3DQPA

Crystal structure of the oxidoreductase ylbe from lactococcus lactis, northeast structural genomics consortium target kr121.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
219
structure length
219
Chain Sequence
b'MKIFIVGSTGRVGKSLLKSLSTTDYQIYAGARKVEQVPQYNNVKAVHFDVDWTPEEMAKQLHGMDAIINVSGSGGKSLLKVDLYGAVKLMQAAEKAEVKRFILLSTIFSLQPEKWIGAGFDALKDYYIAKHFADLYLTKETNLDYTIIQPGALTEEEATGLIDINDEVSASNTIGDVADTIKELVMTDHSIGKVISMHNGKTAIKEALESLLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase ylbE
publication title Crystal structure of the oxidoreductase ylbE from Lactococcus lactis, Northeast Structural Genomics Consortium Target KR121.
rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Oxidoreductase
total genus 72
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dqpA00
5FF9A 1BRMA 3MJCA 1P1HA 4DRYA 2GERA 1A71A 2EIHA 4F6CA 4IGFA 2GO1A 4AJKA 5TIIA 2W4QA 1E1MA 4RVUA 4CV0A 2Y0EA 3BTOA 3JD3A 3D64A 4L76A 4FR5A 4INAA 4O1MA 3OH8A 5LC1A 3T7EA 3C85A 1E3SA 2ZQZA 2Y0DA 2PZMA 2AE2A 4RO0A 3GDOA 2HJSA 4J1NA 4NFYA 1NPTO 4BNVA 3KEQA 2G76A 3H4VA 3NTQA 1NBOA 2NADA 4OQYA 2VCYA 4CMBA 4IQGA 1K6JA 3STHA 3W8EA 3JQBC 1PIWA 3H65A 5BR7A 2HMUA 4XYLA 5FI3A 3INTA 4FD3A 4FSHA 1M76A 3S2EA 4WEQA 1GAEO 1ZSYA 2ZYGA 3OJFA 2VWQA 4IM7A 4D3SA 4GMGA 2PZJA 5B37A 3JQ8A 3TSCA 1WDKA 1QRRA 4I5DA 2WM3A 4K9DA 3UN1A 2D59A 2O3QA 4BNGA 5I9NA 4Q3EA 5A02A 1U7TA 2J6IA 4FJ0A 1AHIA 4A73A 5T6BA 4KZPA 5IDYA 3IDSA 2BFAA 1E77A 5CDYA 1LDGA 3DZBA 2VOEA 3JQ9A 3WGYA 3TZCA 1UXKA 3QP9A 1PJLA 2EJVA 5BNFA 1H93A 2RH8A 4Q39A 2J5KA 3DHYA 2PKQO 3PDUA 1QMGA 4OL9A 4BNLA 2ZQYA 1GZ3A 5F1PA 3GH3A 1O0SA 1FDWA 2X58A 3PI7A 2ZB7A 1GQ2A 1I2BA 4ND5A 5F5LA 4B3HA 1SBYA 4ZQFA 4L75A 5C7OO 4YJHB 1KVUA 3ZWNA 1DFIA 4NQZA 3OICA 4LVCA 1D1SA 1ZK3A 2PNFA 2X5KO 3AFNA 3FD8A 3W4JA 5JY1A 3KEOA 4NBWA 4BGIA 5A9TA 4KQWA 4WLFA 2DBZA 3JYOA 1MC4A 3IKVA 1HL3A 3A9WA 3K30A 1YS4A 5DCWA 4CM9A 5CG1A 5IZCC 3KYDB 3W6UA 2V6MA 1DC3A 1Z6ZA 2EF1A 3AM4A 4A27A 4RGBA 1NHWA 3I9KA 4J4BA 4OJNA 5BSFA 1IZ0A 4MDHA 3ORFA 3PTZA 3ZWWA 3PGJA 3DAPA 3ZWAA 4EBFA 1I2CA 2YV3A 3RASA 4IS3A 3ON5A 1EEHA 1QORA 2ILTA 4CM3A 5IF3A 4N7RA 1XG5A 1HTBA 2A94A 4CLEA 1W0CA 1WMBA 3MTGA 2PK3A 1I5RA 2D0IA 3PJEA 4KMSA 1PWXA 1HZJA 3R3SA 4CR7A 3RUAA 3DONA 2I3AA 1P74A 3R0IA 1EVYA 3JYQA 3LVFO 3ZHBA 1E7WA 2Q49A 4DMMA 1SZJG 5JYEA 1NP3A 4KUEA 3PXXA 2ZYDA 4CM8A 4BVAA 1XKQA 2VN8A 2JHFA 3AOEC 3LLVA 1Z7BA 2JHGA 3N58A 5DZSA 7MDHA 3NT5A 1CF2O 2J5RA 2VT2A 1R37A 2Q45A 1SMKA 2EV9A 4JBHA 2O2SA 3KTDA 4BNTA 3RC9A 2ZTLA 5EERA 1XGKA 5CAEA 1ONOA 4M1QA 4BMVA 3U62A 2X7HA 2RHRA 3Q0EA 1PGJA 2B4RO 4BNYA 3WJAA 3OEYA 2A9FA 3GT0A 4DBZA 2E82A 3D3WA 1P45A 2DVMA 3EMKA 3PP8A 1I33A 1GQYA 3CINA 3H7AA 2X86A 3QWIA 4ZQGA 1LXCA 1R4MA 3WGIA 2WYWA 2QZZA 4HNHA 1C3VA 1O95A 4IDGA 3LT2A 1IHXA 4RPGA 5F1OA 3AY3A 4MP3A 2IZ1A 4XR4A 2R2GA 3WGOA 4CODB 4PLHA 1ZSVA 2CUKA 4I08A 2Y1EA 3K2BA 2VHYA 1F17A 2DT5A 3KYCA 4N18A 3KO8A 4PGFA 4G65A 5FYDA 2DBRA 5TLSA 4HFRA 4PIVA 3TQHA 2JCYA 5T5QA 4OSOA 2TMDA 3U4HA 4CR8A 2GPTA 3DZJA 3P19A 3QWAA 1HE3A 1NVTA 3JQ9C 1KVQA 4PZDA 1RPNA 2FP4A 3DZHA 1Y7TA 5CP8A 1LA2A 3C1TA 4QO7A 2QRKA 3HNPA 4YT4A 4J1SA 1BMDA 5AXCA 3WX0A 3GVXA 4HBGA 4LRTB 3ZWMA 4Q9NA 1ENPA 4BMSA 4DQXA 3BMCA 4GPD1 4IZIA 3KUXA 4XGNA 3ASUA 4FFNA 3QWHA 4R16A 5G0WA 1UXIA 5I7VA 3VZSA 1C14A 2FHSA 4FGSA 5DBIA 3ZU2A 1ZW1A 4LSMA 2NACA 1EVZA 1DAPA 2GF2A 3WFIA 1BDBA 3M1AA 3AI2A 1ZFNA 5THKA 3QWBA 3QVOA 3VHRA 3BYZA 1IULA 1QP8A 2P91A 4UVDA 3GY0A 5BSHA 4FB5A 1GTMA 5TJ9A 2A92A 4I5EA 1ADGA 4C7JA 2O7QA 3MZ0A 2YUTA 1SB9A 1NX6A 5CPFA 3UCFA 1PJSA 4NBUA 4EW6A 3AOGA 3QJ5A 4XD2A 4CM5A 3G1UA 1MB4A 3MOIA 4ALKA 4WOKA 2C29D 5AXBA 3RVDA 1H5QA 4EEZA 4ZN6A 1X1TA 3IOYA 2I3GA 3EAGA 3K92A 1T2CA 4GMFA 4RDIA 2IZZA 3I9MA 2G17A 4CLDA 3RUIA 3ZWOA 4N54A 5T8KA 3C8MA 3U4CA 3HB5X 3RUCA 5HS6A 3TZHA 2I5PO 3N74A 1LRJA 5A1TA 1UP6A 1P1KA 4Y6RA 4PRKA 2DPHA 3HN7A 5A9SB 1VKOA 4FFOA 3EVNA 4J0FA 4J2OA 3K8ZA 4LMPA 2ZCUA 4EUEA 2ZTMA 4BNMA 3IIEA 2FWMX 1JAXA 1ZEJA 1VJTA 3VTZA 4O63O 2GRAA 3L77A 4NJMA 4WCFA 5JO0A 2PTGA 2DUWA 2G0TA 3FWZA 3IAHA 1P33A 3O8QA 3U4DA 3WBFA 1NHGA 1XSEA 1TLTA 3FPLA 1N5DA 3GDFA 2Y66A 4IJVA 2P68A 3GFBA 2CY0A 2PGLA 3KSDO 3G3EA 4CUZA 1Q0LA 3OSUA 5JLAA 1E3EA 3GRKA 3DMTA 5GZ3A 2NQTA 3WIEA 1B3RA 2EHDA 3PVZA 3TPCA 3R3JA 4YQYA 3Q9NA 2OOSA 1R16A 3KSZO 2Z1NA 1I3MA 4C7KA 4UUMA 4DUPA 4DYVA 4GSKA 1NR1A 5L7TA 4ZJUA 4MVJD 2YHUA 4NFSA 3ITKA 4L73A 4I1IA 1WLYA 2FPGA 4Q3AA 5TGDA 1B3BA 1ULSA 1E3WA 1ZBQA 1E1NA 1E7MA 1QR6A 1YBMA 4GKBA 1VL8A 1W73A 1LX6A 1NWHA 1EVJA 2YY7A 4UEJA 4UAGA 3LLSA 1ZJYA 1Y81A 3JQAD 3BA1A 1XQ1A 1QYVA 5MGBA 1C1XB 1EBUA 4MJLA 4KP7A 2X6TA 4H16A 1MP0A 2OBNA 3G0OA 3QLJA 3E9QA 1XIVA 2D5AA 1E6WA 1QV7A 1BW9A 1Z75A 1P1FA 1IPEA 5G4LA 1PJBA 3FWNA 4BO3A 3MJEA 2FOIA 3QVSA 3WR5A 3U0BA 1R4NA 1R0LA 3GHYA 1PJTA 4CQMA 2RH4A 1UP7A 3TZ6A 2P5UA 4M54A 1VLLA 4XYEA 3HN2A 5JAZA 4OQZA 3TJRA 4WLOA 3JQDA 1A5ZA 1YQXA 1DJNA 2PGDA 5JE8A 1ZH8A 3I9OA 5TRTA 2QYTA 3PGXA 5HTOA 1PS0A 4NBTA 2R6JA 3PIIA 4YB8A 3UXYA 5KKCA 5CDSA 3GC6A 1EQ2A 3V2HA 3KV3O 4CLRB 4FFLA 1JKFA 3BMOB 3ZWBA 3F6YA 4BGEA 1X7GA 4GX1A 3PLRA 4CMAA 1R15A 3MWEB 2I99A 