3DPUA

Roccor domain tandem of rab family protein (roco)
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
519
structure length
485
Chain Sequence
PEIVKQGKEAVRQYFQSIEEARSKGEALVHLQEIKVHLIGDGMAGKTSLLKQLIGGLNVVTKQAPNIKGLENDDELKECLFHFWDFGGQEIMHASHQFFMTRSSVYMLLLDSRTDSNKHYWLRHIEKYGGKSPVIVVMNKIDENPSYNIEQKKINERFPAIENRFHRISCVESIAKSLKSAVLHPDSIYGTPLAPSWIKVKEKLVEATTAQRYLNRTEVEKICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLNTSALGYILNEEKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLDVKEFIPLPGHPDELVEYKELLGLEKMGRDRYVSGKLEKVFSVSKMLDSVIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Roc-COR domain tandem of C. tepidum, a prokaryotic homologue of the human LRRK2 Parkinson kinase
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Signaling protein
molecule keywords Rab family protein
total genus 150
structure length 485
sequence length 519
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
A PF16095 COR C-terminal of Roc, COR, domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2190 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dpuA01
1.10.10.2200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dpuA03
3.30.310.200 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3dpuA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dpuA02
4I1VA 5FL7A 1Z0KA 3NDBB 4W5WA 1P75A 2IYWA 2IXEA 3D8BA 4HLUC 1K8RA 1YKSA 3AV0B 2XOKD 3ZVMA 4MITA 3V4RA 3R9WA 5H1YA 1U99A 4ZDIA 1CKEA 4XSHA 1T0HB 3K0FB 3U4QB 2J1LA 1HQCA 1X3SA 1ZBDA 2GXSA 4P0TA 4IFBA 2QMOA 4LGMA 3PR1A 5ANRB 4JLDA 3NEJA 3CNLA 2ZJZA 1JXOA 2AK3A 2OFWA 2B7BA 1NSTA 3EZFA 2IXGA 4BFSA 2QGNA 5E7MA 5JCPA 1VMAA 5KSOA 4R7ZA 1SXJC 3OFND 1FMJA 2IL1A 3DL0A 2XJ4A 1D2EA 3L8ZA 1F48A 3BK7A 2N1BA 3B82A 1OFHA 4LJ6A 3BERA 1RYFA 2OFXA 2RGDA 3RS3A 1UDWA 4IVQA 2B8WA 3MCAA 1GILA 1GRQA 3J81k 4YC7A 1KJWA 4FWIB 4LOAA 5JMTA 2A2ZA 4JMPA 3B8HA 2R65A 2X77A 2JDID 2H1LA 2C9YA 2ZE7A 1E2GA 1FFHA 4IOKA 1Y63A 1G7TA 2FPMA 3LLMA 1IY2A 2ZS8A 2XZOA 3Q5DA 4WBSA 4B34A 4LHWA 4M22A 1NN0A 3NWJA 3X1YA 1XPRA 3FMOB 2D3WA 4XVQA 3NKVA 2JLXA 2A78A 1FUKA 3GD7A 1GKYA 3ZLJA 1L8QA 1WBBA 3ADDA 4LCBA 2RGNC 1F5NA 5EUQB 2ZRLA 4B2LA 2VH5R 4MUBA 3EC2A 4HAXA 1DG3A 4KCGA 2P6NA 2CL7X 5HR5A 4DB2A 2WOOA 4YONB 1CU1A 2WAYA 1NJGA 2CNWA 3KQLA 4JYCA 1FNMA 4LC0A 3X1XA 2CK3D 2WBLC 4RD4A 3SYNA 3EAQA 1OHHD 4IDHA 2ZEJA 4OI2A 5L3SB 2VA8A 2PZGA 2O8CB 3KUDA 1DAFA 4HZUB 1OXSC 5F98A 5HTKA 1QHIA 2VSOA 3GLHE 3MLEA 5DSZA 2Z43A 4LDJA 1G7SA 4KFSA 3U7HB 2QP4A 1W0JA 1WRBA 3EARA 2H18A 2NO9A 2AL7A 4M0LA 4CEHB 5B2ZA 1D9ZA 4JVSB 1AK2A 2L0XA 4A9AA 1U9IC 1ZVQA 3HU3A 2OT3B 4G1UC 3VU9B 3A37A 4DVGA 3W5IA 3OESA 5FPKA 2G6BA 2ZXUA 1EWQA 2PCLA 3EWAA 1TMKA 2LWIA 2RGBA 1T8UA 4JKIA 4D26A 4JJZA 4BFXA 4PC1A 1AIPA 1EK0A 4CEJB 4YMUA 2CHQA 1L4UA 5CM8B 4CYMA 2JJ1D 4PANA 1G21E 2RHDA 3EWSA 4NL4H 4QGAA 5KOYA 4PZLA 3GMTA 3QJYA 4URUR 2QE7A 3LVRE 3TW4A 4EPYA 1SXJA 2BMJA 4M1OA 4MGYR 3BE4A 1DAKA 2C96A 3AF1A 3L0IB 1IXSB 1SZPA 2ASEA 4RZ3A 2QG6A 4KJZA 3A6PC 1WP9A 3AF3A 1GAJA 4PC2A 4A0GA 1KO4A 1UBCA 4QJ5A 2OXCA 4LJ4A 4IKEA 4C3ZA 3JVVA 1KGDA 2DB3A 5IRCD 1P5ZB 5HKKA 1NF3A 2YOHA 1ZD8A 4L8GA 1KI6A 2CXXA 3G0HA 2XNDD 2NO6A 3TE6A 3T12A 5D3MA 2B7CA 1Q20A 3P32A 2W0MA 2F3TA 1TNDA 2BCGY 1JEDA 1XEXA 2ODNA 4XTRA 3LBHA 2WZQA 1BS1A 1S2MA 1G6HA 2NZ8A 1DAMA 4W5HA 1NLYA 4Y0VA 3GJ4A 4DCTA 4TLEA 1A1VA 3EZ7A 3R9XA 5DI9A 4WW0A 1TF7A 4C0HA 1W46A 3K0AA 1OFIA 5CB8A 3X1WA 2REXB 2DBYA 3PFIA 2MSDB 2VHJA 5M04A 4LYJA 4QBFA 121PA 5FTKA 5FOWA 1YZLA 2OM2A 1Y3AA 3QKRB 3VKWA 1KAOA 4FMDB 3NBXX 1JEEA 1LV7A 3B13B 1IOZA 2YWHA 2EFGA 3BBPA 1XNJA 4FMCF 4IVPA 4ZDKA 3WRYC 4AKGA 2WJYA 5CJPA 3QOFA 1DBSA 1MO5A 2AKAB 4KFUA 2BKUA 5J4HA 1VDZA 1X8JA 4OJQA 1MRSA 4M8NE 2EFEB 4GSYA 4E07A 1UKEA 2GHIA 4TYWA 1F60A 2BV3A 1D2NA 1CR1A 3GFTA 1T3LA 1WF3A 2E1RA 5ELXA 1UKVY 1N6RA 1P2TA 3K9HA 1IN4A 2C77A 5J40A 1U0HC 1KSFX 2CBZA 2FX3A 2J46A 4W7SA 3CUEF 2D06A 3T06B 1N6LA 1GL9B 1N0VC 1TUIA 4Q4JB 4BFVA 5K8UA 3LO5A 4B73A 3AP3A 4XJXA 4I1SA 1AGRA 1YU9A 3T34A 1ZM7A 4BFWA 1W5SA 1COWD 3O47A 3PEWA 3B6EA 2O8EA 4C2UA 1TQ4A 1U94A 2YYZA 2CE2X 1P73A 3ZVLA 4A92A 1NN1A 1ZC4A 4TMVA 1W0JD 4HAWA 2QT0A 1RE0A 1SXJB 1IJEA 1CS4C 1WA5A 2IYUA 3VMFA 1G8HA 4LBVA 3QXCA 1R5OA 1SVWA 1XZQA 2Q0HA 2ZE6A 5KO2A 3TUJC 1OSNA 3PXGA 1AKEA 5TDHA 4AC9A 4AD8A 4CGZA 2QI9C 1YVDA 3CX6A 2IA5A 1LTQA 4URWR 3NBZC 1KDPA 3IKJA 4TL9A 4C9BA 3GJ7A 3D6TB 2W83A 2AFHE 5EP3A 2YWGA 1P9NA 4KO8A 2D2EA 3P1JA 4RKEA 2OO7A 1EXMA 2NGRA 4XOIA 4O2RA 1B0UA 2ZI4A 2ZI5A 3BOSA 5FUXA 4MGIR 5G3ZA 821PA 1EFCA 4KHZA 4Q9KA 4NYIQ 4M9ZA 1XCMA 2GAOA 3NBFA 4NYMR 4DDWA 2B6HA 4B76A 1PLJA 2D7CA 4G5OA 2NPIA 4Q48A 4NYJQ 1KMHB 1MRNA 3B1WA 3GLFA 3O8CA 4L9SA 1Q22A 3TAHA 1VIAA 5AUOB 1OYYA 2ZANA 2IXFA 3BH6A 4JLAA 5D3MB 1NVVQ 4UQOA 3TSWA 5FH9A 1P61B 3LQQA 2FWRA 4DKXA 2VHCA 1T3SA 2EU8A 2GCOA 4NYIR 2ZREA 5KNCA 3SJAA 1VHTA 4R2HA 2G1JA 4Z8YA 3PITA 1TQDA 1GTVA 3DKVA 2D2FA 3EC1A 2O0JA 4MYCA 2X19A 2NIPA 4A1FA 5IHPA 1SKYE 2EQBA 1G8YA 1VPLA 4EIWA 4WIAA 5C4MA 3JZAA 5TXGA 2F7SA 1TUEA 1MT0A 4JL6A 1JR3A 4C7OB 2JIZD 5L3QA 1A7JA 2QAGA 5FBWB 4UNSA 1Z08A 3M0EA 1E1RA 3SS8A 4QBIA 3BWDD 2R6CA 4DCVA 2EVWX 3WNBA 2WSSD 1UBFA 2Z4RA 2WWGA 5EE0A 