3DQPA

Crystal structure of the oxidoreductase ylbe from lactococcus lactis, northeast structural genomics consortium target kr121.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
219
structure length
219
Chain Sequence
MKIFIVGSTGRVGKSLLKSLSTTDYQIYAGARKVEQVPQYNNVKAVHFDVDWTPEEMAKQLHGMDAIINVSGSGGKSLLKVDLYGAVKLMQAAEKAEVKRFILLSTIFSLQPEKWIGAGFDALKDYYIAKHFADLYLTKETNLDYTIIQPGALTEEEATGLIDINDEVSASNTIGDVADTIKELVMTDHSIGKVISMHNGKTAIKEALESLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the oxidoreductase ylbE from Lactococcus lactis, Northeast Structural Genomics Consortium Target KR121.
rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Oxidoreductase
molecule keywords Oxidoreductase ylbE
total genus 72
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dqpA00
4FQ8A 1KBZA 3I23A 4FJ1A 4GX0A 4CL8A 3QVOA 4E2XA 4BB6A 1I32A 2V6FA 3BXXA 4M89A 2VCYA 3B20A 5DBIA 3G17A 1K6XA 3IAHA 5CDSA 1HDRA 1QSGA 2FSSA 1QYVA 4N5LA 4OGWA 5I9LA 5JFOA 4CM8A 3F6YA 4YJFA 1DFIA 3GZNA 3VPGA 4N5NA 4RVHA 1AGNA 5JPIA 3QHAA 3WFJA 4BV9A 1ISJA 2VOEA 3WYBA 3JQGA 4Y67A 1U9JA 4NDNE 5T64A 4BKOA 3UICA 1OOEA 4AJJA 1DO8A 1KVRA 1A7KA 4OKIA 3I9MA 3GG9A 4DPKA 4ND2A 3ASVA 2OO5A 5C7LO 1P77A 3BMOA 3EZYA 1Y9EA 3L0DA 1DRVA 1Z7BA 2PH5A 4JBIA 1PGQA 3IKVA 4J16A 3DC2A 2PKQP 2I76A 4BNIA 4OHUA 3PRJA 1R4NB 1CF2O 5CEFA 1P0FA 2CNBA 4DWVA 2UDPA 3ZWWA 2P5YA 2BI7A 1T4DA 5TX7A 3CSDA 1Z75A 1ZFNA 2FSVA 2LDXA 2A92A 2EP7A 1PQWA 3BZUA 1OAAA 3IIEA 1B2LA 2Q45A 2GLXA 3LC1O 2VWQA 3QE3A 4IMPA 2BF7A 1LC3A 3NYWA 4OXYA 5HS4A 1ZK3A 4WLNA 5TT1A 3WBBA 4XGIA 1Q7GA 4FDAA 1EQUA 4W9NC 4A10A 2Z1NA 2IODA 1B8PA 2VHYA 3H5RA 3TZCA 3VH1A 3Q6IA 3NAQA 3OEWA 4M55A 3WMWA 3ZV3A 1F12A 4BO6A 1ZK2A 1J5PA 1NHWA 1QYCA 3NUGA 1U28A 3AFMA 1PJTA 4YRDA 5EPOA 2XXJA 2DC1A 3JQ7B 4LVCA 3CIFA 4YR9A 1Y5RA 3I6QA 1LSOA 3FBTA 1OFGA 5BNTA 3GNSA 3TWOA 4EEZA 3F46A 1Z74A 4KUGA 5IDWA 4YT5A 5A9TA 3MTGA 4FPXA 3D5QA 1TLTA 4YYZA 5GY7A 3H9GA 5TSDA 2BGLA 4PLFA 1E7WA 1DXYA 4J1SA 2IEDA 3OICA 2EWMA 3QWBA 1NNUA 3OSUA 4BO8A 4HFJA 4TSKA 2J3IA 3IKTA 1GL3A 3KYBA 5A3VA 1CDOA 5JCXA 3KEOA 5AVOA 1K89A 4TZKA 1ZJZA 4WGGA 3JYQA 1U2DA 1XYGA 4DC1A 2G76A 3ONEA 2H9IA 4Q3EA 5ENVA 1CJCA 4RZHA 2BHLA 2P2SA 4IDEA 1LDNA 1LX6A 5FI3A 3WMXA 1QR6A 3LF1A 4IXWA 2XOXA 3PGJA 4IZHA 4DIOA 3KVOA 3QWFA 1UJMA 1DOHA 2VRCD 4CMEA 3H3FA 4XGNA 1UZMA 3HDJA 1ZSNA 2GUGA 3GFBA 3PHJA 3OIGA 4UEKA 1PTJA 1C1DB 3I4FA 4Q3AA 3RAJA 3O4RA 4PGFA 3KSDO 1PJ4A 3QW2A 4J2HA 4EYEA 1YO6A 1M6WA 1PS9A 2EKLA 4JROA 4BGIA 4FC7A 2YZ7A 4CM9D 1LBEA 4K28A 5A4DA 4JLWA 3Q2KA 1T4BA 3G49A 3GN1A 1P74A 2FR1A 3SJ7A 4J1NA 2OFPA 1BGVA 3HDHA 4FBGA 2PGDA 1X7GA 1LDGA 3G0OA 4MJLA 2NQTA 4CMIB 2HK9A 2EV9A 1FDWA 2O3JA 2VWPA 4NNJA 4RVSA 1P1RA 5THKA 4WOKA 4XDYA 4BUCA 2ZYAA 2DUWA 2JD2A 3MJTA 4II2A 4BO3A 1VSUA 3AJRA 1ZSVA 2NU6A 3KUXA 1BSVA 3H5NA 3MJVA 4ZJUA 2QYTA 1RM3A 2JL1A 3L4BA 4ND4A 6LDHA 4YT8A 2PZMA 3PLNA 3G79A 2AQIA 1UDAA 4I5DA 3JYPA 5L7YA 1IZ9A 1U7TA 4DIFA 1EEHA 3AUSA 3G1TA 3SBOA 3LK7A 4J2OA 4UAGA 1R16A 3ZW9A 1LC0A 2YUTA 1Q2XA 1U1IA 3B1KA 2B4QA 