3DPUA

Roccor domain tandem of rab family protein (roco)
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
519
structure length
485
Chain Sequence
PEIVKQGKEAVRQYFQSIEEARSKGEALVHLQEIKVHLIGDGMAGKTSLLKQLIGGLNVVTKQAPNIKGLENDDELKECLFHFWDFGGQEIMHASHQFFMTRSSVYMLLLDSRTDSNKHYWLRHIEKYGGKSPVIVVMNKIDENPSYNIEQKKINERFPAIENRFHRISCVESIAKSLKSAVLHPDSIYGTPLAPSWIKVKEKLVEATTAQRYLNRTEVEKICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLNTSALGYILNEEKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLDVKEFIPLPGHPDELVEYKELLGLEKMGRDRYVSGKLEKVFSVSKMLDSVIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab family protein
publication title Structure of the Roc-COR domain tandem of C. tepidum, a prokaryotic homologue of the human LRRK2 Parkinson kinase
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Signaling protein
total genus 150
structure length 485
sequence length 519
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
A PF16095 COR C-terminal of Roc, COR, domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2190 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dpuA01
1.10.10.2200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dpuA03
3.30.310.200 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3dpuA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3dpuA02
1ZUNB 1QHIA 3RABA 3TQCA 1HT1E 4PC6A 4KFSA 4MKIA 1IAQA 5EZ5A 2BEJA 2CXXA 4P4SA 2NTYC 3B1WA 4HUTA 4NYIR 1IHUA 3QBVA 4Q7JB 1E3MA 2V8OA 2AKAB 4TYQA 2A5YB 3H4MA 1ZNZA 4D6PA 4EPRA 1GL6A 3AKDA 621PA 1KKMA 1BYUA 1QHNA 3SHWA 3BBPA 2R44A 2Q9AA 4M4SA 4M9ZA 5JJLA 3T34A 1GTVA 4Q4JB 1LF5A 3NXSA 4BRWA 1H8HD 4XVRA 1D2MA 2ERXA 3O47A 1TL7C 4LSGA 1X1SA 1YRBA 3QKRB 2XAUA 1TEXA 4JLMA 1P60A 4Q03A 4WIAA 1U9IC 3WXMA 4A82A 3TR5A 4XTRA 1GKUB 3NC1C 5L8VA 1E2QA 4ABYA 3UMSA 3HYRA 4Q1DA 4DB4A 4PX9A 5TV2A 1G5TA 4DBLC 4KBFA 3DM9B 4FI3C 3D3QA 3ZQ6A 4V0LA 2VPPA 5EUMA 2ZI5A 2GEDA 3SN6A 1JEDA 2RCNA 4JVNA 4B2PA 1X8LA 2ZRAA 1MOZA 2GHIA 3PQCA 3Q8XB 1IY0A 1WF3A 3SE0A 4DLVA 1KAGA 3MWYW 5CM8B 3MJRA 4V0MA 1P73A 1D8TA 2O8EA 1NJFA 3AP2A 2C2HA 5FFMA 3U4QB 3FKSD 1JB1A 4V0OA 3AM1A 5FBQB 2MMCA 2OM2A 4OK6A 3NC0C 2PT5A 3L43A 1FUUA 2DY1A 5IHPA 4MDFA 1VIAA 1XTQA 4G01B 3R8FA 5DHAA 4NHOA 1HUQA 1Z2CA 1HA3A 2OZEA 5CDFA 4A8JA 1N6KA 3U5ZB 5B57C 1GP2A 2X2EA 1WP9A 4A6PA 4V0ME 3B78A 2PX0A 2FGKA 2ZIAA 1CBUA 3SYNA 1KIMA 2BMDA 1KKLA 3NEJA 3KKQA 2GBLC 2OHFA 3NIBA 1KI2A 4IDQA 2VP4A 4NCNA 1OB2A 4A2QA 1MT0A 1QHSA 3GLFA 3W3ZB 2AXPA 4TT3D 1SULA 1ZVQA 3CNOA 4RZ3A 1KNQA 3F5FA 4W5WA 4HB3A 2R62A 2N46A 2OAQ1 1DO0A 1EGAA 3GJXC 4IDPA 4TMXA 5D3MB 2OESA 3RAPR 4U02A 3GFOA 5AUNB 1VDZA 1AGRA 1CTQA 4KFRA 2GILA 1ZC3A 2FV8A 4IEEA 3EASA 2HLDD 4YONB 4ZCLA 4DCTA 2G9NA 4WOPA 1HURA 1JQJC 1NBMD 4LI0A 3LX5A 4TLEA 1F2UB 2J45A 1MO5A 2N1BA 3OESA 3LO5A 4JL8A 4CEJA 3GLIB 2WKQA 2E87A 5HR5A 1TQ2A 5KDOA 1Z0DA 2DPXA 1OFHA 3PJRA 1Q21A 2PCJA 4D4LA 2ZRFA 1NY6A 1K8RA 4PQYA 1OH7A 3QF4A 5EE9A 2UZIR 4M2LA 2Z4RA 1ZC4A 2ZE7A 3ZD6A 1QVAA 1S3SA 1ZMXA 4WXPA 4CYMA 2JLYA 3LD9A 3RRYA 2BMFA 3I72A 1OJLA 3H84A 4URYR 3SJZA 4AD8A 1PZNA 3W34A 3V4FA 4M53A 3X1ZA 5KO2A 2WMNB 3NBFA 5JSZA 2Q21A 1YQTA 3BERA 1TUIA 5JWOA 3QG1A 2DBYA 2QMEA 1WE2A 3EXAA 2K5UA 4NMMA 1R5NA 1Q20A 5JWHA 1OH8A 2WJGA 1FPMA 1YHNA 2YWEA 5JWRA 1KSJA 5HCIA 4TLCA 1SVWA 3FMIA 3REGA 4NONA 2EFDB 3EA5A 5CIQA 2NO6A 3OEHA 4DLZA 3IUYA 1CR4A 4IJMA 3QSYA 1FP7A 3K53A 3BB3A 4Q1BA 3VR2A 4BFUA 4RCZA 2QUZA 1W4RA 2J0UB 3GEHA 3WP1B 1VECA 4PO1A 3AGPA 2EFGA 1XPOA 2XITA 3GLHE 1SXJB 3TVDA 2P6UA 2RKOA 3B85A 2ZJYA 3T1TA 1DO2A 4DLWA 3SJBA 2ZANA 3IPYA 1E9FA 3I5XA 2XZOA 1ZIOA 4O3MA 2O0HA 2XX3A 3WNDA 1W47A 1J99A 1P5ZB 1GOTA 2A5GA 2DWQA 2OCBA 2IXGA 3AEZA 4TMWA 5IK2A 3B2EA 2Q9CA 4AG5A 1EX6A 1Z5ZA 4MA4A 5FL3A 1VCOA 5TY0A 2ZE5A 1XWIA 2FSGA 1LNZA 1FOEB 4WA7A 1Z83A 2WJVA 3FMFA 2PCLA 2F6RA 2GAOA 1UBFA 1E0KA 2X19A 4RCYA 4B3FX 2P3SA 2ZI3A 4M9QA 4Q00A 4FMDB 4GMXA 2H57A 2ZRJA 4HLDA 1JBKA 4EPXA 1R5OA 4HZIA 4B3BA 2F1HA 4Q9HA 2C78A 4US2R 3VQTA 2XTZA 1S0UA 1XZPA 3THXB 3SNHA 4DRZA 2J59A 3KB1A 4I99A 1GKIA 4JIMA 1JXOA 3ICQB 1HE8B 4AURA 5BW8A 5J4KA 2QU8A 5SZKB 1X6VA 1XCPA 4NKRA 4DWJA 4EFNA 2OUKA 5E7IA 1S1CA 4H1UA 5AUPB 1KMHA 2PZGA 4LK2A 2W6IA 5KUTA 3GJ7A 1GIAA 4OHWA 3VMFA 3OIVA 2W0SA 3AVQA 2GCOB 1MRNA 3QVUA 2HV8A 2FH5B 3MFYA 4M1SA 3BD9A 5L3SA 1XF9A 2C8VA 2H16A 1KK1A 2F43A 4RFSB 1G6HA 2QGZA 1U94A 3CUEF 4GPTA 3EA0A 4ZO4A 1Z0IA 5E7MA 5BYJA 2QP4A 1NKTA 1SVOA 3BS4A 1NSTA 3BH7A 4HDQB 4QBGB 4ZKEA 4ARZA 2PL3A 4UNRA 1BMFA 3BOSA 2OFXA 2KBFA 2O8FB 2FE4A 4B6EA 2WMOB 2SHKA 3C4JA 4ACAA 1T9HA 1CF4A 1GL9B 3CPJB 2R65A 4B3GA 1W36B 4CRWB 1GWNA 5IDVA 1OIWA 4R98A 4PAMA 1PV4A 2FG5A 4IOKA 5BWMA 5C4MA 5FBVB 3T12A 2XXAA 1G7RA 1L8QA 4L8GA 2QPOA 1P61B 4B75A 1SKYE 2JJ2A 4URXR 4P4UA 3PR1A 1Z2AA 3X1DA 4QJ3A 4ZCMA 3U44A 4TSFD 2G88A 2JLZA 1JEEA 5GJCA 2CHQA 2QBYB 2UZ3A 2ZSDA 3MWJA 1P62B 4OQFA 1RZ3A 3EWSA 3AVTA 3WBKA 2IHYA 3L0PA 1OE0A 2F1JA 1E9AA 2D06A 4UXIA 2X77A 5D3QA 4MYTA 4AYXA 1GAJA 4BASA 5K8UA 1E9SA 2ZTSA 4MYHA 2BBWA 1D2EA 2VSXA 4RY2A 1GSIA 4DT1B 3HPRA 1Z0FA 2VLIA 3JVUA 4DLTA 1F3OA 3ZQJA 3HDTA 1Z06A 3HR7A 2AFIE 1NL3A 2W2XA 1VHLA 2OCYC 4BE7B 3CNLA 1N6OA 4MKHA 3K0EA 5FPKA 