1SULA 3LD9A 1AJEA 3LAWA 1ZNWA 5CYOA 3ZDQA 4ACBA 2QM7A 2HT1A 3QKSB 3I61A 3BFKA 1TX4B 4JVNA 5CDFE 1J90A 4GPTA 4DC9A 1WE2A 2CHVA 4LC1A 3CF2A 2JLZA 1YZKA 4X8LA 1AS2A 3K53A 1E1RD 4NHOA 2GZDA 4V03A 3CF6R 3LW7A 3RS7A 3FMFA 4F38A 4R71A 5K8LA 1XEFA 1Z6XA 4PZYA 3PQCA 2RKOA 2JIZA 4C0JA 2QM8A 1KZ7B 4M1YA 1U8YA 1QHHA 1U98A 4YMVA 4DCUA 4B3GA 3OEHA 1KI4A 3CR8A 1CJKC 4XD7D 3REFA 4A4DA 2KE5A 1XBTA 1SXJE 1F2UB 4OHZA 3T61A 2XZLA 3I8XA 3QVUA 3RRYA 4L16A 5FI1B 4M1SA 1NI3A 2NG1A 2YWEA 4YXWA 8OHMA 2IS1A 3U7EB 3CO5A 5KDDA 4DJTA 4D25A 3MD0A 2A30A 5IK2A 2OE2A 3IDQA 3C16C 1ZD9A 2IW3A 2O5VA 1COWA 3ZIAA 2ZPTX 4CT4B 1IXZA 2GZAA 4TTQA 4OHYA 4RJLA 3RS5A 4B47A 1KI9A 2F1RA 2FG5A 1Q3HA 2NO0A 2IX3A 4LJ8A 4H1UA 2QBYA 2HF9A 2YZ2A 1IHUA 221PA 3QXXA 3KQKA 1LS6A 3B1YA 5DH9A 3MWYW 1KNQA 3EPHA 1KI2A 1W4AA 1MABA 2GBLA 5FTJA 2VBCA 2IHYA 2ZYVX 3OE7D 1R5NA 1IY0A 1YJ5A 3NDPA 4MKHA 4YLGA 1VHLA 2GETA 3ADKA 2WHXA 1OLOA 3W6NA 5JJIA 3VR1A 2ZTSA 4MUAA 1E6CA 4IOLA 3SHFA 3Q72A 3UWKA 3DO6A 1Z0JA 4JSTA 2CL0X 5JSZB 1TU3A 5FI0B 1DAEA 3AVVA 3VNUA 3FOZA 3I32A 1OIXA 4D4JA 5KTYA 3SJZA 3SN6A 1NN5A 1S9HA 4NCKA 2B92A 3T1QA 1G7CA 1II8A 4C0BA 1N2CE 4QGFA 3SC3A 4S2EA 4JS0A 4C0KA 5SZJA 1FZQA 4QG7A 2C99A 3FFBA 1F3OA 2R62A 4IEEA 2QQ0A 2V7QD 4V0KA 3IHLA 3ZQJA 4FCTA 4BZQA 3QBTA 421PA 4TYNA 2W6JA 2GESA 3RS2A 2WV9A 3SI7A 4EJSB 2YNMA 4LV8B 1GG2A 3QI2A 4GDFA 1CLUA 1F6BA 4Q1FA 1AS0A 2F43A 3AVTA 1NIJA 2HCBA 1DVRA 1XB2A 4QC2A 4DT1A 2JJ2A 1XEXB 2YC2C 5HZKA 2CLDX 2ZS7A 4D4KA 2V3CC 1XFAA 1FP6A 3BXZA 5AWFC 4BLOA 4Q00A 3Q7QA 2J59A 3M6AA 3P4YA 2QN6A 2FV8A 3BB1A 1JJ7A 1IN5A 1XWIA 3FHCB 1AQUA 2VHQA 4KI0A 4B74A 1BOFA 4PQRA 4Q4LA 4B6EA 2O8DB 4QGGA 4BRUA 1N6KA 1XEWY 3BRWD 1Q1EA 3KJGA 3CLVA 3UMSA 1CJUC 4Q1DA 4BLPA 1P7CA 2Z0MA 4LK2A 5JEEA 4ON9A 3EIHA 4PR0A 4TLBA 3SZRA 5L8VA 1KK2A 2BWJA 4F4CA 1RFLA 3P27A 1SXJD 5G40A 1NBME 3ZZTA 2IEZA 3NC0C 3BB3A 3CWQA 3KX2A 3MSXA 3QXJA 3KDSE 1E0AA 5BN3A 1DELA 2IUUA 4AG6A 3EZ9A 1RVDA 4P32A 2F9LA 5JWRA 1OJLA 5J4KA 2WM9B 3QKUA 4ARZA 2GK6A 3SNHA 1GP2A 2YHSA 4IOMA 4KVAA 4XWOA 3E70C 2RGCA 3AVOA 1YZUA 1HE8B 2ZSDA 2CLSA 1G19A 4HLUA 1UF9A 2J87A 1FMLA 3GFOA 4PO1A 1Z28A 1NKTA 4CT5A 4BECA 4XVUA 4ESVA 4KITB 4LHVA 4ERNA 2ATXA 5JS7A 4TZ0A 3TAUA 2QORA 2NO7A 1ZIPA 3AQ4A 4WA7A 4CEJA 1UADA 2VP4A 4XWAA 3FYHA 3KKOA 3SQWA 5GJVC 2WKPA 1P60A 1XRJA 4YQFA 5EZ5A 1T5LA 3K9NA 1U0JA 4EKDA 1EX6A 1UAAA 2GEVA 2XNDA 3U44B 2Q9CA 4FIDA 1ZYUA 2AK2A 3IEVA 4V0OA 4IRUB 2IC5A 1WXQA 2DHRA 2JASA 4TQUS 1VG1A 2W0SA 5FUVA 2WWFA 2X2EA 4BLRA 2GZHA 2OEPA 3TBKA 1GRRA 4BPBA 1YZTA 5EP2A 1CBUA 2CNWD 4DCSA 1CXZA 1YHNA 1BO6A 4P33A 2IS2A 1QHNA 3UG7A 5KSZA 2VPPA 1E9AA 5FPSA 3KQNA 2JLQA 3K1JA 2C78A 1P9RA 3GLFE 1E2DA 3LXRA 1KOFA 1OT3A 3AH8A 4HZIA 4W5JA 5GJCA 3CRMA 1E9CA 2N46A 1UEJA 4L5BA 1DS6A 2ZE8A 2ZSAA 2NZJA 1DAIA 1JPNA 3K0EA 4Q66C 5SZKB 4C30A 2J41A 4MGKR 4E5UA 3GJ6A 4HSEA 1GOTA 4MDFA 2BMDA 3OIYA 4M1KA 2DWQA 3ZVNA 2CJWB 2JJ1A 1M6NA 1MO6A 4ZIRB 3EXAA 2BHRA 2QAJA 3CH4B 1E96A 1ESNA 4QHSA 1B23P 1GNRA 1CEEA 2VP6A 4EQ6B 4Q7KA 1SKQA 3W3AA 1IXRC 1G1MA 1N6IA 2CMKA 4DSOA 2GXUA 5FBRB 1G20E 3PG5A 5AUQA 5FOTA 4B35A 2GWHA 3ZD7A 2CHGA 2BBWA 1FW6A 2BMEA 1XDBA 1KJYA 1IN6A 3CX8A 1VYUA 3HWSA 3U6BA 2QA5A 5EE9A 3MFYA 5IK2D 3DPUA 5FOSA 2GVDC 5LB4A 2HEIA 3TSZA 5CLLA 2GA8A 3LA6A 2VSFA 2WWXA 4GI7A 1OIWA 2QROA 1KHTA 3OFNA 1PUJA 2QMHA 4OL0A 4QJ4A 3GLIB 1KSHA 5EUMA 1GKIA 3IIMA 2RGXA 1Z6AA 3LV8A 2R8RA 2N42A 2BBTA 1VIYA 2Q9AA 2D62A 5UKDA 2ODEA 3E5HA 3I3SR 2JLRA 1E2QA 1WQ1R 4NYJR 4YMTA 3L43A 1W1WA 3SQXA 4Q5IA 1VCOA 3GJ3A 1J2JA 1SQ5A 1E9BA 4F93B 4CEIB 2OHFA 4OK6A 2BVNA 3CONA 3NC1C 2D74A 1N6HA 1D5CA 2ZRNA 3IIKA 3DM9B 2CCJA 1I4TD 2ZYUX 3TJZA 3WNCA 5JWOA 2A5JA 3KKNA 5FTNA 1II8B 1G6OA 3GLFB 2WSSA 4TLCA 4A8JC 2KB0A 3OAAD 1YR7A 4A6XA 2JDIA 2W6IA 3HPRA 2HXSA 4P4SA 4UNNA 3FWYA 4NH0A 2J0UB 4A2WA 2Q21A 3UXMA 2WJJA 1CTQA 4DSTA 4RZ2A 1ZM9A 4Q19A 3EZ6A 3GEIA 5KSPA 1VG9B 1NL3A 3D31A 4Q01A 1OYWA 2IF0A 1XTJA 3NIBA 3KFVA 4RKFA 4RZUA 4KVGA 2BIFA 4DLYA 3GEHA 1XTRA 1T91A 1HE1C 2NO1A 3X1DA 1TPZA 1E2LA 3W34A 521PA 1JNYA 1RKBA 2OCPA 2AHOA 3CF0A 5FBQB 4BASA 3IBYA 3WP0A 3GLIE 1KY3A 2BCJQ 3CRVA 4HEJA 2P5TB 1ELOA 4QNMA 4NCIA 1NBMA 1ZU4A 5DYIA 3W8NA 4Z51A 3AVXA 1HT2E 3EA0A 2CVHA 1FTNA 1GITA 1R2QA 5BYKA 5DN6D 3CNNA 1E79A 4I81A 2C2HA 4NTZA 3H86A 4MRNA 3FMIA 5BWMA 4JLNA 3W6OA 4DIDA 2H5EA 4LJ9A 3N70A 3UIEA 1M7BA 2V1XA 4BQSA 1H8EA 3AP1A 3AKYA 1OPXA 1TF2A 3A4LA 5A5GA 1Q1QA 5C4GB 1OKKD 2VYFA 3KXIA 2DFTA 3DDCA 2ZUDA 3MGCA 2Y8EA 4LY6A 1GNPA 4M2LA 2HLDA 3GLHB 3MJRA 3GP8A 1QHSA 2GVZC 5BYJA 4B3DA 2EWVA 4QXAA 4DB4A 4DDVA 1ZNXA 2WJIA 4URZR 3IGFA 3O8RA 3OIVA 2FZLA 4B32A 3FDIA 3BJIC 2QSZA 4O25A 2F1IA 3C15C 2VO1A 4TYPA 2BBOA 3WYGA 1A2KC 2PX3A 3TR0A 4ESHA 3MAAC 2OLJA 1NN3A 5J5CA 5FFMA 4B3XA 3AF4A 1ZUHA 2WWWA 5K8TA 4NBSA 2VP9A 4ZDJA 4B43A 5BN4A 2XXAA 6Q21A 2FDCA 1XP8A 2ODBA 4LWZA 1KO5A 4PPNA 2QUZA 3K8YA 4ZCIA 1E2KA 3QPUA 2ZJYA 4Q9IA 3K9GA 3LXXA 1LF5A 2X8AA 3EZ2A 3NTUA 3R20A 3ASZA 4QKQA 2PZFA 1NVWQ 3KJIA 4ZKEA 1ZM3A 2QTHA 2DYKA 1EWRA 1W4BA 3AF0A 3QPWA 2EYQA 4Q02A 3UMFA 5JLJA 1E9SA 1EX7A 2C95A 2VSXA 1X1RA 2ZRAA 4EFNA 3VNVA 2J0UA 1Z5ZA 4FMBB 1US8A 3F5FA 3VHLB 1YZGA 4EPXA 4ZIRA 4M9XA 5JHGB 2YOGA 4NU0A 