2QW8A 4I1IA 3JD2A 1DC6A 3WIEA 5JW6A 1O5IA 2ZTLA 5TGDA 3I4CA 4CMEC 5ES3A 2NU8A 1U4SA 1WMAA 4LGVA 5EJ2A 2PFGA 2SCUA 4XB1A 1SCUA 1VSVA 3OECA 4KUEA 5TS3A 2PGJA 5KTKA 3FNHA 3DZGA 3VH2A 2H6EA 4AJ1A 3VZQA 4WCDA 1NFQA 4MVJP 1N92A 3UFXA 2VZ0A 3L4BC 4Y6SA 4IY1A 3RIHA 1QV7A 1IE3A 1SB8A 1PZGA 4Z9XA 2NTNA 3OMLA 4CL3A 1ENYA 3DFUA 3PQDA 2ZQZA 2VTDA 4XYBA 4JCOA 2CMDA 4Y6PA 3ROKA 3W8DA 3PDJA 3EVNA 4H7PA 4PRKA 3OM9A 1HWYA 3V8BA 4XB2A 4UUNA 4YRAA 4QFCA 4RZIA 3L6OO 4QO7A 1K6JA 3CTMA 1N1EA 1I0ZA 1MB4A 5KWEA 2BI8A 3RBVA 2PV7A 3QVSA 3W4IA 1PGOA 4B4WA 1Z73A 1H5QA 1I8TA 1DLJA 3ENKA 1HKUA 4LMRA 4U6QA 1XSEA 1LLQA 3TQHA 5A03A 1GPJA 3S55A 5IN5A 1T2FA 1T25A 2PH3A 3H4VA 5ITVA 4RPJA 4GWGA 4YVFA 2B35A 4YB8A 3SC4A 3WIDA 4BKQA 4DLAA 4DTIA 1EVYA 1BHSA 5FFFA 4XJTA 5C3MA 1SEPA 3ANNA 4FR5A 3FPLA 5I8ZA 2V6MA 1WP4A 3GVHA 2OL4A 2EJVA 4L74A 4RPGA 5HM8A 3F4LA 3RU7A 3GFGA 3GC6A 3R0IA 1EK5A 4BMVA 4RVGA 4FCCA 4FS3A 5ILGA 4U8GA 1NP3A 4IXTA 1F14A 1P1KA 3EVTA 3TZ6A 5KJCA 3AUAA 1GZ4A 4TRRA 3BMQB 4BL5A 2GR9A 3CPSA 4GMFA 4GPD1 1X7HA 2BFOA 4PCVA 4DPLA 5JMWA 3NDRA 1JAXA 3SC6A 3U0BA 3KB6A 4J49A 4O5OA 4UVHA 2WM3A 1GEEA 3KYCB 1R4MB 1VC2A 3EC7A 4GGOA 3ETDA 3PHGA 2DVMA 3WLEA 1HDYA 1G0NA 3PK0A 1PS0A 2RH4A 1BWSA 1NQAO 3UKOA 1EK6A 2BD0A 4GMGA 1E1KA 3E9NA 3VTFA 3DTYA 3RC1A 1I30A 2HSDA 2HMVA 2VHWA 1KETA 1X1EA 1YE3A 3VZRA 5TLSA 3BTVA 1ZMTA 1E7MA 1Q1NA 3LT0A 2GN6A 1R4MA 3OJEA 3OQ6A 2Y1GA 4FW8A 3C7AA 3ZU3A 3BA1A 2C5AA 3MJ4A 2I3AA 3D5TA 3LU1A 4GKVA 1AN9A 2YYYA 4AJOA 2CFCA 3HZZA 1MXFA 2YDXA 2ZB4A 9LDTA 3ST7A 1PZHA 5JNLA 4FOOA 3ON5A 4ND3A 3PYLA 1ONOA 5T5QA 2ZCVA 4J0EA 2NTJA 3C24A 4CLRB 3GG2A 4MDHA 3HDQA 3BHIA 3O8QA 3OQBA 4L4RA 3OF2A 1YL7A 2G1UA 5KNLA 3GK3A 1LDBA 1NQ5A 2OMEA 4I5FA 4LSMA 4GBJA 1CYDA 3CH6A 3NGLA 1PQPA 2O3RA 1Y5MA 5A9SB 3AY7A 4IDCA 1XHLA 1QRRA 1UP6A 2QZ9A 4OM8A 2C82A 3E6AA 3ADPA 5A9RA 3F4BA 4CMBA 3H2ZA 1VJTA 3RUCA 1UXIA 4GVXA 5JDCA 3HSKA 3K6JA 1R12A 5B12A 3KLMX 4LRTB 2D8AA 5CG1A 2Z5LA 4FFRA 1GUZA 5U4QA 1O9BA 2OP1A 1GCUA 1H6DA 1R6DA 3ETGA 1NAHA 1NPYA 4GX2A 5JAIA 4D3SA 3LLSA 1QKIA 4PLCA 4BNYA 2IZ0A 1DDOA 1M67A 1R15A 1FF9A 1ZSYA 4HFNA 3ZV6A 3DZIA 3O26A 4DYVA 4YJGA 2JD1A 2HAEA 2P91A 3RJ5A 4I9UA 2POQX 1C0LA 3EDMA 4UREA 2JD0A 4XYLA 4WLVA 1B15A 1ZVMA 4C7KA 2AG8A 4ZQFA 2EW2A 2B5WA 3VPSA 2EERA 3WSWA 4E5KA 5JY6A 4XDZA 4B4UA 3FSRA 3DBLA 4XYEA 2EJWA 3GPIA 3QRWA 1N8KA 1C0PA 4FFLA 5AYVA 4UUOA 3GUYA 4NU5A 4NFHA 2NWQA 4I9HA 4L4XA 1T1RA 2AHRA 1C3VA 4J3FA 2EHDA 4BNNA 4BNJA 5CG2A 3ZNNA 2PD3A 3B6ZA 3DHYA 1PQUA 3VPXA 3HE3A 3MJSA 1M75A 5DNAA 2Q2VA 4YDRA 3GNTA 1YVEI 3ICPA 1X15A 1NASA 5EERA 4J4BA 4WJZA 4DC0A 1Y8RB 5A05A 1HYHA 1U2GA 1E3SA 4A0SA 4YACA 4EBFA 4ZQGA 1AXGA 4JBHA 3RUFA 1LLDA 4UUPA 1HETA 2Y0EA 2Q4EA 3DHNA 1GR0A 1NYTA 2H5LA 3OJLA 5BSHA 1DHTA 1JA9A 3AY3A 2GNAA 1LRKA 3IMFA 3KBOA 2VYND 2Q46A 2VQ3A 2ZJ1A 1R66A 3VVCA 1FDVA 1PX0A 1B14A 2ZYGA 2OBNA 2P68A 4PZDA 1ZJYA 5LDGA 3WGTA 4ZD6A 1WLYA 2ZK7A 3EW7A 4CM7A 1OC2A 1VPDA 1GADO 4B79A 5CAEA 3DMYA 2X58A 5JC1A 1ISFA 1QYXA 4JXKA 4EUFA 4FB5A 5DT9A 3JQGB 4I5EA 3WTBA 3WQRA 