 1VECA 1YU9A 5JWOA 5HKKD 1EFRD 2ZI9A 3BFVA 3REGA 4DSNA 3HP1A 2ZI7A 4XWKA 3A4LA 2VHUA 2PJRA 1CLUA 2O52A 4QOSA 1XMJA 4G5QA 4M9SA 4HB3A 1P4SA 4IOLA 4F92B 3I32A 4GP7A 1U8ZA 1ZMXA 3EZ6A 4KVGA 1QHGA 1NN3A 3SJCA 2HEIA 2XEXA 2IW3A 2Q0HA 3ND9A 5H68A 4JLNA 4JJZA 3K9GA 4HLUC 2C04A 2QRNA 2C9YA 4TL8A 5JHHB 4FWTA 1OHHD 1L2TA 2V1XA 1E2LA 2JLYA 1GNRA 3K0CC 2CK3D 4CRWB 2ZRHA 4GPTA 2QBYA 2FSGA 3EA5A 5TXGA 2P3SA 4YONB 3I62A 4PANA 3GMTA 1P6XA 3IQXA 3RRZA 1WBDA 2XNDA 5CDFE 3SYKA 4LHYA 1N6NA 4BGDA 1ZW6A 3QE0A 1F5NA 2HJGA 1JR3E 2J7KA 4A82A 4C0SA 4HAYA 3I3SR 4JLAA 3N2EA 1A2KC 4KSCA 4DZZA 3L8YA 4BFVA 1LTQA 4PC1A 1E2PA 421PA 2RGEA 2VYFA 2J3EA 4JLJA 4V0NA 1G8HA 2HJVA 2JGNA 3LAWA 5FBQB 1UF9A 3BB3A 5AJZA 4PHHA 2QPOA 1XPUA 2FU5C 2DYKA 3EW9A 1XX6A 4EAQA 4W9MC 5FTKA 1E9FA 1JALA 1DO0A 2B21A 3K9NA 1SVOA 4IDOA 3RS7A 2GXQA 5FPSA 3EZFA 2ZROA 4QHTA 3K09A 4OHZA 5BN5A 2SHKA 4HB0A 4UJ3A 2WWFA 1RRGA 2XITA 3UG6A 5B57C 2G83A 2ERYA 2OFOA 1NLZA 1QBKC 1Z3IX 2IS2A 2X19A 4CEJB 1Q44A 2RHDA 2F55A 2GJ8A 2GJKA 4TYPA 5FBRB 2YWEA 5BN4A 1Q0UA 2RGNC 1Z63A 3K70B 2HT6A 1P7CA 5J4VA 1IJEA 5KHOC 1AKYA 2OBLA 3IIJA 5FBWB 1KDPA 5JCZA 2YWHA 2W2XA 2F1IA 5JZVA 1WA5A 1XTSA 3H2YA 3SHFA 2BOVA 1Z47A 3WMEA 3QENA 2QM7A 4TYYA 3KX2A 4KBGA 1U90A 1OF1A 1SXJB 4BFWA 3X1ZA 2OV2A 4M4SA 2W2VA 2GHIA 4LHVA 1G21E 2X2FA 3CUEF 2QAGB 1UBGA 4A8JC 2YYZA 2O8CA 5M04A 2AX4A 2IHYA 4LDJA 2GCOA 5JECA 3ETLA 4WXRA 5DYIA 4URZR 2QP9X 2CMKA 1KY2A 1XEXB 4OQXA 4ASUA 1D6JA 1G20E 1TF7A 1UM8A 2FGJA 2J0UB 3CPEA 4RD2A 3RLFA 2VHQA 3G82C 3GFPA 5B58C 2NGRA 1RRPA 2BV3A 3BE4A 3ZLJA 1G3QA 2F3TA 2ZI5A 1C9KA 3LQRA 1GNPA 1XMIA 1DAMA 1AS2A 1ZNXA 4FIDA 2W0MA 3R9WA 4B2LA 3L2OB 2JJ1A 1Z83A 2HF9A 2GRJA 3D8BA 3BFXA 4LWZA 3EZ7A 3PUWA 1IONA 1Z0DA 1BIFA 2ODEA 2ZEJA 3H4MA 3MD0A 4UNPA 3A6PC 1Z6XA 3FFBA 5JWRA 2IS6A 4PC6A 1GL6A 1YR7A 2IUUA 3EXAA 2Z6VA 3GJ8A 3AF0A 1VCMA 1M1YE 1TADA 2DFKB 2V1UA 4KI0A 4KYUA 2OLKA 5GJVC 3MAAC 2IS4A 3AVQA 2FJUA 3ZS8A 4URUR 1OLOA 2JDID 2GBLC 5G40A 4DIEA 5FTLA 2GKSA 1U8AA 1ZP6A 3EG5A 2IYSA 1UBCA 1YRBA 4MRSA 1J8YF 2XSZA 4Q9LA 5JRZA 2OUKA 1Y3AA 1KDOA 4M21A 3ZZTA 1HE1C 3SN6A 4C0BA 1OFUX 1FL9A 3CW2A 1L8QA 4PPNA 2IX3A 1DAKA 1S1CA 4RCZA 3B9PA 3QKRA 2GF9A 5FOXA 3OEEA 4LBVA 1VG0B 3KFXA 2O0KA 4MKHA 3EPLA 1EESA 3U60B 4NKRA 4JL5A 4ESHA 5EXXA 4DWJA 1M7HA 4DC9A 1F3OA 2Z4RA 2ZUBA 2GXAA 3LRPA 3VKGA 5FBLB 2D7DA 5TDHA 4MRVA 5AJXA 3L0SA 2XB4A 4F38A 1P2UA 2GNOA 3M1IA 1UPTA 2FF7A 3Q7PA 2J46A 4LV5B 4M9XA 3AVTA 1EX6A 3RS4A 4LOAA 1KGDA 4Q9HA 2UZ3A 3R8FA 3A1TA 2N1BA 5SZKB 3RHFA 2QE7A 1G4AE 1T91A 1ZC3A 2YC4C 5KUTA 4C2UA 1E2GA 1E9EA 2JJ8A 2ZYUX 1NI3A 3CRRA 2QTVB 4XTRA 4LHWA 2ECKA 5L3QA 5GVRA 3NDPA 1Z0JA 2JJ2D 3T1QA 1AGPA 2OZEA 3GEEA 3B2EA 4NYJR 3CRVA 1CJMA 3J81k 1VDZA 3U2QA 4F7WA 1B23P 2NPIA 4GOJA 3BH7A 2ZUCA 3LNCA 2EYUA 1L7VC 1NMYA 2YWFA 3B1YA 3OFND 2P5SA 5EUQB 3SBDA 4AIIA 1GSIA 1CTQA 3QXXA 4NCNA 4D6PA 1T5LA 3OAAD 1KY3A 1OFHA 5EQTA