3IHWA 2CJWA 4B32A 4KI0A 4MDEA 3RRZA 3CZPA 3B1VA 3O8DA 3K9LA 3KJIA 3MAAC 2HT1A 4M0LA 4A2PA 5GADl 4DSOA 4PC1A 3TSZA 1PLJA 2ZRDA 2YHSA 1W2HA 4A36A 4CZ2A 5E95A 3HJNA 1KI7A 1YR6A 5A4JA 2PLRA 1E2PA 3I32A 1OYYA 2Y8EA 5AJZA 1EFCA 1O87A 1EWQA 4P3YA 3VU9B 4DSTA 2VSFA 1Z0AA 4YDHB 4PPFA 1QRAA 2ATXA 3CR7A 3P4XA 4BWYA 5DN6D 1CJUC 2BMJA 1IY2A 2WTUA 2BDTA 5LD2C 3QKSB 3VHLB 3TE6A 1VG8A 521PA 3L0IB 3N70A 4OHVA 1JAHA 4QJ4A 4WAUA 2VP6A 4LY6A 5EXXA 1XX6A 3SQXA 1XD9A 4HLUA 1MKYA 4JJZA 4Y0AA 4D0LB 1TQ4A 2JEOA 1YZTA 2WPDA 3F8TA 3QQ5A 4LRWA 1G16A 1OKKD 3UKDA 2PX3A 4DEXA 4YXWD 4YMWA 3M6AA 3M4YA 1IM2A 1JJ7A 4S35A 1NG1A 3HPQA 5TXGA 2ZSFA 1US8A 2B8TA 2C9YA 1KHTA 2FF7A 2P0EA 1G7CA 4HB0A 3VR1A 3SYLA 2JLVA 3A4LA 1YJ5A 2GWHA 3FE2A 3MUFA 2GAAA 4HUQB 3EC2A 1ZM2A 4NBSA 2VO1A 1XD2A 3GFPA 1U0JA 2OE2A 4J0QA 5JI3E 4OHYA 1NN1A 4Q66C 2XOKA 3D8BA 1UEJA 4ESHA 4KYUA 3A1VA 2IUSA 5E3HA 4CT5A 4QG7A 1E4YA 4Z51A 1VG1A 4LV8B 3QXSA 3SU8A 1C1YA 3IQWA 1V5WA 3AUXA 1PJRA 3FPAA 2O5VA 4NDZA 5B58C 2KBEA 2ZETA 3WRYC 3ZVNA 2IS2A 4BLPA 2DWPA 2VA8A 2FSHA 1E2IA 4C0AC 1I2DA 1DAHA 3BE4A 5EP4A 4BLSA 1IQPA 4Z1MA 2DR3A 2IK8A 1ANKA 1E2MA 3IIMA 1AQUA 1O3YA 4HSEA 2B8WA 4NU0A 3AQ4A 2AN9A 3PG5A 1JPJA 3FHOA 4KAXA 3B82A 5B30A 5DLQC 1PVOA 2J7PD 1UF9A 1XNJA 4G5SA 3U3OA 4LBVA 3WYFA 4LC1A 1OV4A 1W0JD 3VTKA 2ASEA 1F48A 4BFVA 4R2HA 1N6RA 2RGNC 2Q3HA 3W6OA 1OXXK 5JS7A 4CEHB 2ZE6A 4Q47A 2QM7A 1G8GA 4M1TA 5DE3A 2YWGA 1XJQA 3PVSA 4FXPA 3CBQA 4KXFB 2OT3B 4TLBA 5H1YA 2G0NA 1E1QA 1KMQA 3LQQA 4MKGA 3ND8A 3GJ6A 4QGFA 4TN1A 3R7WA 2RAPA 2C95A 4JBXA 2VEDA 2PEYA 2CVFA 1F2TB 3K9GA 4TTPA 1R6BX 1TX4B 1IONA 4Q4JA 4C0BA 1DG3A 5DHFA 3BK7A 1SVLA 4MYCA 3EIQA 3QKRA 1NIPA 5JECA 3RS2A 4ZDKA 3GJ3A 1L2TA 2AK3A 4B3DA 5J47A 3KQNA 5CK5A 3EARA 3B60A 5FI0B 2QEQA 2WWHA 4A6XA 4JLKA 2NG1A 4Q02A 2MSCB 5LPNA 2BJWA 2OSBA 1ZU5A 3OE7A 3FYHA 3EZ2A 3CF6R 4XOIA 4FD2A 3UMRA 2C5LA 3MWLA 4XWOA 4XVUA 1W0KA 1GUAA 3WNBA 4IFBA 3KJEA 3QIAA 1N5IA 421PA 1AS2A 1N3BA 4TYPA 3BH0A 5KHOC 2HJGA 4URVR 5J5CA 3WYGA 3HP1A 1ZBDA 2IYXA 3HU2A 2PT7A 3K0AB 1LW7A 1P2VA 2BV3A 2PLFA 2NPFA 3QY0A 4PC7A 4GOKA 1E1RD 1V43A 1WA5A 3REFA 4U7DA 3OIWA 3I3SR 4CF7A 5LDDC 2ZS8A 3U61B 4OQLA 1SKQA 2Q3MA 5IT5A 2HYDA 4JLVA 1UBGA 2GVDC 2BBOA 2LKDA 3EZFA 4GP6A 1Z0KA 5C2JB 1XMIA 3RC3A 1L7VC 1EXMA 4LC0A 2IL1A 4M1WA 4WXRA 1Q3TA 3I61A 1AKYA 2R8RA 1IY1A 4I81A 2XZPA 3ADBA 4EFMA 2RH5A 1G7SA 1OFIA 2OILA 4K8OA 1ZRHA 4Q9JA 2F3TA 3THYB 2QRZA 5H70A 2IXEA 2NZ8A 2R9VA 2ZJ8A 2QE7A 1U99A 3LVQE 4DDVA 3VR6A 1E9EA 3FHCB 3P20A 3U3MA 3KQKA 1ZU4A 4ITRC 2D2EA 3VX4A 4PHGA 3C5HA 4FWTA 2QQEA 3A6PC 3W8NA 4X8LA 1X8JA 3QNUA 3X1WA 1KI6A 4OHZA 4JLJA 4D4JA 1ZUIA 2IYZA 4XSHA 3V00A 4EUNA 1COWA 4W5JA 4D0NA 4RD3A 5D3MA 4D25A 4MYUA 4RKEA 2PJRA 2QT0A 3EZ7A 2R6AA 3I5YA 3BFXA 1E4VA 1G3IA 2HXYA 2WV9A 3CIOA 1A4RA 4OL0A 3DOEA 1Q0UA 4RD4A 4RFVA 4B71A 1ELOA 5FUWA 1WQ1R 2CL6X 1Z6GA 4QRHA 4OI2A 5L3QA 3WBJA 2WKPA 5CIWA 4JKYA 4FWIB 1R5BA 1FNMA 1NVWQ 1R7RA 1MO6A 1NF3A 2Q0HA 2EFEB 1T6NA 1A1VA 3GCGA 4QFMA 2XNSA 821PA 1CR0A 2VHTA 2JJ1A 4KBGA 5FR1A 1S1MA 2GJKA 4R9UC 3NVAA 4V02A 2I4IA 5EJEA 4KSBA 4Q1EA 5BN4A 2G1KA 2GF0A 4KHZA 4F92B 1UBCA 1W2GA 4EPTA 5HTKA 1ZNXA 1OH6A 1MV5A 3S1AB 3M0EA 5JHHB 5IRCD 2ZUBA 1M74A 2Q6TA 3GLIE 3A1SA 5AJVB 1SQ5A 3VFDA 2G77B 3K70D 1U98A 3U3RA 3QVVA 4LYFA 5JCPA 4NYMQ 4TQUS 3NDPA 1KNXA 3NH6A 4MGIR 1JR3D 1TEVA 1E9BA 4B2IA 1XD8A 4MRRA 2V54A 2IW3A 5GJVC 3K70C 1NVVQ 3JZMA 3HU3A 3K1JA 4AG6A 4DC9A 1LB1B 1EFHA 2BC9A 2P2LA 2Q3FA 4QNMA 1ZCBA 3DHWC 3FKQA 5E7JA 3AVPA 3MMPA 5F2EA 2FFAA 1U0HC 3RRMA 1SVKA 4JLAA 1W5SA 1P9NA 4W7SA 4ZPXA 3AVYA 5M04A 3KUDA 3JVVA 4CW7A 3FFAA 3ZZUA 4LPSA 3QI2A 4BLTA 1KJYA 1UKZA 2ORIA 4IOJA 4I1UA 5H68A 5FL7A 3LAWA 3BB4A 1CIPA 3R9XA 5JMTA 4NZYA 2F9LA 4C0JA 5KU1A 4B2LA 2X2FA 1N6LA 5G41A 4JSTA 3SYKA 2Z6VA 2QNRA 2YNMA 3GJ8A 5FTMA 4BFXA 1LFDB 2WSSA 4OI4A 1GKYA 1GZSA 2CNWA 2ZRPA 3I92A 3NKVA 4DIEA 2ODNA 1Z8FA 3M1IA 1WDTA 5KNDA 2EWWA 1SXJE 2AWOA 2RGGA 4HAXA 3UXMA 1ZAKA 5DYIA 1PLLA 3O8BA 1DELA 4K46A 4TYYA 5HKKA 3IEVA 1GRRA 5JEDA 3LQRA 4E07A 3LY5A 3V9PA 3GLGE 3ICEA 4DEYA 1UADA 5FOUA 4F4IA 1T0JB 2JLUA 3OIUA 1RE0A 2KB0A 4QC2A 4EJSA 721PA 1A2BA 2ZRLA 4PR0A 4XIGS 3ZIAA 4HAZA 2AR7A 2V7QA 3ZVLA 1Z29A 3CRMA 2D74A 3PUYA 3PV0A 4Q7MB 4JMPA 3ZJYA 4AKGA 3CKLA 2CDNA 3THXA 1W4CA 3FOZA 4KITB 2DFLA 1VMAA 1RIFA 2ZYWX 2ZITA 4HAYA 4GDFA 2FX3A 4BGDA 4HDCA 1HT2E 1XDBA 4TMVA 4RSGA 1DOAA 5IK2D 2WJJA 2FPKA 2EWVA 1NMXA 4FCVA 3L0SA 3PXGA 5JS8A 1CXZA 5FOVA 4ON9A 3DZ8A 4C7OB 4OQMA 2FEOA 4NYJQ 4RVCA 1TMKA 1PUIA 4ZI3A 2IWRA 5EP1A 4FMCB 2ZSAA 3B8HA 4B73A 1J70A 2ZJBA 1TPZA 2GCOA 2XNDA 3MJHA 4LOAA 4RJLA 4D81A 1AS3A 3UK6A 2AK2A 1HV8A 1I4LD 3CRQA 2MMGA 4PTLA 5LD2B 4FN5A 4RFSA 1X86B 4M21A 4RZ2A 3Q72A 4TMTA 3LVRE 1NLFA 2ZPTX 4DB2A 1NNEA 1G5RA 1ZM9A 5KOYA 5HZKA 2GXQA 3KKMA 2IWHA 3GP8A 1XXHB 1E9DA 3ONWA 1J7KA 1U2RA 2O8FA 2VP0A 4XD7A 5EP3A 2QMOA 4M8NE 2GETA 1S96A 2ZVQX 3UIEA 2FZLA 2EVWX 2H5EA 1W48A 4QBFA 2GKSA 4KFTA 4BFTA 2IS4A 1PUJA 3K0CC 2W6ID 2R6DA 4URWR 1W44A 3BH6A 2R6FA 4HLCA 2QAJA 5CLLA 4C2TA 1P2UA 1E2KA 2GZHA 2XSZA 3A4MA 4DLUA 2VH5R 1P6XA 3DO6A 3JZAA 1VYVA 2QBYA 1OT3A 3K9HA 4GOXA 4O25A 2AFHE 4BFSA 5AWFC 5K8TA 1KK2A 1YR8A 2DFNA 4ZIRB 3HWSA 