4RFSA 1E0SA 4GMDA 1JB1A 3X1ZA 2JLYA 1U0LA 2R44A 3VR4A 1XU4A 4M1MA 3L0SA 4GOXA 1MOZA 2J7PA 3PUVA 3GFPA 4GNKA 4NMMA 4PPQA 1ETUA 1G16A 1ODFA 5F9FA 1JQJC 4WZAE 1J8MF 5TMPA 3IQWA 4Q4AA 2VHTA 1Z2AA 3AP2A 4Q9JA 1NMXA 2CVFA 2IYZA 3D3QA 1YR6A 3CPJB 1T6NA 3FMPB 3KTAA 1JR3E 2B8TA 3FGNA 2CEAA 4G01B 3OIWA 4JT4A 2GKSA 1KMQA 3HJNA 2RB4A 1MV5A 2A3RA 4KAXA 4QOSA 4CIDA 1ZP6A 5H68A 3BB4A 2Q3HA 3PV0A 1GKUB 4HDCA 3LBIA 4KBFA 4TMXA 2IYLD 2OCAA 3JVUA 3I5XA 5J4VA 1UEIA 4MDEA 1CR0A 3K0FA 3U4QA 1CRPA 2PT7A 3E1SA 4QNRA 3PVSA 5H8WA 4LBZA 3ZS8A 2Q3FA 3RRNA 4Q1BA 5BQ5A 1K5DA 1S4QA 1KI3A 2BMFA 3F0TA 3IO3A 1M2OB 3U3KA 1Q12A 2OG2A 1AS3A 3DM5A 3LX8A 4JLPA 1E98A 3FVQA 1XJCA 4M4SA 2C04A 3A1SA 4Z1MD 2O8EB 4Q1EA 2G0NA 4GZMA 2UVQA 2IWHA 3QSYA 1XCPA 4FN5A 3THWA 2GJAA 1M8PA 2EYUA 4RD0A 1Z83A 3TGPA 3GLGE 1E9RA 4HB3A 4Q47A 3W9YA 3L8YA 5B57C 3CRRA 1M1YE 3NVAA 1BMFD 1OFUX 3THOA 4OI0A 4CRWB 2WJHA 5EP1A 5HE8A 1XTSA 2XNSA 3DZ8A 4BFZA 1MR3F 3CPEA 4LV5B 1VCIA 2IEYA 3FKSA 5CM9C 2HF8A 5FOUA 1DARA 1GNQA 4V02A 4BFYA 4O2LA 5LD2B 3TIFA 1AQYA 3QBVA 1E69A 1M7HA 2PL3A 2G88A 3B60A 2PLRA 1RC8A 2QBYB 2P6RA 3IUYA 1PLLA 3MWJA 4US1R 2IWRA 5L3VA 1R6BX 1ZD1A 1KK3A 3PEYA 4LV6A 2QRNA 3SHWA 1KKLA 1TEXA 2AWOA 1S1MA 2ZVQX 2ZJ5A 3K0CC 1AZSC 2I1QA 1BH2A 3KKMA 1KK1A 2F1JA 4OQNA 3ZGXA 4AKEA 1OXVA 4HI0E 1XEWX 4I1UA 4CVNA 1R0XA 1Q0UA 1G18A 4MKIA 1LFDB 1Z22A 2EFCB 3ECCA 3WP1B 5J4YA 4D80A 4V0LA 3KL4A 1L4YA 3Q8XB 1E4VA 1I4LD 1MKYA 2HV8A 2A5FA 1G8FA 2QP3A 2RH5A 2WOJA 2YWFA 3IPYA 4Q4JA 2ZYWX 3WMFA 2ZR9A 3MRSA 3WMGA 3U6KA 5P21A 2O8DA 1R8QA 2OUKA 5KSYA 4QM6A 1UDXA 2MMGA 3T1VA 1K6MA 3HR8A 5HPYB 1N6OA 2OZEA 1X8LA 4B2PA 4OQFA 4N3NA 4IHQA 1OHHA 2ZROA 4DZZA 4RSGA 4D81A 2QPTA 2SHKA 3QF4A 4FW9A 4UJ3A 2O8BA 3AVQA 3ZH9B 2IYQA 3QG1A 2AN9A 1W4RA 2FFAA 1W48A 2KJQA 3TMKA 621PA 4GZLA 2IS6A 2VTKA 4HLDA 2XSZA 4ZV4A 5BXQC 4IW3B 3E2IA 3OEEA 1KDRA 2O8FA 4XSGA 4Z8XA 1YR8A 2A7QA 3QVVA 5DYGA 4B3CA 2OCYC 1I2MA 4EPWA 1NY6A 1DADA 2FPKA 1Z0FA 4QBGB 1TF5A 2BKEA 3AVUA 4NONA 3K09C 3OEED 1Z0AA 4TMWA 1HTWA 2Q6TA 1N5LA 2XTMA 1KSJA 4H1VA 4DSUA 5FUYA 1CR2A 5IF9A 3RWOA 5JWHA 1DTSA 4Q9HA 2DWPA 5KHOC 1Z2CA 2V54A 3RNLA 2FH5B 1YE8A 2QMEA 4DLTA 3Q7PA 1GDDA 1W49A 3VFDA 4P31A 4DLVA 3ADBA 1EFRA 2J45A 4JLOA 2HYIC 2Z83A 4JLMA 4KYIB 4PQYA 2CDNA 4QM7A 3NBYC 4PAOA 2AR7A 1TQ6A 4E03A 1KZGB 2ZRHA 3CB4A 3PUXA 2GAAA 3OHMA 4V0MA 4EFMA 4P4TA 2IYTA 2FSGA 2X2FA 5JSZA 4ILEA 4B44A 4JJKA 4OK5A 1LY1A 4M1TA 4HZUA 4R9UC 1W2GA 5EXSA 1XD8A 2OBLA 4LYHA 5G3YA 3HU2A 3LQRA 3H2YA 4EPRA 5GVSA 4TWZA 1RRCA 2QAGC 1E2EA 5FL3A 1A5TA 5CB6A 1QDEA 1GVNB 3U44A 1E2MA 5EZ6B 1Z47A 1FPMA 2REBA 2JAQA 1G291 5KNDA 2F55A 2WWIA 4Q4HA 5AJZA 3BH0A 1E2IA 5C1BA 4B48A 2ZAMA 5EE1A 4FCWA 4Q4HB 2OAP1 4E09A 3FKSD 1OXTA 4ASUD 3THXB 3UATA 3MJHA 5JEDA 3VAAA 3QENA 1US8B 2VRWA 3QEOA 3QXSA 1JALA 5FOXA 3REGA 4K8OA 3TVDA 5EJEA 4JBYA 2AXNA 1TU4A 2OSBA 1R10A 4TTRA 2W2VA 4DLUA 5E7IA 4Q7MB 4MYTA 1Q21A 4B3FX 1Z06A 2V8OA 3ETLA 4N1AA 4D0NA 3QF4B 3TK1A 2O8BB 3RS4A 2QPAA 4LHYA 4OYHA 1KJZA 2GEUA 4TLAA 4MQBA 4TSFD 3C4JA 1ESMA 2ZUBA 3DOFA 5E3HA 2FNAA 3U61B 2RGNA 2H57A 2DPXA 3O8BA 4JLBA 2GBLC 1J7KA 1C9KA 2FPLA 4XVRA 3QPVA 3RLFA 4URXR 4UJ5A 3NG1A 4Q7JB 4D4LA 4PSKA 2HUPA 5CK5A 3BC1A 4HDOB 1E1QA 3R9IA 1FQKA 4X8OA 1A2BA 4UXJA 3ZZ0A 3AVWA 5KUTA 1KDOA 2BM0A 1SVSA 3M1IA 4UNPA 2XXAB 1P2VA 3ONWA 3AF2A 3F3YA 4MRRA 4Z54A 2PCJA 1KI7A 4U5XA 2P3SA 1VYVA 4TT3A 4D4MA 4LJYA 2W2XA 4EJSA 1ZW6A 1XD2A 1HY3A 2JATA 2J9RA 3IEUA 1FTSA 2XTZA 1IJFA 3HU1A 4PC6A 3U3MA 1UBGA 4BZXA 2JCSA 4C7OA 5JRZA 3A8TA 1AM4D 3BIFA 1UPTA 1OH7A 3A58B 1XPOA 2RGAA 2ZE5A 4N0DA 4G5SA 3SR0A 4TYYA 2FGJA 1KKMA 3I92A 3WBJA 4C0LA 1K5GA 2ECKA 1G41A 2QTVB 3L0PA 1NSFA 2OAQ1 3KQUA 2ZJBA 1CR4A 2PLFA 3FFAA 3EPKA 1DO2A 1XZPA 4QHTA 3U5ZB 4NP6A 4JLVA 3KKPA 5DGXA 4GOJA 2RCNA 1G8PA 5JZVA 1E0JA 1N6PA 1W5TA 3C5HA 4NCNA 3TH5A 4BEBA 4JKYA 4AY2A 3VR2A 2R6FA 3U3OA 3BFXA 3ADCA 3SOPA 2IBMA 4PPGA 3RYTC 4JLKA 5DN6A 3PIRA 4I4LA 2A5YB 3T35A 3KQHA 1E4YA 2G1KA 1W36C 1AN0A 2GCOB 1NBMD 5FBVB 2Q3MA 4A8JA 1HA3A 1Z63A 4A0HA 2ZRIA 1L7VC 2QENA 3SFZA 3B1ZA 4U7DA 3B2EA 3QY0A 1CJVC 1U8ZA 3C5CA 1JECA 4ZPXA 2OBNA 5H70A 1PLKA 1X8KA 1S3GA 2WMNB 4OBEA 2MMCA 3CRQA 2ATVA 3D7MA 2RMKA 4KODA 4JIMA 4JT2A 3EX7C 1FP7A 1D9XA 1KK0A 1NKSA 2ZU0C 2PBRA 4OJKA 1VG8A 3RWMB 2PX0A 4O0MA 4BWYA 1JI0A 1Z6TA 1R8SA 3F8TA 4FMDF 4P4UA 2W6ID 3GPLA 4OHVA 1OB5A 4PO9A 1SVKA 1G3RA 1T0JB 3DOEA 4BLTA 1O87A 4PAQA 4IDOA 2VHUA 4IOJA 2VP2A 1LNZA 4WZBE 4BFTA 4KV9A 1N5KA 3KB2A 5KDOA 4M53A 4OQLA 3V9PA 4DWJA 1OB2A 3B9QA 2BM1A 2GJSA 4B2IA 2O8FB 5BN5A 4Q7LA 1HUQA 1XCGB 4L4UA 2C03A 1XJ0A 2EWWA 2KSQA 1HT1E 4IJMA 4U00A 2FJUA 2J0VA 2KBEA 3PUWA 5AJXA 5JCZA 4E22A 4HUTA 1F2UA 3PUYA 3P20A 2G3YA 2R6DA 4HB0A 2ZQ5A 4JBWA 3RC3A 2FU5C 5AUNB 1YR9A 3K0CA 4CZ2A 3EIQA 1OV4A 2IYSA 1GWNA 1XMSA 2R6AA 2ZYTX 4KLNA 4OHWA 4B33A 2O8CA 5LB2A 2I1VB 2ZRKA 1E94E 1QHGA 2FEOA 3VX3A 5CIQA 3LVQE 2OBMA 3HYTA 2JA1A 4LHXA 4C0QC 1XXHB 2DCUA 4LBWA 3HDTA 4PC7A 4Q21A 3WY9A 2W2TA 1X6VA 2NOAA 4YMSA 1XXHA 2C5LA 4HLCA 4CEHA 5G53C 4QGHA 5GJBA 1LW7A 1S3SA 4FWTA 2F9MA 1CJTC 2ZRDA 3W90A 5AK0A 3G82C 2G9NA 3VTKA 5C46F 1PV4A 1XMJA 3ICEA 1W47A 1KNXA 4U02A 4EJSC 4OK3A 4FI3C 3ZYCA 4BLSA 2ZS9A 4ZKDA 