2VZ0A 3QVXA 2YV1A 3WWZA 2EXXA 3JD1A 4EJMA 2AXQA 2Q46A 3WFJA 1WXDA 3K31A 2E37A 4HWKA 4BNKA 4RJTA 3U3XA 1E3JA 1TVEA 4ZRMA 1NAIA 4OO3A 3AU9A 3FF4A 1DBVO 5DULA 5H81A 5EN4A 5L7YA 4YACA 1BVUA 1SEPA 1ZK1A 4A26A 3ZW9A 4E5PA 3FTNA 2HRBA 3R1IA 1V35A 4BOYA 1ISFA 3B70A 5IZ4A 2SCUA 5T8KC 3T4XA 1H9BA 4H3VA 3ST7A 4CPDA 4D3FA 4R1UA 2VZ9A 2ZJ1A 1H94A 2FSVA 3Q9UA 4BNNA 4F3YA 3RFTA 1I24A 2X0IA 4E33A 1NNUA 1GDHA 2POQX 1GV1A 4XQ9A 3QSGA 1KVSA 2OORA 3WYCA 1U8FO 2BGMA 1H2HA 4WCFC 3SLKA 5FEUA 3NX4A 1NFRA 3F9IA 4BV9A 1ZVMA 4JCOA 4Q3BA 5L4LA 3PHLA 4PLFA 1RJWA 1UDCA 2BGLA 2Y1GA 3DMTC 4M55A 1DIAA 5IN4A 3PLNA 1J6UA 3ANNA 3NT4A 1E5QA 2DKNA 3A1NA 4BB6A 2HSDA 3WNVA 4B8ZA 4NMHA 1LSSA 1C1DB 5ITWA 2Y99A 3H9EO 3X2EA 3I9NA 1CQIA 2O23A 5TT0A 1SO8A 3O38A 3ZU3A 5KIAA 2BLLA 1BGVA 4L4RA 5A06A 4I5FA 3CZRA 1KVRA 1C0IA 3FBTA 4W9NA 5JDCA 1DJQA 1T24A 1NASA 1LSOA 1LQTA 1I30A 1DAOA 3WXBA 1Z82A 2HK7A 3F47A 3ROQA 4XA8A 1ZJZA 2DC1A 1VSVA 2IDZA 1X1EA 3RC2A 3IL2A 2JFHA 3S8MA 4DLAA 3PFFA 5EINA 1Y1PA 1WZEA 3VVBA 4WLVA 4E5MA 1GV0A 3F5QA 1H2BA 5JPIA 1EFKA 1VJ0A 3IUPA 3ROMA 3JQ6A 2F00A 4RF2A 4FJ1A 1LJ8A 1MUUA 4JBIA 5DF1A 2CZCA 4LGVA 4ZRNA 1XA0A 3GEGA 2YDXA 4FFRA 3WTCA 4R54A 4ND4A 1H6DA 4TROA 3AI1A 3PQFA 4BNIA 3RSHA 1VI2A 1PL7A 3C24A 1I3NA 4N5NA 5DP2A 1QXSA 1HEUA 3K96A 4CMEA 2BKAA 4EUFA 4YVFA 4J49A 3AM5A 2FR1A 1P9LA 2DUUA 4LISA 4GVXA 2B4TO 2NNLD 2AG8A 1JQBA 3IMFA 3CMCO 1KEUA 1X13A 4UUPA 2W90A 5JCXA 1A72A 2IYPA 4AG3A 1MXFA 1YE3A 2DQ4A 4XIJA 4CMKA 3HJAA 1CETA 4Y98A 1OZAA 3GN1A 4PLVA 2Y05A 4WLNA 2W2LA 4Y6SA 3EZLA 1K2WA 1ZSNA 2Q1WA 4CLHA 5A5EA 3PHIA 1ZK2A 5IN5A 1SOWA 3ZNQA 1HYHA 4NNJA 3PHGA 3HDYA 1VC2A 4AJEA 3NTRA 2GYYA 3ZNPA 2HUNA 2EEZA 3DB2A 4G81A 2DTEA 3EDMA 4OOFA 3NAQA 4IQ8A 2CNBA 1XU9A 1R0SA 3D1LA 4I9UA 4MIYA 2GUGA 3W1VA 3ZW8A 4EGFA 4PG4A 2X22A 4CMCA 4E3ZA 1PGOA 5JMPA 4W99A 4J9VA 2UUPA 1DRUA 3KBOA 4GGPA 3D4NA 3VAZA 5CFZA 1K6XA 1UXGA 5KJCA 1N9GB 2VWPA 4IIVA 3H8VA 5ER9A 3WSVA 4HY3A 4MVJF 3ZDFA 5DBGA 3ZH2A 2DFVA 4AJOA 1ZO8A 1U8XX 3MCVA 4BO9A 5L9AA 3V1TC 1DFGA 3RUDA 5CEFA 2C54A 5A4DA 1DSSG 1GUYA 3HDHA 3P2YA 4QSMA 5CHEA 1TT5A 3ENNA 2UV8A 2EERA 3LF2A 2UVDA 4ALNA 2VZ8A 3PZRA 5CDTA 1WP4A 1IPFA 4RVSA 5IAAA 3EGOA 2NTNA 3QW2A 2DTXA 1JDJA 1K5HA 3JQAB 3GR6A 1Z73A 2B36A 1PZGA 2VQ3A 2VYNA 3PQDA 4JLWA 4U0JA 2AE1A 3PYLA 4QFCA 4GGOA 1Z74A 3IP1A 2P4HX 1Y5RA 3EUWA 4PLYA 3I1JA 2D4AA 1RM4A 3OFSA 5JNLA 1N7HA 1O89A 3V8BA 1LDEA 2IXAA 1W4ZA 4MKRA 2WJPA 4GX5A 4MVJE 4AJ4A 1WWKA 1I0ZA 4E2XA 3AUSA 4KWIA 4GKVA 3WOHA 4DPMA 3OHSX 4IINA 4EEXA 7ADHA 4W9NC 1F14A 3UICA 1PS9A 4TRNA 4MIEA 2GDZA 2HMTA 1B8PA 1JVBA 4RV9A 4DQUA 1H0KA 1LDNA 4GI2A 4NHEA 5EPOA 1D8AA 4Z9XA 3B20A 2RIRA 4FFMA 4R51A 4YDRA 1DLIA 3L4BC 1MLDA 3JTMA 1B14A 5LDGA 3OQBA 3EK2A 3ROKA 5ILGA 2WWRA 4KTVE 4YYZA 4ALJA 5A03A 3PHJA 1B8UA 4FQ8A 1F12A 4GL4A 2WSBA 1CJCA 2VUUA 2O7SA 4TRMA 3RI3A 3PPIA 4YJGB 5DCUA 3HE3A 4PZEA 3PK0A 1YB1A 3AW9A 1UP4A 2DBVO 3FBGA 2QYSA 4FC6A 3WS7A 4CMEC 3DBHA 2B0JA 4J6FA 3E82A 4JJFA 5B12A 3IP3A 3PQEA 5F21A 1LLQA 2NSDA 4CR6A 4CM1A 4J4HA 3PJDA 3G49A 1E3LA 2AMFA 4JXKA 2DAPA 5AYVA 3WBBA 3ZNOA 4XR9A 2XXBA 4XGKA 4J1TA 1L7DA 1LDBA 2C2XA 1XWFA 3E48A 1CERA 3ZWPA 2O3JA 3DBLB 4R69A 1PQUA 1SNYA 2AEFA 1EVIA 4DTIA 3UH1A 5LDHA 4QUKA 1FXSA 4M86A 4TSKA 3UF0A 5L95A 2BELA 4PN3A 2HO5A 3P7MA 3INGA 2PWZA 4FDAA 2R00A 1ISJA 1V9LA 3G17A 4ILKA 1P77A 1QYWA 3TOXA 2PH3A 1N1GA 5JSFA 4LSWA 1JVSA 1KEVA 3F4BA 4FN4A 1MXHA 4IZHA 1RM5A 3KLPX 2P4QA 4R9SA 1HZZA 1IL0A 4W7HA 4J9UE 3H6KA 4D0RA 5COQA 2GASA 2AHRA 3ENKA 3L4SO 3LC2O 2D3TA 3MJTA 1ZXBA 4PVDA 3QE3A 4OM8A 3D0OA 3IUSA 3NUGA 2AW5A 4FIZA 4D3DA 4YR9A 5ILOA 5I7FA 3SLGA 3I6QA 4C4OA 4DA9A 4IBOA 1NYTA 1LDYA 4CQMD 3TWOA 4XWYA 1W8DA 4I9HA 3D7LA 1HDZA 5B4VA 3H9QA 1HDOA 1UAYA 3HUDA 3GPDG 3VTFA 3S2GA 3E5MA 3L6EA 1PJQA 2A4KA 2EJWA 1X7DA 2G5CA 3AWDA 3IS3A 3DDNA 5JYDA 2P5YA 1P1RA 4IUYA 1B2LA 3NKLA 1N1EA 2JCXA 4TVBA 4Q3DA 3SJUA 1NQAO 4CL8A 1O5IA 4OOEA 2W2KB 1XHLA 1SOVA 4CMIB 2IEDA 1F8GA 4B79A 4BQRA 3UVEA 3F46A 2O3SA 4TVOA 3NGXA 4YJHA 4PLGA 3GUCA 1LLCA 3Q2IA 2AEJA 3OEWA 4CMJA 3DHEA 3RBZA 3D4OA 4OKNA 4DPKA 4R1NA 1B0AA 3PJGA 4EJ6A 3W6ZA 4RZHA 3KYDA 3SC6A 4YAKA 4LW8A 3AFMA 2Q1SA 3NYWA 5DOVA 1QG6A 3UKOA 1A4UA 5L51A 2JFFA 2YJZA 5AQ1A 3JQ7B 1ZK4A 4D7AA 5JC1A 1R6DA 2VRCD 2X5JO 4QTZA 4Y8VA 2LDBA 4B4VA 1WZIA 1AUPA 4A0SA 3RKUA 3KM0A 3C7AA 5ER6A 4HFJA 4AICA 2X23A 2EP7A 1O8CA 3GAFA 4JBGA 1LC3A 4R5HA 1EUZA 1I36A 4NBVA 4MVJG 2H6EA 4NZ9A 4HV4A 3VDQA 4HNGA 4D45A 5ICSA 4D41A 4R4JA 2PY6A 3PRJA 3QV1A 1GYQA 1TI7A 3OIFA 4E13A 2O3RA 3L9XA 3OP4A 4BHTA 3TF5A 2OUIA 3GG2A 4ALIA 4RPLA 1DO8A 2Z1MA 3GMDA 1FDUA 2C7VA 4ND3A 2X9NA 4DLLA 1GL3A 3DQPA 1HF3A 3WDSA 1JWAB 3WGTA 2J8ZA 1UZMA 3WJ7A 2YQ5A 1HDXA 3E9MA 3DXFA 3PYMA 1NQTA 2EW2A 2C59A 2HMSA 2QIOA 3CE6A 1ADFA 3PWKA 1P31A 4PCVA 5K9ZA 1NXQA 2JAHA 2Q2WA 4MKZA 2FR0A 3HHPA 1FDVA 4HX5A 5HS4A 1HDGO 3K6JA 1U9JA 3KOUA 1X15A 1R66A 1YGYA 5L53A 4KQXA 2ZJ0A 4XQEA 1OAAA 1YVEI 2VYVA 4NG5A 4BV8A 1YL6A 3HQ4O 4W4TA 1W6UA 4CLOA 4XDZA 3B1FA 4BNHA 1Y6JA 2J5QA 2R00C 1YBVA 4I8XA 1QLJA 5TQVA 1T2AA 4ALMA 5JMWA 3RFXA 2QRLA 2HRZA 4J90A 4K1LA 2DM6A 1E7QA 1U5CA 5TT1A 3OJLA 3WLEA 4BO7A 