2W6JA 2HCBA 4PHFA 3SBEA 2VL7A 3VR5A 4C0HA 1VCMA 3FTQA 3QPWA 5JCZA 4PPQA 3MD0A 1D6JA 3OIYA 3U7EB 2Z83A 1Q1BA 4A0RA 5TDHA 4DT1A 4Z8XA 1ZD8A 1RYHA 1XBTA 4LYAA 4FINA 4WBSA 1B23P 3AKYA 3HYTA 4LDJA 1AZSC 5AJXA 1BS1A 1CULC 1Y3AA 4Q5IA 2CK3D 2HJVA 3CRW1 4Q48A 1ZP6A 2WAXA 4PC3A 4OQNA 3RS3A 5CB8A 3RRNA 1OF1A 3L8YA 1UPTA 5DNYB 1N0WA 3C5CA 1UDWA 2JJ2D 1WRBA 2HF8A 2E1RA 2ZQ5A 1YR7A 1ZNWA 2MSEB 3GLHA 4QBHA 3BWDD 5AJYA 4C4PA 3RNLA 2BWJA 2ZRGA 1JR3E 1LY1A 1I4TD 4CEIB 2JAQA 3IKJA 1NSFA 4AY2A 1JAIA 2ANCA 4UNNA 4OYHA 5FUVA 3TAUA 4AK9A 4FCWA 3CRRA 5J4LA 1OXVA 4LBZA 4Q9IA 3IBGA 3K09C 2ZXUA 5FUYA 1XJCA 1NLZA 1RJ9A 4LJ9A 1XMVA 5CYOA 2OBNA 3RANA 1M1YE 4JLNA 1SHZA 3AP3A 1U9IA 3GJ0A 4PAQA 5HE8A 2HUPA 3QKSA 4LUCA 3NTUA 1WBDA 2DWOA 5HCNA 1QHHB 2LCFA 2YC4C 1FTNA 4I4LA 1XEXA 5K8LA 3GLGB 4ESVA 2R6CA 1KTVA 4M9XA 1XMSA 4QOSA 2VRWA 3C7KA 1KSGA 1XCMA 1CRPA 1G19A 6Q21A 3K0SA 1KO4A 4HUQA 4E03A 4US1R 1KJZA 2A5JA 1N5LA 2C9CA 3ADKA 4XH9B 3RSOA 3AF2A 4YLGA 2P6NA 5FTNA 3MSXA 5AK0A 4YMTA 3QENA 2O52A 3T1OA 1N5JA 1P9WA 2RGDA 3QJYA 2AX4A 1MO3A 4KVGA 3T35A 4KODA 3AH8A 3LNCA 1XB2A 4BZPA 2VF8A 4TQ9A 1N5KA 1T8TA 2BBTA 4B6FA 3PEWA 1QHGA 1OXUA 3TIFA 3K0FB 2C99A 5AUOB 3U7HB 4RD1A 1JPNA 3T1QA 2O8BB 1T5IA 2NPIA 1IN6A 3E1SA 1G18A 2DHRA 2OXCA 2HXSA 2G6BA 3CPEA 4AIIA 3ETLA 1J2JA 4PC2A 3RYTC 2RGXA 4PZZA 1G3RA 1T5LA 2IUUA 4X8HA 2WAYA 4X8OA 1G5PA 3VAAA 1P2SA 1G3MA 1KYIA 3IO5A 1Q12A 2RHDA 1BH2A 1T3LA 1G21E 2IHBA 3CRVA 5G53C 5EE1A 2ZEJA 2BMEA 2ZRMA 2XOKD 4JLBA 4DLRA 3QUSA 2ZJZA 3KXKA 1ZM3A 1AM4D 2MSDB 2GA8A 3KUCA 5CYPA 1A82A 3VKGA 2ONKA 2TMKA 4MRSA 1D9ZA 1KI9A 2KSQA 2FJUA 2PBRA 5FPYA 3RDPA 4DVGA 1QG4A 1P3JA 2A9KA 2AXNA 4NYMR 4O2LA 5GVRA 4L9SA 5J4YA 3MLEA 2GJ8A 3L0OA 4MGYR 5CM9C 3A36A 5EP2A 1E2DA 1E32A 1ZCAA 2ZRIA 4B3CA 1NVVR 2RGBA 5HE9A 2J46A 2CBZA 3WNCA 1VYUA 1DE0A 2Z43A 4Z1MD 4TLAA 2C77A 4GT1A 1Z28A 1NBMA 2JATA 1G8HA 1R10A 1Z08A 1AZTA 4IVRA 4E22A 2VP9A 2WWFA 3W6PA 2CE7A 2R2AA 2CVHA 1S9HA 2QT1A 2ZYUX 2QAGC 2NGRA 3OEEA 1NG9A 1EFTA 1G3UA 1Z6XA 3KKOA 3NHAA 1TAGA 2GF9A 5A5GA 2IBMA 4JLPA 5EXPA 3BXZA 1N2CE 5JLJA 3GLFB 5SZJA 5L3VA 3QBTA 1Z22A 3NBXX 4JYCA 3EZ6A 3ZH9B 4D80A 5KDDA 2GTPA 3W3AA 1NBME 2H92A 5TB5A 1M2OB 4LYJA 2IXFA 2JLWA 4EQ6B 1LV7A 5CK4A 1XTSA 4G5RA 4IDHA 2WJYA 4D82A 1UKYA 2B92A 4ZDIA 2IS6A 1UEIA 4JLDA 2YVUA 4TL8A 3K70B 3MRSA 5EE0A 2A78A 3DOFA 4PHTA 1FUKA 2OFOA 1BOFA 2JIZA 2QGNA 1KZGB 1LF0A 3ZS9A 3OHMA 3U7FB 1G17A 4DCNA 3J81k 4GRAA 1YZQA 3K9NA 1VCIA 2ZJ2A 3W5JA 4Q18A 2HT6A 3OE7D 4JLOA 4EDHA 5KYKA 2I3BA 2J0VA 2KJQA 1UJ2A 2GXAA 1EFRA 1OLOA 1W0KD 2A5DA 2JLSA 4FIDA 1T4GA 3QF4B 4I1SA 5C18A 4ZV4A 1NKSA 1XZQA 1OW3B 3QXXA 3UWOA 4W9MC 3DKPA 2QP3A 4WZBE 1QHYA 4B35A 5FPHA 1CS4C 2OCAA 3Q7QA 1NY5A 2EQBA 3B1YA 2D2FA 1IJFA 4BFWA 4LPKA 2HDNB 3OZXA 4Q4AA 4F7WA 2VYFA 4V0NA 3O8CA 2YINC 2WOOA 2QPTA 4TL9A 5J40A 2IYTA 4MH0R 4NYJR 2V6IA 1KAOA 5F98A 2BHRA 5DH9A 5FPTA 3GEEA 3BJIC 2ODWA 4QKQA 1HQYE 1K5DA 3DVLA 3WHKA 2ZI9A 3Q7PA 2FNAA 3WMFA 3RWOA 1T3HA 4PFSA 5F9HA 1GNPA 2WZQA 3B7GA 4KSCA 3TUIC 5FBWB 3VKHA 2VF7A 2Q9BA 5FUXA 1YZLA 1KGDA 2PZEA 4DXAA 3ZGXA 2EFCB 221PA 3LFUA 3IPXA 1JALA 3EIHA 2XGJA 1J8YF 1XTJA 2QPAA 2WM9B 1QG2A 4POAA 1XFAA 4A2WA 4JYBA 2EFHB 3KL4A 4Z54A 4Q4HA 3I62A 1TUEA 1CJVC 3DMDA 4LCBA 4AYWA 1AJEA 1NN0A 3AF3A 4P32A 1VG9B 4DKXA 3CZQA 4H1VA 3Q9LA 2I1VB 2CHGA 3U2QA 1EFUA 2XJ9A 4OBEA 2A30A 3ZVMA 1XU4A 4N0DA 3S1AA 3Q85A 1E79D 1FX0B 1YZKA 2F55A 4PZYA 1CJTC 4CVNA 4UNPA 2ZYVX 1UFQA 4QM7A 3PUWA 1DPFA 3DMNA 4F38A 2VQSA 1QVRA 1G291 3AF4A 1L4UA 1KK3A 121PA 4BFZA 2WOJA 3IHLA 4C0SA 3THWB 4HB2A 4PANA 3G82C 3TVTA 1SGWA 2W2TA 2HEIA 4LJAA 3TK1A 4AI6A 3F0TA 3SDZA 2NO1A 1LVGA 1L4YA 1MABB 2WHXA 1OXTA 1CR1A 1KI1A 4YQFA 1Q22A 2A3RA 2JJ1D 3Q5EA 4BEBA 5JBQA 5KSOA 5TVKA 3PEUA 4JT2A 1XRJA 4EPYA 1IN5A 2QY9A 4KFUA 2IF0A 4KLZA 4O2RA 1C9KA 3HR8A 1DS6A 1KO5A 2IEYA 5SZHB 1LTQA 2D4HA 8OHMA 1E2GA 4IW3B 1HTWA 2GNOA 4LHZA 2BBSA 1GDDA 1NN3A 2JLQA 2ECKA 2ODEA 2V3CC 4MKFA 2ZJOA 1Z07A 4LV5B 2GJAA 3SR0A 3EAQA 3QEOA 1OHHD 4RKFA 3VR3A 4PO8A 2J7KA 2WBLC 4BPBA 2ZI6A 2DB3A 4TLDA 1HY3A 2IYVA 3KJGA 4QGHA 3AF1A 2JDID 4LYHA 1XTRA 2QP9X 1OH5A 4MQBA 4M22A 2C9OA 4TMZA 4FMBB 4C30A 2H17A 1TQ6A 1FMJA 1X3SA 4CGZA 4Q7LA 1S9DA 3B9PA 2DCUA 1GRQA 3SJCA 1ZIPA 1R4AA 2GJ9A 2O0JA 4UJ5A 3LWNA 4DSUA 2ZREA 2NO9A 1D9XA 1X8KA 1DAKA 3MWKA 1DG1G 5F9FA 4JL5A 3TSWA 3EX7C 3PIRA 3ZD7A 1KDOA 4JVSB 4QNRA 5DI3B 3R8CA 4LHYA 4WZAE 2OAP1 5J4HA 2AD5A 4GMDA 4RD0A 4IFEA 5EE3A 1BYIA 1G6OA 1E9CA 4OJQA 2FFHA 2NIPA 2WSSD 3T15A 1CJKC 3U4QA 3AVWA 4I1VA 2CNWD 3KTAB 3LW7A 5KPDA 2ZRHA 2CE2X 1SHKA 3W90A 4RD6A 1PLKA 2AKYA 2VSOA 4BZQA 5HKKD 4UXHA 2JLRA 3QKUA 3LXRA 1R0XA 2VTKA 3QEJA 5FTLA 4ASUA 1OFTA 4A15A 2PZFA 2J5XA 4D4KA 2GVZC 2BCGY 4QBIA 1KOFA 3B9QA 2FU5C 2OCPA 2I1QA 3SEAA 1NP6A 4URZR 4TZ0A 4DCSA 1CU1A 1ESNA 2H8KA 1KK0A 5DN6A 2EYUA 4GNKA 2GDJA 5LB2A 3BFKA 4JL6A 3RS7A 4P31A 3RC8A 1E2NA 4F91B 4U00A 2C96A 4MGKR 4A92A 4EJSC 1TQDA 2QMHA 1II9A 2P65A 1E2FA 4CIDA 2IC5A 2CL0X 4DIDA 5EUQB 1M6NA 1OKKA 1FTSA 2ZU6A 2JJ8A 3N5CA 2CL7X 3BIFA 3TUZC 2W58A 4UNQA 4V0KA 2REOA 3T61A 4HZUB 4ZDJA 4PO9A 2QN6A 1XXHE 1EESA 2XNDD 3CF2A 4PSVA 2ZRKA 4IKEA 3X1XA 4C2UA 1KDPA 1P9RA 2YZ2A 5H8WA 1F2UA 4A8JC 