3SYKA 2LKDA 2CLCX 4PFSA 4LUCA 4MGZR 2JJ8A 3FKQA 3W6PA 3UKDA 3CNOA 2IK8A 5JECA 1NG9A 2DY1A 1DO0A 2BEJA 1PZNA 1U9IA 5B64A 2GF9A 2GTPA 4LBYA 3K70B 4DT1B 4GMXA 4BRWA 1YRAA 4ACAA 3ICQB 2DR3A 4RFSB 3TRFA 2ZI3A 3PUZA 1VG0B 3QKTA 1KY2A 4X8HA 4F4IA 3H4MA 1HH4A 1J70A 1QVRA 2ZUCA 5AJWA 4DLZA 3T1TA 2ZU6A 3IQXA 4RY2A 4LI0A 1CRQA 4JVLA 1QG4A 4LYFA 1EESA 2JGNA 3NXSA 3IHWA 4AYTA 2QPOA 1S96A 4KFTA 1V5WA 1JAHA 2A5DA 3QNUA 4A2PA 3LW8A 1MABB 1J99A 3K70D 4TQ9A 1KAGA 2ZR0A 4HATA 4HB2A 1OH6A 3P4XA 1YRBA 2DFNA 3AKDA 2RGGA 3Q5EA 1RYHA 3AUYA 2ZRMA 2XZPA 1CIPA 1BYUA 2AD1A 2REOA 1NJFA 2QGZA 4A8JB 4DEXA 4JYBA 3FPAA 1Z29A 3UMRA 2XB2A 2RGEA 3W5JA 5CIWA 3PEVA 1D8TA 2X1VA 3WBKA 2NTYC 2IYYA 2PMDA 2P65A 2V55B 1FX0A 3U7FB 2FE4A 2ZIAA 4QRHA 1G8GA 3HYRA 2WIBA 4DBLC 1QBKC 4RCZA 3DVLA 1U8AA 2VQSA 4RD2A 1IM2A 1Q57A 2HJVA 4KXFB 3CBQA 2HYDA 4US0R 4RZXA 4B71A 1OXUA 3KTAB 4Q9LA 1EFTA 4DUGA 1NVXQ 5FOVA 3BGWA 3QUSA 4WXRA 5AJYA 3PJRA 2WIAA 4ABYA 5DHFA 5KDLA 2R9VA 3I5YA 3LLUA 4P3YA 5CYPA 4DLRA 4LJAA 4GFDA 2FFHA 2J5XA 3IBGA 3CRW1 2QY9A 2FFBA 3ND8A 1Z0DA 3A1TA 1TTTA 3B7GA 1YZNA 1CP2A 2BC9A 2ANBA 3U7GA 4TN1A 1P3JA 1V43A 3BAFA 3BH7A 2QNRA 4A0FA 4MH0R 5DIFA 4HDQB 4DDUA 1HYQA 2TMKA 3NEYA 3GLHA 3R8CA 4IVRA 5IDVA 1P72A 1RPZA 3VKGA 2XTNA 3AKCA 1SGWA 4CDGA 1P6XA 2ORVA 2ZRFA 3KKQA 2ZRCA 2V1UA 3DHWC 5FPYA 3MG9A 1JAIA 1NVVR 2PT5A 3KUCA 1QHYA 3BFVA 2CCKA 3QE0A 3W3ZB 1Z8FA 3LH5A 1JQLB 3DZDA 3TW8B 1GRNA 4RCYA 2XGJA 3B9PA 3H0KA 5D3QA 2ZJOA 1XMIA 2V7QA 1G4AE 4A82A 3OF5A 4RVCA 3AM1A 4NYMQ 4AYXA 2ZRJA 2HDNB 4MRSA 2G83A 1VKJA 3Q9LA 1EG7A 4PC3A 1FNNA 5HZHA 1AA9A 1Z6YA 3GJXC 4BZPA 4PX9A 4MKGA 4DSNA 4LPKA 5TV2A 1E2HA 5HKKD 1SKYB 1P4SA 5EQTA 3VR3A 5TY0A 4OI4A 3A36A 2ZSFA 1N6NA 4K81B 4AKIA 1HURA 2F1HA 2WKQA 2KWIA 4HAUA 4L15A 1XX6A 2WJGA 4XIGS 2P2LA 1YQTA 3EASA 3TR5A 3H84A 5C18A 3K0SA 2BEKA 2GILA 2WKRA 3TVTA 4NPHA 2HJGA 2J7PD 2Q9BA 1C4OA 3R7WB 4ZI3A 2WMOB 5F9HA 1W0KA 1AGPA 2V6JA 3N2IA 4HAVA 1I4DD 4ZCLA 3ZJYA 2FMXA 1P2UA 2VP0A 4I99A 4QFMA 3HR7A 3NH6A 2FN4A 1TAGA 5FTLA 1E3MA 4S35A 1R7RA 2FA9A 2QTFA 1RW4A 1AKYA 1C1YA 2GJ8A 2JJ2D 2OFOA 3TQFA 1E2PA 1WB9A 1OH8A 3HPQA 1KI1A 1PJRA 4PSVA 1JBKA 3T15A 4D6PA 1HEIA 2D7DA 2ZETA 1I2DA 1R0ZA 3AB3A 3CWZA 1RRPA 1KO7A 5GVRA 3THXA 3AKEA 3AGPA 4L9WA 5JRJA 4GP6A 5CK4A 2IYRA 2EFDB 2ONJA 3T5DA 3TKLA 3LBNA 4POAA 1NG1A 2P5SA 3LRPA 1KSGA 4AI6A 1T9HA 1ZJ6A 3UK6A 4YXWD 1N5JA 1TQ2A 1NLZA 2PJZA 1RRGA 1JXMA 1W44A 1ZM4A 1ANKA 4XH9B 2ZI6A 4KYUA 1H8HA 3THYB 1GL7A 1D6JA 4A2QA 4BE7B 3GJ5A 1E32A 3EW9A 3I1FA 4J0QA 1ZM2A 1UM8A 2ZAOA 3C7KA 3CX7A 4JL5A 1CF4A 1W4CA 1OH5A 3MUFA 1Z3IX 3TQCA 4JBXA 3WMEA 1X1SA 2ZRPA 4IEIA 2LKCA 1E2FA 2PEYA 5F2EA 3RSOA 1RIFA 3OE7A 5FPTA 3ZD6A 1W2HA 3LWNA 4EQ6A 3EA5A 5KU1A 5JFGA 2GNOA 1II9A 4ZO4A 2JLUA 1OKKA 5G41A 2ORIA 4US2R 1IQPA 4PPFA 3VHXA 2JLWA 4NDZA 4G5GA 3VU9A 3LDAA 2HXYA 4ZI2A 1H8ED 2ORWA 3RAPR 2UZ3A 3CPHA 1DPFA 1G3QA 3CR7A 3I4LA 2ZSBA 1R5BA 1QHHB 3EPJA 3M4YA 4P4SB 3V4FA 4D0LB 2FGKA 2V6IA 2FSHA 5DLQC 2C8VA 1P62B 1JJVA 2XX3A 3BS4A 1G3IA 2GEDA 1H8HD 4UXHA 1E2NA 2H7VA 3U3RA 3LY5A 5EE5B 4IFEA 4PXAA 4TLDA 3NHAA 1XD2B 3RSLA 1EGAA 3ZZUA 2ZVPX 1M7GA 2QRZA 721PA 4Q4AB 1FUUA 2H16A 3GCGA 4CW7A 1E9EA 2WVJA 4JSYA 3SJCA 3SBEA 2ODWA 4ZCMA 1DOAA 2DFLA 5GJWC 1WDTA 2UKDA 3S1AA 5J4LA 4G5QA 1GIAA 2J0QA 1XTKA 2YJTD 1NLFA 4DIEA 3WNDA 2GJ9A 1Z07A 4HUQB 1S0UA 4FXPA 1WBDA 2IF2A 3DPTA 1SVOA 3QKSA 3A1VA 1UKZA 2XOKA 5EP4A 4F92B 4A15A 2IYXA 4QL3A 1Q1ZA 3TNFA 2PMKA 3VX4A 3FHOA 2GRJA 4BGDA 5AJVB 1W0KD 1TEVA 3VR6A 4EPVA 5FR2A 4O3MA 4TMTA 5FTMA 3CM0A 1XJQA 4WVFA 4Y0AA 4M21A 4DRZA 2GXAA 2XB4A 2E9SA 2F3RA 3OZXA 5TB5A 2GJKA 3SYLA 4IXMA 3THWB 4URVR 3K9LA 2ZJ2A 2G77B 4C0SA 1ZINA 1EFHA 1IBRA 3A4MA 5KYKA 3OIUA 1JR3D 1KO1A 3ASYA 1ZC3A 5TVKA 1E0KA 4Q18A 1G64A 2HCJB 3GJ8A 4UNRA 5LPNA 1BKDR 2KI5A 1QHXA 3RHFA 1P9WA 2ERYA 4MKFA 5DISB 2QAGB 3AVPA 2OCBA 3DMNA 4HUQA 3U60B 1E1QD 3GJ0A 1J8YF 4OQXA 2GF0A 2IYVA 2ZI9A 3W8RA 3R8FA 5DI3A 1OXXK 1GUAA 3C41J 2WPDA 3NHBA 4YDHB 4A6PA 5A4JA 1NNEA 3AVYA 4F91B 1XXHE 4AURA 2C9CA 2ERXA 1ONBA 1RJ9A 3WYFA 2PEZA 1ZNZA 4UNQA 2W58A 2P6UA 1EFRD 2E87A 5FR1A 1VECA 2GK7A 3U3JA 4JL8A 1S9DA 2I3BA 5EXXA 3TLXA 3I62A 2ZM5A 4B3BA 1GM5A 3RDPA 3FB4A 2H8KA 4HAZA 2CL6X 5HCNA 4DLSA 1W7AA 1N25A 2CCGA 1SVMA 5E7JA 1GL6A 2R2AA 2XJ9A 2ANCA 1DE0A 2WICA 3QXHA 2OILA 1VTKA 4X8MA 2IS4A 1E2JA 3VQTA 4AK9A 4ITRC 5CITA 1UJ2A 2G0TA 2PH1A 1OE0A 4ASUA 1D2MA 4MRPA 3EPLA 4WZ6A 2FSFA 1R0YA 1W36D 2JLVA 2P0EA 2VLIA 1SVIA 1NP6A 4OQMA 4DUGD 2FEMA 1KYIA 5IT5A 3KXLA 2WWYA 4HB4A 2VP5A 4TMKA 2WJVA 3FE2A 2NQ2C 2CE7A 1W36B 3EIEA 4W9MC 4FINA 2FOLA 5SZIA 3CZQA 2YV5A 2QQEA 4V0ME 1FQJA 1OF1A 1DG1G 2QT1A 2XSZD 3B1VA 3RANA 5KPJA 3CIOA 2WTUA 3MWKA 1KTVA 4MA4A 4TL7A 2F43B 2FZ4A 4AG5A 5LD2C 4OKSA 2IUTA 1SHZA 5GADl 2BOVA 2KBFA 4NE2A 4R98A 1E9FA 1N0UA 1ZIOA 3JZMA 2I4IA 4LX0A 4DDTA 1R4AA 2RHMA 4QBHA 4NKRA 2XEXA 4TL6A 2AD5A 4LZZA 2OXRA 5CDFA 5L3QB 2VF7A 5J47A 2YINC 4M9QA 5EE3A 3RS0A 4DHEA 3MMPA 4G5RA 4CF7A 2OLKA 4II7A 1ZRHA 5JJLA 2BJWA 3P26A 4AWXA 3QKRA 2VEDA 2PJRA 3SU8A 1XTIA 3TUIC 3AGQA 4DEYA 4D0GA 5KPDA 2K5UA 3HP1A 1G3MA 1T4GA 5JJKA 3SJBA 4GP7A 2OV2A 3A1UA 1Q3TA 3TSOA 2ZRBA 1Q1BA 2QL6A 3L2OB 1X86B 3UPUA 3GLGA 