chains in the Genus database with same CATH superfamily
1V1JA 5ALJA 1J7KA 1Q1ZA 4LIUA 1YB5A 3HKEA 3RYHB 1GZDA 1QYWA 1U5AA 3QMMA 2XWBF 3HN6A 5ITSA 3H2GA 3RZDJ 5IULC 2DPMA 2VDRB 2NVTJ 5EJMA 2XRZA 1HDYA 2XOKA 3V6MA 4IL6C 3AKCA 2QN6A 4JOMA 1C2YA 2QBYB 4ABTA 4G4SP 3FDIA 1VSQA 1YDWA 3EG9A 1GZHB 1QDEA 2XCRB 2XGOA 4RJ2A 3LAJA 4WKOA 5ECDA 1D6MA 5DU2A 3WDLA 3HP4A 2MABA 5ES4B 2XUFA 1HW2A 1B3BA 3PV0A 2DVMA 4EB8A 4BJ1A 4F93B 2FEMA 1RLMA 2A5LA 2R7RA 4HO1X 4MVYA 1JPNA 1T1IA 1XG1A 4JFRA 4KODA 3SNHA 4BX3A 4MZDA 1RADA 3E9YA 3TOZA 1RHJA 1WR8A 4F8EA 2XGDA 2AXTC 3VH3A 3RTAA 2FSSA 1K88A 5B4TA 1JHYA 1NJSA 1OMOA 3KYIB 4D9EA 3FTQA 3QSGA 3H36A 1Z06A 3UFXA 3T7DA 4B2PA 3Q0EA 1G5RA 4D43A 2HWWA 2HLPA 4AKGA 1QFZA 2G17A 1JIVA 3KAKA 4NZYA 3S8YA 1E8NA 4PLWA 1SHJA 2BI8A 3D81A 1WHTA 1OX4A 2YWRA 1VE9A 3N58A 1JN0A 1NM5A 4QXMA 4GZ5A 3G9QA 5CNJA 2V4ZA 3CIOA 2OO5A 3A8TA 4XGIA 3AOGA 5DGIA 2VATA 3HXKA 2MCFA 2HMTA 3CEJA 2Q9BA 3QNWA 4MVJD 4CCMA 3K1ZA 3JSOA 4ZDLA 2XHIA 2PO5A 3TF5A 4YV7A 1FJ2A 2LW7A 3HS3A 1HT0A 4YAGA 1TZJA 1W8DA 3I23A 2Q1WA 1FMWA 5E8RA 5IYZB 1KQOA 5IVPA 2J31A 1SM4A 3RSLA 1E89A 2IXGA 2OB2A 5IM4A 4B3XA 1AGRA 4C20A 2CJFA 2C54A 1VHWA 4X7BA 2XVZA 2D06A 4WUVA 1R66A 2V6IA 1WDWB 2Q4DA 3I3OA 5HA5A 4ZICA 4Q6WA 3ROGA 3U3DA 1MORA 1WB6A 3OIWA 5C3EJ 3WL8A 3VYSB 1JLHA 1A6IA 1U9OA 1CS4C 3R3YA 3TZBA 1JS1X 1JAIA 3ROZA 3EQ8A 1SOAA 5KTOA 3DGEC 2JAOA 3L6UA 5FJJA 2YQZA 1YOVA 2JFZA 2D0IA 2GASA 4QYXA 4AZTA 1AMUA 2A9QA 3THYA 4JSYA 2CXRA 3O3MB 1ES9A 4PY5A 4PFSA 4EFNA 1E7RA 5B55A 4HUJA 1G19A 4NF2A 3PFWO 1ID1A 4BKRA 4P3XA 4WZZA 4M89A 2BY3A 4EJSB 2YFKA 4RVNA 5ECWA 4HDMB 3BSYA 4M83A 1NVMB 2WVGA 1NKSA 1G5HA 3HFGA 2FFAA 4EIWA 4NULA 2VCYA 1HNWB 3GF4A 3HYRA 2B9VA 4FTHA 1P9RA 3BWGA 2H4WA 4D44A 1E42A 3G6EI 3ND7A 2W11A 3EJ6A 3OOSA 5DFAA 3VSKA 4FYPA 5FKNA 1V8FA 4F8YA 3BZKA 1N4DA 4LW8A 5EWMB 1E2IA 1PHRA 4KJZA 4UMEA 5HPYB 2XIGA 4RWZA 2EILH 4AM8A 3FMFA 4GNKA 3CW8X 1IB0A 1V8OA 3BTSA 1MEJA 3NEPX 2O20A 3LCMA 2Q3LA 5I7SA 3LYHA 4E09A 3WWZA 3GRCA 5CPFA 4NZ9A 1NXTA 4TPSA 1PT9A 5BSRA 3CFYA 1L4MA 1QS0B 2D4HA 2BGNA 4AQ7A 4JUIA 1SUDA 1Z4QA 2NU6B 2XXAB 4A3LJ 1NYTA 3IVMA 2FJPA 3UOGA 2WTMA 3H11A 4B8YA 4HLXA 1I94B 3TW0A 3PX7A 2GN8A 2DDBA 1JTVA 2QJFA 1UBJS 2Y1OA 1J1ZA 3CC4I 1DAOA 3NAQA 