1ODFA 1FNNA 4L4UA 1XEFA 5E4FA 2GCPA 2C03A 1SVIA 4YDSA 2VHCA 4IEIA 3GLIA 1E0AA 1NMYA 2Z4SA 4ZIRA 4G3XA 3QXHA 3QXJA 4DDTA 4HDOB 3A37A 1M7BA 3ND9A 4XD7D 1CRQA 3U7GA 3LDAA 3CX6A 3I8XA 4AC9A 4L5BA 4P4TA 5BXQC 4LGMA 4XJXA 4L16A 4M1OA 4GBMA 2BJVA 3LA6A 2GZDA 2JASA 1NMZA 2QZ4A 3IIJA 1WBBA 1P7CA 1RFLA 2V4ZA 5C1BA 1JXMA 2ZYTX 1VCNA 4Q21A 2A5FA 3IILA 3BFVA 3L2OB 3U3KA 4JBYA 1M34E 2NO0A 3VNUA 3DPUA 4AYTA 3LH5A 2G0TA 4IHQA 1AGPA 1KO7A 5DIFA 5P21A 1XD2B 1Z63A 2OO7A 4S2EA 3UPUA 2B7CA 3RS0A 1LS1A 5B2ZA 4CEIA 3CX8A 4LV6A 3E5HA 4LBYA 2P67A 4G5QA 2W6JD 3B5JA 2FSIA 2W00A 1G1MA 3N2IA 4QHYA 5G3YA 3KQHA 3G0HA 1KY3A 3I4LA 3PUVA 4BEJA 5F3WB 2J0UA 4NH0A 4UQOA 2IT1A 2OXRA 1ONBA 4Q19A 4IXNA 4Q1AA 4TYNA 5BN5A 1VYTA 1N25A 2ZRBA 1T8UA 3TNFA 1SXJA 4MRPA 2Z0MA 1FMLA 1KDTA 1DBSA 1QHHA 2QAGB 2YOGA 1B0UA 4BFYA 3TH5A 1HYQA 3EWAA 3SZRA 3A1UA 4LWZA 1UBEA 2QA5A 3GJ4A 3CW2A 4WZ6A 3GLGA 3KXIA 5HZHA 4Q9KA 4ZI2A 2IS1A 5EXTA 3TLXA 5JZVA 5TARA 4FCTA 4N0EA 3U6KA 3AKEA 2IYUA 2QI9C 2FA9A 2IYQA 3C8UA 3IEUA 5KTYA 3SQWA 2ZE8A 2BM1A 3OEHD 3T5GA 1JJVA 1R2QA 1TNDA 4HATA 3CPHA 4KCGA 1G4UR 2N42A 2O8DB 3CWZA 5FPSA 3R7WB 5EZ6B 1IBRA 2A7QA 4UNSA 3AV0B 1NVUQ 1YR9A 4KYIB 1G4AE 4F93B 2ZM5A 3UATA 2B7BA 1E1RA 2YYZA 2GK6A 1KO8A 4P33A 4KVAA 5CB6A 1Y63A 3C41J 4LHVA 2HF9A 1R0WA 2RGCA 3K0FA 2YV5A 2FWRA 2O8BA 1E2HA 3DEFA 2EW1A 3OAAA 1G3QA 2RGAA 4TL6A 4D0GA 3EPKA 3AUYA 3UG6A 3KX2A 2IEZA 4TZ6A 1TU3A 1CJMA 4ERNA 1GL7A 1EG7A 4R71A 4B34A 1J90A 1H8EA 1KI8A 2ZAOA 4O0MA 4HLQB 4EPVA 5DSZA 3RWMB 1E98A 2KI5A 4II7A 1Z3IX 1W7AA 1F5NA 3X1YA 1W4BA 4Q01A 1Z0JA 2W2VA 1Q1QA 3FHTA 1D2NA 5FOTA 4RD2A 1II8B 4RZXA 1E2EA 4BLOA 5FI1B 3H0KA 2BVNA 2WWIA 3BB1A 3WYAA 2R6GA 4M9SA 1E96A 1OIXA 3LRPA 4DLSA 3VX3A 3ECCA 5JJIA 1S3GA 3TSOA 3RS5A 2ZAMA 4GFDA 1E99A 1UDXA 2EU8A 3K8YA 4MITA 4D26A 3RSLA 1GNRA 2CLCX 3U3JA 2UKDA 4IVQA 4Q1CA 3NBYC 3THOA 2WWGA 3LX8A 3PENA 2JLXA 2AWNA 4XSGA 4XTCS 1R0ZA 3H1TA 4IDOA 4JVLA 1MR3F 1W46A 4KLNA 1S4QA 3KKPA 2RMKA 2NMVA 1KJWA 1VTKA 2ZR9A 3DDCA 2QTFA 5GJBA 3C15C 5C4GB 3QKTA 2B6HA 1G8FA 2GXSA 3EPHA 1M7GA 1S2MA 3IDQA 2J0QA 5CDFE 2BM0A 3PCRB 3NEYA 4DLXA 3ADCA 1WB9A 3AVOA 1FZQA 4JBWA 1AA9A 4A0FA 1KI6B 2XJ4A 3U60B 4XWAA 2G1JA 1UKVY 2YKGA 2WWYA 2OG2A 1KSHA 1OIVA 2ZI4A 2REBA 2ZJ5A 5CITA 2FN4A 5DGXA 1BMFD 4EQ6A 4LX0A 4QL3A 1TTTA 2FEMA 5KNCA 2WVJA 3TMKA 2FOLA 3L8ZA 3T06B 2YJTD 2IYWA 1P72A 4KV9A 4JZKA 3L82B 2HYIC 4DUGA 2WIAA 3IQXA 3GLFE 1JR3A 3EC1A 3FGNA 4DZZA 1JI0A 5ELXA 1JR6A 4LJ7A 2KE5A 3FFBA 5L3QB 1VIYA 4FMDF 4H9GA 3OFNA 3PEVA 2J3EA 4Y0VA 1G7TA 3OEED 1AQYA 4ILEA 1RRGA 1ZD9A 3TW8B 4GOJA 3NH9A 4NCIA 2JGNA 2VHUA 4DLYA 1KSFX 1AIPA 5KSPA 4QHSA 1G8PA 2P5SA 1XEWY 3H86A 4US0R 2B21A 4DJTA 4YMVA 2Z5FA 4K81B 4M1YA 4HI0E 1GG2A 1M7HA 3LXXA 5FR2A 4R7ZA 1GNQA 5GVSA 5CLQA 2ZUDA 3VU9A 5JEEA 2XTNA 3ASZA 2O8CB 1IN7A 3KDSE 2J87A 4GZMA 2JIZD 1ETUA 2PJZA 3FMOB 4PAOA 2GZAA 3FB4A 2D7CA 4FW9A 5C46F 5HPYB 1H8HA 4LJ6A 3TBKA 3ZZ0A 2CCKA 4ZKDA 3LV8A 4OKSA 3TKLA 3WY9A 4NTZA 3Q5DA 2QG6A 2RGEA 4TTQA 5DO9A 5TMPA 5DYGA 1EFRD 1VKJA 4L9WA 2ZSEA 2YOHA 1VHTA 1FW6A 5J4VA 3DM5A 2GEUA 1TU4A 5SZIA 4CT4B 4P4SB 3ZDQA 1TADA 2CCJA 4LHWA 1Q57A 3LLMA 4NL4H 3AGQA 1I2MA 5FOXA 2QSYA 4EFLA 3UG7A 1DAEA 5UKDA 4M1MA 3SFVA 1K5GA 1CP2A 1AN0A 1XMJA 4R2IA 5AJWA 4C0LA 3TR0A 1K6MA 3A8TA 4IVPA 1CKEA 1S8FA 3FKSA 4ZDWA 1BO6A 1FX0A 3KFXA 2HCJB 3NBZC 4HEJA 2VHQA 5BQ5A 1N6NA 2JA1A 5FTJA 5KSYA 4IRUB 2FZ4A 1ZJ6A 1FQKA 3GFTA 3IBYA 2CLDX 3P26A 4DCUA 3W6NA 2WPDD 3A1TA 4QGGA 3TAHA 3KB2A 1E0JA 1X1RA 3EPLA 1RC8A 2ZROA 2GBLA 2YWHA 3PITA 3NWJA 1ZUHA 2A2ZA 2F7SA 2F9MA 4HLUC 1EWRA 3THWA 1GM5A 1KO1A 2ZI7A 3R9WA 1Q1EA 1U8YA 2XTMA 3PUZA 4EJSB 5JI2E 4YC7A 1W1WA 3F3YA 3SC3A 3SOPA 5DISB 4E09A 3C16C 3I1FA 3UMFA 1MABA 2PEZA 1FFHA 3RVBA 2QTVB 3LW8A 4HAVA 2IYYA 4Q7KA 4CEHA 2LKCA 3AP1A 3EG5A 3K0CA 4PZLA 3KQLA 4QJ5A 3MGCA 2O8EB 2AD1A 3D7MA 3QXCA 4TT3A 4UJ3A 4PSKA 2W83A 4OI1A 3FDIA 2G83A 4NE2A 3DPTA 1GFIA 2ZJAA 3IO3A 1UKEA 5KNBA 3BORA 3EPJA 5L3RA 2YC2C 2FFQA 1F2TA 2D62A 4A8JB 1T3SA 3CONA 1KZ7B 1R8QA 3C14C 2HLDA 1YKSA 1Z6TA 4NP6A 4OJKA 3PFIA 4LZZA 2QSZA 3G5UA 2OLKA 4HAUA 1DADA 1KI4A 2E9SA 4X8MA 1N6IA 3PUXA 1JECA 2GESA 4A4DA 3GMTA 3NHBA 4GSYA 3TGPA 2ERYA 3TJZA 1G64A 1KI3A 4A9AA 3U6BA 1A5TA 2QENA 3WMEA 1N6PA 5JHGB 4U5XA 4TL7A 4IOMA 2VIIA 4PPNA 1XTKA 1WXQA 2AHOA 2GEVA 1OYWA 3UANA 1E1QD 3IGFA 1MH1A 1A2KC 1Z6YA 2DYKA 2IYRA 3BC1A 5DI3A 2VP2A 2CK3A 3K0AA 2OEPA 4PQRA 4EPWA 3CF0A 1XPUA 1WCV1 2CLSA 4HB4A 2XB2A 2D7DA 1QZXA 1G8YA 4Q9LA 4G0NA 4TTRA 3KTAA 5FOWA 4PXAA 2V6JA 3GJ5A 3ZLJA 1QHXA 3LBHA 2H1LA 2JCSA 5AR1A 1GITA 2GXUA 4DSNA 4Z8YA 3VKWA 4CEJB 3K09A 4NCHA 4N1AA 2OBMA 3N2EA 1ZW6A 1P4SA 4B48A 1U0LA 1Z6AA 3UWKA 4AWXA 2GJSA 3NG1A 3SS8A 3THYA 3TRFA 1E9RA 2VBCA 4PSAA 2P6RA 4JKIA 3FVQA 4NPHA 1YRAA 3DL0A 4BQSA 1SVMA 1YZGA 4MRVA 2ODBA 1HQCA 2AL7A 1CR2A 3RLFA 5JFGA 3W8RA 3B1XA 2F1IA 1Q44A 2BIFA 4LJ4A 4NYIQ 1XP8A 1R8SA 5JSZB 2WJHA 3GD7A 4G5OA 1U81A 1OSNA 2QRNA 1DAGA 2ZS7A 3GLHB 3P27A 1IN4A 4HZUA 1RRPA 1JQLB 3VHXA 1ZM7A 1DEKA 4ASUD 1HE1C 5LB4A 2OLJA 1E0SA 2ORVA 4URUR 4BLRA 3ASYA 2P5TB 3CB4A 5LBIA 3AVXA 2QE7D 5G40A 3CH4B 4B47A 2ZR7A 1RJ9B 1TF7A 2ONJA 4ACBA 1E2JA 1OFUX 3ZVRA 3CR8A 5CJ2A 2PH1A 1FL9A 