2FSIA 1MO4A 1F2TB 2YOFA 3RRZA 1ZMXA 4TZ6A 2UZIR 1NVUQ 2AKYA 3O8DA 3T1OA 5C2JB 2ZSEA 4FCVA 5JS8A 1F2TA 2A9KA 1E9DA 1FOEB 3RABA 2QE7D 5DHAA 2C98A 1GFIA 3RRMA 1U81A 4IDQA 1UKYA 1G17A 1U90A 2EW1A 2AXPA 1S1CA 2IUSA 4G3XA 4JLJA 4D82A 4YMWA 3KB1A 3SE0A 4TL8A 2DFKB 2C9OA 2H92A 4D2IA 2AFIE 2H17A 1U2RA 3S1AB 1TADA 2QEQA 4DLXA 1BMFA 3G5UA 1G9XA 3LX5A 1IN7A 1FX0B 2Z5FA 3K09A 3FHTA 4FMCB 1JR6A 1N3BA 3A1WA 1RRFA 3A4NA 3AEZA 2R6GA 1Z0IA 1XD9A 4HLQB 5DI3B 4IXNA 1ZCAA 2XITA 4Z1MA 5B30A 4YDSA 3LNCA 4PZZA 3VKHA 4TMZA 4BLQA 3SBDA 2PZEA 2ZJAA 3DMDA 3QQ5A 4HAYA 2GCPA 2ZITA 1QG2A 4XTCS 1DAGA 3QF7A 1NIPA 1RJ9B 1T8TA 2ONKA 1CULC 5B58C 3RC8A 2V4ZA 2EFHB 3SEAA 3N5CA 1KI8A 4BUJA 2CK3A 3C8UA 4N0EA 5F3WB 1QF9A 4LYAA 5L3SA 2Z4SA 5AR1A 3I73A 4WOPA 4A0RA 1OW3B 4RD1A 4EFLA 1L2TA 2HT6A 3KJEA 4KSBA 5CLQA 5EXPA 4IDNA 3K70C 2CJWA 4F7WA 1ZNYA 4K46A 1IAQA 5K8IA 5DNYB 3V00A 4F4JA 2YC4C 2BJVA 2D4HA 1M74A 3L82B 2O0KA 3B85A 3X2SA 3TUZC 4AYWA 3WYAA 4GOKA 2QZ4A 1ZUIA 1G5TA 1E99A 1LS1A 1QVAA 3WHKA 2IHBA 3MWLA 4NZYA 3KJHA 2VIIA 4KU4A 5E95A 3UG6A 3ND9A 1PUIA 1G5RA 2J7KA 4PHFA 4C4PA 5A0FA 3VR5A 4ARZB 1QRAA 3CKLA 5TARA 3B78A 3GEEA 4EAQA 1SVLA 3SFVA 1LB1B 2IT1A 2P67A 1T3HA 4GBMA 4QHYA 1XMVA 1S8FA 5DE3A 3WXMA 1A82A 2MSEB 1BYIA 2WAXA 3H1TA 4LPSA 4V0NA 3FTQA 3T5GA 1H65A 4DLWA 2QMUA 4M1WA 2MSCB 4TTPA 1R0WA 5AUPB 1KIMA 3L0OA 3RVBA 3CH5A 3KXKA 4BEJA 3QEJA 5KNBA 3IILA 1XPUA 2F6RA 3THYA 4GRAA 3K0AB 4PHHA 3DKPA 4EDHA 4LJ7A 3UANA 2W6JD 3PEUA 5E4FA 1KDTA 3R7WA 4CEIA 2JEOA 4URYR 2NMVA 3SDZA 2RAPA 4UKDA 3IIJA 2AWNA 1OFTA 2BDTA 5JI2E 5EXTA 3CZPA 4PAMA 1NMYA 4MYHA 4ZDWA 2A5GA 5BW8A 1GSIA 4B75A 2FFQA 1HQYE 1NMZA 3U2QA 3EG5A 4PHTA 3ZS9A 1G4UR 1ZAKA 4M9SA 4NCHA 4XWKA 3C14C 3UWOA 3GLGB 5SZHB 4PQFA 3ZVRA 3N2EA 3CW2A 1MO3A 4KSCA 4PO8A 5JHHB 4RFVA 2AX4A 2WSMA 4PTLA 4KFRA 1BIFA 1CJMA 1XTQA 1HV8A 2Z6VA 5CJ2A 1SHKA 1DAHA 3QIAA 1EFUA 1G7RA 1VYTA 1WMSA 2FF7A 4JVMA 5LBIA 4DCNA 1T5IA 5JI3E 1JPJA 1FL9A 1VCNA 3LFUA 2J3EA 2BBSA 3IPXA 2VF8A 1RZ3A 4WAUA 2WWHA 2LCFA 4LJ5A 1M34E 4LRWA 1ZCBA 3PENA 2JLSA 4I1OA 2YVUA 3KZ1E 4TT3D 1IY1A 2ZJ8A 5HCIA 3GLIA 4GL2A 4QJ3A 2YKGA 4TQAA 2J0SA 1G3UA 2QSYA 4G0NA 2GXQA 1UFQA 3ZQ6A 4KBGA 4R2IA 4IDPA 2O52A 3KFXA 2ZI7A 2QP9X 2ZRGA 1G5PA 3I8SA 3BD9A 1IONA 5FUWA 1UBEA 1Z6GA 5FPHA 2QU8A 3Q85A 3BORA 1II0A 5DO9A 2VL7A 1A4RA 3AUXA 1AZTA 1E79D 1KMHA 3QG5A 3PCRB 3ZIAD 4B6FA 3NH9A 4C0AC 2O0HA 3GQBA 4EPTA 3I72A 5FBLB 2V9PA 2WPDD 5HE9A 4LSGA 1LVGA 1KI6B 1N5IA 1IN8A 1ZU5A 4JZKA 1WCV1 4HYYA 1QZXA 1OIVA 1NY5A 1O3YA 4H9GA 4TSFA 2W00A 4OI1A 3B1XA 1ZUNB 4AIIA 4C2TA 1VCMA 1N0WA 3IO5A 1MH1A 1TL7C 1XF9A 1DEKA 4NCJA 4Q1CA 4A36A 1PVOA 2GDJA 4WXPA 4Q03A 4KLZA 4XD7A 2ZR7A 1LF0A 2XAUA 3B5JA 3OEHD 2B21A 2DWOA 4LHZA 1GZSA 3WHLA 2GCNA 4PHGA 1P2SA 4Q1AA 4MRVA 4MYUA 5FL7D 3Q3JB 4BFUA 1YZQA 4GT1A 4AKHA 4UXIA 3WRXC 2OESA 5L3RA 4TYQA 5JBQA 3DEFA 4OHXA 4EUNA 4DXAA 2NPFA 4RD3A 2HLDD 1Q44A 1NRJB 3OAAA 4FD2A 4RD6A 4PSAA 5LDDC 1KO8A
chains in the Genus database with same CATH superfamily
4D41A 4DIQA 2YJ5A 2IGKA 2PFSA 4XXHA 1H5NA 3L8CA 1T1JA 4Y6OA 4ZDIA 1N2CA 4MVJF 1T0HB 3LSKA 4Z7OB 5D51S 2GXSA 3NEJA 2D00A 2B7BA 5BWCA 2XPCA 5FAKA 5LIRA 2HD4A 5AW8A 1ZMBA 5DM6F 1PUFA 1D7AA 2XKJE 2JFUA 1AU9A 4ZDPA 1W52X 1GILA 3KWMA 4DY6A 5JJ5A 1PFKA 2EA2A 1E2GA 3UJ7A 2P2ZA 3PQ7A 3ECAA 5HQJA 4NEGA 3NWJA 3OYKA 3CSDA 4DLNA 2Z09A 5FEMA 1L8QA 1F5NA 1IEXA 2I71A 4YCAA 5A4FS 4K0RA 4E13A 4XQCA 4F85A 1V1RA 3N7UA 4GECA 4RHCA 1OHHD 5LLSA 1XSDA 1F1ZA 2PZGA 5FQNA 3KUDA 4BO1A 3A2LA 4MJXA 2V6FA 5DSZA 3MLEA 3WLJA 1T15A 4WRRA 2JGEA 4OYLA 4UEJA 2H29A 3KJNA 2LH9A 5AHWA 1OASA 3KP7A 5F64A 2BFAA 3EWAA 5BT9A 2RGBA 1LUAA 3MBOA 2JVHA 1EK0A 3PGA1 5CM8B 2XIGA 1HQKA 3VYRB 2CXQA 3E6MA 4FNAA 1Y9EA 3BE4A 2QZZA 2NVOA 4FIZA 3A6PC 1WP9A 1R3UA 1UBHS 3P2EA 4QOFA 3RKSA 2ZFUA 1C9BB 2CO5A 4G5YA 2BMVA 4WCFB 1DIHA 3AETB 4WXYB 1Y7TA 4WZAA 1VPWA 2JHNA 2EZ8A 3BJAA 3KKZA 1B3BA 5D6FA 4YAUA 1KL7A 4EJYA 5BNZA 1WOMA 3I2YX 1TF7A 3QVJA 1DX4A 5IWCA 4QBFA 4KJXA 1P4JA 121PA 4IYJA 4ZWNA 3OCVA 4HKTA 3BL6A 2BOLA 3OR1C 3H0GJ 2EP5A 4MS1A 4KQMA 2BKUA 5G2OA 2O0MA 5BSGA 1MRSA 1M1ZA 4F5EA 3A2KA 4PY5A 2O1XA 1GEEA 5REQA 3N2LA 2JH8A 4YUAA 4PWYA 1TJPB 3AP3A 4B3IA 3TZHA 4K9KA 1GPWB 2CYCA 4ROCB 2JAPA 5KX5F 3SNKA 5JCOC 4C2UA 5ADHA 3R7DA 4WNIA 4A27A 4JX9A 4X44A 1ZARA 1YU6A 3DKKA 3PXDA 3JRFA 3N8NA 1GU1A 3TUJC 2GPTA 2UZ0A 3BG6A 4BO3A 4WXAA 2V59A 2XUZA 1MVLA 1JIVA 3OKAA 5JXJA 1P2GA 4Y1FA 2ZI4A 2R8YA 3VWBA 2SKCA 1V1RB 4LXGA 3OIFA 4TTVA 1YJQA 3AR4A 3LJKA 1K5HA 5B1BH 3WWZA 1XVIA 4Q3LA 4M38A 3DFGA 1E59A 1J97A 3ROUA 4JLAA 4O6VA 3LQQA 5HIMA 2LBFB 1KOLA 3IBSA 3OKFA 3DWGA 5LLTA 3IH7A 1MAUA 4ENRA 4R3WA 4A1FA 2IXTA 1CUGA 3E8XA 3CE6A 1JR3A 1MB0A 2L7KA 2BM8A 5FBWB 2Z58A 4PYIA 2F3QA 4RK1A 3H19A 3OL3A 1E1RA 5DTJA 4WVLA 4DCVA 2EVWX 5JARA 1ZNWA 3QKSB 4EB8A 2QVGA 2JA6J 5IYZB 3M5WA 1C41A 4R40A 4N3AA 5K0SA 4X8LA 1AS2A 1E1RD 3FMFA 4WZZA 4L8FA 1MSEC 3GCWA 1T2AA 1JQ5A 4OBXA 1XBTA 5HIIA 2FZWA 4NCBA 2Q1TA 4EELA 1IATA 3MD0A 2JAUA 1NXOA 2L2OA 3DSRA 3W5BA 2B4RO 1MQSA 3NALA 3HSFA 1D3UA 4YBRA 5A62A 4OHYA 1M9NA 3S55A 4ZV7A 4DCPA 4W63A 3PRYA 1Z9CA 2YZ2A 4XWYA 1H1LB 4BV8A 3PHHA 4CN9A 2P6OA 4ZI7A 2C4VA 4MV6A 2JHCA 3ETGA 2R4UA 