4RF5A 4X3PA 4GP6A 1XZHA 2JBWA 3W3AA 2CF6A 3W04A 1OX6A 4IDGA 4EVRA 5CEJA 3OYHA 2ZW9A 3HJHA 4DMMA 3T1OA 2ACWA 3FWZA 2UVDA 5FWYB 2UZ1A 1BD3A 4KNVA 3U81A 1X8KA 1W4BA 4QA9A 4C2MJ 4B84A 1MAHA 3JVEA 1U9JA 3BB1A 3G73A 4OIMA 5ALZA 5AW7A 1XXHB 2Z57A 4JI5B 1TWFJ 5DO9A 4Q7QA 3E7FA 2OBMA 3I0ZA 3ZIUA 1XUOA 1W5AA 3UK2A 1DKMA 5JISA 4ZU6X 3IAM2 5DHSA 1KR2A 5EIFA 4JC5A 3TTVA 5KTSA 4EH1A 1NQWA 3BOQA 3ULQB 1M6EX 3P5SA 1QZYA 1I24A 3KUDA 4TTPA 2V7EA 3DLHA 4K1LA 4O2LA 5LOVF 1BQEA 3IYLW 2MR6A 2CXSA 4UHJA 3SZOA 1D4ZA 3LA8A 4WOPA 3R2JA 1W4RA 3MJHA 5LZ2A 3TRIA 1JIIA 1BDMA 1FSZA 3A9CA 3MWGA 2CW7A 3NVAA 1EWYA 1KA9H 4PIMA 4RACA 1I14A 1NVWQ 1J8QA 2Z6AA 3JZFA 5D8LB 1KE1A 3H2KA 2FZEA 1NM5C 3TD2A 4TKVA 2B8NA 3I01A 3GCZA 3FK7A 2Q4TA 2OD5A 1DEAA 5I7EA 1CYDA 1BOBA 2AFHE 3L6EA 3FNHA 2P69A 3O9VA 4AD9A 3VHXB 3A4VA 1T26A 2YXLA 3RADC 2OU2A 4XNFA 5E2IA 1LRLA 3AVUA 2VODA 4ZV9A 1HT3A 1ZS9A 2KL4A 4UULA 1AUOA 2PFBA 3E0JB 1WSWA 3O9MA 3ZCRA 2ZJZA 2ODTX 1D8AA 3LT4A 2FOWA 1UBSB 4GE3A 2DQZA 1WP9A 4X93A 3A3YA 3KFVA 3HBNA 1XROA 4Q7MB 2VZLA 5KOIA 1FOWA 2GN4A 4Y2GA 3IT2A 1EH8A 2XLCA 2ZREA 2C7RA 4YLYA 3MGCA 1CULC 2M30A 5L4LA 4Y6PA 1SVUA 3TFOA 3MTJA 3V34A 4PRLA 2I2FA 2NU6A 4RSMA 2VP5A 2VQDA 1BMFD 3KT6A 4NU8X 1X2NA 1T8YA 4ACAA 4G0YA 3MLBA 3NVKI 1ZEMA 5HF9A 3FR8A 3VC2A 2CK3A 3KPVA 5AKEA 3R0AA 4LNUB 1ZISA 3DOEA 1MO4A 5KVAA 2Z16A 4XCVA 3DOOA 3BR1A 2YXDA 3CF2A 3IA7A 2EKDA 2AG8A 3Q0TA 1G5QA 1R4NA 3TOAA 5CCDA 5L3CA 5ALMA 4ZYYA 3ZCOA 1UZNA 1YZQA 4KTVE 4EAIA 4EKIA 2WFMA 4MQEA 5FQOA 4LZWA 2X9QA 1H88C 1IRGA 2M8GX 2UVPA 4NCKA 4RKRA 4UVBA 1XK7A 3HUDA 4DUGA 4MKZA 4NC8A 2F5DA 1PEKE 1Y8QA 3NIFB 5A5GA 3W8DA 1U2ZA 4YQZA 1KYUA 2VONA 2QKYA 4WW0A 1KZ4A 2CE7A 2GBYA 5EXEA 2QN3A 4D9HA 1JIJA 2QW8A 1FTQA 2QRVB 4TUYB 4Z0HO 3KTUA 4D97A 4WCFC 2PL1A 5CFOA 1T29A 1LB2A 5E8IA 2I91A 1HNNA 4ZHSA 1BJRE 3C98A 2FG6C 2UZ4A 3MMZA 3F5QA 4RF3A 5KVCA 4LF4B 4RJIA 4PLTA 4DG9A 3LUKA 5E79C 1WZ2A 4H60A 4BNMA 1ODFA 4E7PA 4LJKA 3OGDA 1LDKB 1GVNB 3SXYA 4KR3A 1ZD1A 4O63O 1B26A 4GZMA 2VYVA 2HYJA 3UV3A 1KR5A 4QDJA 4OIOF 1ST3A 3OCVA 4EFLA 3IP6A 1R3UA 4EHLA 4TYWA 4G9GA 2FPGA 4FJ1A 2V4MA 3NGLA 1QJ4A 4OH1A 3ZWWA 1YASA 3OL3A 3FZYA 1AK2A 3CDIA 2X7XA 4ZVKA 3ZLVA 5B3SH 3OR1C 2ILTA 4KRXA 1Z4LA 5FOQA 2FQ4A 3RFFA 1XBTA 4YP7A 5CQGA 3DFZA 1FY2A 5ILQA 2E4UA 2A5GA 1HDRA 2HYIC 1ACMA 1E5XA 4C01A 1W5BA 1GHTA 2DFEA 1PFWA 4BJHB 4ZPJA 2EFYA 4J1NA 5ALPA 3NDRA 4MRPA 3D5QA 2R5XA 5AM0A 4YX9A 2I2BA 1SGWA 4GFBA 1JBEA 3RTCA 3TSOA 1X7YA 3I0WA 1C29B 1WKVA 3PFNA 3UJ8A 4QD3A 1T2NA 1D07A 4EUEA 4G1MB 3W5CA 2XB0X 5IPAA 1ETVA 5JN5A 1XAGA 3VTKA 