1E94E 1EK0A 1W5TA 3H2YA 4OK5A 3SHFA 4CDGA 4DHEA 3CX7A 4E5UA 4OQXA 2KWIA 1GRNA 1AS0A 3WRXC 2VP5A 1HEIA 1T91A 4DDUA 2WSMA 1IN8A 1NRJB 1DARA 4IOLA 2C98A 2BCJQ 1XEXB 4HAWA 4LJ5A 1P2TA 3CM0A 1E2LA 4B33A 4D2IA 4TMKA 1COWD 2ANBA 3SJAA 5EXSA 4G5GA 2C04A 3MCAA 3KXLA 4QHTA 2IA5A 3QE0A 4LBWA 2OFWA 5B64A 2XZLA 5JJKA 1W49A 2EYQA 2ZVPX 1YVDA 2NZJA 1SZPA 3OF5A 4JT4A 4NCKA 1RKBA 4QM6A 3QOFA 4DCVA 4I1OA 2L0XA 3QPVA 4QGAA 5KPJA 2NQ2C 4B76A 1OB5A 1DAIA 1YE8A 1UM8A 2FGJA 1RRCA 4NCJA 1DTSA 2GCNA 4MRNA 3MG9A 3KFVA 1AKEA 4C0KA 1DAFA 3B6EA 4OI0A 2REXB 1IXSB 1N0VC 1E6CA 1QBKC 3W5IA 2ZUCA 4RZUA 1ZD1A 4PPGA 2FDCA 1RW4A 1R0YA 1I4DD 1P75A 2QAGA 2ORWA 3LBIA 2O0KA 1KMHB 2FPMA 2W0MA 4A1FA 2GK7A 4BRUA 4C3ZA 1NJGA 2FPLA 3O8RA 4QXAA 4GL2A 1E69A 2PMKA 2RB4A 5L3SB 4EIWA 3E2IA 1IXRC 1J8MF 1Z47A 2IYLD 4TSFA 4IXMA 4KJZA 4Q4LA 2F43B 3RS4A 3SBDA 1II0A 4A0GA 3GPLA 2V55B 2IX3A 2BKEA 2J41A 3CO5A 3EZ9A 4GI7A 2IF2A 2ZU0C 4PQFA 2O8DA 2OV2A 2NOAA 3I73A 5A0FA 4ARZB 1F60A 2WICA 1M8PA 2CHVA 3TQFA 1SKYB 4JVMA 3P32A 1FQJA 2H18A 5FL7D 1NI3A 3A4NA 2RHMA 1XJ0A 3WHLA 1SXJD 3RHFA 3AVUA 4UKDA 3HU1A 3R9IA 5KSZA 3B1ZA 2FSFA 1IXZA 5KDLA 1YZNA 1ESMA 1VG0B 3P4YA 4GP7A 5AUQA 1VPLA 1SXJC 3W9YA 1AK2A 3CWQA 5FOSA 2XXAB 3Q3JB 2WJIA 2J1LA 4G1UC 1H65A 2UVQA 2WWWA 4C0QC 3BRWD 5CJPA 4XWKA 1RRFA 3BAFA 1MRSA 3KQUA 3U44B 2YWFA 3B13B 1CLUA 4C7OA 1SVSA 4EAQA 4LJ8A 3CLVA 2BKUA 4B3XA 4EKDA 4B43A 1Q3HA 1ZYUA 1DVRA 1XEWX 3A58B 2ATVA 1ZINA 4XVQA 1II8A 1QDEA 3VNVA 1TF2A 3D6TB 4KO8A 3PEYA 3VR4A 1RPZA 2QORA 1NIJA 3ZYCA 3QF7A 3AVVA 1N6HA 4OHXA 2QMUA 3GQBA 1EX7A 3IIKA 3ZIAD 1XCGB 1N0UA 1T0HB 2V7QD 3SI7A 2ZSBA 3ZZTA 4L15A 4Q1FA 1ZNYA 2QTHA 2FMXA 5BYKA 2VHJA 3LBNA 2ZS9A 2G3YA 4D4MA 5FH9A 1A7JA 3QPUA 1XXHA 1JNYA 2V9PA 2YOFA 3OAAD 3X2SA 1BIFA 4V03A 2V1XA 4GZLA 1HH4A 1RYFA 4WVFA 2X8AA 3TUJC 3R20A 3AKCA 1IOZA 2CJWB 4LHXA 1H8ED 3CH5A 1OXSC 3GEIA 3EIEA 1KY2A 4YXWA 3T5DA 2FFBA 1CEEA 4BLQA 4P0TA 2QM8A 5FTKA 4N3NA 4MGZR 1G20E 1U90A 4JJKA 1NN5A 2XEXA 2LWIA 3AF0A 2WIBA 2IYSA 2F1RA 4YMSA 4TWZA 1YZUA 1NLYA 1XPRA 4W5HA 5ANRB 2QL6A 1XTIA 4BZXA 3WMGA 2ZR0A 5BN3A 4Q4AB 4IDNA 4BUJA 1ZM4A 1TF5A 5EE5B 3V4RA 5EQTA 3ZS8A 4F4JA 2DFKB 1IJEA 1D5CA 5FBRB 2J9RA 4AKEA 4A0HA 2OBLA 3P1JA 2CMKA 1E79A 4TQAA 5JRZA 3TW4A 2J0SA 3DKVA 4AKIA 2GRJA 3QG5A 2BOVA 2D3WA 1GILA 3BGWA 2CEAA 4HYYA 2F3RA 1W36D 4B74A 4F4CA 5FBLB 2CCGA 1G9XA 3WP0A 1WMSA 1US8B 3FWYA 1KDRA 1U8AA 3DZDA 2V1UA 4DDWA 3CNNA 3KJHA 1U8ZA 2RGNA 3LLUA 4OK3A 1W36C 4KU4A 1UAAA 4AKHA 1W4AA 1Q1ZA 4MUAA 2J7PA 1QF9A 4Q4HB 5IF9A 2XSZD 3NDBB 1W0JA 2XB4A 4BECA 1LS6A 3EW9A 4JS0A 2H7VA 1OPXA 1MO4A 1NVXQ 5GJWC 4TYWA 1F6BA 3D31A 5JRJA 2WKRA 5DI9A 1YU9A 4WW0A 2QROA 4PHHA 1GVNB 2BEKA 4UXJA 4C9BA 2O8CA 3A1WA 2DFTA 5G3ZA 3T1VA 1FP6A 4DUGD 4FMCF 1BKDR 1G41A 2QQ0A 4LJYA 2IUTA 3E70C 4MUBA 4ZCIA 4M1KA 2ZRNA 1RVDA 2ZRCA 1DAMA 3KKNA 1OHHA 1C4OA 3FMPB 3SFZA 4YMUA 2WWXA 2PMDA 3KZ1E 4B44A 3AB3A 3OFND 3ADDA 5K8IA 4JSYA 2JDIA 2NO7A 3I8SA 2X1VA
chains in the Genus database with same CATH superfamily
3RABA 4PC6A 3HVIA 4WMLA 2WJWA 3PC6A 4HAIA 2I8CA 4AQYB 3J7AO 3ILVA 1XTVA 5KINB 1P6UA 4Z4CA 1GNLA 2EBHX 5LA6A 2QW8A 3IP7A 1VJDA 1K7EB 621PA 3QPTA 2R44A 4XXHA 5JJLA 2F4OB 3HLKA 4KX3A 3O47A 2ID4A 4R31A 3QVOA 1X1SA 3QKRB 1TEXA 4FUQA 1E6MA 5FLXA 4G6QA 2HQSA 3LY7A 1B1AA 1HBJA 3DM9B 3D3QA 4JVNA 4L08A 4C7JA 4BVJA 1NRIA 2VYVD 1IHDA 3R6WA 1DC3A 5IAJA 3T4EA 4QLCU 5H3LA 4OK6A 3HVHA 1XTQA 3KYLA 5LIPA 1CZOA 3F49S 4LOIA 4UE3S 4M0FA 3KJFA 3INRA 3RPJA 4A2QA 5C3MA 4KNVA 2AC4A 3W3ZB 1LSOA 4TUYF 1A6IA 5DXAA 2W4QA 1W76A 2F5EA 2UXNA 2V5VA 3I0XA 2AH5A 4X1EA 5MDHA 4EHAA 3E9RA 4XCXA 2FV8A 1C1HA 5CW1A 4DYQA 2PVPA 4JQYA 2PIAA 1U02A 2WKQA 3W77A 1CUCA 1TQ2A 2DPXA 2AZXA 4IUYA 3DR5A 2GM9A 2OCDA 4MHOA 3ECSA 1OH7A 3VJRA 3KD2A 5EE9A 3D5LA 3ZD6A 2Y93A 3D4LA 4D92A 2BMFA 1PZDA 3RAEC 3W34A 1AUPA 1XMXA 3ZMZA 2WMNB 4EJVA 3A70A 1USSA 4HEA6 4AJLA 1Q20A 2YWEA 3HV0A 2CUKA 3MK31 2HBQA 4S1TA 3REGA 4L9NA 1H2BA 2OR3A 1UK7A 3IQHX 1RJEA 4DSAA 2ZJ1A 4WQMA 5FLKA 1QNCA 3H1FA 5JAIA 2FWJA 5HJ5A 2E5NA 4D6XA 3TLGB 3VFZA 3QTTA 3HVKA 1XAIA 3I5XA 3FHNA 1CUEA 4J6FA 2O0HA 2XX3A 3WLNA 2QKYA 3D8NA 2IXGA 1IAWA 2REQA 1QRSA 3GWZA 4ZCQA 5CLIA 5TQ0B 2IP1A 3GQVA 2K3FA 2X19A 4I4TB 1SBNE 3L6CA 5REQA 4EPXA 2HX1A 2JK1A 3I83A 4YI3A 4FDAA 1XZCA 4R2WA 1IO2A 4JIMA 4A2UA 1HE8B 2DMUA 2PLWA 3IOYA 1XCPA 5K3FB 2WK1A 3C70A 3RB8A 1W4ZA 5KUTA 5CFLA 3OIVA 4I55F 3QVUA 3SLKA 5BSGA 3BR6A 4NCXA 5JS2A 4AX4A 4RFSB 2K2WA 1KJ9A 2BLNA 1L5MA 1ZY2A 4OJTA 1LWVA 4UNRA 5ELMA 3OPXA 4RHYA 1LXTA 2P91A 1YASA 3AHGA 4JR0A 4GYJA 5GZ3A 3S2GA 1DIZA 2BYVE 4ARAA 2Q5HA 3KQMA 1JHDA 4D4IA 1Z2AA 3HLTA 2E85A 2AA3A 4TMYA 5DK6A 3EF1A 4UOEA 2C5HA 2PFSA 1JDZA 3TTSA 3VNSA 3EEBA 4FHDA 1QU2A 1E9SA 3ZMSA 1OJ7A 1XR3A 1GY8A 2VSXA 1BKSB 1VQ4I 5GTHC 4MPTA 4OSEA 1K08A 3CNLA 3RUDA 2ZM6B 3GMIA 4GPZA 3DPSA 3HB4X 5GADl 4ZVVA 1VQ5I 4IQJA 2BDEA 3IJPA 4EHHA 3TIXB 1E2PA 1YTBA 4DPKA 3N05A 2P7IA 2XI4A 3QKSB 3F23A 3CUQA 2PX3A 2BEWB 5F5LA 1PT7A 4FSHA 3VR1A 4DWVA 4D99A 5KVRA 4EB0A 5G0VA 3K4PA 5LDGA 1U0JA 3V8LA 4OHYA 3A1VA 1LCIA 3LCUA 2OB2A 4D9EA 2I6FA 3ZY6A 3UK1A 2O5VA 4PZAA 4UU1A 5LRSA 3DAGA 4ABZA 3NAZA 3R75A 3BWXA 3ENWA 2RQQA 4WESA 4KAXA 3I0TA 3WYFA 