2D1HA 2QJRA 5JJIA 3W78A 5FLXA 4AUEA 1M8JA 5FI0B 1UP6A 3AVVA 1OIXA 3K1TA 4KO3S 5F35A 3FGZA 4BACA 1G7CA 4FFNA 1CQJB 1Y42X 5F2NA 3TZCA 3V4PB 1Y3CE 5GIOE 4FS8A 2WV9A 4EJSB 4OB7A 3JRDA 2KM1A 3A0HC 1LXCA 1DVRA 3GRAA 1GV5A 1N0HA 2FV8A 4BRUA 1JUDA 2IH4A 1WXDA 3CLVA 1CJUC 4AF6A 3GRVA 5L8VA 1KK2A 2CXNA 4F4CA 3EGWA 3VB2A 3AR6A 3KSAC 5DK4A 4P32A 3K1AB 3QKUA 4IIBA 5DK6A 4KVAA 4EL0A 3MMSA 3MCWA 4WNYA 1FBQA 3ES9A 4EI2A 4YUZA 3AM5A 3CMEI 4UUQA 4BPBA 4YY3B 1PNRA 2GYWA 5KSZA 1QYXA 4PGFA 4BMNA 3CVJA 1ZS9A 1DBRA 3HB9A 3K4QA 1RHQA 1CT9A 4E94A 4F5ZA 3LCRA 4H17A 4JB3A 2WABA 3RYCA 3BK2A 3T3NA 2C2XA 4JU8A 4RS3A 4AIHA 4F3RA 4HRVA 3HJFA 2C3PA 2PX2A 3VZQA 5CQEA 1J4AA 1M8FA 4XQFA 3ZH2A 1NNI1 2EG5A 5CLLA 2GA8A 4BEVA 2VSFA 4GI7A 2HO5A 1V8DA 2X42A 1XCVA 1JTFA 4JQZA 2XPWA 3H5VA 1CUUA 2NLVA 1T43A 5L3DA 5C31A 3T9FA 1ODIA 3O82A 2D2WA 1E61A 4FEAA 1OYOA 2PS3A 1I1NA 3UJ6A 1KEEA 3DWIA 5GY7A 4PJMA 3WLKX 3T54A 2OORC 3VSCA 4JNKA 3TOBA 1ZJWA 3L3BA 4YYEA 5D5HA 3E4CA 1CDEA 3K8QA 1VLLA 5IM4F 1KA8A 4B7ZA 1XI2A 2HHAA 2DA2A 2P5TB 1U3DA 4JQYA 3OURA 1MEOA 3BCAA 3AHCA 3G2OA 5LBUA 1EFAA 1LK7A 3DBOB 4IOCF 2QN8A 1DQUA 1OZAA 1NDHA 3WQHA 4Y6RA 2H5EA 4LJ9A 4Y7CA 1ZN9A 3AKYA 1HFEL 5KYWB 1LWYA 4DDVA 1JFVA 2PO7A 1DIRA 1M10A 2ADMA 2H0AA 5FX2A 3ZI0A 4ESHA 4B3XA 1CW2B 3CHYA 2GO7A 2A67A 1QTIA 3RG2A 4MQ5A 1P4HA 2OGZA 1ZQ1A 4Q9IA 3EZ2A 2OZVA 5EEGA 3ASZA 4A2CA 3IJPA 2GN1A 5JLJA 3AF0A 1YWGO 2FEPA 1Y6IA 4I76A 3EC7A 4ZIRA 3N97A 2YOGA 5A71A 4GMDA 3VR4A 4QDJA 1JQJC 4WZAE 4BQEA 2GM3A 1IHDA 3DMHA 1NH3A 1XLWA 3EUAA 3OQ6A 3DTKA 3BCSA 3L0BA 3KLPX 4EAKA 5EUBA 4CCWA 4YJGA 3ZS8A 5HJEA 5ALRA 3D2LA 3CUQA 3UOAB 1RYMA 4ARUA 4RADA 2JNWA 1Z4QA 3WL7A 2CD9A 1XCPA 1Z83A 4HB3A 3O74A 3UFXB 4C4YA 5DW3A 3OICA 3LRXA 4DGWB 4CSWA 1E60A 2XNSA 4NWIA 1VLMA 1PQ4A 3NO4A 3OTWA 1BD4A 1M7HA 2QBYB 1C8LA 1ZD1A 1C80A 3UNXA 1U7WA 3EG9B 5EXEA 3ESDA 1RCTE 1QBGA 5J8CA 1VJCA 1GQSA 2XVXA 3GJQA 5CP8A 1FMTA 1LFDB 5LZ7A 4D80A 3KL4A 3Q8XB 1JKXA 3H8WA 2D1RA 3WMFA 2V45A 3A27A 4ZZ3A 3U6KA 4GI5A 5KSYA 3BJRA 3GBSA 1A27A 4I50A 3L4JA 1N6OA 4RW0A 3PUHA 2ZROA 2AI1A 1FC0A 3N75A 3TMKA 5LLQA 3OEEA 2BT4A 1T56A 2O8FA 5DYGA 2A7QA 4B3CA 3W77A 2BKEA 1E9VA 3V7UA 1Z0AA 2HZMA 2I6GA 3GDWA 2PQ0A 2FH5B 4OMFG 3PDIA 4JUIA 2BEVA 4EK9A 2RGWA 3WOVA 4OHMA 3ZCXA 3HS9A 3RIEA 1LGYA 3BIJA 3NBYC 4PAOA 2AR7A 2ZRHA 4E4HA 3I9V6 5REQB 1UBTS 4G6ZA 5HFJA 2C4MA 2J3MA 3AYXB 2YJZA 1XD8A 4LYHA 4EPRA 3WKAA 2JRCA 5LQJA 1C7JA 5HUQA 5EZ6B 2JIBA 2X41A 5GP9A 1AF4A 5CFPA 4P9FA 4ZHQA 3BCRA 2P30A 3J7YJ 4YG2F 5IT9Z 3IODA 1JALA 2HMYB 4I0AA 3VR6D 3S2SA 3VI4B 2B8EA 3IUPA 3KV1A 2CH0A 5GAJA 4OLHA 1VHQA 2PUAA 4C6TB 4OB8A 1ESMA 4L8LA 1GARA 3D5EA 2IELA 4KICA 3HZZA 2OMEA 1J7JA 5AM5A 1Z2EA 2XAJA 2HDCA 2E2HJ 2P9JA 3OSUA 4B0AA 3PHBE 2W2XA 2C07A 1ZW6A 2G9UA 4AJKA 1A5BB 2KPMA 3ILXA 2F3UA 2VQLA 4DG9A 4AZWA 2VBWA 4QOHA 1NSFA 4UUNA 1TCAA 4CIBA 4K3UA 5HCUA 1XZPA 3A4TA 3GJTA 4WOJA 3M3PA 1BEEA 1E0JA 1I3MA 3TH5A 2DPYA 3BA6A 1JILA 2PUDA 4EY3A 3G8BA 2G1KA 4C2AA 3EYIA 2H1OA 3HR4A 4ICIA 3G23A 1NTCA 1XC5A 1G9SA 2H7YA 1PZGA 3OLYA 4FGLA 5BPFA 2F67A 2JA7J 2WSIA 4IZIA 4RQBA 1RT9A 2LY2A 2IVZA 3X2QH 2BFEB 2LGJA 4BLTA 4MWEA 2A33A 5BV7A 3M49A 4DWJA 2YIVX 1W1IA 3UJHA 3IT3A 2I67A 5IUJC 3LUDA 1XJ0A 4RKWA 4EG5A 2KBEA 1XV5A 3G0IA 2IGTA 3RC3A 3H1PA 3DE6X 4DZPA 1JRLA 3DHVA 5FA6A 3OSZA 4X6UA 3HYTA 3G2NA 3S27A 1USVA 2DETA 3E35A 4MKXA 1DC4A 1I1GA 3P7MA 3IH3A 4GLBA 1BJRE 1XMJA 4U02A 4C20A 3L8MA 2WUWE 1D1SA 2A6HF 1GZ4A 2XLCA 5K3CA 2PUHA 2VXYA 3DZGA 4WI1A 5DCMB 4MVXA 4ACAA 1KZ1A 2RAFA 1DBVO 1C50A 5DNUA 2VNHA 3BM5A 4REMA 1PKXA 4RL4A 2A9JA 1CRQA 3SBOA 4K9MA 4A3SA 4HNAA 3MC1A 1ZK2A 2H08A 2HZBA 1Z82A 3GAZA 4W1RA 1GVJA 2DSNA 1BRMA 3WSTA 3NTQA 1TWAJ 4NQRA 4QTUB 4H60A 4FLFA 4L5IA 2REOA 1P0QA 3QP5A 3RVRA 3UMRA 5L3EA 2WC2A 4IKFA 2BEUA 1RRMA 1FX0A 3U7FB 3N3BC 2HRZA 2JFHA 1ZOLA 4XCQA 3OP4A 1OXUA 2CQXA 1QCCA 3VOBA 3BGWA 5IBRA 4BNUA 1JQEA 2PVCA 1ETOA 4N8DA 2IFTA 2MFZA 3VJLA 1Y5LA 2Z9CA 2JVKA 3AX6A 2P9QA 2QRVB 4KXMA 1F2VA 2ORVA 4A3CJ 3CEHA 4C88A 3WAGA 1NVVR 5EIOA 5CVIA 2QY6A 1FP4A 3DZDA 4J7XA 5ESRA 3RTAA 4BGUA 5J1RA 3GRKA 3M4ZA 2WP8J 3WLTA 3KEQA 3L7DA 2PBIA 4BZPA 2J3QA 2Y30A 4KRFA 3A3OA 3UW2A 1P4SA 2D8MA 3L9XA 2JSCA 1Q7CA 5C18A 1PV4A 3EASA 3KOWA 3TVTA 1FPQA 5GINE 2Q9BA 2H1KA 1ZQ9A 2WMOB 3QE4A 4KG7A 1RKXA 2VP0A 5KYUB 2G17A 4JVOA 5B7NA 3SSOA 1M76A 3IAS6 2M7AA 2O54A 3AB3A 4TKMA 2DVMA 4AUMA 3AKEA 3BDVA 1GNVA 3TKLA 4DJDC 4BAZA 1PBTA 4U2EA 3Q0WA 1UBJS 4A2QA 4M0EA 2ACEA 1UPFA 2Q5HA 3PNSA 4C4RA 1SJ9A 3UHOA 2ZB3A 2WZBA 3BJEA 2DR0A 1J8VA 5KU1A 1PTJC 3LPNA 1K7EB 4GXQA 3DOCA 3HXOA 2C3YA 1MC8A 2FWBA 5F7XA 4ZI2A 4MAFA 2GZSA 1WTCA 1U7DA 3RFUA 2EFWA 1L4LA 3I4LA 4BJ5C 1QHHB 4QTTB 3V4FA 1NJSA 3HBAA 3K5WA 3D7NA 1OILA 3B38A 4NBNA 2JIQA 3NARA 2XKAA 1WJDA 1E2NA 3GOQA 3ZWBA 4I7HA 2QRZA 1FUUA 3G0OA 2AYXA 5CAEB 4BWGA 2H4HA 2UKDA 1GYQA 4G5QA 3FSGA 2J0QA 4ZJUA 1H85A 2XVCA 3QU3A 3SJMA 5E3NA 4LNUA 4PX2A 3TFOA 2IV9A 1CVRA 2JTVA 4BGDA 1DKOA 3E7XA 5FR2A 4Y0AA 4UUSB 4M21A 3K32A 2GXAA 2GJKA 1PFVA 3I6ZA 1PVVA 5F5LA 5LPNA 1T0IA 4D3FA 4ZRNA 2IEAA 5KWSA 3TW6A 1SAUA 3GLXA 3RASA 4YCJA 1Z4KA 4BQRA 4XYLA 3FZYA 3JCZA 3ZCVA 1BGWA 2ERXA 1IGNA 2PEZA 4HV6A 4RELA 2K7LA 3AG3H 1YUNA 1VECA 