2NMVA 2ZB9A 4P4UA 2GM5A 1XVAA 4O4JA 2KLOA 4D56A 5HGXA 3OZGA 3AEQB 2GCIA 3TPZA 3UQYS 3QU9A 3ETNA 2D2XA 3UHAA 1Z34A 4RVDA 5JQGA 3FWNA 1ZVQA 2BEUB 1QN9A 1E1YA 4DV3B 5LNK6 2BEWB 3LSHA 2F4IA 1B43A 3KZCA 4LLLA 5BYJA 3TZCA 1VI2A 1RKUA 2QD1A 4WESA 1MRZA 4NJEB 2XB2A 4I02A 5E6SA 3MN2A 1OLSB 3DL0A 4RMHA 1HDIA 1Z28A 5LD2C 2JUCA 2PUWA 1LX6A 3N6VA 4IEFB 4MVJE 4YHBA 2AWNA 4P55A 4P6VF 2B8WA 4DNXA 4W5HA 3KEYA 1ZRFA 1XTAA 4AS1A 1RM1A 1ZINA 2GZDA 4TWJA 1VIVA 1DUIA 1RMYA 1XF9A 1ZXXA 3L4EA 2C5BA 3KKMA 4M1WA 5IVKA 2AIRA 3AQ4A 3PHHA 1JJAA 5JAOA 4KMOA 2D1HA 2YZNA 4TUYA 4AKTA 4WA8A 2ZJ0A 1Q7RA 3VPDA 2HBYA 3G1TA 1PHPA 1NVTA 4S1TA 5A4MS 2KHMA 5G0VA 1X7DA 4KOEC 4JQYA 3INGA 2MA3A 1T5IA 4WF2A 3GQVA 3A1FA 5EMKA 3CUOA 2XT6A 1Q9UA 4BNTA 1L7MA 1G6Q1 4ID3A 1NVVR 4Q12A 4CYMA 4DB2A 3AEUA 2X1HA 1EAYA 4IHAA 4DV4B 1XMAA 2IUYA 5KYGA 1C0KA 3LF2A 3UO8B 1QTRA 1R9GA 4H4DA 1TO2E 1DRWA 4I4NA 2QQ9A 3VPXA 4BJ3A 4JEHA 4MVJG 2OHFA 4KIGA 3QV1A 2FGTA 1QGUB 3GJTA 1UFRA 3F97A 3O6BB 3Q85A 2P2ZA 1CY2A 4FDAA 3VI3B 1O95D 1OYWA 1TC2A 2G0EA 4MB6A 4DV6B 3BHMA 4MW9A 2FSVA 1FQKA 3D2LA 1DJLA 5JJIA 1QN7A 3W0LB 1Y1LA 4PF1A 2IF2A 2XQVA 1U3DA 5KOYA 3SC4A 1W52X 4C14A 2P3LA 1YX5A 1J42A 4GLBA 1XS9A 4JJKA 5JSZB 4IFIA 4UVEA 3JQDA 2Z95A 5GTHC 2AHRA 2ZCUA 1V5WA 3GUHA 3W6PA 4FX4A 1OREA 1CQJA 4BRZA 2EW1A 4S2EA 1UC5B 2PLFA 2I4NA 2P4QA 2GPBA 3L8ZA 3O4RA 2WKPA 5FL7A 4MGHA 5LZ5A 3UOWA 3WAJA 2VP4A 1AM4D 2KLBA 2VAXA 4DR6B 1NT2A 3AKEA 5BVGB 2JHCA 4H9GA 5JVGF 2O50A 2K2QB 4D81A 2FUG1 1OXTA 4QXRA 5JCJD 6PAXA 4A12A 1PK8A 5C1DA 2PSFA 1Y7TA 1QHHD 3EUAA 2WTEA 4DMUB 3COPA 3DU5A 4FFVA 2H1KA 4PN7A 2UZIR 2RGWA 4EGSA 5EJ5A 1J90A 4KIJA 1SZDA 4OU5A 4ATNA 2IELA 2P6RA 3RC8A 3HNOA 5EFOA 3CESA 2ZMEC 2B7LA 3JXEA 3O90A 4HX9A 4ARZA 4PO8A 3QWIA 1Q7GA 3U3JA 4EBBA 3H5RA 4PN3A 2WAYA 5IAGA 2HGSA 4FE4A 3CLRD 4P84A 2HCTA 4XEUA 2HRBA 1E62A 1JBQA 4GI2A 2WJIA 1V5IA 3BTCA 2EVWX 2PMZN 4ALNA 5DM0A 4L0CA 2Q8QA 2G9UA 4WCVA 4NG4A 4PGFA 2E1PA 1FSHA 4GECA 2XODA 1H6CA 4D5FA 3AR7A 5JASA 5LU8A 1KKMA 1A4XA 4UBNA 4Z99A 1Q22A 4B0AA 2G5PA 3V7NA 4Z7OB 2ARKA 2H08A 1FJGB 4Z9BA 2YMLA 3I2FA 2K7ZA 1O3SA 4CUGA 3AR2A 2OHVA 4UDYX 5TF0A 2Y0DA 5K9ZA 1YS1X 4NPAA 2OKCA 4H4KC 4Z53A 4G1UC 3AWIA 3D2CA 1J59A 3BZBA 1P0CA 1R15A 4RHUA 1A71A 3IJEB 2HA4A 3ZH9B 1M6NA 4P5OA 3A1YA 4QIHA 1VIMA 5LA6B 3TNLA 3S3MA 3A04A 2VUHB 3MKYB 3PC4A 2VRCD 4EFKA 1LS1A 3C24A 2QLFA 1X0XA 3EIHA 3VTZA 1T2VA 2GAIA 1XTIA 3PUXA 2KJBA 4PZZA 4HN2A 1NVKA 3C15C 4EGJA 3V1MA 1MBFA 3PD1A 4HQNA 1J8MF 5BW4A 4FOTA 5E1DA 3R7AA 2ZE8A 4MYUA 3SYNA 3B73A 3WVNA 3W06A 1I7SB 1CKEA 1WPXA 2O0JA 4PJNA 