2B30A 3M49A 1F48A 4CEHB 4MKRA 2ZG6A 3PICA 3LKBA 4HWRA 1NK2P 2QLJA 2RGVA 3EYIA 4NLLA 2RAPA 2P6PA 2OWEA 2E4UA 4JBXA 3PSFA 1F2TB 3NIFB 5IM4A 1EVYA 4HTFA 3MAJA 2PKCA 3AW8A 4MW7A 3OCXA 2QD5A 4L0MA 3ED5A 1NVTA 3V33A 4UHCA 1QTQA 4S0ZA 2ON6A 3HCWA 4RLSA 4LK1F 3HU2A 1WJWA 1P2VA 2F7LA 1Z74A 1JDVA 5LUBA 1YKGA 1L7XA 1E1RD 1WA5A 2CUNA 3U61B 3M70A 3JALA 1EWTA 4WK6A 4WZBB 2I7TA 3RGWS 2NO4A 1IC8A 2Y99A 1YFJA 3MCWA 3NRJA 1L8AA 3S93A 4K8OA 2AR0A 2YY6A 1CDEA 3GJTA 2UXCB 3OKCA 3WK9A 3Q2IA 3GDFA 3M1YA 3GUYA 2QRQA 4U39A 1XN1A 1G5QA 4D46A 1ZS9A 1HLGA 3A9WA 1KOLA 4DDMA 1FP4A 4FWTA 5CVTA 5FWXA 1OILA 4DJDC 4R3NA 1ZUIA 4ARIA 2XLCA 1RJDA 3H19A 1H8AC 5LOVB 3AONB 4DANA 2X6QA 5FUWA 3KOWA 4QRHA 4P83A 2NAZA 1B14A 3LF1A 4JKYA 1NVWQ 4ENTA 3OTWA 1JHVA 3JZIA 4BBRJ 1GUYA 3ZXYA 5CVRA 2CNBA 4QDTA 3OY9A 3A25A 5AW1A 2EGGA 1MV5A 5SY6A 3S1AB 1KZ9A 4QU8A 3QSGA 1Y80A 1U80A 2CMPA 2CLIB 3F9RA 2ZJQF 1WG8A 4R1MA 2DI3A 3QVVA 3H9QA 3LQ4A 2FKMX 3OHSX 4B2IA 1DBIA 3K70C 1LBEA 1QV6A 3EMDA 1CY0A 3LVFO 5F1OA 4BCDA 3S70A 4FJ2A 5F35A 3O3OB 5KU1A 4M6WB 3SYKA 3SZ3A 2PKXA 2JA7J 4RELA 3BRWA 3WKDA 1GZSA 1RXSA 2AWOA 2I2AA 2V7UA 4JR1A 2QTWB 1A3CA 4TYYA 3HBAA 5HW0A 3LY5A 5ITSA 3V9PA 2D0OB 4P7BA 5FOUA 1A9YA 3TRKA 4MO2A 1Y1KE 4HP8A 4NXMB 1N7IA 3O8GA 3CRMA 3ZJYA 4AKGA 3ERED 3NU1A 2JRTA 2M5WA 4HDVA 1XSDA 4HDCA 4N41A 1H9BA 4EF6A 2DYSH 4X1YA 4NYJQ 5E9AA 3H9GA 2ZXHA 2FQYA 3WGZA 3ZWKA 3A03A 4OFZA 2Q6IA 1USGA 2R97A 1NNEA 2GXQA 1OTHA 5CVEA 4E7PA 1FUYB 2JI4A 3ML6A 4PPYA 2YICA 3UQYS 3I9OA 3DKXA 1SANA 1CUDA 5TS3A 1Z4JA 2P9GA 3JVDA 2GZHA 4AKTA 1ZRCA 2IPOA 2HFHA 4UVHA 3LBAA 2A35A 2MR6A 4O8CA 4UM9B 1VCMA 3QPWA 5HLTA 3VSCA 2VT6A 1XVUA 4A0RA 3FOFC 1NNLA 2YH2A 2W2LD 1M76A 2VATA 5FWDA 1Y3AA 5CB8A 3KKKA 2ZDGA 2Q1XA 1MXFA 1Y4SA 3QJ5A 4RAGA 1CETA 4ZEOA 2Y4NA 3IKJA 2Q5IA 4J49A 4Y18A 1RWMA 4KO4S 4QVGA 3HDYA 2ZB9A 5DD8A 1GXPA 1M1YE 1KQFA 3AP3A 3LNTA 1Z18A 2WRZA 3REOA 4AJ4A 3DG9A 3SK0A 3WWOA 1ZN9A 4TUYB 1SD1A 2LMDA 2VRWA 5AI0A 4YYEA 4B0OA 3MTJA 1Z05A 3AF2A 5FTNA 3PGVA 2CFSA 4UEWA 2XAQA 3RC7A 3GBPA 4K2AA 2OO5A 2ZTMA 3G2NA 4YCMA 4P93A 4N0QA 3HM9A 3T1QA 1ETYA 2C82A 1IWPB 2Y8LA 3KZYA 1EWVA 2G6BA 5CDUA 1QYCA 3M5CA 5LQUA 4OU4A 2EL7A 2J4CA 2NOEA 2QUHA 3L84A 2I6GA 2ONKA 1E2BA 2KSQA 4BWFB 1BDHA 5BMVA 1OZ0A 1RXIA 1J1IA 1R6UA 3TKAA 2XYVA 2ECOA 2Z43A 3JYNA 4Z1MD 1KP2A 1F8GA 4TLAA 4DF3A 4JI1B 1JAXA 2WWFA 4EJWA 4ZAYA 4UE2A 5B7GA 2H1WA 1REPC 4I4CA 2VPLA 4K40A 4JN6B 3EXFB 1UBLS 4FYPA 3DQPA 4LYJA 1H23A 4G5RA 1SO8A 4FE4A 3ABOB 4PG6A 1BOFA 2NXWA 3ZJVA 2C97A 3NAUA 4GRAA 5DPMA 2OTJI 4Q18A 1YE3A 3IV6A 1XZQA 4I7HA 1MBGA 4I55B 5L4LA 4M8SA 3KZOA 4Q4AA 1DTWA 1F0YA 4V0NA 5E6RA 5TQ2B 3IHTA 4NYJR 4TPKA 4AC0A 5F98A 3EN0A 2JFBA 1RYDA 2B99A 2R3SA 1THZA 3WHKA 2ZP1A 5H81A 3BCBA 3VKHA 1MMAA 4F84A 2OYCA 2Z56A 4Y1EA 1KE1A 2JA6J 2FRVA 2XGJA 3IXLA 4MAAA 2WM9B 5GPBA 2EFHB 3KL4A 1TUEA 3JAKA 4EYSA 2HU5A 2CHGA 2K7LA 2JRLA 4DLNA 3EIWA 1E79D 1UMQA 2A0UA 1MIHA 2Q0OA 2L7KA 1GQRA 1BCRA 3IVAA 4HDNA 4LJAA 4X95A 7MHTA 4M98A 4YQFA 1AA7A 3Q5EA 4J7XA 5TVKA 4D02A 3LX6A 3FMRA 3NRBA 3WGMA 2J08A 2B4RO 4FKMA 1YBAA 1N1DA 2FX2A 1NN3A 4MKFA 1BVHA 4NOLA 2I9PA 3EAQA 1GARA 1NR5A 1SHJA 3P2OA 4M22A 3MJCA 1HLDA 3MTAA 4ZC8A 5C8ZA 4HFJA 4FD3A 2W7TA 1E8DA 4O6JA 2UXXA 3QOXA 3PIRA 3D59A 4ZTZB 5KK1A 5EVJA 3BMQA 1TNSA 3F3MA 3KP1A 4Z6YA 5T64A 4I1VA 1YE9A 4KBYA 2PQ8A 4F3QA 2I87A 1FLVA 2EFJA 3Q11A 1SD5A 4RK1A 2ZUTA 3COVA 4UXHA 1FFDA 4R40A 1TLFA 4EHFA 2GA1A 2PZFA 1K4KA 4DUZB 2CN1A 1CU1A 1ESNA 4XKCA 1NVDA 1E18A 4B09A 3RS7A 1GQYA 2VKTA 1SFOJ 1FLDA 1ECLA 4CMIB 5A06A 5C1PA 2FE1A 1NMYA 3WRYA 2HEGA 3QXJA 3ZCPA 3JRDA 2IPNA 3DCFA 2VPIA 3FBNB 2W2MA 1NUAA 2Q41A 1ITZA 3L2OB 5EGOA 5DHTA 4TLMB 2E4XA 3R7DA 1DFGA 1XZIA 1ZD5A 1F4VA 3W5DA 4QZVA 3DL7A 4U8GA 2ZTLA 1Z1DA 4KDFA 5LU9A 1D1SA 1HLFA 3VR5D 3KQHA 2SBTA 5JQWA 1Y0UA 1KY7A 3IS3A 5BN5A 3H36A 4G5HA 2XVXA 4YRDA 4G0ZA 3CVUA 1E61A 2ZWMA 2VQEB 2ZT7A 1K86A 4EW3A 4UAUA 2H0AA 3ASNH 2D0CA 4RBNA 2O7OA 2G9QA 3R7WB 3VZDA 2Q4DA 3ILYA 4AN4A 1UHMA 5IYZF 4QEZA 1Y63A 3A06A 2Y0BA 4LHVA 1R0WA 2FZGA 4YWJA 2EW1A 4BC1A 4R79A 3L9XA 1ULAA 2C3OA 1WDMA 2KI5A 3HG9A 3ESWB 4NX2A 3ZKWB 5GONF 4RZXA 3PMGA 4IH9A 3OECA 4JBHA 2XCOA 2CY0A 1KFBB 3F22A 5GP9A 2XMCA 3LRPA 1X1CA 4QTYA 4WFJA 3Q3VA 1D3AA 4PAGA 3H1TA 2GTIA 1W46A 3MWEB 3QYPA 4MUIA 4EKGA 1U2EA 5ES3A 1UG2A 3G71I 2B6HA 2DPDA 3D6HA 1TL8A 1HYBA 1S2MA 4ZEMA 2HAEA 3H5RA 3DONA 1IRZA 1Q7CA 4IIFA 1O5OA 1FTWA 3FTCA 3TZEA 2MSKA 3A6LA 4EQ6A 2FEMA 4D1QA 4YP0A 1DX4A 5FQOA 3KC2A 2EBWA 4BNKA 3EC1A 3QH4A 2PMHA 4BJ5C 5BMOA 1UB9A 4U2CA 3W6KB 3R1IA 4JQSA 2PRYA 1PG0A 1ZEJA 2J9FB 5FKNA 5D8DA 2Z5GA 16PKA 1PWXA 3FX2A 2P5SA 4KN4X 1PS9A 4EITA 4K81B 5C8YF 4ABTA 2XB9A 3FYSA 4GWGA 2CKMA 5CLQA 4EB6B 5JEEA 5EJCA 1IN7A 3OV8A 3R40A 5D3KA 3ISTA 1M6VA 4ZCRA 2AS0A 4ZKDA 4YMIA 5HM8A 1U2DC 5DYGA 1KA8A 4II3A 3DM5A 5SZIA 1TADA 4WCFB 2QSYA 3O9ZA 2K4BA 1N3CA 5KWSA 3SFVA 4KYWA 1NE7A 3KYCB 3TXXA 1Z4MA 2I33A 1F43A 2DKNA 1BGVA 4HEJA 1J1ZA 3CZ6A 3TZBA 3GFTA 2BKVA 3O7WA 4NH4A 3TAHA 1W30A 1JDBB 1Q1EA 1U8YA 5JI2E 1MD0A 3SOPA 3C16C 2Z2IA 3LQKA 2ZWPA 3ZD9A 4DV3B 2A9PA 1W2WB 3C4QA 4P5DA 3WFZA 1OKRA 4PZLA 2OKGA 3K0CA 3TF5A 1JT9A 2AHRA 2ZK7A 3FDIA 4TYMA 3TTVA 2Q7DA 5TT1A 