3CPSA 3FRJA 4MKXA 2ZTVA 2UUOA 3HDQA 1M75A 4BKOA 3NT2A 4YRAA 4ZQEA 5EQDA 4YEDA 2B4QA 4BKRA 2GZ2A 1YBAA 3ADPA 4ONEA 1GUFA 4CV2A 1MA0A 3I6IA 4RF5A 4JNKA 1LC0A 1YOVB 1M66A 4A03A 3LQFA 5H82A 1X7HA 2VRBA 3JD4A 2FR8A 1ENOA 1KETA 4WASA 4E31A 3AUUA 4YT2A 3DFZA 3DEYX 1U4OA 3LK7A 4FCCA 1E1KA 3BMNB 4D46A 4DREA 1PTJA 2EG9A 3GNQA 3KLMX 4RLSA 3RCBA 4ZGWA 1VJ1A 4KUGA 3UW3A 3K5PA 5KVVA 4YJFB 4TQGA 3DAFA 3AJRA 4XZ3A 3U09A 3TN7A 1R12A 1AGNA 3NRCA 1NQOA 4BO4A 3NGLA 4P4NA 3SVTA 4W7IA 5G4KB 2W2LD 1ADCA 4QECA 1FDTA 1DEHA 2V65A 5JFOA 1QV6A 3H9UA 3JQGB 4NH4A 3H2ZA 3RAJA 1LLUA 1P0CA 4CV1A 3QA9A 1GCOA 3X2FA 3I4FA 2I67A 1C0KA 3C1OA 3GNSA 1HDRA 1UZNA 1YQDA 2IEBA 1HKUA 4AJLA 4B3JA 5I9LA 3C7DB 3OA0A 4RVGA 4RPJA 2FN7A 5F5NA 1YH3A 4YPOA 4IDDA 1YL5A 4M49A 2NUAA 4BS9A 3I9JA 1K0UA 3GMSA 1IZ9A 2HJRA 4H15A 2Y68A 1G6KA 2WDZA 5KJFA 3CUKA 4B7XA 2GZ1A 1HXHA 2AQ8A 4BO5A 1NPDA 3JYPA 3BMQB 1J5PA 3JD0A 4NI5A 4E4YA 3DZGA 1NM5A 1VPDA 3WGZA 1I32A 2GSDA 2O4UX 4NIMA 3SXPA 4EUHA 5K0ZA 5JBIA 1E3WB 2PLAA 1LU9A 2P9GA 4BKQA 4BMNA 1B16A 1K89A 4DQVA 5EJ2A 4Z3KA 3HADA 5H83A 5I9MA 4B8WA 1GEGA 1YO6A 3M2PA 1KOLA 4IGEA 5C7IO 4IJUA 4RLHA 1JKIA 3K2EA 4FFPA 2HMWA 3KETA 1EMDA 4ZQBA 1U2DA 3NDJA 3TDKA 5HM8A 1S6YA 2Q4EA 5ES3A 3E18A 1KBZA 1J49A 5CDUA 4II3A 5B4UA 1BWSA 2O48X 5A9SA 4OYRA 4YTEA 3CH6A 1EBFA 5EL0A 3P5SA 1LDMA 1TA4A 2VHVA 3GG9A 1DFHA 3AI3A 4GLLA 2AG5A 2V6GA 1V3TA 3VKUA 3WB9A 1OMOA 1DRVA 1S7CA 2DPGA 3TL3A 3I23A 1Z45A 4M89A 5IXYA 4BO2A 3RBXA 3ETEA 5ICMA 3QVTA 2PD3A 2UDPA 5BSGA 3C1AA 1P1IA 1KYQA 1KY4A 2PD6A 3CXRA 1T2DA 4L8VA 4HKTA 3ZHXA 1N7GA 4M87A 1F0YA 2B83A 2NV6A 2JCVA 2Y1CA 4L4XA 4YAIA 3W8FA 1IE3A 3MOGA 1E3IA 4OSPA 4RL6A 4CQLB 1HETA 4R3NA 3B1KA 3FTPA 1RM0A 3OA2A 5HWSA 5AVOA 4XB1A 2PV7A 2RBEA 3VPGA 3E6AA 4YXFA 3ZZNA 4X54A 1NQ5A 1TT7A 3UOGA 1LLDA 2BGKA 2FPIA 2FZEA 3I9LA 4EITA 1C1XA 2HU2A 3WYEA 1G1AA 2A35A 1XU7A 2CDBA 1UUFA 2Y67A 3NTOA 3PIDA 1E7YA 5BNTA 1A4IA 1V0JA 2J3IA 4R68A 5I7SA 3KXDA 1MV8A 4ZD6A 5A9RA 2BI8A 2CFCA 1GR0A 4B3IA 4ZICA 1GYRA 3LU1A 1H6AA 5I7EA 1PWZA 3DWFA 4N5LA 1PZHA 4WKGA 3JQCA 1JAYA 4U7WA 4NK5A 1QLHA 1YRLA 3VZQA 5IXSA 2ZK7A 4OXYA 4R9RA 3GGPA 3TL2A 2WE8A 1FK8A 2DBQA 2QW8A 1KEWA 1F8FA 4LCJA 4Z3DA 4XDYA 4RQTA 4BO8A 1E92A 1X0XA 3ULKA 2EWMA 4DXHA 3W4KA 3ZWCA 4CM4B 5JW6A 1VSUA 1J0XO 3WIDA 2WYVA 1EK5A 3ETGA 3ONFA 3PDJA 3VC7A 5JC8A 3EC7A 1HYEA 4P4LA 4CLRA 1HDYA 2H63A 1BDMA 3DC2A 4J43A 3ZNNA 4B4WA 4R1SA 1HSZA 4J4TA 4CM9D 1OFGA 3S2IA 3UAGA 2PKRA 3RJ9A 4GVLA 1MX3A 3CEAA 4MINA 4PG7A 1IOLA 4BNJA 6ADHA 4E5NA 2ZIZA 2IRWA 4NR0A 2EKPA 4LMRA 4DC1A 5EESA 3WSWA 1AHHA 4R01A 4XYMA 1SCUA 2NTJA 2WD7B 5T57A 4E6PA 4AJJA 5CG2A 1DRWA 1MG0A 4U0KA 3HDJA 1A7AA 1I3LA 1PSDA 1DB3A 3FCOA 2C5EA 2X9GA 3D4PA 3F4LA 2Y1FA 3FI9A 1BXGB 3L9WA 1UDAA 3ADOA 1Y5MA 3AY6A 3V2GA 2E48A 3SJ7A 1ZEMA 5EMHA 1YJQA 1XDWA 4EYEA 1XQ6A 2E4AA 3H5NA 3WTBA 2X1HA 3ZHYA 3UCEA 4TWRA 2XAAA 4IDEA 4S3MA 3U4IA 3GZNB 4GH5A 4OHUA 1SB8A 2GR9A 1MFPA 2JKVA 3VKVA 3C3XA 1KY5A 4YRDA 3H9GA 2YDYA 3L4BA 4BO0A 4JIGA 1U28A 3ZU4A 3OBBA 2QG4A 2Z95A 1U7HA 2EGGA 4R41A 5KOIA 2CVQA 2F1KA 2V7PA 4HXYA 3AUTA 4K6FA 4E5YA 1ADBA 4IPTA 4WEOA 3QWFA 2OZPA 2YFHA 3CZMA 2JD1A 1KIFA 4GQAA 1C1DA 1DLJA 3JSAA 4FBGA 2DTDA 4A7PA 4GWGA 1GFSA 4XGIA 1GU7A 1A9ZA 1I3KA 1Q7GA 2BI7A 5C7LO 1ISMA 2Y1OA 2HKIA 3TFOA 5A05A 1LTHR 3JD2A 4RVHA 3T4EA 6LDHA 1CIVA 5FFFA 2G1UA 5G0TA 2RAFA 5CEJA 1BSVA 4XB2A 4F46A 5IDXA 1G0NA 1DC5A 1DOHA 4XEHA 2NVWA 2VHWA 3GLQA 4UVIA 5IG2A 2BRUA 1CQJA 4RVFA 4GAEA 9LDBA 2GGSA 1CWUA 3KB6A 4JP3A 4QO8A 4L74A 5TC4A 2VYVD 3FN4A 3RC1A 1LSJA 1VL6A 3RU9A 4HFMA 1Y8QA 4Y6PA 4A2CA 4ZVVA 4IDBA 1NTOA 2CMDA 3EW7A 1ZZEA 3L6DA 5KJ6A 1H9AA 2H5LA 5IDWA 4NU5A 5JCJA 2NVUB 3WGHA 2NTVA 5FWNA 4DLBA 1E0DA 3O9ZA 1SEVA 1F06A 1EDOA 5GY7A 3FHLA 4PG8A 2HDHA 2H9IA 3GEMA 3DBRB 3S2FA 3WLFA 2C2YA 1JLLA 3QY9A 5AXAA 3DO5A 2OFPA 3BHJA 4DWVA 3WWYA 4DIBA 2AA3A 4EJ0A 4IXTA 2X4GA 3L07A 2YFQA 1B7GO 1UR5A 2PGJA 1PGPA 1UDBA 3E8XA 4ZHSA 4S1VA 1V3VA 1ZMOA 4IS2A 2YHIB 2VUTA 3V1UA 1LI4A 3GVHA 4U8GA 2IODA 4YAJA 2OXIA 1ENYA 9LDTA 1FJHA 3L6OO 3QQPA 4JP2A 3JQEA 3MTJA 3BZUA 1Y9EA 3ZGYA 2QZ9A 4D0SA 3GK3A 1E7RA 4WECA 4XYGA 1E1LA 2GN9A 3ZU5A 4F6LA 4D44A 2NU9A 3MJ4A 4WLEA 2JAPA 1LSUA 1N8KA 1N9GA 1WAMA 2I9PA 4CUJA 2FMUA 2C82A 3RKRA 3S1LA 3T7CA 2PZKA 2AQKA 2YV2A 1O94A 5KTKA 2HMVA 2ZB8A 2Q2VA 3MJSA 3O4RA 5K6AA 1UH5A 1XEAA 4Z9FA 3RIHA 4YWJA 2EP5A 3GUYA 1PX0A 1VM6A 5AXDA 1BTOA 3AK4A 3MEQA 5GMOA 1HDCA 1PZFA 1QKIA 1O6ZA 4CV3A 3BTSA 1DXYA 1RYDA 4E32A 3FNFA 3Q2KA 1Y8RA 3OQ6A 2P9EA 1Q7BA 3CKYA 3FPCA 3JQ8B 4KDEA 1WW8A 4WGGA 5L4NA 2WTBA 4FW8A 4MO2A 1VE9A 1WVGA 4NJOA 5THQA 3DAGA 3E5RA 4Q3CA 1U3VA 3CIFA 1T2FA 3ZN2A 3OECA 1PS8A 1DC4A 3KHUA 3FNHA 3A14A 3KZVA 1NFQA 2O50A 1T1RA 1KVTA 2Q1UA 4Y67A 2VTDA 3HG7A 3HFGA 3ZV5A 2Q1TA 1NVMB 3NJ8A 4XQCA 5GZ1A 2HQ1A 4WLUA 2LDXA 1G0OA 3JCZA 4AVYA 1SPXA 3FR7A 2I66A 4ESOA 1ORRA 3O26A 5G0SA 2CDCA 4PZCA 2I65A 1PU2A 3UFXA 1PGNA 3U49A 4YQZA 3SEFA 4ITUA 2G82A 4LCEA 4Z6KA 2CF6A 4JROA 5ENDA 3F3SA 1KEPA 1FDSA 3OF2A 4BQPA 3WGQA 2PZLA 4RPKA 2CD9A 4E2ZA 4IXWA 4EI2A 4YJGA 1Q2XA 1FMCA 3I83A 2OGUA 4J7XA 5CDGA 2Y1DA 1CEQA 3H9JA 2X0RA 4O5OA 4GX2A 1RWBA 