4ZFNA 1IIBA 3RE1A 4N5DA 1QHXA 1GGMA 1VL0A 2ZI7A 4XX0A 2RNJA 3K9QO 4QOSA 4DNOA 4IOLA 4I08A 3WC4A 4UVAA 3FIJA 2QBYA 4PZAA 2EP5A 2VBGA 3D2BA 3LAPA 5EIHA 1ORHA 1FFBA 3I3SR 3IDOA 1JPUA 3JAMK 3OPVA 4WLOA 1Z0SA 2YNMD 1IBKB 2PYIA 1ODJA 3EW9A 4EAQA 3WWCA 3DMHA 3C5WP 4OU4A 2DSNA 3L8MA 1XN4A 3H9UA 2ZIFA 4BEVA 4YFVA 4XR9A 1NK2P 3FUXA 1P7CA 2DA7A 2PGLA 5JCZA 1A9ZA 1XTSA 3H2YA 4ZZ3A 4BIIA 4AW9A 2WJ6A 2W2VA 1U2QA 2JEZA 3OS2A 4QO8A 3OQMA 5FBZA 1BE8A 5M3FJ 3GWGA 1SQGA 2IHYA 3DV0A 1TTPB 2OYCA 3G1OA 3PIDA 3OPYB 2J07A 2M5WA 5B58C 3BE4A 3ZDFA 4CMGA 2JIBA 3LQRA 2RHRA 3GRRA 1XAIA 1K4YA 4O0LA 1IZZA 4DNFA 2OKGA 4BGUA 4O4JF 4K1XA 4E7LA 3QZUA 2RV8A 3E81A 4WBXC 3FSGD 4XXHA 1M6WA 1Z5VA 4ZOCA 1MJ9A 2OLKA 1DP7P 4QJBA 1MOSA 1ZP6A 2P9YA 4JUAA 5IT3A 1H22A 4YJ3F 1SAUA 1PL0A 4NBTA 1OFUX 4RCZA 3QKRA 4XRFA 3OEEA 5SY4A 4PLCA 3GLQA 4DV0B 3EVNA 5EXXA 1M7HA 1EHIA 2ZUBA 1E1CA 4Z49A 4R0NA 1XA4A 1VYHA 1YH3A 3AW8A 3SIXA 3BZWA 2NPOA 3EA4A 2ILVA 3LUCA 4B4DA 2JJ8A 4NHEA 4WRRA 2XRMA 4TXNA 1SCBA 3GEEA 2G6TA 3J81k 2ONYA 3WK9A 3JW8A 3CHYA 4MTDA 1HG1A 2BDTA 1KSJA 1RBMA 1ZEJA 4W5OA 3VNAA 4JT8A 3EGOA 1JNXX 4IRMA 2ODNA 1ZLXA 2J5XA 3PCTA 4X20B 4FMCF 5K0SA 4MGYR 4RJLA 4FMPA 4L0ZB 4YT8A 4MVCA 1OJ7A 2YFYA 4E5MA 1NYQA 1PZGA 2Q62A 3K1MA 3VPBA 5JSFA 2NU7B 5BQ3A 4IQFA 2H27A 3R5JA 3X2QH 2I2DA 5HNKA 5KYVA 4CL3A 4MJXA 2QSZA 3C85A 5EJIA 4LGMA 1V6CA 1Y6FA 1ZRCA 5E1BA 3LIPA 4H08A 4OYYA 4Q1BA 3VYRB 2JHAA 3H1EA 1O94D 5ENZA 3KV1A 3T3MB 5E4YA 4LWPA 3VFDA 4LRYA 4UHEA 3JQ8A 2H2IA 3C1DA 3NWSA 2JFQA 5J2TA 3U21A 4N5MA 5LJLA 4HDRA 3NWBA 3F8TA 3P2IA 1OX4B 3PUIA 2LKDA 2PO7A 3CISA 1GR0A 2FX2A 4DCCA 2DODA 2X8JA 4A0GA 2FWPA 2JFNA 1GCAA 3UK6A 3LDAA 1JQEA 4X5OA 3EB9A 3JZIA 4N8SA 5BQPA 3TD6A 3OMLA 3FYUB 4TRNA 3M07A 4EJTA 2ODWA 3H0EA 3WSVA 3LOUA 4WEQA 4JNKA 3VTAA 3FBNB 4AZ0A 2YVLA 5AHKA 1RQXA 5JSKA 1G3UA 1XZPA 5A4IS 3K8YA 4P1WA 1KO9A 3CCUI 1UFKA 3GZ4A 4GOMD 2DLNA 3S1RJ 1SC3A 4FR2A 1Z5PA 2GCOB 2XIQA 3R5KA 5JJBA 1KFQA 1Y4SA 5JOQA 3HKBA 3R6WA 3H3XA 2HPVA 3NKFA 3MKZA 2P9CA 1EHYA 4AXBA 1VG8A 4NC7A 4G8BA 4D7MA 2GK3A 4CR7A 1VSUA 3G0IA 2G7HA 4FBLA 4XQEA 1KH1A 4Z2YA 3T8RA 5IBCA 3CG4A 1HEUA 4WJKB 4X94A 1WCXA 1M75A 2H8KA 2KX7A 2CO5A 2QD3A 1DIGA 1OZFA 4ZCPA 4KXUA 2RAFA 2OD7A 1FS5A 2AXQA 2V9VA 2X0LA 4F96A 4NB5A 3U7FB 3CWAA 1BR4A 4G8XA 4Y15A 1P5ZB 4BE1A 2GZWA 2A9KA 2YRXA 3V32A 1RMTA 3P96A 5EZQA 2WFLA 5FCDA 2D59A 4ZDOA 5JS6A 5HCNA 2Y93A 3U1BA 1SVNA 1T9BA 2QTAA 3SYMA 4NEHB 3CRNA 1KI6B 2OHJA 2H5EA 3ORYA 1GV5A 3IILA 3ZE0B 2GPWA 4KFRA 3TL6A 1E92A 1XU9A 4U6QA 4TKVB 3AUFA 2SKDA 2CEAA 1NJ6A 2HF7A 4QECA 2JIZD 