4Q9NA 3HUDA 4DMMA 3DOOA 1YS4A 1LNQA 2O2SA 4ZN6A 1DRUA 3K2BA 1PGNA 2RH8A 1GZ3A 4M86A 2I66A 3WNQA 1PJQA 2IE0A 4L75A 3RBXA 3S2FA 2HK8A 2VYVA 1E3WB 1D3AA 4MVJI 1JN0A 1EDOA 1XG5A 1JDJA 4AL4A 4CUZA 3FWNA 3GF4A 4BNHA 3GN2A 1P44A 3L77A 1Y7TA 2GN4A 2A94A 1K3TA 5TJHA 3WB9A 4U0KA 3TZHA 1YGYA 4BO1A 3LT2A 4IIUA 3C7DB 4FIZA 1BW9B 2NUAA 3PJDA 1IYZA 1PU2A 2B36A 3FD8A 4URFA 4NBTA 3KETA 5A9SA 4CV3A 1E3IA 3FI9A 4O6VA 4A5OA 2VUUA 3STHA 1P1HA 3NTRA 2CUKA 4M54A 4Q3CA 4D46A 4DRYA 1Q7CA 5KVSA 1V3TA 2AE2A 2QRKA 4ALIA 5I7FA 5LCXA 4KP7A 3WX0A 1DIHA 1JTVA 2ET6A 2V6BA 5G4KA 5IZCC 2AQKA 4HV4A 3FHLA 4PIVA 5DBFA 2BRUA 4HWKA 4E31A 4F6CA 1I3KA 3IL2A 4XR4A 4J91A 1C1XB 1ZK4A 3UW3A 4FJ0A 4CR6A 4KMSA 4PLPA 3PWKA 4PN3A 1GUYA 4BKUA 1QMGA 3WGIA 1BG6A 3JQCA 2C0CA 4DXHA 3GA0A 1M6HA 1X1TA 5TQVA 5CDGA 4MVJF 1W6UA 5CHEA 5I7VA 1O0SA 4FN4A 4R41A 3E8XA 5L4NA 1HYGA 2AA3A 4K6CA 4NZ9A 4EGFA 4A03A 3P7MA 3I9LA 1E3JA 4CV1A 4NJOA 1OC4A 1CRWG 1JU9A 4IJUA 2C2XA 4EJ6A 1LU9A 1YWGO 2IXBA 1BVRA 2BMAA 2PZKA 2X86A 3GEGA 2X22A 2CDAA 4CMAA 5AQ1A 2Z95A 5JYEA 4R69A 1LDMA 1ID1A 2EG9A 1X7DA 2YHUA 4E6PA 3LC7O 2BFMA 3KLPX 3PYXA 4PG8A 1YDWA 2OP0A 2GN8A 4YAIA 3C1TA 4JNKA 4GSLA 3R3JA 3EMKA 1MUUA 4BNTA 2ZTMA 3R3SA 1RM0A 3H65A 3RU9A 5CPFA 2VZ8A 1XA0A 3WGOA 4GGPA 4XQ9A 1HT0A 5C7OO 4R68A 3JQFC 1NQOA 4BNUA 2D5AA 3HDYA 4A73A 2FPIA 2NU7A 1K5HA 1KC1A 2G0TA 4FFOA 4IDBA 2WD7B 1NFFA 1ENPA 2X0RA 4KZPA 3EYWA 2R2GA 4II3A 4HX5A 2TMGA 2GZ1A 4WNIA 4AICA 3FCOA 4HFMA 3ORFA 4WLOA 1T1SA 3EY4A 3U5TA 2J3HA 2G5CA 4U0JA 5THQA 4BMNA 2ZKLA 1AXEA 5CEEA 3KRTA 3PFWO 2O48X 3RUDA 3VVBA 1KVUA 4J43A 2Q49A 3E5MA 3V1UA 1P1JA 4GKBA 4WECA 5JDIC 1CIVA 3GMSA 5IDXA 3U49A 3CXRA 4JK3A 2HMTA 4ZQEA 4AJ2A 1BVUA 4CM1A 5AXAA 3GGOA 1F0YA 1EZ4A 1I01A 1V8BA 3LT1A 3NDJA 3K73O 3PQEA 3S2GA 4RVDA 4IQ8A 2VYVD 2C2YA 3FNGA 3JSAA 3VH3A 5HS6A 4R3WA 1DFHA 4PLYA 1XGKA 1P3DA 4BGVA 1EVZA 3WSVA 5CPBA 2NVBA 3GDOA 5AOVA 5T67A 5CFZA 3VC7A 1MG0A 1PR3A 4PVCA 3PDUA 2D3TA 5KKCA 3ETEA 5B4TA 3JD1A 3AM3A 5BQFA 2W8ZA 5AXBA 3TOXA 4CQMB 4R1SA 4CLOA 3A14A 5EIOA 1Y1PA 4INAA 3S2IA 4BNWA 4TRNA 2IZ1A 3RUHA 3ZWNA 1O94A 3TSCA 4J7XA 1GYPA 4XR9A 1KOLA 3JCZA 1FDSA 1YDEA 5A06A 1B8VA 2VYNA 1D1SA 1WZEA 4CLOB 3VZPA 1E77A 1W8DA 4PG6A 3GVCA 2FR8A 1Z7EA 4N7RA 4EITA 3G3EA 4ZRMA 5COBA 1ONNA 2C7GA 2WYWA 2VZ9A 4CMKA 1YQGA 2RHRA 2NV6A 4FFNA 3AI1A 3D3WB 5FWNA 3AI3A 1HL3A 2B5VA 3LT4A 2OORA 3RBZA 5DOVA 4NIMA 4P4NA 2IYOA 3BYZA 4GLOA 5KOIA 5ADHA 2VRBA 4K9DA 3V1YA 1JAYA 4DIBA 2X6TA 3MOIA 4HADA 4E5YA 3JQ8A 1PL7A 1C1DA 4WLFA 2BKAA 3M2PA 3U4IA 3PQFA 3HWRA 2XXBA 1MC4A 4HBGA 4CMCA 3TL3A 4R5HA 2Z1MA 4OQZA 4OXNA 4B3HA 4IUYA 3V5NA 2CVQA 4PRLA 5G0TA 3GEDA 4TKMA 4LSWA 2X0NA 3PZRA 2H1SA 4Z9FA 3OIDA 4IINA 2FZWA 2X8LA 3JQ8B 1QV6A 3ROQA 3NTQA 5DOZA 8LDHA 1FDTA 3PJEA 4E12A 1EVJA 1C0KA 3SEFA 1XEAA 4JGBA 5COQA 1J49A 4FC6A 4WOJA 5IXSA 4G2NA 4HP8A 4DQUA 4IPTA 1G0OA 1CEQA 4QQRA 4CQMD 1SMKA 4RF5A 3UF0A 4NPCA 2O2YA 1E92A 3U4HA 3UH1A 1O89A 5EQFA 4BS9A 3C1OA 3INGA 1B7GO 3HJAA 2PR2A 3DBRA 3V2UA 1UZLA 2YW9A 4FFMA 4RF4A 1NAIA 3DB2A 4N5MA 1XLTA 