4NFHA 4J7CA 1NR7A 2IXBA 4CMHA 1ML3A 4BKPA 4IIUA 2CVOA 3VZPA 3RU7A 3ANLA 3QVWA 2VNAA 4U5QA 4J1QA 3ASVA 2GN4A 1BG6A 3RQSA 3LF1A 3RBVA 4WE3A 1IYZA 4UUNA 3GAZA 3DBLA 4RORA 2WYUA 4RCVA 3DOJA 3JV7A 5DOZA 1N92A 4JJGA 1LQUA 4Z0HO 1TEHA 1ONNA 3WQSB 4OGWA 3E03A 4UVEA 3FNGA 3GVIA 3H5AA 1J4AA 4CM8B 2W98A 1ZNQO 2CDAA 4GWKA 3OJEA 3V5NA 3ZWVA 1E7SA 1H6BA 4YT8A 4J16A 1PJ2A 1FF9A 4HP8A 4DC0A 1HE5A 1PGQA 4RF3A 3PWSA 4BO6A 4BNUA 3DTTA 2FPPA 5JAMA 1DIGA 4E12A 5L45A 5L7WA 1GYPA 4J0EA 1T4BA 5EIOA 1GPDG 4PLPA 4XCVA 4IJWA 1WMAA 4AJPA 1Z7EA 1E6EA 2HLPA 4IQ0A 1WDLA 4H7PA 4OAQA 3VH2A 3QIVA 3GDGA 4CMGA 5IDQA 4II2A 3D3WB 1YKFA 1KS9A 3HSKA 4BB5A 1LUAA 3RJ5A 4DPLA 2GD1O 2ZATA 4CUKA 5K6AC 2O2YA 1PR9A 2AEMA 2Q99A 2VUSA 1I10A 1R4MB 1IHYA 4WJZA 1MC5A 4IDCA 4XRRA 1PQWA 2C20A 3NJ4A 2IE0A 3TNLA 5B1YA 4PG5A 4XYBA 3LT0A 4OXNA 4DIOA 2NLOA 4PVCA 4B4OA 5IJZA 3MWDB 4TZKA 3G79A 5C5IA 4L4SA 4ZQHA 3OJOA 4HADA 1XYGA 2W2KA 5JAIA 2OP0A 3KYCB 4L9RA 4DL9A 3BTUA 4CMIA 4JQCA 4AJNA 3F5SA 1P44A 1TB4A 2XF8A 4FOOA 4KDFA 1HE4A 2X0NA 3CSDA 1EE9A 2WEKA 1HE2A 4P8RA 4NDNE 2NU6A 4IY1A 5DN9A 2GCGA 4CM7A 1BXZA 1PEDA 3BHMA 2PFGA 4WK6A 4B7UA 5F1KA 1AN9A 4CLOB 4R1TA 2Q3EA 3AM3A 3VPXA 5BNIA 3KSUA 3A28A 5U1PA 3JYNA 5KCZA 2C5AA 2OO5A 1GUZA 2B35A 3JQ7A 2BHLA 3BMCB 4GBJA 3Q1LA 3TZQA 8ADHA 4YT5A 5ITVA 1JTVA 4RVDA 1UAGA 1GCUA 3OQ1A 4RZIA 3SC4A 5KJ1A 3L0DA 3VDRA 3VH1A 1P1JA 2Z5LA 5L3ZA 1IY8A 1ISHA 4A5OA 2OL4A 3DZKA 3GEDA 3PYXA 4IMPA 5EQFA 4J2HA 1EQUA 3WGGA 3WMXA 5F3RA 4B4UA 5B4TA 1MFZA 2P2SA 2XXJA 3I5MA 3ABIA 4M8SA 1XCBA 3GGOA 3OETA 4O0LA 2BFPA 5KJEA 2OHXA 4XX0A 5ADHA 2XOXA 1DC6A 1R0KA 5ENVA 4KUHA 3FSRA 2H1SA 5GZ6A 1WDMA 2EKLA 3EVTA 2B69A 1IUKA 3INRA 2C0CA 2W8ZA 3WYBA 4N5MA 4XJSA 4JK3A 4WPGA 3SBOA 1YB4A 5MDHA 1XLTA 1D3AA 4RF4A 3QHAA 5LCXA 2I6TA 5A3VA 4BNFA 3ETDA 5COAA 5I8WA 5U9CA 1ENZA 4JN6B 3F1KA 4ALLA 2VHZA 1YXMA 2WE7A 3LC7O 2VT3A 3IQDB 3ONEA 4FS3A 4D42A 1YB5A 2HCTA 2VWHA 1EUDA 4E0BA 4R5MA 4EDFA 2X9VA 1DHRA 1M6WA 4E2YA 5A3JA 1D7OA 1EFLA 4IMRA 3DBVO 4WNIA 1JW9B 4TMFA 1YWGO 1Q0HA 1V6AA 4LRSB 2Q4BA 4MIOA 1BXKA 1ZK0A 3RUHA 4XRGA 1U1IA 3DOOA 4NJMB 3BHIA 2NM0A 3GPIA 1YOVA 4WCFB 1OC4A 3O8QB 3I52A 4QT0A 1DDOA 4KTTE 4UEOA 1BHSA 1U2GA 4ND2A 4PLZA 1T26A 1P3DA 1OBFO 3BIOA 3M6IA 1YDWA 3OIDA 3RD5A 4BO1A 1ZUD1 4OXKA 2Y93A 2VTEA 3GF4A 4QQRA 1EZ4A 1YDEA 5JCJD 1JU9A 1T1SA 4XKJA 2AQIA 3BMNA 1WPQA 1UXHA 2BMAA 4E2WA 3PFWO 1A9YA 3B1JA 1GD1O 3KVOA 1M67A 3P2OA 3RROA 4E30A 4DMLA 4OKIA 2EKQA 4YJFA 2B37A 4PLWA 4BIIA 5JS6A 3DOCA 4L0QA 5KVCA 1QSGA 2GN6A 1JA9A 2GLXA 2GN8A 3JYLA 1AXEA 3COSA 2FZWA 5G4KA 5L4SA 3WQRA 2ZB4A 1B26A 1PQPA 3KYBA 5KVSA 1ONPA 3JQGA 8LDHA 1GQQA 1LRKA 3ZHZA 1KC1A 1TXGA 3G1TA 3VPSA 4YA6A 3W4IA 4O6VA 2VYND 1U3UA 4ND1A 1GEEA 5DCYA 3D3EA 4GX0A 4UUOA 4YCAA 3AY7A 1HLPA 2D2IA 4TRJA 1SC6A 1BW9B 3GVPA 4U6QA 1U5AA 5TS3A 1ZXLA 4TRRA 3ROPA 3UGKA 2V6BA 5JXWA 1PL6A 3GQVA 4MVJI 3SX2A 2QRJA 3HZZA 1ISIA 1R4NB 1U3TA 4CQMB 3BMQA 2QX7A 3UCXA 3CMMA 4XJTA 3V1YA 1DIRA 1HYGA 1QYDA 4LVUA 4BGVA 5TF4A 1ZIDA 5CEEA 4KOAA 4K28A 4RDHA 4Z0PA 4URFA 1I01A 3JQFA 1NWCA 4F45A 4AFNA 4DIFA 3O03A 4OMUA 4P22A 4DYDA 5BQFA 5A5FA 3TRIA 4NK4A 1CDOA 4O59O 3H5RA 2JFGA 4CJXA 5BT9A 2IZ0A 4UVGA 2RHCA 4B7CA 5C37A 2AQHA 1GADO 4UVHA 4Z9YA 4QFDA 2JL1A 3I4CA 3K73O 3ICCA 4DGSA 2B5VA 4BL5A 4YRBA 3QRWA 4TKLA 3PHHA 4MOWA 1YJ8A 2B5WA 4MVJM 4CL3A 3IJPA 5DP1A 1GY8A 1MGOA 1HWYA 4Y9DA 3MJVA 1LRLA 1HSOA 1DIBA 3ANMA 2CF5A 3GVCA 4K6CA 3VPHA 3EY4A 1V3UA 4RQUA 3VH4A 3ZCXA 3GOHA 2CVZA 3H2SA 1WNTA 2JD0A 3H3JA 4AJ1A 4AJIA 5JO9A 1JN0A 1XR3A 2PR2A 3AU8A 3OM9A 4XIYA 5G2OA 3UUWA 4NBRA 4MVJP 3EHEA 2D1YA 3GN2A 4QXMA 2PKQP 2D8AA 4AJ2A 3RWBA 4FGWA 2WD8A 3ZV3A 2UAGA 2E49A 3EZYA 1T2EA 1N2SA 2E6UX 2PA3A 4XQGA 3PWZA 5AOVA 3RC7A 4NPCA 4W82A 5U4QA 1L1FA 1UXJA 1Q7CA 1JWBB 3DR3A 1SAYA 4CQLA 4BNXA 3VOSA 4E5KA 1B8VA 1YL7A 4TZTA 1A7KA 1C0PA 1NFFA 5DNAA 1M6HA 2JD2A 1ZMTA 3K9QO 4WCDA 3GA0A 2DLDA 1OOEA 3DHNA 1MG5A 1VRWA 4HFNA 2BFOA 4GSLA 1D4FA 3BMOA 2V6FA 3ZV4A 1ISGA 3DMYA 1I2ZA 1CRWG 2VRCA 1GZ6A 4G2NA 2Y0CA 3IC5A 3ONDA 5JAQA 3GNTA 3GGGA 1IB6A 5TNXA 3RFVA 1LEHA 1AE1A 3Q3CA 3D5QA 1RM3A 3FR8A 4FC7A 4G5HA 3S55A 1E6UA 3HWRA 1T25A 3WICA 5C3MA 3ZI0A 4R3WA 3E1KA 2X0JA 4IDAA 2NU7A 1LNQA 4ID9A 1E5LA 3WMWA 3M1LA 3VVCA 5BSEA 4OIMA 5HA5A 3ZV6A 2GZ3A 2J3KA 5KKAA 1L7EA 1U4SA 5KWEA 2EGHA 1EK6A 1B15A 1Q0QA 1EE2A 4ZA2A 4D79A 4CM4A 3ITDA 2O4CA 4TKMA 1KC3A 1NPYA 3V2UA 4FPXA 1ULUA 3DFUA 1PJ3A 3PEFA 1PJCA 5G0VA 3A4VA 1EUCA 4PLTA 4YAEA 3TFQA 2EW8A 2YQ4A 2YW9A 3KRTA 2X5OA 1DPGA 2IYOA 2ZTUA 3WNQA 2BF7A 4KWHA 3C7CB 1VKNA 3OMLA 4NU6A 4Q3NA 3ICPA 4JJIA 5JDIA 2J3JA 2D5CA 1A27A 1M2WA 4PFJA 2I76A 4WUVA 5KVQA 3JQFC 1AXGA 1ZKMA 3A06A 4FOSA 5HRUA 2OP1A 2NVBA 3R6DA 4OH1A 3WQQA 2BD0A 2C07A 3HFSA 4PRLA 4ZU3A 3RUFA 2ZCVA 4YJDA 2WD7A 2YZ7A 4JGBA 2VWGA 4W6ZA 4UREA 4K26A 2QQ5A 3UHAA 1ZCJA 4J7UA 1GPJA 1BVRA 3LT4A 5COBA 5J23A 1OI7A 3NDIA 3BAZA 3BTVA 5CPBA 5TSDA 1BXGA 3D5TA 3TZKA 3GRPA 4CM6A 3W8DA 4I9NA 3DTYA 2O3UA 3TOZA 2OMEA 1PZEA 3GFGA 4YAGA 1YONA 2VOJA 2BFMA 3U5TA 2RCYA 4AL4A 4BKUA 1U3WA 2J3HA 1RKXA 5DDIP 2X8LA 1D1TA 1X14A 1OC2A 3B6ZA 3EYWA 5TJHA 5G0UA 1UJMA 3IJRA 3JQBA 