3BCBA 2PDAA 1KI4A 5LZ4A 4EG0A 1XTZA 4ZQBA 4YCSA 1TYZA 4BUPA 4Z9FA 1PCZA 4B7UA 1WHSA 2WABA 2VTDA 4E51A 3R7WB 4ZAXA 2BCGY 3BULA 1NVGA 3HGYA 3RIEA 3MRTA 1QUFA 3I2JA 1PS8A 2A05A 2NUPA 3BL8A 4U5QA 4F2WA 5JBQA 4LIVA 3OU6A 3NKVA 1W36C 4MR9A 2GN2A 2WTBA 3HA3A 1FMFA 3HPHA 2OV7A 3MVPA 2YU9J 3K15A 5AXCA 4L5CA 1YS9A 2NXNA 4IJUA 2BI4A 2CLDX 3S17J 3OJWA 2CU7A 5LLDA 5B1AH 3CH6A 1P3JA 4XX0B 3TFWA 3N39C 3VBCA 2L02A 5AM4A 3OU7A 5EYRA 5KU7A 4NNOA 4O8CA 2WHPB 4RAYA 3KZKA 4YRBA 5ALNA 3I2IA 3AEZA 4XLTA 4LQDA 2WTUA 1KZGB 4JC8A 3JRIA 3P52A 4ES6A 3DFIA 5GGXA 4MWDA 4K46A 2CHUA 3IELA 4PXYA 3E22B 1J8DA 1S01A 5C4IA 2JS7A 5E8GA 4IIFA 1SBZA 3ZCXA 1PP7U 1EFPB 5AVJA 5KQRA 1I27A 3RSNA 3OTHA 1MJGM 1ITYA 1PQWA 3PR3A 3I5XA 5CTJA 2JVIA 4ZYGA 2ONCA 1I3NA 2OUMA 3JRGA 4HN4B 3EXFA 1ECLA 5GAJA 1K66A 4LF5B 3JRNA 2UZKA 3LUDA 5K0ZA 2V58A 5CW1A 1T43A 2EP8A 2Z5VA 2BFPA 4LGVA 1W34A 2YW9A 3M8KA 3CMEI 1P6RA 5F27A 3QXJA 3C6XA 1E77A 4DM4A 2QVLA 3MZ0A 3SFZA 1KTIA 2EFNA 3FPAA 4BMNA 2J5OA 3W3AD 3IPXA 4YJGB 4NEQA 5HQTA 4FNOA 5HODA 3R61A 1P4XA 2X3YA 2GB4A 2GQ0A 2CXTA 3JASB 3EQ6A 4IMPA 4RLHA 1HA8A 1AN9A 4Q5IA 5K51A 3KBBA 3SVTA 3G8YA 1F2UB 3VSAA 3PUBA 1Q3TA 2YHIB 3QKRB 3Q9NA 3UT5A 3GGSA 2CDRA 1I1SA 3DE3X 4O2AF 1ZJYA 1VE3A 1JEQB 5FOUA 1KZHA 2O7QA 4PWYA 2ZRQA 3BH0A 3IR7A 5JD3A 4LBZA 4CT5A 3KYJB 2ID6A 2F3RA 1XGNA 3LKZA 3JAMA 1NMSA 4RMIA 3KXIA 4GR9A 2NG1A 1GFSA 1LD3A 1E3HA 4EFDA 3KR1A 1ZOOA 1GPLA 1IOVA 4AULA 6LDHA 4RPCA 1JSZA 2HBZA 2IEYA 5K0NA 5CVTA 2YY5A 1QO9A 4FTWA 5I7FA 2FB9A 1FEXA 3EZXA 3QE9Y 3A0HC 1E9RA 5E3NA 3TLYA 2CL5A 1JMKC 3GNTA 4ZVLA 2R8XA 4MHGA 3TL4X 1LXTA 4ZOLB 4BJTA 5EYPA 1KI3A 4WKGA 3H87A 1U7XA 1NMEA 4L8LA 4JB2A 2ZLBA 1D4AA 2WJGA 5FR2A 3QWFA 3QFSA 1ONNA 3ZPXA 2XUQA 4XX1A 3TO9A 4RAOA 1R8SA 4HJHA 5D7BA 4B82A 4EATA 4B3RB 2BGMA 4UEQA 2XVXA 1JQJC 2Z2IA 3W6ZA 4HWSA 2QN8A 3IP3A 3MMPA 1JQDA 2CSXA 4D1YA 1Z18A 3IAM6 2QL9A 1WCIB 1K61A 3JQ8B 2DQLA 5BWNA 1CUWA 3HU3A 4POOA 3TSZA 4MDHA 1FIAA 2FEZA 4K87A 2DA3A 4IOCF 2FXVA 4MI6A 4YN3A 4DPMA 4R4JA 2D1RA 4G41A 1V1MA 1JYSA 3BMQB 3A4IA 5KNDD 1Y37A 2E21A 3K8OE 5BNTA 2CXQA 5EMJA 1XN1A 3DLCA 3BL5A 3DJYA 3KEGA 2VC1A 4BV2A 1Q91A 4XLHA 3IE2A 2JOIA 4FBGA 3PD0A 1AS3A 4TGLA 3T7TA 4COOA 3RJZA 3TUZC 2F1JA 2LZ0A 1ORRA 4Z6KA 4NE2A 5DGCA 2AV6A 4YELA 2WDZA 2ATVA 3ZU5A 1OWLA 3IVXA 1II8B 3VOBA 2QR5A 4L5BA 1YNOA 3V7WA 2FPMA 4P80A 2OR3A 1AO0A 2ELHA 4ESOA 1E94E 3FB4A 4MYHA 4NZNA 2VJYA 4HNAB 1QIHA 1BEZA 1B6TA 2AEFA 3ZDRA 3GEHA 1GQYA 5BMPA 4IEIA 3RVJA 1RFGE 1U9ZA 5IJXA 4Y6OA 4H1TA 1UWLA 4IW3B 3VNQA 3P20A 1WJWA 3WAKA 5AUQA 3PSAA 3IMEA 5KBYA 4IV8A 