1MA0A 1VL8A 3PHHA 5TT0A 3X2EA 4GSKA 1RYDA 2FRDA 3DZHA 1U3VA 3OA2A 1ENZA 3PGXA 5IZCA 4S1VA 3B1FA 1D8AA 3NRCA 1ZUD1 1IB6A 4BNKA 5GZ1A 2JKVA 4AJ4A 4Q3DA 2GZ3A 3A1NA 3UVEA 2O23A 4BO4A 1LJ8A 3BMOB 3DMTA 5HA5A 2RCYA 4GQAA 3CKYA 4P38A 1HDCA 4K1LA 3U4DA 3VKUA 3ASUA 4U7WA 5LC1A 2G17A 3PHIA 1K6IA 1PJBA 2W2LD 4QUKA 3H9EO 5G4KB 5A04A 2YDYA 4NBUA 1ONPA 1LLCA 4NFYA 4W6ZA 4MOWA 1ZZEA 3D4NA 2C54A 4BNZA 1WPQA 1C1XA 1L7DA 4BNVA 3AM5A 2DU8A 4RDHA 3H9JA 5BSEA 2IDZA 1LRLA 1SEVA 5JC8A 3DL2A 1ZXBA 2BFAA 3H3JA 1F8GA 2YV3A 3HFSA 3EK2A 5JCJD 3LZ6A 2X1HA 2J3JA 2DTXA 4BQRA 3LVFO 4YQZA 1LDYA 4CM5A 1WXDA 2Y68A 1GEGA 1TXGA 3FTNA 1SZJG 2W2KB 1ZBQA 4L0QA 2EP5A 1V3VA 3W4JA 4ALKA 5IDYA 1SNYA 3QSGA 1H93A 3IQDB 1U3WA 3OEYA 1I2BA 2VTEA 4LISA 5KVCA 3ZWVA 3UCEA 1Q0QA 3NT4A 5JAZA 3DBHA 1LQUA 1A5ZA 1UDBA 3I9KA 4MVJA 2VNSA 1UXJA 1T2DA 1GFSA 3IUSA 5BR7A 3JYLA 1UXGA 3WGZA 3QY9A 5IJZA 4TMFA 4E3ZA 3BTSA 1VI2A 4D42A 4QT0A 3F1LA 1PS8A 2HRZA 3PVZA 2EKPA 4IDAA 2ZJ0A 4GAEA 2QRLA 3PLRA 4W9NA 2X5OA 1VKNA 1YH3A 3UGKA 4R54A 3QVWA 5DCYA 4JP2A 3LSYA 1SOVA 1EFLA 1K2WA 1ZMOA 2DBQA 5JDCC 4CMIA 1HSZA 3GPDG 4DYDA 2HMWA 1LUAA 3ABIA 3AOEA 3ONFA 5JDIA 4CUKA 4IDDA 1DBVO 3ZHYA 4UVDA 4OQYA 5EESA 1T2EA 3AI2A 3F9IA 4NMHA 1I3MA 4YAJA 3QWAA 3QWHA 3PIIA 5B4UA 2HO5A 2CY0A 2WEKA 5COAA 3JQEA 3KYCA 2PKQO 4E33A 4OSPA 1DC3A 3ONDA 4B8WA 5ILOA 3D4PA 1ARZA 5IXYA 1VL6A 4IM7A 1Q0HA 3WR5A 1IL0A 1XKQA 5U9CA 3VPHA 4DLLA 3TDKA 4YJFB 2J8ZA 3DZBA 2AW5A 5H82A 3ZZNA 1Z6ZA 4F3YA 2HLPA 2ZB3A 2FMUA 2HJSA 3KSZO 1B3RA 2WMDA 1FMCA 1NQTA 1IHYA 4KUHA 1EFKA 5H81A 2C7VA 4XYMA 3ZDFA 5B1YA 1OBFO 4CLRA 4DBVO 1SO8A 3PYMA 4OOEA 1PL8A 4YXFA 1T2AA 3OH8A 3P2YA 2ZIZA 3WTCA 2R6JA 1HE4A 2J5KA 1OZAA 1XELA 1JKJA 2BELA 3NEPX 3TFQA 1DLIA 1TT7A 3KV3O 2YV1A 5F3RA 3L6EA 2NQ8A 3JQFA 1YL5A 2XF8A 4I9NA 4Y98A 2I65A 3PTZA 1H6AA 3PXXA 2D4AA 1UUFA 1PWXA 1VJ1A 2DFVA 1HSOA 1IZ0A 2O3TA 3JV7A 3WGYA 2HDHA 3E9QA 3IDSA 4RQTA 1CETA 2O3QA 4TROA 4LCJA 1JVBA 4LMPA 1ISMA 1HEUA 4ILKA 3L4SO 1IHXA 3GVIA 5DP1A 5EQDA 1XU7A 4FGWA 4QXMA 4KWHA 4X54A 2YV2A 4PZCA 3DOCA 3K30A 2BH9A 3PJGA 3FPCA 3QWIA 3KYDB 2JCVA 2E6UX 5ICSA 4GL4A 4P8RA 3U9LA 3BAZA 1BXGA 1UDCA 4AG3A 2B69A 4MIYA 5JXWA 1U8XX 3Q2IA 2A35A 2D2IA 4J7CA 3TRIA 3JQ7A 4F46A 1PZEA 1I2CA 1GPDG 1G6KA 4LVUA 1UXHA 4XQGA 3FN4A 4W7HA 3BMCA 2I3GA 1SB9A 3M1AA 1I3NA 2DM6A 3VH4A 1HDXA 1O6ZA 4ROSA 1HE5A 4C7JA 2E82A 1DJQA 2HRBA 1S6YA 4A7PA 3K31A 3TNLA 5IZ4A 4B7UA 4ZQBA 5L95A 2JAPA 3QP9A 1D1TA 4TQGA 4BB5A 2Q1TA 1TT5A 2ZTVA 3JQDA 4BMSA 4XCVA 1EBUA 2PGLA 4TWRA 4Y6RA 4B8ZA 2ILTA 4CMGA 3ZHZA 2GZ2A 4WPGA 3UHAA 5TC4A 3ZI0A 1I3LA 3TFOA 3OJOA 4MVJD 4ALNA 2EXXA 3OETA 1NM5A 1DHRA 3WGQA 5L9AA 1E6UA 4XD2A 3RD5A 3DTTA 1QXSA 3CZMA 5JYDA 1XDWA 4Z6KA 4CM3A 3LDHA 3SX2A 5DCWA 1YRLA 2FWMX 3ZHXA 1P31A 2V6GA 3MEQA 3SXPA 3HFGA 4WKGA 1XQ6A 1LI4A 4G5HA 1C0IA 3KM0A 3RKUA 3DONA 4EW6A 3EZLA 3CMCO 3W6UA 2I99A 1R0KA 2YFHA 4L9RA 3PWZA 1V0JA 1E6EA 1C14A 3EHEA 4GLLA 5HBRA 1YJQA 4CQLA 4MKRA 1HDZA 2DAPA 1GZ6A 2PD6A 2CSUA 3JQBA 1VL0A 2X9GA 2JCXA 2O3SA 2VUSA 3HN2A 4IJKA 2W2LA 4A2CA 