3F1LA 3GZNA 1KERA 1JKJA 1CYDA 1Y8QB 2BH9A 2YYYA 3BXXA 3LDHA 3LC1O 4QEDA 3GHHA 2ZYAA 2HK9A 1QYXA 3VPFA 3E9NA 3PJFA 2HK8A 2FY8A 2VHXA 1NAHA 4GLOA 4CLXA 2DU8A 1DHTA 1RYEA 4DVJA 3AUAA 4ROSA 3GZ4A 2VNSA 3CTMA 4LK3A 4BNZA 1ID1A 1QYCA 4I5GA 5JY6A 1DIHA 4HUJA 4AJHA 3NEPX 1H6CA 3DZFA 4JX8A 3N7UA 2ZKLA 2DFDA 1TT5B 2CSUA 4UEKA 2PH5A 3U9LA 4WNCA 5DBFA 3PZBA 4IDFA 5I8ZA 1K6IA 1LBEA 1PL8A 3Q6IA 2O3TA 4UULA 2NU8A 3DL2A 2JJYA 2Q2QA 3LSYA 5A04A 4P4GA 2NQ8A 3OJ0A 4BNWA 1PR3A 2FRDA 4MPDA 3ZWYA 2C7GA 5FI5A 1V8BA 1X0VA 3VZRA 3NDRA 1PJ4A 2UYYA 4WOJA 1GZ4A 1XELA 4BUCA 3I3OA 2NWQA 2GNAA 2WMDA 3OIGA 5T64A 1HRDA 3LZ6A 3HB4X 4PG6A 4J91A 1T4DA 1UZLA 3DZIA 2HAEA 1K3TA 1O9BA 4Z0TA 5IZCA 2ZB3A 3NV9A 4MP8A 4P38A 4E21A 4BGUA 5L40A 1YQGA 5DT9A 1VL0A 1NVGA 2OBYA 3LT1A 3H3FA 1EDZA 3M2TA 2XPCA 2NVUA 4QX6A 1Q1NA 1C0LA 4A10A 4DBVO 5TX7A 3RUEA 2ET6A 3ZWXA 3FNEA 3DBRA 3WG9A 3IKTA 5IFLA 4MVJA 5T67A 1HLDA 1P0FA 2FSSA 4IJKA 1Y8RB 4LN1A 1ARZA 4YBZA 2QHXA 5HBRA 2P9CA 4U6SA 3VH3A 5KNLA 4PLCA 3Q11A 4MVJH 2TMGA 5JDIC 2Q50A 1HT0A 1Y9AA 2YHIA 3JQAA 4D43A 4RPHA 3DBHB 4MP6A 1I8TA 2PD4A 3LYLA 4EZBA 4FJ2A 3AOEA 5JDCC 4J3FA
chains in the Genus database with same CATH superfamily
3GIWA 5FF9A 3COZA 4DRYA 1YQQA 1EFCA 2EU8A 4LKRA 3Q8WA 1JV2B 3LQ2A 2YC4C 4M46A 1U0RA 3QPBA 2W4QA 4TKUA 4GM1A 5KWJA 5ICCA 1NE2A 1HE8B 3OY2A 3R8XA 2ZPTX 2ZM6B 4CV0A 1NZDA 3BTOA 3BQNB 4JOBA 3RYCB 1IK4A 3IXLA 2XZLA 5GJWC 4KR6A 3D64A 4A8TA 4O1MA 3DSRA 4OXXA 1E3SA 2C99A 2ZQZA 5JRDS 2XBMA 4RO0A 3GDOA 3QEOA 3TFWA 1OLXA 1ZHHA 1W0JA 3TLGA 2I87A 5DM1A 1JPVA 3LXUX 2FEKA 2G06A 4BNVA 3H4VA 3NTQA 4KSBA 2AL7A 3SIXA 2V4ZA 3ESQA 4TYYA 1AUQA 5E2IA 5FI3A 3CR3C 4JSYA 4YXWA 3QXSA 5LQUA 2PRIA 4JSRA 1QO7A 4F84A 3EASA 1M76A 1LZLA 4RWEA 4LQDA 5HF6A 3S2EA 4FX2A 4ACAA 4BMZA 4DEXA 3QG5A 4JNCA 5DNEA 4RU1A 2ODEA 2RHLA 2PRYA 2R6AA 3MRTA 1PSWA 2ECPA 2A9PA 2PZJA 1QGOA 3EXIA 4O8CA 4TMVA 5B37A 2O14A 3WLOA 3QEMB 3K9BA 4QKQA 3NM4A 4EHNA 3TSAA 3X1ZA 1HORA 1QMPA 3FHTA 3OEEA 1CUYA 2R7LA 3HC7A 2O3QA 2RGDA 4NDZA 3S1AB 1PR1A 1J56A 2CB0A 4PIMA 4KMMA 3P2MA 3HMQA 2J6IA 1XVIA 4FJ0A 4IV5A 3TTYA 4I4TB 4KZPA 3C1UA 4CKYA 2JI8A 3IDSA 2QUBA 1E77A 1YA6A 2RK4A 4JI6B 3RRFA 3DCJA 1TAHA 4PTYA 1OHHD 3DZBA 2NNWB 3QA3E 3G7NA 4QUJA 3TZCA 3KJHA 3H13A 1UXKA 4Z7OB 2WJGA 2C95A 3VYVA 1PJLA 2EJVA 4YRTA 1VSBA 2RH8A 1EK1A 2QX4A 4R2IA 5DASA 3CNHA 4B81A 1EWVA 3FZNA 4R0VA 4OL9A 1LPAB 3OJWA 5F1PA 1S3SA 3AT1A 4HG2A 2FRDC 4X95A 4QDTA 1FDWA 1L3CA 3GEHA 2X58A 3OU7A 3ZDDA 3C3BA 4FYKA 4TVKA 1BKYA 4P83A 5F5LA 3A9VA 3EA4A 5K0JA 4WINA 1OH7A 1BEUB 4ZPXA 2W42A 5BMVA 2XOKD 4BZPA 1QU2A 1S3FA 1XL0A 2C0PA 3Q9LA 4F2HA 4NQZA 4LVCA 5AKKA 2FWAA 4R8LA 7ABPA 1PV1A 1PQ4A 1UEXC 1VIDA 2UYQA 2BUCA 5EYPB 3JARA 4CM9A 1P3JA 1P81A 3K70C 4INOA 4P4TA 4OG2A 3WIVA 4KPGA 3AM4A 4EECA 4JGIA 1K6MA 3KKOA 4PSVA 1HURA 4G8BA 5LLDA 2O1XA 2YS6A 3I9KA 3QTTA 1IZ0A 4MDHA 3ORFA 3EIQA 2VT6A 1TM7E 1ND5A 2XTNA 3ZWWA 2I3ZA 3DXXA 3OUZA 3O4FA 3RASA 3ZHTA 1GCAA 1L5HA 3CUTA 2ILTA 3LMKA 4PR3A 1MDBA 4XVQA 4N7RA 4E07A 5LN1A 4BB9A 1PL0A 2J87A 4EKIA 3U19A 5C1BA 1AZTA 4G36A 4CVNA 2TRSB 3CWCA 2O8CA 3ZTWA 1I5RA 2VDQB 1C7QA 1J0AA 3FVQA 1HZJA 3GD7A 3LUDA 4H18A 1TZMA 4BX9A 3B5EA 3IKLA 1OROA 2PKXA 3LUGA 4CR7A 4DABA 4CKWA 5ELLA 1P74A 4FR0A 4B7AA 1BJRE 4RNCA 5C1DA 3QNWA 4PYLA 4LI3X 4DMMA 2GBGA 4JB3A 1SZJG 4OU4A 5JYEA 5J2TB 1NP3A 1B93A 2R6FA 1H2WA 4J8PA 3C5VA 1EUQA 4BVAA 2X6RA 1HGXA 1VMKA 3IO5A 4MR8A 3VVLA 4ARCA 1RLOA 1KAEA 4OAOA 3SHVA 3OZEA 3C5WP 1JQLB 3EBPA 3N58A 4UMFA 1LW7A 2XR1A 4NZNA 7MDHA 4EGAA 2H85A 5KDDA 3DLHA 3AF6A 1P0MA 4N12A 4B3FX 5BV2P 3M3DA 3VYUB 1J21A 3GP3A 2SNIE 1ITZA 1MOZA 2E4ZA 4JBHA 1MV5A 4WNYA 5DX0A 5TQ2A 1E9FA 821PA 3KYIB 1QB8A 2ZTLA 4NV3A 2BUAA 3A11A 4GU5A 5EERA 2G5GX 2OHJA 1FMTA 3U62A 3TVTA 1AHNA 2X7HA 1BOOA 3CVUA 5LOVA 4BNYA 1IN1A 3N59A 1TYDE 4DBZA 3HABA 1U0LA 5HF9A 2JHCA 2VF8A 1EZ1A 1DMRA 3MYYA 2A7XA 3PP8A 3G6WA 3S4YA 4O4IB 1VPWA 1GQYA 3CINA 5KYVA 2BE7A 3W90A 3QELA 4CTKA 4ZQGA 3WGIA 1R4MA 3FPEA 4DGQA 2QD2A 2QE7A 3DFFA 1STOA 3ZY4A 1AHPA 4M7RA 5IK2A 1L7AA 3FUTA 4XUEA 3LT2A 4OQMA 1AZLA 2HV8A 3DT9A 4M0LA 1JPJA 3WGOA 1F9EA 4PLHA 3HKDA 4QGBA 1LS1A 1W25A 5E8JA 4CEIB 4AMUA 2VAMA 3WYDA 2J9FB 4HDAA 3DTVD 3L79A 3IPCA 2ZIXB 1FNNA 3NHWA 4HS4A 2DT5A 3KYCA 4QRIA 4HQRA 4N18A 3QBVA 4X1KA 1QHGA 4G65A 4ZVTA 5H4GA 1NJ8A 2W71A 3GRUA 2WD9A 4Y2SA 3Q7RA 2XQGA 2PSJA 3OM0A 4I1VA 5TLSA 2PKEA 3ZQKA 3KD3A 2JANA 3JZAA 5LA6A 3N7AA 4E6EA 1USKA 1CVIA 1O5TA 2YIDA 2DR3A 2RGWA 4CR8A 1JX6A 1PJZA 4IXNA 5FWDA 3DZJA 2CYCA 2Y92A 3ZLUA 2YN2A 2O05A 1KVQA 1QPBA 3T94A 3GARA 2QRKA 3IQEA 2LIVA 3HNPA 2GK7A 1I7QB 1BMDA 1GGFA 1GTSA 2FK8A 4MWBA 1QV9A 4BCDA 1ENPA 4DQXA 2EBHX 1SKQA 3BMCA 4GPD1 4IZIA 5DXJA 4LHXA 3QSYA 1NA5A 3WGKA 4R16A 4CGZA 2B92A 3EFOA 4OIFA 4RA6B 4BFUA 3K1AB 1HZZC 4F4DA 3H4MA 3VZSA 4FK8A 1Y5IA 4X00A 2FHSA 2QD4A 2D2FA 3L7OA 4FGSA 4G5GA 5DBIA 3ZU2A 2O2GA 3WLSA 1C9JA 5IT4A 2Y4NA 3PQ6A 4UHKA 4L72A 3ZE0B 4H0FA 2WSSA 1N5MA 5MF6A 1DAPA 1Z33A 3WFIA 3M1AA 5IEJA 4EB0A 4AK9A 4TSRA 1PQYA 3FWPA 3GUUA 5K01A 1XVUA 3K1JA 1YUNA 2BBTA 3NJRA 3QVOA 4KO8A 5THKA 5CFQA 4Z7QB 1XD9A 4WTOA 4B87A 3GY0A 4MRAA 5BSHA 3E7PA 5TJ9A 