2VF2A 4YWHA 3OZIA 3NHKA 1ULBA 4C5CA 1GAEO 2Z56A 5F0FA 1H9BA 1KEPA 3ND6A 1JKXA 5AJTA 4PQRA 4JLVA 2K7FA 1T0PA 1JZQA 2EJVA 1HLDA 5JANA 2XUZA 2P4SA 5DISB 3T8TA 1JLKA 3HDHA 3T7EA 3DW3X 2AT1A 3ZQ4A 2N1MA 1W6UA 2VE9A 4AJIA 4ZDIA 1WXIA 1X80A 4JFAA 2X9DA 2B4QA 4IIGA 4IJAA 2XWPA 2SCUA 3HACA 2O3TA 2FG7C 1UC9A 3TSYA 4E1AA 5CB4A 4MGKR 2OESA 2IYEA 1CUVA 1Z7UA 2A3NA 2NVUB 4DGQA 5LQNA 4A8JB 2NXWA 2WP0A 2BHYA 2MWMA 2HKPA 1CF7B 3H2IA 3C7JA 1ECBA 3CC2I 1R6DA 2DR3A 3IP7A 2AN9A 4WNAA 3L0YA 4K8OA 4NR0A 4ZMSA 1DQNA 2B99A 1QCZA 1NG1A 1I0ZA 1IATA 3R9XA 1UHMA 2IYPA 1R10A 2E1MB 2JAHA 4TSFD 3GFIA 4Z7JA 4K6MA 1TJPB 1N2HA 2Q0QA 1C1DA 3HGMA 3ZQIA 3W5AA 1IO2A 1MGOA 1XDDA 2PGJA 1OYYA 4B40A 4MV3A 1PL8A 4PNEA 3K0AA 4MV5A 3C41J 4I2VA 4H4EA 1S5LC 1NNLA 4W7SA 1N57A 1NUHA 5H81A 5IAJA 2PE5A 1YFKA 5DEIA 4E7JA 3IC7A 2WLSA 3ORQA 3FGPA 3SIRA 1TA4A 2C1ZA 3SS9X 1D1PA 1ZCAA 4GBMA 1N6HA 2BMDA 4YA6A 1WIWA 4LFAB 5JY1A 1XN7A 4GVPA 1P0IA 3DVAB 5E7IA 3IP4B 5IKOA 4DOZA 2I9PA 2B6HA 2FOLA 1NA5A 3HM2A 4EPVA 2GYUA 4RA6A 3ELBA 1WJDA 5BWLA 4KYIB 2X0DA 4AT1A 3WQSB 1XSZA 3LWNA 1OT5A 2ZYHA 1N2IA 4JI7B 4QUIA 1YQEA 4RKEA 1JG2A 4KQCA 4JLUA 1P1BA 1JQLB 5C53B 2QUAA 4D9CA 3EC2A 1GEGA 1IOWA 3UG7A 3L1IA 4R83A 2MDTA 4RZ3A 4FX5A 4ROSA 4KCGA 3EEOA 3TB6A 4OMUA 1WQ3A 1XEWX 5ALVA 4M1ZA 3OT1B 1TC1A 2HYDA 1ETQA 3S29A 3CZ5A 2B8EA 1PAUA 2ZSHB 3CUQC 4DCNA 1VXRA 4GRDA 5F04A 1AU9A 1CPYA 2J0SA 4N5LA 1YD7A 1CZHA 3GEMA 1RYHA 4V2GA 3OYBA 2RGUA 3KQHA 4IH9A 3MKWB 4W9RA 3AEUB 4PE5B 4N3CA 4A3GJ 4D5EA 1VKLA 5KSYA 4GD3Q 2NOIA 4UUSA 3R5SA 4Q9IA 3USES 2X4GA 1JDVA 3PF9A 2OBPA 5IT9K 3GFTA 3AHJA 2B3TA 2EBFX 2Q1YA 2VPXA 2IHTA 1ITZA 4Q4HB 4U7HA 4TYNA 4HZUA 3WK5A 5FROA 5EP3A 3KKKA 5K1ZA 1VMEA 2FZCA 3OM1A 4P22A 4HMOA 2CFIA 1L8LA 2EK5A 5AVWA 4MPTA 4J43A 1U4SA 4C2AA 2HF8A 4D26A 1CRZA 3N05A 5EZGA 5KNDA 5H8WA 1NJFA 4HFMA 1BA3A 3ZOBA 2AKYA 5K2MA 4RD1A 4FUTA 2J4FA 4FKBA 1VQ1A 4NDNE 2QQGA 4M1SA 1A5JA 3HB1A 1WCIA 4I81A 2P7IA 4MVJA 5I7VA 4O02B 1E4OA 5K3OA 1NIPA 2FOIA 1THGA 4R6XA 2VSOA 4W7IA 1G63A 2PMWB 3AR3A 1YBAA 4O5VA 4RV5A 3JYNA 3RSQA 5JFRA 5J1SB 3ABLH 2IYAA 4CM6A 1YR9A 3EXG2 3IQHX 4NY1A 1M1ZA 1A9TA 3WHKA 2R44A 1GNTA 2QLJA 1RKTA 5TPWA 2FETA 2X8AA 4AN0A 4IY1A 5HVQC 2HHCA 2KJQA 2VKEA 3DVLA 2WAAA 2AKEA 3C74A 3ZI4A 4I50A 3HR7A 1F4VA 5IF3A 3W5IA 2WIJA 1PR6A 2CV2A 1YQLA 2BJVA 4US2R 1S2DA 3B85A 1N2BA 5HLTA 3UKDA 1MCZA 2V7WA 2ZBDA 5C46F 1DUXC 5ALEA 4EHHA 1TCUA 5LIRA 3DZKA 1A9XA 2NM0A 1B6SA 3SHOA 1R00A 3P0EA 5ICSA 1WWXA 2QRMA 2NO4A 1BJAA 1ZN9A 3FCEA 5FUXA 3B1KA 4JB8A 4IZ6A 4FNMA 2EOAA 2B4YA 4ZYZA 2CLFB 2NYXA 4I5DA 