4A26A 1SC6A 2Y66A 4BNXA 3FNFA 3ZWPA 2E48A 3A28A 3ZV4A 3JD3A 3SVTA 4OOFA 4BGEA 1H6CA 3VOSA 3UOGA 1ZXLA 1P9LA 2NVWA 5G0WA 1RWBA 4GI2A 4NU6A 5I9MA 1E6WA 2D0IA 2NVUA 2P9GA 3GNQA 2UV8A 4R3NA 1YB4A 3GLQA 1GQ2A 4RJTA 4WLEA 3DWFA 4Z3KA 5KJ1A 5L7WA 4MIOA 1DIBA 4XQEA 4GWKA 1DIAA 1TA4A 4QFDA 2ZQYA 4OXKA 1EE9A 1BRMA 1PGJA 1BXKA 1CQIA 1L1FA 3UN1A 5IF3A 1IUKA 3KHUA 5BSGA 2QX7A 3N7UA 1PJSA 1R0SA 3VDQA 2HMSA 3AWDA 2NACA 1H2HA 3SLGA 4EUHA 3TF5A 4J4HA 4CLEA 1WNTA 3RUIA 4ESOA 4YT2A 4YJGB 3ZHBA 5KJ6A 5EMHA 2PWZA 1YL6A 2FPPA 4D7AA 4XZ3A 5HWSA 2RIRA 4BNMA 3KYDA 2JHFA 5C37A 2FOIA 4LRSB 2VOJA 3ZWCA 4CM4B 2P9CA 1RPNA 3DZFA 4CQMA 4D43A 1T2CA 3K92A 1DRWA 2WE8A 1W4ZA 2PZJA 4YAKA 3GDGA 3CZRA 1I2ZA 3S1LA 3PP8A 1S7CA 4BV8A 4D3DA 4FOSA 4NJMB 5G0UA 1BDBA 1BXGB 1U5CA 3I5MA 3NJ8A 3DAPA 4E4YA 3GR6A 2X7HA 2NSDA 1RM5A 3DBHB 4XQCA 4HKTA 3AOEC 1U7HA 3GVXA 4RPLA 4CM4A 3K8ZA 1IPEA 4GX1A 1Q7BA 4TRJA 6ADHA 1AHIA 3KSUA 3GGPA 1YKFA 4R5MA 3DAGA 3K2EA 2X9NA 2Y0DA 5F5LA 1N7HA 2X5KO 5BNIA 1QP8A 2PKRA 4L4SA 2FR0A 4MKXA 4S3MA 4M87A 2O4UX 1FJHA 3U4CA 3GAFA 4NBRA 3WDSA 4DUPA 3FWZA 1H6BA 1OI7A 2OGUA 1V9LA 4FFPA 3ZNQA 1HLPA 4MVJM 4YJHA 1O8CA 2ZB7A 4D79A 4CMHA 3E5RA 3I3OA 1KC3A 4ONEA 4O0LA 5B4VA 3C8MA 5JAMA 4N18A 4HFRA 3ULKA 2Q2WA 2UVDA 2Y67A 3ENNA 2C5EA 3WQQA 4GVLA 1JWAB 7MDHA 1YXMA 1U3UA 3MTJA 4DQXA 5I9NA 4JJFA 4Q3BA 1LSJA 4B3IA 3OA0A 1DEHA 3QVXA 3BTOA 1A9YA 2ZYDA 4AJEA 4EDFA 1YBAA 3QV1A 2JFHA 2UUOA 4PLVA 1LQTA 2AEFA 1SPXA 5DF1A 5MDHA 4WK6A 1JLLA 2NLOA 2GSDA 3E82A 2RBEA 2TMDA 3GDFA 2ZB8A 4ALLA 3W8EA 4D3FA 2YHIB 4J7UA 4WEQA 2PTGA 3I52A 2GCGA 1AUPA 1B0AA 3I9JA 4ZHSA 1UH5A 1CWUA 1X14A 4XYGA 4D0SA 4YAEA 1ZEJA 3QJ5A 3WS7A 2Q4BA 4WCFC 3RJ9A 1E7QA 1UP7A 1YQDA 4NFSA 3D0OA 4IJVA 4NR0A 1LA2A 3MCVA 4CQLB 2WDZA 2FHSA 2GN9A 4AJPA 2NTVA 4KTVE 4CPDA 1B26A 2IYPA 1VKOA 3GEMA 2FN7A 1DIRA 2GASA 3G1UA 1ZCJA 2VRCA 1E3LA 1D4FA 1GY8A 2CF5A 3RUAA 4IQ0A 3BMNA 3W6ZA 4ZGWA 3DBRB 2B0JA 1YBVA 4CLDA 1E3EA 1HZJA 3M1LA 4YRBA 3PIDA 3MOGA 1PEDA 1WVGA 5JE8A 1RKXA 4XRGA 3JQAD 4P22A 3RFVA 1FXSA 4CJXA 4CLHA 1NR1A 3JYOA 3NTOA 2VT2A 1YJ8A 1DFGA 2GD1O 2DBZA 2W98A 4CODB 3VAZA 2GO1A 3DBVO 2X23A 4QTZA 3AUUA 5JY1A 5MGBA 1WDKA 5ER9A 3L9XA 4XX0A 3HG7A 1NTOA 4ALMA 4JJIA 5LDHA 5L45A 3OQ1A 3H7AA 5IFLA 1KEVA 1P33A 4U5QA 1HDGO 1DIGA 3Q9UA 1EVIA 2AQHA 5TRTA 2DBRA 3IC5A 1NFRA 5HRUA 3MJCA 3FR8A 3DZKA 3CE6A 1A4UA 1V35A 4PLZA 4CM6A 1GYQA 2J5RA 4BGUA 4NJMA 2GERA 1DPGA 3UXYA 4NQZA 2DPHA 1ZNQO 4YAGA 4AFNA 2ZATA 1YBMA 2PD4A 1YB5A 4ZRNA 4Y8VA 5EINA 5FF9A 2Y1DA 3T7EA 4MVJG 3RC7A 4MINA 1XR3A 5AXCA 3UCXA 1ISIA 1HDOA 3ITDA 3NJ4A 5F5NA 3Q0EA 3SJUA 3D3EA 1JKIA 2B83A 4RV9A 3I1JA 4UEJA 3IS3A 2AEMA 5J23A 4HY3A 2P9EA 1LTHR 1MLDA 2C29D 3WWYA 1UR5A 3BIOA 4B7CA 3RI3A 1YOVB 1GAEO 1HRDA 1PJCA 3QIVA 2B37A 4BNGA 2Y1FA 2F1KA 2RHCA 4W7IA 1NVGA 3C1AA 4PVDA 4WEOA 4KDEA 2IRWA 2CF6A 1DJNA 2Q1UA 1BXZA 3JD0A 1WDLA 5GMOA 5T6BA 5GZ6A 4B4VA 2R00C 3VPFA 3H6KA 1EUZA 4IJWA 4TVOA 4OMUA 2VWHA 4U6SA 1H94A 4K6FA 3HNPA 5C7IO 1Y8RA 7ADHA 2HMUA 2WD8A 4YBZA 1EMDA 1I5RA 5CEJA 3GOHA 2NM0A 2PZLA 