4IR7A 1DAHA 1E0SA 1TLFA 2P5SA 2R7NA 1WBBA 2JFUA 2OV2A 2CYAA 2O7QA 3JZDA 4RM2A 3ZG6A 3QNMA 2YBDA 2YUTA 1SB9A 1H65A 1ODIA 2FQ1A 2LGJA 3ILXA 5J5AA 2ZUTA 4D3XA 5EP4A 3TQIA 1GGMA 3EVZA 2NPFA 2JFNA 5D51S 2V1UA 1ZY2A 5BVGA 1PWYE 4MQMA 4LI0A 4XD2A 4RC9A 3D9QX 3FGZA 4QU5A 2DPMA 3UWDA 3NKFA 121PA 2YWJA 1TF7A 2HIAA 4G3XA 3GA5A 3CJTA 4ALKA 4WOKA 1FXUA 1KO4A 2X0KA 5F5XA 5AXBA 3LP6A 3M5DA 3OUUA 4EF6A 3H0KA 1QQAA 1G7CA 1H5QA 3IKJA 1P9OA 2XWBF 3LLCA 3P9IA 3IOYA 2I3GA 4OQDA 1BJTA 3OZFA 4B0PA 3W5BA 3I37X 1T2CA 2K2WA 5FQNA 2JGLA 2XD4A 4LRYA 2IHBA 4MWCA 4JWKA 4RDIA 1XTZA 2DZDA 2XNDA 3RSOA 3TX6A 4JI7B 5JATA 1D2NA 2C2GA 4ZEWA 3ZWOA 4AY2A 1Y9JA 5T8KA 2HHJA 3MTIA 4CE6A 3HB5X 3JAWA 1JQ5A 2QT1A 4MS3A 4OFWA 4LYDA 4P5EA 3RUCA 1WCWA 1O8BA 2I5PO 3T3EA 4HSEA 2ZRMA 3GFVA 4E1VA 4QTTB 2XMBA 5A1TA 5KTPA 3SHFA 1KMMA 2QN6A 3UT6A 1EVLA 1YD7A 5JD3A 2LKDA 1Y7HA 5GM2A 4WBNA 5C8YF 1RWXA 4XWOA 2ZTMA 4KNWA 1Z5NA 2ZWVA 3PQ7A 2JGAA 2GRAA 2COKA 3NG1A 4KVFA 5LQSA 3K70D 3FWZA 3LY7A 1W47A 3O8QA 1CY7A 4I14A 3U4DA 3ASYA 3W3AD 4WUTA 5HDBB 2GJ9A 3IRVA 4O4JB 1MAUA 4REQA 4X60A 5JFTA 1PHPA 3A6EA 2P68A 5KNDA 4CUZA 3DLCA 4X20B 3OMXA 1E3EA 3DMGA 1I4DD 3GRKA 4OQEA 4KYTA 1D4ZA 5F33A 4FLEA 4EELA 4CG2A 4DMHA 1B3RA 1O95C 2EHDA 2H52A 2JLSA 2OQ2A 2XNSA 3ED1A 3PVZA 3R3JA 2WJJA 3Q9NA 2ZRLA 4R1OA 1NBAA 3KSZO 1XLWA 4WKCA 5AHOA 2R1TA 1LW6E 4B7ZA 1U9YA 4UUMA 3D6UA 4GSKA 1NR1A 1Q14A 3BL8A 4ZJUA 5BN3B 2P9TA 1FP2A 1Q5PA 4PZZA 1GSAA 3R9XB 3BD9A 3RRNA 4X3CA 5H8WA 1EFDN 1TJYA 2FPGA 4L6AA 2IV3A 4ARZA 2VJBA 1B3BA 1ULSA 3OKAA 3I2YX 2QVXX 3BSFA 3DLPX 2GEJA 1ZBQA 2BUBA 4CI9A 1QR6A 1E7MA 2R5WA 4GDFA 4BDTA 1G8YA 1VL8A 2IYYA 4KFTA 5KWIA 1VCMA 1NWHA 2L17A 3U7FB 3LLSA 3ECAA 3PR3A 2Z09A 3CPEA 4DSZA 3OC6A 1PNOA 3KFVA 3JQAD 1BYUA 4RMJA 4IZOA 1ZINA 1NN5A 2FPIB 3W8RA 1FOEB 1C1XB 5DM70 5CLLA 5M29A 1F0KA 1GPYA 3VSDA 3QI7A 1MP0A 4CFYA 1R0BA 4JEMA 2ZFUA 4XTCS 1TGVA 2D5AA 1GNRA 1R0XA 4HDNB 1RAFA 5HR5A 2C2KA 1LB1B 1AV7A 3M6AA 4F04A 1Z75A 1CJKC 1IPEA 1JR2A 3NWOA 1RWNA 3TSYA 5AW5A 5JCPA 3KOZA 3M1IA 5G4LA 4GOJA 1Y5NA 3MAJA 2J08A 4ZAXA 3ONNA 1J8YF 2FOIA 4R1MA 5AUQA 3QVSA 3RRYA 4X8MA 3U0BA 5EIAA 1R0LA 4GGMX 4CQMA 5DHQA 4BNDA 1QIEA 1RWVA 3UUFA 1R18A 2ZROA 3EHDA 4XYEA 4E5DA 1U94A 1V41E 4OQZA 2XSZD 1QF9A 4WLOA 4AF7A 3C5EA 4DA4A 3Q7EA 4DLVA 4QPNA 3IP6A 1NC3A 5IU6A 4BRWA 4NECA 4Q4JB 5JE8A 1ODSA 3V4ZA 3WLHA 1X1SA 1L5KA 3AC0A 2ZBEA 3E5HA 4KHPB 3QOWA 1FYVA 1GZUA 2XMCA 4QGGA 3PGXA 2ONJA 1VMAA 3N1UA 4G07A 5HTOA 2NQ2C 1WCYA 4B43A 2R6JA 1EFPA 5B64A 3MLBA 3DLAA 1G5HA 2YRFA 3GC6A 4TYQA 4YMWA 5HKKA 1WPXA 4BGEA 1E1DA 1LD3A 5P8WA 4GX1A 1IN4A 1KEEB 3L7CA 4B3BA 2RHMA 2BCGY 2ZJ7A 3D6TB 1BQ4A 3BK7A 4ZCLA 3ZWKA 2X7JA 3KZXA 3UYKA 2R8XA 2IYFA 2QRGA 2WJHA 2FZKA 4J76A 3T54A 3WWZA 1YBFA 2EXXA 2RAPA 1MAVA 1UC9A 2H4JA 2Q0XA 2AXQA 3GRAA 3KPJA 1K4KA 2DHEA 3VNBA 3WFJA 3LK6A 4UDXX 5J5VA 3RWMB 5MHTA 5FI1B 2NU7B 1QO9A 2UZ4A 1F2UB 2WPDA 1E3JA 2PMBA 2PLFA 3FPGA 2Q3JA 4ZRMA 3WQHA 3FF4A 1H42A 5DULA 3HYLA 1UBLS 5L7YA 2HPVA 1RMQA 2ZG6A 1BVUA 3IQXA 3PVCA 4HZUB 4MQEA 3T9BA 4A26A 4EYGA 3EX7C 2HTFA 8ABPA 1N6RA 2Q5LA 1P4JA 3R1IA 2XQVA 2X3UA 3MWYW 5E7QA 1W5BA 1FNMA 4D9HA 2SCUA 1PDWA 4FEGA 4ZO8A 1SU6A 2FJ0A 2Q9CA 3AHHA 3W2HA 5ITZA 5F64A 4HAUA 3CX4A 3ST7A 4LGCA 4R1UA 3L06A 3N0VA 2OA0A 2A78A 2ZJ1A 4F7DA 3Q9UA 3AUXA 4OK5A 3EXEB 4GBED 4M9CA 1NVVQ 3VA7A 2DYKA 2JFWA 3QVUA 2POQX 1KVSA 4BCCA 3VYRB 1UFOA 3CB2A 5ENZA 1ZVMA 2VG8A 5CW2A 5EJIA 2GTHA 2REQB 1R4AA 3KUKA 4JCOA 4TLLB 4QSHA 3AVYA 3EODA 3PHLA 3FWHA 2Y1GA 2CXXA 2JGDA 3ZCRA 1OYYA 1DIAA 4R6WA 5LNK1 3CZQA 1DXQA 4KE8A 4MCIA 1E20A 1ZUHA 2W6CX 3I0ZA 3NHSA 4H7FA 2BKLA 2W4IA 1MIOB 4RIFA 4WKOA 4NMHA 4GC5A 1X94A 5GJVC 4B8ZA 1P6XA 1LSSA 2NTYC 1C1DB 2VXBA 2C2MA 4IEIA 1Z5UA 3TZBA 3KELA 1BFUA 3OE7A 1M34A 4CU2A 3X2EA 4NZOA 1WA5A 4RTLA 1EU1A 1H1LA 1SO8A 3ESYA 2PN1A 2E5LB 3E7WA 1LBQA 3WI7A 2QE6A 2BLLA 3TEJA 5KIAA 3M6XA 4C7OA 3TMYA 1AOXA 3DVRX 3FBTA 2Q07A 2X8BA 3CX7A 4W9NA 3PXUA 1OJ7A 4IEEA 5C53B 3RO7A 3IAFA 1QYRA 3QUSA 3LXXA 1LQTA 1M7GA 3PRYA 4BU1A 3TLZA 4Q02A 4NQRA 2ES4A 2O5CA 1EA7A 1VA4A 2ASEA 3ROQA 4XA8A 3AYZB 1VSVA 1X1EA 2XB4A 3IL2A 1MA3A 3BGIA 1Z08A 3S8MA 5F23A 1DKLA 4QM6A 4LDQA 2GESA 3V55A 1KGDA 1V26A 4F2PA 2H3EA 1WZEA 4TN1A 3VVBA 4E5MA 3F5QA 2ZBRA 1H2BA 4RK5A 1EGVB 3E9DA 3HZOA 4ZCSA 3U61B 4P5PA 3THSA 2I2FA 3ROMA 4RQBA 1U63A 2F00A 2QAIA 5JR3A 3N75A 1MUUA 5K8JB 5DF1A 3GJ5A 3R6LA 4HVCA 2Q6OA 1ZLYA 1SCIA 3DMHA 3GEGA 2YDXA 5ALWA 2XOEA 5AVVA 4ND4A 5IDVA 4S1OA 4C0JA 2AJLI 3AI1A 3N3BC 4F92B 3SZGA 3KSAC 4QA9A 4RIHA 4RLFA 3ZE1B 1TJ3A 1FUUA 5I51A 3LG2A 3I0NA 1RJ9B 2B25A 1SY7A 2HCRA 1M1UA 4LYEA 4AUKA 3F67A 1QXSA 4CMEA 4LOKA 2GI4A 3N70A 3AM5A 1SQ0A 5AW8A 4WSOA 1OIXA 3HCNA 4Z99A 4JYPA 2NNLD 1C1HA 4F8YA 1JQBA 1O95D 4ZYYA 3IMFA 2PUHA 4QPZA 5EHXA 5JCXA 4CQNA 1YE3A 5K8LA 4CMKA 1ECJA 1S8AA 1TAQA 2C5LA 3HJAA 5EIFA 4MULA 4YPFA 5HQTA 3U37A 1OZAA 4K9KA 2XUIA 3UGTA 2Y05A 1OBVA 2IXTA 5ESXA 2BSAA 5LBUA 5EWMA 5JZ9A 4II7A 2VF7A 1ZSNA 3HN6A 1BVYF 2R68A 2E5FA 3A9CA 3DVQX 3ET5A 3LDGA 4OGLA 4QOIA 1N25A 1EP3B 1SOWA 1ZK2A 2LXNA 4PAGA 3MJRA 3PHGA 5SY9A 2WNHA 4JYCA 5HSGA 3HZRA 1BQ3A 4BP3A 3LY9A 3NTRA 1C7EA 