4MVJE 4M86A 1U8EA 2M0MA 3OMXA 1N6IA 1YX3A 3GLLA 3TGPA 4R8RA 2QENA 3C0KA 4IDAA 1QZ3A 5HS4A 4E7LA 3NIWA 1OYWA 1NATA 5FI5A 2PRZA 4UREA 3ESBA 4TV9F 5KYVA 5A2QZ 3VJLA 4Y33A 1V1MB 2IEKA 2YWRA 2CLSA 4HB4A 3RBZA 1PR4A 1L4MA 3BQYA 2WFZA 2V6JA 4TKMA 2D0PB 3HUDA 3TL3A 3E9QA 3PS9A 2Y0DA 1Z9CA 1P4SA 4DMRA 3IT3A 3NG1A 2V6GA 3RLIA 5FKOA 1ZSNA 4JKIA 3HYSA 1JX6A 1YA4A 2G1PA 3MFKA 1CR2A 3V2UA 3KLNA 1H0RA 4LJ4A 1AMNA 4UUSA 1E4EA 4YROA 4GXOA 1NDUA 3VZCA 1JA1A 2CXRA 5BSWA 4G37A 3GNLA 1IN4A 1ZN2A 5CG2A 3TFQA 1JEYB 4I8DA 3HXQA 4BLRA 4TKVB 2D1HA 4CMBA 4LOCA 1E2JA 3SKVA 3SF8B 4MS1A 1GT0C 2VDRB 4LNHA 5CA0A 3EG9A 4G1MB 3IB3A 3HCFA 2CNLA 4DV1B 4AS2A 3KE9A 2ZFUA 3KPWA 4QHTA 3QE0A 1X3ZB 4G84A 4BO8A 2DMTA 4PZDA 3KNZA 1C8KA 2D8AA 1YVDA 3KVRA 3PD0A 4FBGA 1DAIA 4QGSA 1G42A 3OQMA 3RYIA 1N0VC 4BV3A 3LG2A 4DVJA 3R0AA 4O2AF 4EAKA 4ZK6A 4RB1A 3F1LA 4OXYA 5JJ5A 4Y7NJ 4GF5A 2GK7A 5K3EA 3TQOA 1QN5A 4D5EA 3E3OA 3GPBA 1DT5A 3PNQA 2Q1WA 3GEMA 1FSHA 2X8LA 3IALA 2V55B 3CO5A 3ZY3A 4JOMA 1DUIA 3I73A 2JI8A 4ESEA 4ESFA 4XORA 1U2QA 3R0IA 3TFWA 2WP8J 4MTCA 2NOIA 1RPTA 1N9KA 2C94A 4UOQA 1TA4A 4ZYUA 4GP7A 3E9MA 3NAQA 3LWBA 2XXAB 3QMWA 4C0QC 1RXWA 5JXHA 2PZBA 4ZJUA 3BXXA 3CSSA 4XVQA 1IRIA 1I2CA 2CMDA 1R64A 2ZSBA 4Q1FA 4YAFA 1JNYA 4AF8A 4CQMA 4G1EB 1BR2A 4B6SA 1S5PA 3H87A 1H8ED 4KPFC 1NFRA 3EQ2A 3QE2A 2D1TA 2LWIA 1GZDA 3FJ1A 3FAKA 5JPIA 1KBZA 5BQ3A 4HWSA 3RUHA 2XUKA 4KICA 1W73A 1V7PC 5KVVA 1NGMA 5D85A 2D2VA 5ADHA 2R7LA 3NOOA 3BJEA 3WG7H 5CEJA 1DXHA 4Z86A 1RI3A 1W36C 2O2DA 4AKHA 3DU5A 5DLPA 2F00A 5HF9A 4DKJA 4BECA 2H3HA 4P1ZA 3UKOA 1PJSA 1LI5A 4BPRA 3TI9A 1NVXQ 5GJWC 5A3VA 2WKRA 1L8LA 2E34A 3CISA 5ERGB 5CCEA 2HSWA 3CF5F 1RHJA 1DAMA 1AD2A 1FTYA 2X2PA 2CGEA 4ZN6A 2X8BA 1WXEA 3NJ8A 4ZOLA 2LRDA 4OLHA 2J6BA 2DK5A 1PGOA 3GC6A 3GHHA 5I51A 1IAQA 5FORA 4OP3A 3G79A 4JFRA 3GUUA 3M5PA 4O2BA 1RZRD 5HZMA 4HAOA 3CCYA 1IQRA 3QLUA 1YFKA 4JLMA 4Q03A 4W9NC 5DM60 2G28A 1HR0B 2ZJ0A 5DGIA 1QBGA 3V42A 1ORHA 3M6XA 1V4VA 4EJ0A 1C4GA 3E27A 1KY5A 4RTOA 2PKYX 1A8HA 3MJRA 1VMIA 5A4AA 4NJEA 1PBTA 5FFMA 4WECA 2IYPA 4YJHA 4AM3A 3M2TA 3BD6A 2OZEA 3U5ZB 3C7CB 4A27A 1JQ5A 2X6XA 5IYDP 3DWLE 4FX0A 3UB2A 1H1LB 4PGFA 1TLLA 1PWZA 2G7MC 1UZAA 2AXPA 5K9ZA 5JPCA 2VDNB 3T5PA 3CNEA 2E19A 2A1UA 4IDFA 5JNTA 4TMXA 1W0CA 2HA3A 4GKVA 3L41A 2HL8A 5IYZB 3EASA 3L1KA 3BWBA 4F3YA 2WF9A 4NBRA 1QN4A 5ITZA 5I3CA 3VTFA 1EH5A 1C4KA 2H4JA 4IDGA 3MWGA 2ALJA 1IDZA 3I9NA 3TGLA 1L5QA 5GONB 2Q5FA 4HRXA 4L9JA 5F3DA 2E48A 1XVVA 2R92J 3ORFA 3DMFA 3JCUC 1Q14A 2CYAA 4I50A 3K1MA 3DXFA 3R6LA 4NONA 5CIQA 2NO6A 1QRYA 4X3PA 1QE0A 1ZI6A 3ZZMA 1NQUA 2XITA 3GLHE 4I6EA 5K5RA 2LY1A 1L1RA 3RSGA 4FYJA 4GMGA 1UK8A 1W47A 1J99A 1RWBA 3VSLA 3ER8A 1Z5ZA 4MA4A 4E3ZA 3RIXA 2BGGA 4W97A 3OLPA 4EY7A 4ZDPA 5J8FA 1X7XA 2YYYA 1UJMA 3WRWA 3F2VA 3ROZA 2WABA 3O74A 1A8QA 4MVJA 5C8YB 1Z77A 1ZMTA 2E21A 4JY7A 3HCEA 2WB4A 2HV8A 4OQEA 1ULSA 1EP2B 3GF4A 1B0PA 5I9TA 5BYJA 4HNAB 2ZVJA 4I5DA 1CNFA 4AMZA 2C88A 3QE3A 2F62A 3IVCA 2PRKA 1UAGA 3GAFA 1NHGA 4P86A 4HGOA 5ENZA 3H9BA 4E7JA 2O2ZA 1L3IA 1H9AA 3VUFA 4OXIA 3GIWA 3PNYA 2RC5A 3X44A 2BUCA 3ZWWA 3AVTA 3JVIA 2F5VA 2A59A 4CH7A 4MYTA 3ZU4A 4AYXA 3D0SA 1GUZA 5K01A 3OA2A 3EYWA 1I5EA 3JVUA 2WIJA 1NTCA 1Z06A 5F9CA 2AFIE 5FD5A 2OCYC 3ZDFA 3RSZA 5HVNA 2ZRQA 4B32A 1BWRA 2YHIA 3KJIA 2EBFX 3RV3A 3EGIA 3WYEA 4NICA 3RI4A 3RF6A 1O87A 4KG7A 4ZANA 3V8QA 4QECA 1V41E 2VSFA 3L6EA 5AN4A 1VE5A 2O2HA 3VO2A 1QRAA 2BMJA 2BDTA 5E6UB 3L0IB 1P7JA 2O61A 1RHKA 4Y0AA 5M34A 4K3UA 4WI1A 3M4YA 4TV9B 3IEXA 4YPFA 2C5AA 3SYLA 2IDJA 4CF4A 4A3CJ 1XD2A 3WHIA 1M5UA 2WJ6A 3AOEA 3BR1A 4RXMA 3M82A 4KYUA 4HJHA 2BY2A 3AFGA 4KVFA 3W2GA 1ESZA 5B58C 1NI4B 5TJHA 2VA8A 4I5FA 4UEKA 3GYHX 4AROA 1DAHA 2WVHA 4WK2B 5AQEA 1JJ6C 5IABA 2PLYA 2IHVA 4RAZA 1OV4A 2HVRA 3JQBC 1N6RA 3S2SA 2C0QA 4HMPA 1YQ9A 3CLUC 1XJQA 5A62A 5H1YA 1QTPA 1E1QA 3RHSA 3NWTA 5AKYA 2NU7B 5L40A 1LUAA 2DR2A 3ANLA 1SCDA 3ILXA 3C04A 2OHIA 4IFTA 3PP8A 1CGPA 3CC2I 4UZFA 3FXJA 2IBSA 1QBJA 4DQKA 4XWOA 5JD5A 1W0KA 3OOEA 4X92A 1IF1A 2ZR8A 1YI8A 1U0BB 2AO9A 2D2IA 3L92A 3WYGA 3HP1A 3ZR4B 2H4HA 2X7JA 2A9QA 3KWFA 5CJJA 1IMJA 3NUZA 2PLFA 3REFA 3HOXJ 5JNRA 3M4ZA 4RY9A 3LE8A 2LKDA 5C2JB 4P98A 1H5QA 5EC8A 4XL9A 5CPRB 1PNOA 1EXMA 3TP0A 4O2AB 1C9JA 3M4NA 1GA6A 1N4DA 2ME0A 2JZYA 2KHMA 1HGXA 3ZDDA 1TCCA 4G81A 1FYMA 3UCFA 2NTNA 2WC2A 1YBMA 1KI6A 3TLBA 1WKCA 4HH0A 3V00A 1PFGA 4W5JA 1Z37A 3OZUA 3IKLA 2XGOA 2CZGA 4N18A 3SIRA 3TW6A 1DRVA 2I2CA 4YRBA 1B73A 3ZLUA 1E4VA 2P62A 3NKFA 1N5RA 2CL6X 1Y3HA 3RVRA 4E21A 1YB1A 3E3LA 5BN4A 1G2IA 1PJTA 4MV1A 4RM3A 3I1YA 4DHWA 3DWIA 5K20A 3ZJUA 2INGX 3DAOA 4NC7A 4FR0A 1P4HA 1DC8A 2PKRA 3NDPA 1I4EB 4A0YA 4L9RA 4BVGA 4D8YA 1BDMA 4G25A 4H4DA 1W5SA 2XGMA 2X0LA 1R37A 1URPA 2JGDB 3D6VA 5LSAA 3BB4A 2F9LA 4E7IA 3ODGA 2BI4A 2BR4A 3S2EA 3NKVA 1MIOB 3FDFA 2PAFA 1PR9A 4RTSA 1AGXA 2O7VA 4ZGBA 1EE9A 3LWZA 4PFJA 2EP8A 1RE0A 3EXG2 2V7QA 2NSYA 3PV0A 4JMPA 1UT8A 1L5WA 1VMAA 4E5DA 1X2MA 4ON9A 3I4CA 4RA6A 1PV2A 3W6JB 1T6YA 4XM2A 3MJHA 1QH1B 1Q2XA 1H4VB 4BIMA 3CJTA 5JD3A 2DBRA 4TVSA 2CSXA 3GG2A 2CNDA 3GLRA 2VP0A 4OYLA 3VOAA 4M8NE 2GETA 2H5EA 4QBFA 1ZCZA 4EUFA 3B6MA 3CTAA 1M8KA 2BHTA 5DB4A 5JZ9A 3FLEA 5EZYA 1VYVA 2KISA 2QBYA 