4J4TA 1MG5A 4PZEA 2OBYA 4XKJA 3TZKA 3GZNB 4CM9A 1F06A 4D45A 1FK8A 2J5QA 4OO3A 4WNCA 1N7GA 5L4LA 4PG4A 3QLJA 5B37A 3N74A 4FJ2A 4RLHA 5KJFA 4UVIA 1ZO8A 2NVUB 5IG2A 1QYWA 1PJ2A 3EUWA 2XAAA 3IP1A 3Q11A 3ANMA 5FI5A 1X13A 5CDTA 2CDBA 4XWYA 2I9PA 4TRMA 1HE2A 4H3VA 3TOZA 3WICA 4XGKA 4E5NA 4ZQHA 2DFDA 4UVGA 2JFFA 1XWFA 2CDCA 2DTEA 1BDMA 4BVAA 1NR7A 4F6LA 1ZKMA 4MVJH 2VT3A 3DXFA 4QEDA 1R37A 4JP3A 3LYLA 4RORA 2BFPA 4LN1A 4CMJA 2Y99A 1MX3A 3GVPA 3WG9A 3D7LA 4QECA 2D59A 2AE1A 3W1VA 3H2SA 2EKQA 3K96A 3L07A 3B70A 3PWSA 1Y81A 3D64A 2WSBA 3NGXA 3P2OA 1BW9A 5U1PA 2VHZA 3ZW8A 3KZVA 2UAGA 1Z45A 2Y1CA 4BO7A 1GCOA 4F45A 3WFIA 1HE3A 1WW8A 3BMNB 3OJFA 4J6FA 2R00A 4KQWA 4M1QA 5JCJA 3ZNPA 3KOUA 2CZCA 3CMMA 3RC2A 3JTMA 3ITKA 3TN7A 5C5IA 4I8XA 1YQXA 3OHSX 3PJFA 1DC5A 4IIVA 1ORRA 3D1LA 4MVJE 5DP2A 4UULA 2O4CA 2DTDA 3HB5X 1GTMA 3GMDA 1E0DA 4IQGA 4MP6A 5L7TA 1W73A 3ZWXA 3H8VA 1E5QA 4ALJA 5FYDA 1V3UA 1KYQA 2IZZA 3LC2O 2Q50A 2V65A 1KEWA 1QORA 2FPGA 2GGSA 4WLUA 8ADHA 4E21A 5GZ3A 4LCEA 3RVDA 1KY4A 3WYEA 3Q9NA 3PFFA 5JSFA 3GH3A 4N54A 3GRPA 1GD1O 1LLUA 5L3ZA 5TNXA 2DLDA 1BTOA 2X0IA 1H9AA 4I5GA 3RASA 4DLBA 3RQSA 1X0VA 1WZIA 1XU9A 1NX6A 3RFXA 5BNFA 3RC9A 4BNLA 3WLFA 3AW9A 4D0RA 3EAGA 2BGKA 4WASA 5IDQA 3OJ0A 4IBOA 4ND5A 4ZVVA 2B4TO 5A5EA 2OXIA 3ZWMA 2HU2A 3P5SA 2Y05A 3NDIA 1HTBA 1LSSA 2X9VA 4QX6A 4IDGA 3W8FA 1DC4A 3Q1LA 1A7AA 1KIFA 1YB1A 1Q0LA 1ENOA 1BMDA 4RDIA 4ZICA 1TEHA 5TJ9A 1ZK0A 2Q2QA 1MP0A 3PEFA 4YPOA 3QVTA 1WMBA 2I5PO 3IJRA 4NBWA 4PG7A 5EN4A 1AE1A 4MP3A 3GAZA 5G2OA 4MIEA 5IN4A 3EGOA 4UVEA 3N58A 1VLLA 1DSSG 3S2EA 5F1PA 3RKRA 5DZSA 1YOVA 1PJLA 4BOYA 4R1UA 5BT9A 3WGGA 1ADBA 1V6AA 2WE7A 4YJDA 5ITWA 2FP4A 1GV1A 3ZWYA 2Y1OA 4J9VA 4R1TA 3K9QO 4RVFA 1AHHA 5L51A 1VM6A 5JO0A 2WWRA 3AU9A 3CUKA 4IMRA 3MWEB 2EW8A 4ID9A 3HQ4O 1N5DA 5I7SA 3MJEA 3INRA 5JLAA 5L53A 4GX5A 1NXQA 4HNGA 4EUEA 3U09A 4JX8A 2BLLA 3X2FA 3KTDA 5DCUA 3U3XA 3COSA 3A06A 4TVBA 2PA3A 1QG6A 2UUPA 3KO8A 4CM8B 5CP8A 1H0KA 1VRWA 3RCBA 3ZWOA 1UAYA 4Z9YA 2X5JO 1MFZA 1MFPA 2CVOA 1UP4A 4IGFA 4L8VA 1ZK1A 5TF4A 5KKAA 1ADCA 1J4AA 3T4EA 2HJRA 3WNVA 2DKNA 2PY6A 3NV9A 1B3BA 3GY0A 1E7YA 4BO9A 3IJPA 2CD9A 2FZEA 2VN8A 4DA9A 3ZU4A 3NT5A 3TL2A 1JWBB 1QLHA 3E18A 3I83A 2QIOA 3FBGA 4G65A 1GUFA 3FF4A 4RPKA 2D1YA 1IPFA 2GPTA 3UAGA 3E1KA 3GRKA 1PWZA 4L76A 1JKFA 4B4OA 4WCFA 5DDIP 3AOGA 4Y9DA 5CDYA 4ITUA 3D4OA 1P0CA 3JQ9C 1PGPA 3VHRA 4YT4A 4UUMA 4RO0A 5EL0A 3ZNOA 1B8UA 2DQ4A 1ZEMA 5JO9A 1KVQA 4BO5A 1A27A 2GDZA 4BO2A 3GUCA 1LDEA 2OUIA 2W4QA 4DMLA 5KJEA 3DAFA 3UCFA 4NK5A 1KS9A 2Q99A 3V2HA 2QHXA 4E5MA 3ZN2A 2O50A 1GQYA 3INTA 4WCFB 2E49A 2IXAA 3AK4A 4DBZA 2YY7A 4R16A 3RWBA 4HNHA 3S8MA 2A4KA 1PZFA 4DGSA 3JQ6A 1F8FA 4OSOA 1U3TA 3AY6A 3CINA 2JFGA 1EUDA 1XCBA 1HYEA 3H9UA 1EQ2A 1TB4A 3AFNA 1ZIDA 3HB4X 3I9OA 1Z82A 2GF2A 3B1JA 2Q1SA 4NI5A 4E2ZA 3FTPA 4DPMA 2ZCUA 2HKIA 4MP8A 3WXBA 3BHMA 2C59A 4PG5A 4FGSA 5F1KA 3ZH2A 4E2WA 4IZIA 1RJWA 3F5SA 3I6IA 3H9QA 4OH1A 1MXHA 3DMTC 2Q1WA 2W90A 5DULA 4E2YA 1TT5B 1UZNA 4JQCA 1LXCA 4BQPA 3BTUA 2NNLD 1SAYA 2X0JA 5K6AA 