4ENUA 3VTFA 2OTCA 3V2UA 3CUSA 1U1FA 2OILA 1VTKA 4D6XA 1WMBA 2G0TA 3R0JA 3IPLA 4DJAA 3NGLA 5AOBA 2V58A 2II6A 1K8QA 5FO1A 4BL0B 1BC7C 4XARA 3AHEA 2ZWOA 3DH0A 4CG0A 5LZ5A 4PCLA 1Z5OA 2YV5A 4L6CA 1EZ4A 1ZH6A 2WTUA 3MUOA 4Q4DA 4QJIA 4RTJA 4JKOA 4QLAA 1QC5B 3HWX1 5DV9A 3BFJA 1IEVA 3E27A 2Q2OA 2RAUA 4YUVA 2PD3A 1SIWA 4KPUB 3AWDA 4RK4A 5CQGA 3AU8A 3I0NA 5CDFA 2XHEA 3HXQA 2JZYA 3MMPA 5AKLA 3QWAA 3KNZA 3FYSA 3NJ8A 1SUAA 3EDRA 2A9FA 4EY5A 4F1KA 5KX5B 3HVHA 4DGSA 4PSWA 1IG0A 2HMSA 5BR4A 1Q1HA 1F2TA 2A9KA 2ZCUA 1I7LA 1C7RA 1TYZA 1RKWA 1NVMB 1EH5A 5BORA 1U90A 2HK7A 5IY5H 1RWKA 4S1OA 2MJ7A 5CLSA 2QLZA 3PNYA 3K6KA 5DN9A 2M45A 2F8LA 4L78A 5LCXA 3FHTA 1LI4A 3JQ6A 5DI3B 5IVDA 4IXNA 4ALNA 4FYYA 2ATEA 4RA9A 1FU8A 1QUFA 4AMGA 3IVCA 2X15A 1UK8A 4HAYA 2ZITA 1FYKA 4BKOA 4XIFA 4RD1A 3E18A 1XOIA 4EFLA 2PLNA 1ULHA 5CLQA 3K70C 4PLTA 2ACKA 1ZNYA 2WIKA 2FUVA 1MX9A 4PLHA 1MD9A 5BW6B 3MQ2A 3SDBA 4H0CA 3RRXA 3SFVA 1Z56C 3LF2A 3NNDA 3W9SA 2MSEB 5KEIA 3U40A 3GNLA 4OH1A 1JIJA 2RBEA 5E38A 1X4PA 3L0OA 1CUIA 1ILEA 1Z17A 2TMGA 1KDTA 4JUDX 3DNFA 2RAPA 1VHWA 4B09A 2XMPA 3TEMA 1NMYA 3TGLA 4JJAA 1J07A 1Z8NA 3U2QA 3KLOA 1K75A 4NCHA 1U8BA 2CNLA 2ZT7A 3G2PA 3OYMA 4IL6C 2ZFDB 4JP0A 1J9ZA 2DWCA 4JVMA 2LBPA 5FBHA 1RZ3A 3F98A 4LJ5A 4JI2B 3FPLA 3T7IA 2J0SA 3N6RA 4EYEA 1P17A 4U2FA 2F5DA 3DMRA 3ZV4A 5LU9A 3EVGA 4GYWA 4I3GA 1YC2A 2R4GA 1L3BA 5FI5A 4YUXA 2QL5A 5GPBA 2I29A 3DBIA 1XAHA 1ZUNB 2PD4A 4YRNA 4KLZA 1PWZA 3LCUA 3EJ6A 4LVUA 4XD7A 1KJ9A 3O2PE 1MJ5A 3WGIA 4RD6A 3FZEA 1S2DA 1L5FA 4EO7A 1IVSA 3ZVMA 1JAXA 3K0FB 5HVQC 5A3SA 1V4RA 2EILH 2DLDA 2NAZA 3OY9A 2R7OA 4CCJA 4BQIA 5E7MA 5JCPA 2YWDA 5DMXA 1BSVA 4LS3A 4M6YA 5BVGB 5KNBD 1ZL0A 2N1BA 1XN4A 5ITSA 3S2IA 3O8LA 2QUJA 1GRQA 4UQLA 3PSHA 4J0JA 5J2TB 1E7RA 2XOEA 4NMXB 1DG9A 3JRAA 3HIFA 4CMGA 4ZYLA 4PSXA 2C9YA 4RL6A 1QGZA 2OYRA 4JK3A 5JADA 4BWVA 3Q5DA 4Q6BA 4WOKA 3D6AA 3NKVA 1LJUA 2A78A 2RHOA 2UDPA 5KVSA 3EC2A 1ULAA 4OG2A 5E3IA 3O3MB 1Y8RB 2P6NA 3QAHA 2PQMA 2ZBVA 4IO0A 3ESYA 2OOKA 1PUXA 4R1HA 4B3SB 4CTKA 4IIHA 4JX8A 2NO9A 4QE3A 1QIKA 3OJWA 5DYMA 2I4LA 5LQUA 3KWFA 3HSKA 3VUEA 2EWMA 2DT6A 4RVGA 5TGTA 2WM2A 4BFXA 1L4UA 2B36A 5CA1F 2V0NA 3LVRE 1DAKA 2AV6A 1V2GA 4QJ5A 2VH1A 4LJ4A 3GGJA 4U9HS 3FLBA 4BB5A 4WDRA 2VIXA 3RBXA 1RLJA 3GMSA 4F60A 2XNDD 3SVZA 3TE6A 2QUFA 3LUPA 1YRLA 5FGMA 2ODNA 3NHYA 5IZCA 3S17J 4F9TA 3BXOA 2IDMA 1B59A 3GJ4A 1VQLI 1IDOA 1U9ZA 4EKEA 2AZ4A 3I76A 1P1JA 2OM2A 1AWCA 3J81K 1UBLS 4YB8A 1MSFC 1W0TA 5HQTA 2XUPA 1GU0A 3MTDA 1MG5A 4IQJA 1U9NA 5BSVA 2VDVE 2LRDA 4WKPA 5D6EA 2PV0A 1R8XA 5U4QA 2BE5F 1WF3A 1PG2A 2YHIB 4E5YA 3UAGA 1PP4A 4L72A 2J46A 2ID6A 3BD8A 3CW7A 3Q8LA 3LO5A 1SG0A 1IY8A 4HEA6 3OSMA 3FISA 4MRMB 2V6CA 1TJ4A 4OHPA 2MIIA 1C5KA 1CUYA 1W35A 4P86A 2MD5A 4TMVA 3GLSA 4GUDA 1MH9A 4OP2A 1UDRA 4M3EA 3HRTA 1WVRA 2W37A 4NFSA 4B4CA 2WTMA 3J7ZI 1H2AS 2F1OA 2VQEB 2AFHE 1OWMA 2H52A 5DEOA 4KAFA 4B8YA 1IE3A 4M9ZA 5CKTA 1H2WA 4DDWA 3R74A 3CLSD 4NYJQ 3O8CA 1WSAA 4J0IA 5FYDA 4PIMA 1UFVA 4J16A 4QAQA 1U3VA 2JFOA 2VHCA 3KQSA 1F5SA 4FFPA 1CZHA 2FWJA 4LRTB 1VP9A 1XVVA 1U7UA 3ZWAA 2HWXA 2WQZA 4BZWA 2Q5OA 4A5OA 4JL6A 1TCUA 2WHEA 1ZA2A 2UWMA 2BFCB 1WSUA 3WNBA 4MQMA 2RDMA 1SULA 1USUA 2AQHA 8GPBA 4D1YA 4F38A 5K8LA 3DVAB 2D0BA 5JQGB 4P53A 1KZ7B 3AC0A 1CUAA 1FRFS 4OHZA 4HPJB 4C3UA 4OV6B 2OXTA 1ZISA 2IS1A 4ENKA 2I33A 1TD9A 3O4IA 2A30A 5HM8A 1ZD9A 3T3PB 3BREA 1NDQA 3PPWA 4MPTA 2OHGA 2ZPTX 2VKEA 1IXZA 1UXJA 4XVCA 2FSVA 1GYPA 4WK0B 3IOEA 1Y1QA 1E7QA 1KNQA 2E2JJ 2G9VA 4ERXA 4RTLA 1HBJA 3IR5A 4E5MA 1C0EA 4R2LA 2R7XA 3ADKA 5AKKA 5DNDA 1WVIA 1ZI9A 3X43A 3T41A 1IDZA 5HZMA 1MGTA 2CL0X 5C80A 4UAJA 3I32A 5JD5A 5KTYA 3T1QA 4XFDA 1QB8A 4L0DA 1I13A 2AUNA 1G98A 3A3KA 4CIYA 3AVTA 1HCRA 4MR7A 2HREA 2ZS7A 1QH8B 3E53A 1YCFA 4U5QA 3LFHA 3IELA 1EVYA 3KJGA 2HJHA 3UMBA 2X14A 5JEEA 3B70A 2R00C 2G4VA 1SXJD 5DTDA 1G8JA 2A1TR 4M8IA 4G4IA 1R74A 2R79A 3P71T 2IUUA 2YJ4A 4G4JA 1PW7A 3E6CC 3LK6A 1H2FA 4EO4A 3SNHA 1QIEA 1Z2NX 3UWPA 4CJXA 2CLSA 5C1OA 1NRIA 2UUCB 3DONA 5HFAA 1PHRA 3ZEAA 1BNCA 1ZRMA 1H4QA 3H42B 4QXOA 1F14A 1U7TA 2GEVA 4BYGA 2Q4DA 1VPDA 3ENVA 3AG6A 3RK4A 3G0CA 2VAWA 2RKBA 3STUA 4EBBA 6LDHA 2L2QA 3WWEA 4G5XA 1GRRA 4GUAA 2PKQO 5EP2A 1BO6A 2DKOA 3U7QB 1T2NA 3B3FA 1FYDA 5E20A 2VNKA 1KIAA 2RC6A 4RTQA 3NDJA 3PT5A 4AL4A 4TVSA 4KWCA 2ZATA 5LXTA 2M0MA 1YQKA 5B3JA 1XDBA 1VYUA 2E2WA 2GVDC 1O3QA 1T38A 3VGJA 4P7JA 1K7XB 1KHTA 1XQ6A 4LSMA 5C9ZA 2Y66A 1XTPA 5ALVA 1IXYA 2Q6VA 4R0VA 3VMMA 4F2HA 4DV0B 2CLLB 3L4KA 3LV8A 3F8WA 2FLKA 2YV2A 3SIPA 2ODEA 1VLVA 3HYLA 2VLBA 4IMIB 2GBPA 4CEIB 1F36A 1XZBA 1N6HA 3DM9B 4Q9AA 1NQVA 4H4EA 1GCUA 2J0UB 3O31A 3PP8A 1NMQA 1DZ3A 1NL3A 1EA7A 4KVGA 2X5JO 2DYSH 1HE1C 1ZGHA 3L7LA 1GUZA 3D0OA 2FPRA 4TYMA 1NBMA 4FM9A 3IYLW 4OXNA 5BYKA 1EFVB 1JKQC 1SY7A 2C2HA 2O6HA 2VWQA 3IAUA 2XASA 1GG9A 1XZNA 3O0TA 5HNKA 1KZYC 1BXGA 1H8AC 1LX7A 3A4LA 2FVXA 2CLIB 4XL9A 3IGFA 4UARA 3OIVA 5LBQA 1NF2A 4DMRA 1E42A 3R7LA 2QUHA 3DULA 3WYGA 1ULYA 1SCNE 4H7IA 4RVFA 2VDUE 5FFMA 2FK7A 1WIWA 2VPIA 5ABPA 3EWNA 6Q21A 4W9NA 3H0DA 4PZCA 4LJRA 3LXXA 2B2CA 4QKQA 4XKJA 1FYVA 2EZUA 4AC0A 1W4BA 2HQBA 1U3WA 3LG2A 3VNVA 2HIHA 4M8SA 2XF5A 3ZLVA 1A8PA 5JHGB 4M9XA 3NVKI 2XXJA 5JNUA 