2GDZA 1M3QA 2B9EA 2EV0A 4OHFA 2N1MA 1LJ8A 3GTQJ 4GBGA 3CTPA 5TDHA 4E46A 2FHSA 4OCZA 4KXQA 2NN3C 2P5UA 4GFBA 1U4OA 3GLHA 3HCPA 3UJ3X 3PQKA 1LY1A 2HBZA 2XODA 4O4LA 4AK9A 1CF7B 4QA9A 2YHAA 4ON0A 3KUKA 3IDZA 4OJMX 2YN2A 1A5SB 4HNQA 3ZBTA 3STUA 4KQKA 4FE7A 5DWQA 2PGDA 1UP7A 3OFKA 4M9XA 3MF4A 5BWCA 1CRPA 4Y13A 3BG3A 1YJQA 1PEYA 3GLXA 2PGAA 3JQFA 4BMPB 2GZ1A 2PR7A 3T5AA 2HOAA 1Y4DE 3OUUA 3ETGA 3V7CA 3BZWA 1EFPB 4MV4A 3ZBQA 2ZB2A 3JX9A 4YRIA 2OXCA 2OZLB 4HF2A 5B7QA 4JX4A 1OCZH 3WX0A 2QQAA 4U2KA 7REQB 2OV8A 2BEUA 2MSDB 1A82A 2LNBA 4DVGA 5EIXA 5LQRA 4PVDA 1GN8A 3R7FA 3C3YA 3DE0X 4EJFA 2RH8A 2YZMA 1K3TA 3S8MA 3R76A 4IUCS 4QFDA 5AP9A 5FIUA 3HEBA 3BXZA 1PGQA 3JQAA 2AFIA 4XICA 3DQZA 2F6CA 1FRZA 4Q3AA 1QNAA 2PX8A 5DTDA 4QJIA 1MC5A 2ZUEA 5K0GA 1G6NA 5DKFA 3TNDA 1H6DA 2R8YA 2J0VA 4B4UA 1TA0A 4FIDA 3IUSA 3U3XA 1VHJA 3P5BA 3DKPA 5AONA 1X4PA 4BFWA 1SUBA 2C0PA 2IYTA 3OJLA 5HFNA 2FOKA 3H5OA 2ZW9A 2PSSA 2NVBA 4DNQA 3MN1A 1QO7A 1B4DA 1WHTB 1BI3A 2DFFA 3I62A 3MWFA 3GN2A 3ZX4A 1LI7A 2ZJ3A 1WXWA 1HDIA 3IT2A 1LE8B 5B3JA 5BNGA 2LDBA 5EQDA 3FDYA 2DK8A 1V55H 2J31A 2F55A 4MV3A 1V5IA 1UFQA 5AVUA 2OGZA 3HBLA 1PZMA 2ZIXA 5ALSA 1ISIA 1O0SA 1LZLA 3UAOA 3SBXA 5H4GA 1H3NA 3ANTA 3DF7A 1KU3A 4D42A 3CVOA 1JA9A 4FZRA 2R1VA 1Y4UA 1CE8A 2JJ1D 3UAYA 3JQDA 4NG4A 5JBQA 2JGMA 1UIRA 2AOVA 1BGXT 2AE1A 2R00C 2IF0A 5GAGJ 4H1HA 2PSHA 4LOLA 2QTRA 1R36A 1HNZB 1PUXA 1IBCA 4LHZA 5CD1A 2XDWA 5D51S 3SR0A 1WB4A 2J7KA 1USWA 2ACKA 1XTRA 2RHTA 4JXKA 4MQBA 3KRMA 1J5PA 1S9DA 1FXUA 1I1NA 5A03A 3SJCA 2ZREA 4EJTA 1RS0A 4BXXJ 5F9FA 1NOJA 3TSWA 2BZ0A 1P17A 4XIDA 3VU0A 4AP9A 4O63O 1O6ZA 2WZDA 4JP5A 4CL0A 5IEJA 3EXHB 3CR3C 4DBQA 4EENA 5IAGA 4BGUA 3UO8B 2JLRA 2WTBA 4NFYA 1BJAA 2LIPA 1KOFA 1FCJA 2O1WA 3FSJX 3C8ZA 3RC8A 4UAJA 4REQA 2WJPA 1JR2A 1PD1A 2CL0X 3KSAC 1S29A 2PG3A 3AHJA 4UVDA 3PFFA 3BIFA 4KMMA 2WILA 3PHCA 1K35A 4ZZIA 4OIPF 1M6WA 3LFTA 3CF2A 1BW6A 3BKXA 4ND8B 2VK4A 5D6EA 4IEIA 4CHTA 5ALNA 2VRNA 4ZIRA 4KIUA 1M34A 2DA5A 1D09A 1U2GC 5EQJB 3JRHA 4GBMA 2QZ4A 3KPVA 1UC9A 4Q21A 4J0HA 3OZAA 3OSUA 3VZSA 1Z63A 2V65A 4XLNF 3QBJA 1P0QA 2C4WA 2IFTA 4LBYA 2Q3DA 5HGJA 3DAHA 5HDGA 4NH0A 3IR5A 4ALLA 4MVJM 4Q19A 1V37A 4RGRA 3RW9A 4RC9A 1NVKA 4LWZA 1P33A 2F3QA 1X7HA 2C8JA 3V3TA 2GSDA 4WERA 5TARA 4EKNB 2BGNA 4R01A 3BIOA 2IYQA 3TBHA 3OE5A 2QVBA 3ZK9A 2MYSA 3TZ6A 1E4OA 3HGQA 2B0LA 1G4AE 2XB6A 3GZ4A 4C21A 3TCKA 3UHOA 2ZAGA 2FWRA 3AUYA 1MB3A 4QUGA 1VHQA 3WTTC 4LD5A 1II8B 2BVNA 2Z3WA 1YI0A 3IVXA 4R9NA 4KYVA 5M3FJ 1LWWA 1E5DA 1UMCB 4MITA 3TFOA 2UKDA 1X3UA 3Q1LA 4Q1CA 2QRHA 4IDOA 3DL4A 5CAEA 4UTRA 4GR9A 3VPDA 5F7OA 1PG5A 2CXUA 2KT0A 2I4OA 1KIFA 4FW8A 4AY5A 2R5XA 3IP6A 4TS9A 5HDQA 3Q9VA 4BO1A 2DUJA 3PHIA 2YKGA 4FZVA 1T13A 4ZZ2A 2PUVA 5KNCA 3FN4A 1U9ZA 1FIUA 3QP5A 1AT1A 1TC1A 2WDZA 5EEHA 1NJSA 3HZJA 3FGNA 4Q4DA 4QXOA 1J09A 2KE5A 3GHYA 5AVWA 3LRTA 2IHUA 2JGAA 2YV3A 4IMRA 1JT0A 1BWSA 3GW2A 3TTYA 1RWXA 1S8NA 3GOHA 1CFZA 5KKAA 1LNWA 3SYMA 3RTDA 2GZAA 2HDWA 4WNIA 4GM4A 5J9FA 4IHVA 2Y1KA 3D3NA 1IBLB 1BXGB 1ADFA 2EZLA 4PYNA 1DV2A 3BG6A 3E05A 5KVSA 2AOUA 3EVAA 1UPCA 4RGXA 4DBZA 4FYVA 3F8WA 4LHWA 2QLNA 3FRJA 2HA6A 3KIPA 3SE7A 2Z2KA 1MNEA 3IELA 4IVPA 3LYAA 4ZDWA 4LRXA 3W04A 1D2GA 5KSYA 6CHYA 3GVCA 4ALJA 1Q0PA 4RHTA 1YC5A 1Y7IA 1U9CA 1PAUA 1GJRA 9ANTA 3SC3A 4PCQA 1GFWA 5FEMA 3CD6I 3HOUJ 4X54A 5DMXA 2E49A 2JHGA 1IEVA 3DPTA 3N74A 3WK7A 1C3OA 2IODA 3EDRA 3QX9A 3CYFA 3CONA 4S1NA 4XYLA 3RKSA 2HLDA 1B15A 5K0EA 1KI4A 3OCIA 1E17A 3CP2A 2BEVB 5E20A 4Y6LA 2G5TA 4UD2A 2XXBA 1LWNA 2X13A 2PD3A 4D43A 3WMEA 4CIWA 5FJIA 5FFZA 2OA0A 4RTRA 3DTVB 3PZRA 2L9NA 4TRNA 3ASVA 2IYRA 5JHFA 3HMKA 4C1BA 3MCTA 2FN7A 2OEPA 2R8ZA 3G1WA 3BTSA 4KMFA 1B72B 1EFDN 4LKOA 4CI9A 1PCXA 5ALLA 3TGWA 4HCJA 4J1NA 4LY9A 3ISVA 4NCHA 4LJLA 3N2EA 2KQRA 1D0SA 3CMEI 3OUTA 3ZV7A 3GUZA 4LDAA 2P6RA 4M71A 2DFEA 3RRJA 1OQYA 1QIDA 5FHQA 1JHAA 3IUBA 1XP8A 3DAFA 1MB9A 2R7QA 1QNFA 4BEHA 1DAGA 4DQ2A 4I9GA 1CUGA 1LLFA 3ZE0B 3E81A 2EZ9A 2HF7A 1NNSA 2NOJB 1YC2A 5JO9A 4JU9A 4ACBA 2CVZA 2YUTA 1ND5A 3DB1A 3MZHA 3UH1A 2HK9A 3WRXC 1ODSA 1SU8A 1DARA 5HUJA 4FEEA 1PS8A 4E7SA 2ANBA 3C3PA 4N82A 5EXSA 1V9CA 2Z57A 4FMPA 3P0EA 4K26A 4KPGA 2ZVPX 4JT4A 4N3GA 3K8QA 2KDZA 2WYIA 2YU3A 4NCJA 3NOXA 2VZ0A 1ZD1A 3S1QJ 4FOOA 1R0YA 5ALEA 1GPMA 4HDSA 3K1AA 3P9SA 3ERCA 1E69A 2PMKA 1XDWA 2R7DA 2OENG 3LYUA 4EIWA 5KJEA 2IYLD 4FDMA 4ZHSA 1F6DA 3DTKA 4O4HA 2JAXA 4YREA 4A16A 3DEYX 1JHOA 3FX3A 3EGVA 5L3ZA 1M8PA 3TLYA 2AKEA 1MH4A 3ZQ7A 3P32A 1NI3A 1HC8A 1IOLA 1NONA 3KAPA 4CM4B 2PD4A 3FF4A 3LKVA 2CWEA 2FPGB 2VPZA 3ZNOA 1Q1HA 4EEXA 2L9VA 4LJ8A 4JC0A 1E9VA 2LBFB 2ATVA 3OSTA 3OS1A 1C7QA 4YCSA 3GTJJ 4L15A 1PJ3A 3ZWYA 3LBNA 1DIGA 2FX0A 1AKVA 1NPTO 4OG2A 4DCPA 1DZIA 4KTTE 4TM8A 2VE8A 3NARA 3C48A 2XEXA 2E4YA 1RJGA 4LMYA 3K8ZA 3OJEA 4LQ4A 3C43A 3FPGA 5BVHB 1D5CA 3PSAA 3RYHB 3TW4A 5K3CA 4OXKA 5K3AA 2VN2A 2OHOA 1FDOA 2IXTA 3GT7A 5C34B 4IL6C 4HJXA 2ZSIB 3Q3EA 4BMXA 3C45A 4PZJA 4YR7A 2PKEA 4OK3A 3TW8A 2Q3CA 2XSZD 3G7NA 2RI6A 5CEEA 2PVCA 3USZA 2BUAA 5E8IA 2NV2B 5EKSA 1MO4A 2EW2A 5GPCA 4IIJA 2E4AA 1XGOA 1YU9A 1DNPA 3VPHA 3T1VA 1BKDR 4LECA 5FB3A 2ZRNA 5H80A 3KKNA 4YUAA 4LYDA 1QG6A 1W87A 3A9UA 4HFRA 1B1CA 3R3XA 3IKTA 5T3UA 2M3AA