4YEDA 4FSHA 1NBOA 3FNEA 3HHPA 3E9MA 1GQQA 1N9GB 4DQVA 4LW8A 4NG5A 1IOLA 3A9WA 2GRAA 4E0BA 3GGGA 1LRJA 1M2WA 1UXKA 4R9RA 3FRJA 4RPHA 1KVTA 3DO5A 3PZBA 4DL9A 3DEYX 2QQ5A 1DB3A 3GZ4A 4PLTA 4KWIA 4NH4A 1HLDA 4CR7A 2C20A 2HK7A 4YJHB 1HF3A 3HADA 4E13A 3AUTA 5G4LA 2PNFA 2OHXA 5TIIA 4BHTA 1IULA 3GHHA 1G1AA 2Y93A 1F17A 2EGGA 2CVZA 3L6DA 3M2TA 3P19A 1O95A 4R4JA 1W0CA 1D7OA 3R1IA 1Y8QA 4JBGA 5I7EA 5ICMA 1A9ZA 1ZH8A 3A4VA 3WJ7A 4CUJA 2P5UA 1ISGA 2Y1EA 3LLVA 1GV0A 1E1MA 1I36A 4PFJA 2QZZA 2PK3A 4DVJA 3RROA 2I6TA 5L40A 1KEUA 2VHVA 2P4HX 1M66A 2WYUA 4BKRA 1NVMB 3VDRA 4OAQA 1ML3A 4CV2A 1R0LA 3HN7A 4H16A 3C85A 3ICCA 1R4NA 3WGHA 5AXDA 2UYYA 1U8FO 3RFTA 2YHIA 1N2SA 4RVUA 1DAPA 2O3UA 4PLGA 3T4XA 1N1GA 3CEAA 3WBFA 1SOWA 5FEUA 2PLAA 1PR9A 1EUCA 3L9WA 3C7CB 3F47A 3TPCA 5K9ZA 1L7EA 3VKVA 3KEQA 5A02A 3FR7A 5T8KA 3V1TC 3IP3A 4UEOA 4Z3DA 3O8QB 3JQBC 2YFQA 5F1OA 3SLKA 4MPDA 1EBFA 2AEJA 1U5AA 4RLSA 4WE3A 4E30A 2YJZA 1CQJA 4M8SA 2JAHA 3V2GA 3VTZA 4CLXA 2DPGA 1X0XA 4J1TA 1PIWA 3QQPA 4PLWA 4Z0HO 3AM4A 3W4KA 4FD3A 3GHYA 4KTTE 2O7SA 5A3JA 1TI7A 5ER6A 3BMCB 1H2BA 2XPCA 3F5QA 4O63O 3ZV5A 2HCTA 3WJAA 4B3JA 4B7XA 3O38A 1MV8A 1JW9B 3Q3CA 3OP4A 2JHGA 1KEPA 2C07A 1HXHA 1RYEA 2DBVO 3C3XA 3GT0A 1J6UA 4J0FA 4J9UE 4QO8A 5DN9A 1NPTO 3DZJA 3D3WA 3DR3A 1Y6JA 3LQFA 3MZ0A 3DHEA 4D41A 2IEBA 4RGBA 4ZA2A 4OJNA 1UAGA 2P4QA 4AJIA 4K26A 4OYRA 5JS6A 2OZPA 3DOJA 2BGMA 1K0UA 4A27A 4BO0A 1KERA 1ISHA 1I10A 4MO2A 4KQXA 3ZGYA 4JIGA 4JJGA 4XEHA 4QSMA 2Y0CA 1DAOA 1KY5A 3PHLA 2EF1A 2RAFA 2AQ8A 2VWGA 2WJPA 4RF3A 1VJ0A 3NX4A 4IDFA 4EZBA 1GDHA 2NU9A 3E48A 2ZTUA 4HXYA 1ADGA 4AJNA 1T24A 3BMQA 3DBLB 1U4OA 2HQ1A 1QLJA 2A9FA 3OFSA 4BNFA 2V7PA 1NWCA 2VNAA 4P4LA 5K0ZA 2WD7A 3DFZA 5G0SA 5T8KC 1WDMA 4JN6B 4R9SA 5H83A 4EI2A 1RM4A 4TKLA 4ZU3A 3PI7A 2DT5A 4IS2A 4YTEA 1HZZA 4TZTA 4OKNA 1J0XO 5G0VA 2X4GA 1XIVA 3WYCA 4EEXA 2J3KA 4DREA 1FDUA 1N9GA 1P45A 1E5LA 3T7CA 4RF2A 3PPIA 1E1LA 5KVVA 1JVSA 1PSDA 2E37A 4WUVA 2LDBA 2OOSA 1GYRA 5BSFA 4I08A 4J90A 1SBYA 1NWHA 1Y8QB 3NKLA 1A4IA 1KVSA 3ZWBA 2O7QA 3AU8A 2YQ5A 4AJHA 1PL6A 3WQSB 1XQ1A 3BHJA 4XA8A 1I33A 4GH5A 4XJSA 1VE9A 4D44A 1JQBA 3JQAA 5IAAA 2GYYA 4XIYA 4R1NA 1A71A 4AJKA 3JQ9A 3RSHA 4H15A 1Y9AA 4IS3A 2WTBA 3R6DA 4OIMA 3VZSA 4E32A 3IOYA 3ZU2A 3K5PA 1WWKA 2I67A 4M49A 5ENDA 1T26A 2AG5A 3JYNA 4RL6A 4XRRA 1GU7A 1PJ3A 5A1TA 1NPDA 2H63A 5A5FA 3H5AA 1E1NA 4PLHA 3MWDB 5JBIA 1QYDA 5T57A 2E4AA 3LF2A 2JCYA 3JQAB 4AVYA 5K6AC 1ADFA 4W82A 3ROMA 4NK4A 4AJLA 1E3WA 4NHEA 4C4OA 4YWJA 2VUTA 4J1QA 1MGOA 1H9BA 4RCVA 2QYSA 3TJRA 2QG4A 1WAMA 3WOHA 1P1FA 4G81A 5F21A 5JAQA 1P1IA 1ULSA 2B4RO 2JJYA 3TZQA 3JD4A 1M76A 5KCZA 3IUPA 4YCAA 1IY8A 3GQVA 1E7SA 2EEZA 3DDNA 4R51A 4Z0PA 1LEHA 5JMPA 1CERA 5CDUA 4BIIA 1NVTA 2EIHA 3F1KA 3ZWAA 5HTOA 1ZW1A 3I9NA 3U62A 4Z0TA 2WYVA 1LSUA 3DQPA 2W2KA 4RQUA 3ZCXA 3ADOA 4HUJA 4E5PA 2Q3EA 2VHXA 3WWZA 3O03A 2YQ4A 1EE2A 1A72A 2J6IA 4L73A 2F00A 2HUNA 4CV0A 3QA9A 2G82A 1E7RA 3E03A 4MKZA 4W99A 3ANLA 1YONA 4NBVA 3UUWA 1EDZA 2QRJA 3OIFA 4IGEA 3ROPA 2D5CA 1MC5A 3M6IA 3KXDA 4XIJA 4O59O 4KDFA 4BKPA 3O9ZA 1NHGA 2AMFA 4O1MA 4Q3NA 1ULUA 1OMOA 2AXQA 4W4TA 1B16A 4CR8A 4KOAA 4YQYA 3F3SA 4EJ0A 3NT2A 5L4SA 4ND1A 1I24A 4OL9A 3ZU5A 2NADA 3OBBA 4EJMA 4LK3A 4R01A 9LDBA 2EGHA 5I8WA 4Q39A 1TVEA 4P4GA 5KVQA 2FY8A 5KIAA 3RUEA 4YA6A 2DUUA 5DBGA