4UHBA 4OL9A 3MJDA 4M1MA 3L0SA 1RSZA 4NMMA 2PT6A 3DAYA 1RKUA 3ZV3A 3MWMA 1RE1A 1FS6A 3DGFC 4L1KA 4WXMA 3VEPA 2ODQA 2UAGA 5M5WJ 2QTLA 4TTJA 1THMA 2B99A 4QNRA 3QVLA 2BUCA 3IWFA 2BMWA 3P9NA 2E4ZA 3UBTA 1KF0A 4UEKA 4YX9A 1ZRSA 2Q2EA 3K92A 5AVWA 4RD0A 3WYDA 1LFBA 3IE2A 3NVAA 1U9JA 4YRKA 4I14A 1UP7A 3D54D 5CLHA 4MLZA 3U19A 1M0TA 2PLRA 1YVPA 4US1R 5L3VA 2VJ0A 5D8LB 3PNKA 3T7CA 5FYQA 3AUKA 3WLQA 1MJAA 3AR5A 3DAHA 3QFTA 4JJ8A 2JFFA 3GPIA 1MPGA 5AJTA 1Q7EA 5EVCA 4XAQA 2GXBA 2JGDB 4MVJG 1BS9A 3T7DA 2CEKA 2ZJFA 4J2HA 4ODIA 4D96A 4MPJA 2PGXA 1NPTO 4HMPA 2PXAA 4GZLA 2NVMA 5FORA 1KY6A 4M7PA 3UR3C 1EUYA 2OCYC 1SA0B 3KZOA 4HMQA 1FLAA 1E1LA 4EECA 3L2WA 2Y1OA 2M1BA 2P2NA 2DWPA 3E03A 4H7DA 5GONA 3QU9A 5B3LA 2IIQA 5DHQA 2LPMA 3NB0A 3VFDA 2QSFX 3G5MA 2YRXA 2HJRA 2JQ7A 1TQ6A 3EEFA 2HMWA 3L7YA 2P4SA 3DV0B 4B44A 4IRHA 1W2GA 3LQRA 3AR9A 2AJBA 2CLKB 4OMCA 2B30A 1KWKA 3WTZA 3DZCA 3B51X 2JAQA 4XX0B 4F9GA 3IDAA 5IABA 2OVFA 3AM3A 3FF5A 4FCYA 2B5OA 1YMUA 3L1PA 1NWCA 4ROTA 4CQNA 3A28A 3ENNA 1DUIA 5EJ4A 2DUMA 2W2VA 1GZ5A 1SHTX 4B3MB 2DECA 3U9LA 1MORA 4CU5A 1QS0B 3NX4A 1PHPA 4DIMA 1TGYA 5JVDA 3EUHC 3M7IA 1JI8A 3O8BA 5IH7A 3RLFA 4KKXB 5GGYA 2OPHA 4Q7JB 2E6UX 3N5KA 3U9SA 4UXJA 4HH0A 4ZC1A 1MX3A 2FP3A 5BN4B 3ONWA 2IV3A 4MRRA 3S2UA 1HY3A 1PGQA 3NBQA 5EMMA 4PZ0A 3OX4A 1XPOA 3CUYA 5L3CA 3LZ6A 2H6CA 3WHBA 4DADA 2GBFA 3JZIA 3CS3A 5ECDA 4Y13A 4XJSA 2MU1A 2G28A 1U5CA 1E4YA 4Y2UA 3SQOA 3SWWA 1Z63A 3E9QA 3KP1A 2LF8A 1P29A 3D0QA 1GA6A 5DTRA 2VJCA 2QVCA 1JG4A 1NKSA 2I7VA 3M34A 4F3QA 1GGMA 4RDHA 4LMBA 1JI0A 3KB8A 1WJGA 2XE6A 4LWPA 4D9CA 2DLCX 5DOVA 4IDOA 2VKDA 2HSEA 4I5EA 1N5KA 4ZJZA 3BSSA 4A5MA 1ZGBA 2BM1A 2E60A 2HA5A 4LG3A 2YHBA 3WG7H 1TFUA 2J0VA 1J2UA 5KHAA 4HYQA 4O63O 4M98A 4WOBA 4BGEA 2G3YA 4W6ZA 4EGQA 3OYNA 3QGMA 3HY3A 4BAUA 1QHGA 3VX3A 2W9XA 5B4VA 3WY9A 4G0UA 4CEHA 1TMOA 2XUFA 3LUBA 4DM7A 4FWTA 1WULS 3E9YA 3TLGB 5T6MA 1W96A 2XMSA 4FI3C 4BLSA 2ZS9A 4O4JA 1VQ4I 3IP5A 1NG9A 4R01A 2GERA 5K7HA 1PZNA 2W43A 3FPBA 5IVKA 3A6EA 4LBYA 2V6EA 1P4RA 3KL2A 3EF3A 3CZMA 2I76A 5F1JA 2E48A 4JVLA 2MSNA 4KFTA 2Z9OA 1MABB 4HB2A 4N40A 4RV5A 3OLCX 1QZYA 3E3OA 5C7OO 2UXNA 5EEHA 3RPUA 3PNQA 4PCQA 2WA1A 1Z29A 2RGEA 3UKGA 5CIWA 3TLKA 2ZB4A 3B3GA 2IYYA 2IQIA 3VPGA 3IDZA 1JAZA 3QMMA 2YS7A 5ESWA 4I9GA 4LC9A 1G5FA 1T8SA 2HTJA 4G1MB 4WXRA 1WXEA 3LLUA 4GFDA 1CUHA 3CRW1 4F72A 3CPSA 3R61A 1YJCA 4ETIA 4IVRA 2FP4B 4D45A 1H2ZA 4K2AA 2RG7A 1L7MA 3LOQA 4RU1A 1WB4A 2JD1A 4XASA 1TM5E 3LH5A 4EAGA 5C32A 2LD4A 1GPNA 2I4MA 2C54A 2VHVA 3NT2A 4ZTBA 4AYXA 3QBDA 3EIXA 4HF2A 2H1CA 1BI2A 1ORIA 4KUHA 5A0VA 1E2HA 1E17A 3C7CB 1WHSA 4HXYA 4L15A 3VNRA 5EJ8A 2O2IA 3R7WB 2IJLA 2WFMA 2O5CA 1ECCA 4I99A 5HBRA 4QFMA 1N3IA 4FHEA 3OA2A 2FA9A 3IA2A 1WB9A 1OH8A 3HPQA 1SQ0A 4D6PA 1UJ6A 1XR3A 3C3BA 4XYGA 1RWOA 1R0ZA 4ZYGA 2WTAA 3PLNA 4NE9A 2DA4A 4UU8A 2HF7A 4KR0A 4IDDA 5JNSA 3G2IA 4BE7B 3AUUA 3I1IA 2DOKA 2RQPA 1UM8A 4JL5A 1FTYA 2SKDA 1GNSA 4NDAA 4OP1A 3ORYA 1BHQ1 3TLAA 2PJUA 3GO4A 4OLAA 3JD0A 2ZRPA 5FPTA 1OFVA 5BV8A 3GFFA 3IIEA 4U0KA 4ZVOA 4KO2S 2O7OA 2ZBDA 1E1CA 5AW9A 1Z2PX 2X4DA 4JB2A 1AXEA 4CUKA 2VWPA 1RESA 4AWBA 4IRIA 3E9DA 4OQYA 3NANA 4DULA 3RVNA 1E2UA 3L1UA 1NLFA 1QHHD 4OXXA 4IZZA 1YXMA 3QVMA 4E5KA 2J9GA 3EISA 3PNPA 1SVOA 4ITVA 1H9AA 3A1VA 5EP4A 3K69A 3KPWA 5FHRA 1TEVA 4UXNA 1I0LA 4WX9A 3DEIA 3EGVA 3TTXA 5EN4A 3CT4A 3ICPA 2O2EA 1NXQA 2HCJB 5L7TA 4R84A 4KNWA 2QAGB 5AJUA 2G8LA 3QVXA 2JI7A 1VGVA 2QYOA 1YJ9I 3JRGA 3ST7A 4A8TA 1NNEA 3OOEA 4LQCA 2M0CA 1PNVA 1PFWA 4QSHA 3GTOJ 3ZDBA 1KYZA 3EGDB 5AVOA 3VI3B 3G89A 2KRHA 1U6JA 4JOQA 1SVMA 5JRDS 2XB6A 3OEWA 1Q0TA 4RZIA 2WICA 4ENWA 2Q07A 5EC8A 3HXKA 5CPFA 1VI6A 3U4CA 3VQTA 5TIIA 1Z37A 4DWWA 3WTBA 1W36D 2FSFA 5ECGC 2YZNA 2JLVA 1X58A 3MWFA 4XM1A 3FHZA 1CG6A 1QGUB 2WJVA 3NAUA 4R8SA 4CH7A 3FHLA 1FQJA 4POOA 3IUBA 4ZEOA 1BN7A 3TQHA 3NBUA 5LD2C 2KBFA 4Y9UA 4HVCA 3C5EA 4EHAA 4XR6A 4NKRA 1IRXA 4OGFA 5J47A 3PWSA 4DHEA 3R3UA 4RGBA 1A9OA 2BFCA 4D0GA 4OGKA 4MPPA 3SJBA 1XZLA 3BT9A 2BMAA 1M0WA 2O6LA 3K16A 3T38A 3D64A 4RAZA 1M2HA 2CVZA 2NS7A 4Y2GA 3RABA 1LDNA 2EW1A 2FRVA 3BTOA 1DRJA 1Y1WJ 2J9XB 2WY7Q 1U2RA 3F6VA 4KP7A 3GUVA 3BY6A 3AEZA 2XNKA 2XNJA 1B8PA 1O08A 5FULA 1P4AA 4IXTA 3FTCA 4RB2C 4N03A 4KLRA 5KVVA 2DU9A 5AHOA 4S04A 3F8MA 2V79A 3T4NA 2GCEA 1X7ZB 1GPUA 2OVBA 4XQEA 4BE4A 3KJEA 3KS9A 4L0YB 3U7RA 5MGBA 2GAJA 1BU8A 3Q11A 2RK6A 4CBVA 1G8XA 3WHKA 3DHNA 1DHTA 1CDOA 5EGNA 4KQWA 3T6KA 1KVRA 3CZAA 4QHYA 1MZBA 4L4YA 1VDMA 4DW8A 4K6MA 5KYTA 3NCHA 3JWJA 3K4PA 2W2OA 3QEJA 2JBAB 3PEUA 4G26A 1CY1A 1WB6A 4JR0A 1KEEB 4ZODA 1FIAA 2C5GA 2AMVA 4L51A 2AX4A 5A0TA 4O4IF 5ALXA 3UAXA 1LBEA 2R7LA 3OYHA 1FFXB 1XZJA 3INNA 2ZJ8A 3P2IA 2VJMA 2FJ0A 3TMAA 2QP9X 3VYUB 1V1MA 3JVIA 5KKNB 1E79D 4IJVA 3EIFA 3X0DA 2WAEA 3WWOA 3GQBA 2Q6KA 1LVGA 2ZKZA 4D9MA 2P6TA 4WCFA 1HI9A 2RKHA 2PANA 3D7KA 4BVKA 3GN1A 4ZAXA 1U0SY 4LIPD 1DGQA 2Q6OA 1JHOA 4UB8C 4NBUA 4AKHA 4BH9A 3KFWX 2Q46A 3WLPA 4KE9A 3S2EA 3CUQC 3NDBB 1RQPA 2G1PA 3QUAA 1ETQA 1FJ2A 3HVRA 1U8XX 3QODA 1JXOA 4J0GA 2R5FA 3EZFA 3P2OA 5BR8B 2NTVA 3H8JA 2XJ4A 3RYHB 4FFVA 4CKEA 1LDGA 3B82A 4LJ6A 3GBPA 2I6UA 4FGKA 4D7AA 2E4VA 3O6VA 3ZY4A 4CF4A 1JTXA 3E9RA 2X77A 2V7BA 5C5CA 5HRAA 1E77A