2HUNA 3OLWA 3HA5A 4G81A 1U8ZA 3SCZA 4PN7A 3D4BA 3EDMA 4ASUA 2O52A 2OM2A 2P67A 1W35A 2Q6TA 2EG5A 3N9IA 2A5GA 3NAQA 3CT4A 3LYHA 4GOXA 4I9UA 4IQ8A 2GEKA 4MIYA 4N9WA 3ZW8A 2RGNA 3DEHA 2RAVA 4EYSA 5C8ZA 1N6HA 4E3WA 2Z0MA 4V0NA 1OT5A 2FMFA 1SVSA 4QOEA 1WLSA 2UU9B 4J9VA 2UUPA 5IBPA 3WYAA 2IOFA 3D4LA 3DNPA 3KKPA 1B4DA 1U9ZA 2DPLA 1K6XA 3PXAA 5CFZA 5KJCA 1RKUA 4O2BB 1TF5A 1B1CA 5ER9A 1HM5A 4BAUA 2UVQA 1PDVA 4HY3A 3RFUA 4MVJF 4LV8B 5CA0A 4FB4A 3MCVA 1A2KC 4BLOA 4BO9A 2VVTA 3V1TC 4PTLA 5EZYA 2ZSAA 3MCTA 3KTFA 2J30A 4ID3A 5HF8A 1W2GA 1B0UA 1DSSG 1HFKA 4X6LA 1A9RA 4HRAA 4Q18A 4QSMA 5CHEA 5CNIA 2UV8A 1CY2A 2PNJA 1D8TA 1IUNA 2PSDA 1FNCA 2UZAA 1V39A 5KSPA 4ALNA 1MZPA 1GAJA 1WP4A 1IPFA 4P32A 2MYNA 3EB9A 3ANSA 5JNVA 2YYAA 4GP6A 1H4TA 5A4IS 2NTNA 4HYTA 2VDNB 2VRWA 3QW2A 3V4LA 4AW9A 1JDJA 3O73A 5KTRA 1K5HA 1CUIA 3V8PA 2JGIA 4KGXA 8AT1A 5TVKA 4WD3A 1E2EA 1NIPA 1L4NA 3EG9B 5IXJA 3HJNA 2JLRA 1Z38A 1IC6A 2NO0A 4YH1A 3EUWA 4PLYA 3AZPA 3KQKA 1ZICA 3KTOA 1GKKA 5A5DA 1QG4A 3R3HA 5CLFA 2VEDA 2CCJA 4MKRA 4DLWA 2AB0A 2HGZA 4PZ0A 2NPIA 4PICA 1DOZA 3EYAA 1GTRA 4R2XA 4DIKA 1PW7A 1ZNWA 2PUJA 2VSFA 3OHSX 4N03A 1II8B 3D5EA 3F5DA 4EEXA 3MJFA 4PFSA 1F14A 1FP7A 2IHVA 2FFBA 1RRKA 3IAUA 4NP6A 4TRNA 3SQOA 2ECQA 4HXEB 3T4PA 2WI8A 3IQHX 3D31A 1B8PA 4YLEA 3BX1A 1F7UA 3U7JA 1N6KA 1XZPA 2PXAA 3KT0A 4PX3A 3PFHA 1XNQB 1KDRA 3V46A 1VGVA 2RIRA 4P5DA 4I36A 4QDOA 3UO8B 4R51A 4MWSA 1NKSA 1Z13A 3PEYA 1QHEA 1CUAA 3TR5A 2RHDA 1MLDA 4LBZA 5EXEA 3I2FA 3JTMA 8ATCA 1B14A 3PTAA 2CNDA 3EK2A 4EHAA 4IWNA 5ILGA 1NOKA 5FADA 1ORTA 1I94B 3F4KA 3VV2A 3UMRA 5T41A 5A03A 3U3OA 1A2BA 5ERYA 2V59A 2OEPA 3FDIA 4EB8A 4GL4A 5HKLA 5EUBA 3MUFA 2PE5A 1X9IA 2PGXA 1CJCA 3X44A 2EFHB 5K05A 2MOKA 4IIJB 2ST1A 1XJCA 1A9QA 1JEOA 2J9XB 4PZEA 5JJKA 3BG5A 3E3MA 3LUCA 2Q9UA 3BXEA 4NRDA 3IXQA 4JOQA 1P7VA 2XRFA 5CLJA 2WB2A 1MMFB 2HHHB 3E3AA 3E82A 4JJFA 5B12A 4BWYA 4BVLA 1NNEA 3U2QA 1YZQA 1EDDA 4J4HA 2I55A 1KHHA 2Z3ZA 2AMFA 4PYMA 4TZ0A 4FFSA 4NARA 1ULHA 3PHCA 2BM0A 3HR4A 3IMKA 3LD9A 4G24A 4PFQA 4UEQA 4NE7A 4X8LA 4XR9A 1B74A 4I3HA 3V1MA 3GJ8A 3KQQA 4QUAA 4AECA 4BFCA 4DIEA 4MKIA 4PC3A 3E48A 1CERA 4F0JA 2O3JA 4X3PA 5JQWA 4S04A 2ODQA 4OXIA 3RBAA 3RYCA 2ZRGA 1GTG1 1EVIA 1TLLA 3T3DA 1FSPA 1FXSA 3TRKA 1RZ3A 4I8IA 2HRQA 4JXXA 2HO5A 4YCBA 5BR4A 4YY3B 2CLDX 3P7MA 3W6OA 3BRSA 2R00A 1ISJA 1M2KA 4ILKA 4Q21A 3R3YA 1K4MA 5LVAA 1WF6A 3E15A 2PH3A 3BXOA 4D9MA 3UUEA 1N1GA 3W5IA 1KI2A 4LSWA 5DISB 2R7MA 3F4BA 4IZHA 1JA1A 1AA9A 2QR3A 2OYSA 3KLPX 1ZCAA 3RVOA 3JRWA 5FBKA 3SYNA 4R9SA 4AP6A 1W36B 1HZZA 4G5YA 2EYUA 1QPGA 4RNDB 4AO8A 2Z4RA 2IU3A 5COQA 1XDGA 1Z0SA 4XVUA 3T1HB 2ZBUA 3HL4A 3MJTA 4HGRA 5B1DA 3V7FA 1J07A 2OXCA 4IXMA 5IUNC 4DV4B 3D0OA 3BBPA 3VO8A 1PR4A 4FIZA 1CR2A 1HI9A 1YR9A 4HB2A 4C88A 3FPKA 3QEMA 4ZT6A 4D3DA 5ILOA 1ABFA 3QGMA 4GEKA 3Q5DA 3VKHA 5I7FA 3ELBA 3FROA 4RCZA 4DA9A 2HPHA 3FUUA 4FFBB 1NYTA 3EWSA 4L3WA 5SZHB 3PGKA 4LK2A 3S1AA 4I9HA 3W9BA 1MB3A 4LTMA 1ACMA 4YWHA 4A8JC 4V0QA 2WRZA 1SU7A 3GPDG 3QMMA 4I4TA 4LKOA 1JLKA 3UK6A 3VU9B 3Q87B 1O6CA 2P9HA 3LAWA 4KOEC 3PNVA 2EJWA 4Q47A 3TIGA 1EBBA 3AWDA 2WOOA 3DDNA 5CA1F 1AC5A 2P5YA 1XBTA 4IUYA 3VFDA 4Q01A 3D54D 3G8BA 1B2LA 1Q1QA 5JALA 1N1EA 3ERCA 4Q37A 2XWSA 3SJUA 2ZEJA 3FLBA 3OD5A 3V8MA 5LKAA 3KCNA 5DMXA 1R64A 3VSCA 4MUAA 1R5NA 1Y89A 3BFPA 1WSDA 1AM4D 5H5JA 2X2FA 2IEDA 3TLBA 3SFTA 4GNKA 2B8NA 1RLIA 1ZH0A 3MT0A 2M6LA 4TVOA 1F1BA 1JYSA 1E2KA 3GUCA 3LUFA 2VPQA 4L7QA 2PS1A 5I7RA 3EDYA 2PJZA 3D4OA 4LE2A 4B76A 4F4HA 3T12A 4QATA 3PJGA 5EYPA 1KL7A 2CUZA 4GR5A 3W6ZA 1YR6A 3LNCA 3G88A 2AZTA 3LVQE 3SC6A 2LZ0A 1IDN1 4P92A 3F8TA 3AFMA 3NYWA 1Z7GA 1A4UA 5K0BA 3PUYA 2JK0A 3GFFA 5AVKA 5LYJB 1JT9A 4YRGA 3W7BA 1KEKA 4BLWA 1AUPA 2ZPAA 4GYJA 1FE8A 1PEYA 2DHCA 3KM0A 4RESA 1CXZA 3QKSB 4XWAA 3U26A 4DMGA 2JI7A 5LU8A 3F7NA 5M34A 4BEWA 1JYFA 1TYZA 3GAFA 1D09A 1LC3A 3KKQA 4FI3F 1EUZA 1I36A 4NY1A 3V3TA 1KU6A 4NBVA 5ESWA 3LO8A 3M49A 4OLFA 3VDQA 4PXYA 1ZN8A 2O8VA 4C14A 4G0VA 2FH5B 2QJRA 4R4JA 2CMFA 1ATZA 5LQRA 2IU6A 3U7GA 1Y3CE 3LFTA 2VYQA 3R41A 2H11A 2EFJA 1QUFA 1N1DA 5E95A 4BHTA 3VJKA 3KLNA 1N2GA 3GG2A 1CV2A 2OOKA 3QTLA 3C8HA 1G9XA 4M22A 4Q3LA 6ABPA 2H2GA 2O0MA 4P58A 4I1YA 3WJ7A 2MSNA 2OLKA 2HBYA 1UJ4A 3QPUA 1HDXA 3Q3JB 3E9MA 4G8CA 1ADFA 4PCVA 1P31A 5K9ZA 2B99A 2V8BA 1OZFA 3A1TA 3VR6D 1NSFA 4LHVA 2FR0A 1XMPA 1SG0A 4WAUA 3KQNA 4HX5A 2I4MA 4V39A 1U9JA 4L3VA 2FPMA 2F9MA 3HU2A 4J1TC 4CT5A 1W93A 2ZJ0A 1HE1C 2Y9MB 1YVEI 2Z2IA 1ZL0A 3N76A 4NPAA 5CH8A 5GQSA 1TUBB 1AB6A 2XMGA 4CKBB 4UTXA 3FBWA 1OB5A 3E22B 1W6UA 2F3TA 3X1XA 4P34A 4XDZA 3RS9A 3UBMA 1Y6JA 1HK7A 3P9RA 1LK5A 1PBNA 2VNKA 1T2AA 4YJ3B 4LQLA 2RD2A 1SN7A 3D02A 4O4IA 2V4MA 2OFOA 3C6XA 4R2MA 1TFUA 2ZI3A 3KOXA 1USUA 3ZK9A 4E08A 1S2LA 2DM6A 4P4SA 4QDKA 5HJ7A 2BGGA 1XZKA 3CZ4A 3G9ZA 5LQJA 3UV6A 3WMEA 3EVDA 4AULA 4D82A 2YXPX 3HGMA 3B6JA 2OGZA 3HDQA 3LUHA 3MTQA 3OLCX 1C7JA 4BKOA 1U7ZA 1RZUA 3L7YA 4TYMA 4TXLA 1TQHA 4L5BA 4JLUA 4CEIA 2XTJA 3K94A 3KKEA 2GZ2A 1F4PA 1RHJA 1G6HA 1LNZA 2J9FA 3K0HA 4RMNA 3AXTA 1XA4A 3FIUA 3I6IA 1WUIS 3AJ9A 4RF5A 4ZAZA 4NEHB 2R66A 3P97A 3QU9A 1YRAA 1J0DA 1YOVB 1LC0A 1PX2A 1Y48E 1YAHA 5DXFA 