2H3HA 3CX6A 1CC1S 3Q1LA 3R7FA 2Z43A 3TUIC 4RZSA 5IBRA 5AXAA 4Q5SF 2VPLA 2FW9A 5GZ3A 3COSA 1EUCB 2HKXA 4AU7A 3QIAA 5BN1A 2HSJA 2POCA 4IX9A 2V9ZA 4K9MA 5BW6B 1NF9A 2JWTA 2HSWA 4LG3A 2CSOA 1G8XA 5HEKA 1KK0A 1CVIA 2ZUTA 2J3HA 2JFXA 5A71A 4LTNA 2AD1A 3JAKB 2C9OA 3HPGA 4ZZ2A 1R8JA 1QMPA 1OZHA 3Q7EA 3U1VA 4IXNA 2DU8A 3M1EA 1UCRA 1F60A 1E1CB 3WP1B 4LJYA 4BVKA 1XVTA 4PXAA 4OGWA 3DXFA 4G6ZA 2Z5LA 1ZUNB 4B8XA 2JLSA 2PVCA 3RLIA 5IH7A 2O8FA 2LREA 2MSLA 2HQSA 2Z04A 4G0MA 4GYJA 1S2LA 1G8AA 1JXQA 3RSFA 2XGJA 4ZV4A 4H7HA 4OGLA 1D2EA 2JCVA 2E55A 1N8NA 3OE4A 2JAWA 3OJLA 4CEHA 1R0XA 4QLOA 4UUTA 3DO6A 3HBAA 4XBFA 2ZAIA 1A04A 2F8SA 1XMSA 3SIPA 5DDGA 1FZQA 4MIOA 4WKPA 5B37A 3I6QA 3U7QB 4XDZA 2XB9A 3FCYA 1PFKA 4ZZIA 4KQ9A 2OHGA 1W1IA 1M74A 3SLGA 5FR1A 4A0QA 3ZU4A 5I51A 2BRUC 1GPH1 2R4TA 4I0BA 2IPOA 3WK8A 3GRFA 5B7QA 4JYKA 3K0KA 3UXMA 4DVGA 3I6YA 1R6AA 1PP8F 1HOTA 1I5ZA 5JJKA 3EVBA 3OOPA 1E17A 2P7CB 1TIBA 4XD2A 1WCMJ 1TZKA 5BPDA 2EGUA 3K73O 3VZRA 5D86A 1V3VA 2GEUA 1X13A 4XKWA 3KYCA 1RI2A 1XF1A 2V4UA 1TW3A 4XB2A 3GFLA 3HN7A 2ZI9A 3HP1A 4U0YA 4TTIA 5BORA 4AY4A 2P1ZA 1TRHA 4NFLA 1NN3A 1DI0A 3PQ6A 1FX1A 2DR0A 4YONB 4LHYA 1F5NA 3A01B 1A2KC 4DZZA 2I8AA 4JU8A 1ATIA 1R8XA 2FU5C 4I55A 2L9SA 2OENG 5JCOA 2JAPA 2ZB8A 1RWWA 2L17A 5JQGB 2CXNA 4HB0A 1E9VA 1XDSA 1Q11A 2ERYA 2RHLA 4XQ0A 2ACKA 2X6WA 4RIHA 2J9GA 4RPJA 1IJEA 1EWVA 4QOEA 2VTVA 1Z5OA 2FA5A 1OQYA 1P5HA 2BOVA 1B0PA 1IBSA 5ALRA 5EIBC 3BCSA 4IIBA 2YYZA 1JUMA 1MAUA 1W0CA 2O7SA 2OBFA 1D2GA 2JFBA 5JECA 3D7KA 2J9ZB 1JVBA 4V1CB 2CN1A 1JZSA 2RI0A 1UM8A 2VA9A 3OT1A 5AN4A 3W05A 1C9KA 4BDSA 2WIGA 1H6DA 2ADFA 2JJ1A 1WLYA 1GFWA 1KQ3A 3A6PC 3K4JA 4TTAA 1EGHA 4PC6A 5EPOA 2PQMA 2P5KA 5HKBA 5F1JA 1Q0PA 2HXIA 1GYPA 5KAIC 1KZ1A 2H4HA 3U3XA 2ECQA 4HWOA 1UKBA 2AHQA 4RXMA 1RZUA 1TK3A 5LYYA 3FH0A 2O0YA 4CG3A 1DAKA 3ONDA 4YJDA 3JAMZ 4GGPA 3K2ZA 3H1GA 3CJNA 3R0QA 4RESA 1OWOA 1FFCA 3L8CA 3TTXA 2GNOA 4I1PA 1X92A 3V48A 1HKTA 1EX6A 3CE9A 2HKOA 4XW2A 1EYZA 5C8VA 4C2UA 1U2PA 3FPEA 1W5CC 5M7EA 4XAQA 3MF4A 1GZ5A 2DLLA 3D3NA 4F91B 4H18A 1L7VC 3UJ3X 1GSIA 4NCNA 4D6PA 1OFHA 1SHTX 1SUSA 3VSEA 2K3PA 5FGMA 5JI3E 4FMBB 3TLXA 5FKKA 5E3JA 4BLPA 3R3XA 3VSLA 3PB3A 2K4JA 3ELUA 3WU2C 3IXMA 2PT5A 5ALYA 2WOOA 4GR5A 4BQOA 3ESXA 2R68A 1W36B 1CUFA 2Q6IA 1M5TA 4CIVA 4YFKF 5HUJA 2JZCA 2UXBB 2X6TA 1O7JA 4FI3F 4E5NA 3D1JA 2JJ1D 4BL5A 2R8RA 2IUEA 1U7DA 1SQ5A 4OK5A 3RRYA 4RB0A 4U39A 2H0RA 2BMFA 3SNSA 2NUAA 4UPDA 4LHSA 4WDRA 1P2FA 3IMCA 1JDZA 3VR4D 4LRSB 3ZN0A 2RB5A 4B3GA 4PG7A 4BQPA 4E6KG 2XVAA 1UQRA 1PR4A 1E6WA 4F3NA 4AKHA 2W8BB 4LF6B 5KMGA