2J6BA 1L8AA 2ZCJA 3PS9A 3LQFA 3DE1X 1KAOA 4J29A 1E79D 2WIFA 2VRBA 3F6PA 4Q00A 3AR5A 1ENOA 4ZYZA 3KAJA 3A04A 1JJAA 1NMYA 2ZE5A 3AUUA 1I0LA 3OX1A 1YASA 4A92A 2B3DA 2CL6X 3DEYX 3DT8A 3LK7A 1FBNA 3TD2A 3S1SA 2PJDA 4FCCA 4XCQA 4D46A 4DREA 2PU5A 1K6EA 1PTJA 2EG9A 3GNQA 3HSYA 1JSXA 5ALOA 2PBLA 1O03A 2HW8A 5KVVA 2N46A 4FW9A 2ANCA 4U7HA 5AI5A 3BT7A 3CZAA 2CLKB 3RTEA 2ZBVA 4QBTA 1EJ2A 2FZCA 3L7JA 3UV7A 1XA3A 3TN7A 1TYCA 4YTEA 2ZUFA 1AGNA 3NRCA 2JFXA 2KI5A 3G9TA 4EUSA 4W7IA 1FNDA 2XUPA 4YALA 1E2FA 3K1AA 2W2LD 3ZK8A 3VV3A 1NUPA 2RK6A 3OQIB 1X6VA 1DEHA 4RVNA 3SEZA 4BJ3A 1T4MA 1XD8A 3ENWA 3V8QA 1K1EA 5JJ5A 3VBCA 3B36A 1XJ0A 2QP9X 1YFJA 4R1LA 5H3LA 2H48A 3LCUA 5J2UB 1T9HA 1S2IA 1N4AA 2I4NA 1ANKA 2A6PA 5I9LA 2IEBA 4AJLA 4B3JA 3LTNC 1E1QA 4JUFA 3OQNA 1UCFA 2FA9A 4MR9B 3R9KA 4RPJA 5F7JA 5F5NA 4YPOA 4ZAGA 4F60A 4IDDA 2X3FA 1YL5A 3F5FA 4FEEA 4M49A 4KGDA 3C8UA 2DLNA 3WYNA 1IZ9A 4OHXA 4UE2A 2WHRA 1GZHB 4H15A 4A2WA 1ZONA 2WDZA 3CUKA 3NHYA 2GZ1A 3C43A 3AFGA 1E5DA 1G17A 1NPDA 1SOMA 1VBNA 3BMQB 3JYPA 3E0XA 3OLZA 4P0TA 3BL6A 3TI7A 4B47A 3IT1A 3HS3A 3DVAB 4NI5A 2EHJA 5AJXA 3WBKA 4EG6A 4WACA 5CFLA 4S1WA 2EQAA 1MABB 1HG0A 3SBXA 1UL1X 2GSDA 2O4UX 4NIMA 3SXPA 4C3VA 3T15A 3EFEA 1CEYA 2O7NA 5JBIA 2PLAA 1MOSA 3D8UA 3V8RA 2P9GA 3ICEA 5TMBA 4DQVA 1K89A 3U48A 3GPLA 1D6JA 4J0JA 3ZYCA 5H83A 1A69A 1GEGA 5CFRA 4EVQA 4V3BA 5C7IO 4RLHA 1Y1KE 2A9OA 2Q4RA 4N5IX 2G8LA 4MA4A 4QVKA 4EY7A 4URVR 1WU8A 1R3UA 1NVVR 1XMJA 2V74B 4V24A 5HM8A 5IHXA 3HL0A 4K6HA 2OQVA 2IP1A 2GJ4A 5EJEA 1WY7A 2QXTA 1WCXA 5AJYA 3CISA 4DA0A 1YB6A 2QM3A 3GLHB 5B4UA 2IOQA 4MCJA 4MGHA 4DMUB 4PNHA 3R7WB 2PZFA 4XWKA 4FMPA 4LY0A 2IPNA 2KMLA 1DFHA 3SXJA 5H70A 5P21A 3ER6A 3AI3A 3TD9A 3BFJA 1RW4A 2FRXA 3CVWA 2AG5A 3FAZA 2Y0BA 4AG5A 1L4KA 5KX5F 4C05A 3DAHA 2JH8A 1V3TA 4O4JA 5JH7F 1OMOA 1DRVA 1S7CA 1BMFA 4HJRA 4CF5A 1Z07A 3M4JA 4X20A 1U9IC 1Z45A 2CUTA 4M89A 5IBQA 3PJRA 1G4UR 2PQMA 1XALA 2C77A 3DFIA 4N0QA 3RBXA 1C1YA 1DG9A 3WWOA 5JJBA 2I2AA 4MVCA 3II6X 3SQWA 1UWKA 3LBAA 2QTNA 3QVTA 3ROXA 5F9HA 2PD3A 3L6UA 2PZGA 3O1IC 4D25A 2SICE 1KYQA 1KY4A 4LJ5A 2NUBA 4HNAA 3TAXA 3CXRA 1ESNA 3IDFA 2P27A 4X84A 1GNSA 1RYNA 2WJIA 5AHKA 2B83A 2LCQA 3R9XA 2JCVA 4H60A 4R2LA 5JSYA 1FFAA 2BGNA 1NQWA 3KWFA 4OMCA 3MOGA 4ZEMA 1N6IA 1N2CB 1Y8CA 4RL6A 1QB7A 1RACA 1HETA 3O8LA 4YXWD 2E4WA 3I92A 1QLWA 1JDTA 2PCJA 2I7DA 5AVOA 3EWNA 2PV7A 1IB0A 2J1LA 4BV3A 3EF0A 4IKEA 3W1WA 3FSEA 4YXFA 4X54A 1NQ5A 4GOLD 2DP4E 4N8SA 2V1XA 1RHMA 2FPIA 4M7WA 4KYVA 4Z4HA 1TK3A 4ZGGA 1C1XA 2HIMA 2HU2A 2YZMA 4Z86A 5FPHA 5KPJA 1C3XA 3E2MA 4CF7A 4C2BA 1XU7A 4D6YA 3LHDA 3NTOA 1CQXA 3PIDA 4HDNA 2GK4A 5D5QA 3R8CA 3OEED 5BNTA 3KXDA 4ZYTA 1V7ZA 4GRIA 1EG7A 5A9RA 1USVA 1M1ZA 2VBFA 1RNLA 4QBFA 1QHNA 1UBTS 3V9AA 1UBUS 5T3UA 4ZICA 1CNMA 1A5AB 4N5LA 1F6DA 2QQGA 2YNMA 1PZHA 4TOIA 2GD0A 5FUMA 4JI8B 1OGYA 2GLTA 1JAYA 1PLJA 3LJKA 4NK5A 3WQBA 2X8WA 2QMOA 3EEQA 4N40A 1CB0A 3EFHA 2W6JA 4R9RA 4IRUB 1MT0A 3TL2A 5A4KA 1ZYUA 2DKOA 5B3JC 5JISA 5K2OA 1XTVA 1F8FA 2CJPA 4UHJA 4Q4JA 4WNAB 2VHCA 2YV4A 4JC0A 2C8JA 1G3QA 1Q91A 1AG9A 1UBOS 2OHOA 2QV7A 4JP5A 5CJ2A 5EEHA 4G0QA 5AT1A 1O6FA 4BO8A 3LX6A 4WERA 3SI7A 2G72A 5HGJA 1J0XO 3P2IA 4JLDA 4DHEA 4UAUA 2IYAA 5BQ5A 1E63A 1QNLA 1HTWA 3RRZA 4OYLA 3UH0A 1HYEA 1YU6A 1QZUA 4TTRA 3UAYA 2C2HA 1DKPA 3CSSA 3WYGA 4RA9B 1HDYA 1NP7A 1BDMA 2NSJA 3DC2A 4J43A 4B4WA 4MUEA 4R1SA 3EOZA 2GPJA 4QDUA 3C41J 4CM9D 1KEEA 4KFRA 4BWGA 3R8FA 1GPKA 4KIWA 4KI0A 3S2IA 5A1JA 4PG7A 2XCTB 1NM5C 3OLYA 3ZQ6A 3UJ7A 6ADHA 2JI4A 1SWWA 3ME5A 3QEAZ 4CEHB 2V45A 3NFRA 4FN5A 3RVMA 4ZYVA 2VP5A 2A5DA 2ISSD 4IEFB 2P1DA 1XRNA 1Y9ZA 2YIJA 1DX6A 3GLVA 3NIBA 4ZC8A 4RH0A 3A1FA 3TAHA 2OK8A 4XYMA 3QPCA 2WD7B 3WGMA 2IS4A 2GEUA 4UBMA 1P2GA 3AHFA 4YMGA 5J4LA 4AN1A 3JALB 5CG2A 1DRWA 4BBPA 1FX0B 1WBJB 4HZUA 3N5CA 2HRDA 1KXJA 4RTSA 5FFMA 3FF1A 3C6KA 1PSDA 5KB3A 2B0CA 3R44A 4UARA 3RIGA 2YINC 4QBIA 1KK2A 1Z28A 1F48A 3FI9A 3LLMA 2C4VA 4K9QA 5AHRA 5KTMA 3QVGB 2GPAA 3DMRA 1G5IA 4EYEA 1VL2A 2RI1A 2Y2VA 3EXEA 4K9PA 1FYDA 1UFRA 2PL3A 3UCEA 4NC9A 1R8QA 4C7MA 3PRHA 6Q21A 2CMGA 3VNAA 2MHCA 1TZKA 4LXXA 1M5RA 4G41A 2PO5A 3GJ7A 4ICIA 2CV0A 1SB8A 1YVDA 10MHA 2GR9A 4P0PB 2JKVA 4G01B 4S1NA 1N6PA 1KY5A 4YRDA 3H9GA 3SKVA 2REQA 1MPXA 4NF2A 4A82A 3SU8A 2QG4A 1I2DA 3H18A 2H92A 1L4HA 1Z4PX 4XSVA 1BDIA 4KXFB 2ZT6A 4HXYA 2AZDA 2I03A 1HMYA 1MH9A 2AJTA 4KO3S 5D5HA 3ZKWB 1YB7A 2LKCA 3AUTA 1VRCA 3C39A 4B73A 3WHKA 4WEOA 2ZWOA 3D7KA 5KHOC 1OX4B 2YFHA 3B7GA 1MIOA 2JD1A 2R1ZA 4JLKA 2ORYA 4C4XA 3IR5A 2OHGA 4V1CB 1C1DA 1NUAA 2GARA 1V47A 4EY8A 4ERNA 4J0QA 4EX6A 3PC7A 5DNCA 2JFOA 2WIGA 4H1VA 4WVFA 2FETA 1Z15A 1EWYA 3EULA 2BI7A 1ISSA 1GR1A 1SWVA 1B76A 3ND6A 1ISMA 4FDUA 4LEIA 5FFNA 2Y1OA 2HKIA 1OGIA 1LTHR 2Y71A 3V8NA 2IXDA 2XY4A 4WADA 4HLDA 4WQMA 5FFFA 2UUBB 2WABA 5G0TA 1ZKDA 3KP1A 4WVLA 2PS9A 3OPNA 4F46A 3D0KA 1PFKA 1G0NA 1B41A 2XVZA 1NI4B 3AHDA 4WZAE 4XEHA 2NVWA 2VHWA 2F48A 4DYHA 3QKUA 1J22A 4FBMA 4NULA 4WBXC 3QHQA 2WF9A 4AS2A 4NCBA 3C3WA 4JP3A 3NMUF 1ZJ4A 3P27A 3JQPA 2WM9B 3H1GA 3CYFA 4OI4A 4X45A 2VYVD 4Q12A 4W5HA 3HBJA 1TQ4A 1LSJA 4HTFA 1COWA 3ZOZA 1VL6A 2AFIE 2H4HA 4H1TA 3RU9A 2O19A