chains in the Genus database with same CATH superfamily
2H1HA 4GX0A 2J7PA 2VSNA 3E61A 4W1RA 4LX8A 4QDOA 1TZCA 4BB6A 4E46A 3J7AC 5MF6A 4P08A 1ES9A 4HRAA 4OI0A 3BXXA 1SWWA 4M89A 4DQDA 3B20A 5DBIA 1D2EA 3G17A 2QD3A 2IKSA 2MINB 2VXOA 4KWTA 4B8YA 4DMGA 1K6XA 2Q1YA 2HCBA 1QSGA 1JJ7A 1Q21A 4KN9S 2GJ8A 1SQFA 4LRQA 4TTIA 4CM8A 1FSGA 2ZJ3A 4YJFA 3TIVA 3AEZA 3VPGA 1F6BA 1PUXA 1ZMBA 4J07A 1Q20A 4RFVA 3T95A 3QHAA 5B57C 2DR2A 1SCJA 4JBNA 4Y1RB 4F97A 3WYBA 5ENZA 4LHEA 2WTMA 4PC6A 4YRIA 2CL5A 4KQIA 2LCIA 2V3VA 5E4YA 2QD1A 4TTRA 2PGOA 2AK3A 2BCEA 3T7TA 4BJ1A 4AJJA 5JASA 3ZJTA 3A6EA 4OKIA 3U1BA 3I01M 1GZVA 1RWPA 5AJWA 4ON9A 3CQ9A 3KX2A 4DSAA 4DA6A 3NC4A 4UARA 1PJ8A 3BGWA 3W2TA 3U3JA 1YV9A 2XCRB 1I2AA 1DXHA 1YR6A 5CLQA 2ACEA 5ULLA 3ZXIA 3HYCA 1DRVA 1Z7BA 1V9CA 2ZR9A 3WWEA 4NBSA 5J4HA 3TLKA 3UB3A 3C5VA 5FUBA 1XQXA 2AOXA 1O57A 1XMPA 2W2TA 2ESRA 3A3YA 3NR2A 4R0MA 1R4NB 4A0RA 2TRSB 3WL6A 2FH5B 1CS0A 2CLHB 4DWVA 3EZXA 2VH2A 3KUCA 4NESA 3VR4D 3ZZ0A 4GOKA 3C7KA 2O57A 2P5YA 4TLDA 3ZY2A 1N5KA 4WOBA 1JTEA 1T4DA 1NY5A 2HLNA 1T3GA 5EIWA 3VU9B 2H7VA 4MR9B 1H9CA 2ZPTX 3I39X 4QAJA 1PQWA 1WVIA 5AD1A 5EZYA 4PC2A 2WJYA 1T43A 4CF6A 4ZGGA 4R0VA 1TKBA 5FBWB 1VG9B 1KP3A 2WU8A 3OG9A 4MXDA 3NYWA 4YRPA 5LQSA 2A9RA 1T9ZA 2VPZA 4FYKA 4E22A 4P5EA 5TT1A 3SXUA 1CK4A 1W5BA 4QYSA 4X44A 4FDAA 5F9MA 4MV6A 4G5GA 3AHGA 3D6AA 5HIJA 5AM2A 4D3YA 2XECA 3FCSB 5DI9A 1Z62A 4BX9A 4DA0A 4C3OB 5KX5B 4F91B 2W2QA 3UWDA 4MZDA 5LQAA 3T5TA 4BO6A 4DDMA 1NN1A 1JFLA 2PPLA 3CZ4A 4X6XA 1NHWA 1W94A 3RSQA 3V00A 3LX6A 4YDSA 4CEJA 1U28A 2LE0A 2XXJA 4R1LA 1N1DA 4YQFA 1S7GA 4BYMA 4R8SA 5LQKA 2I55A 4FYWA 1NW9B 3CIFA 4HCJA 3ZQ6A 4TKZA 4YUVA 1LSOA 1TFRA 1OFGA 1PLKA 5DYNA 2XCUA 2WLTA 4BEJA 4EJSC 3F46A 4OJKA 2RGBA 3P4XA 4KUGA 2XB4A 3IUJA 5KNDA 2YXBA 2BN4A 4C76A 5EZYF 5IDWA 3WL5A 4YT5A 3HKCA 1RLOA 1GTZA 2VJCA 4FPXA 2WHRA 1KGSA 1GGMA 3B2EA 2GBCA 3D5QA 4TWIA 5GGYA 5BVGA 2XYGA 4CFZA 3IRUA 3M49A 3OZWA 4MUIA 5E0KB 2ZBEA 2CJWB 5TSDA 3ZHUA 3SQXA 4NYIR 2BEVA 4PLFA 2ZPAA 4M38A 4CEJB 4J1SA 4GYWA 3OICA 2EWMA 4X1IA 1IXSB 1NW6A 2ZQ5A 4Y9TA 3LOQA 4HFJA 1N2CA 4TSKA 4WXHA 3TRDA 3KYBA 3WLOA 5BXYA 1E2BA 5JCXA 2B1IA 3QLVA 1G20A 4FE7A 1V16B 2OV8A 4FOPA 1JR3A 3KQNA 2JH8A 4DC1A 2Q21A 1WSAA 2G76A 3GRFA 4QDTA 2H9IA 2WPDD 3HHEA 5CA0B 3H1EA 3OZXA 3T52A 2VDPB 4AYTA 4IDEA 3KLNA 4RBNA 3FF1A 5AJUA 4BBPA 2PRIA 1R6AA 5FI3A 3WIUA 1ZBDA 4IXWA 2XOXA 5KINB 1JZTA 2BGTA 4X7MA 3EFBA 4C78A 1N5MA 4JI5B 4EELA 5BV1A 2YHSA 3R77A 4AZ0B 4LYGA 3C4VA 4CMEA 3H3FA 3GFBA 1PTJA 1C1DB 3KHSA 4Q3AA 3RAJA 2HOQA 5EFZA 1EDBA 2J0VA 3I09A 1W5FA 4PGFA 3RRNA 4CIAA 1KTIA 4LQ4A 621PA 4TKUB 3PGKA 5B3AA 2VNIA 4FC7A 5GV7A 3TBFA 2IE8A 5BRAA 4CM9D 2HI0A 1LBEA 1I7PA 1E0SA 3BXFA 4K28A 3THRA 3ZLVA 4DLNA 3IPAA 3Q12A 3KSAC 1PLJA 1XT6A 3KDPA 2YC2C 2JLXA 4JXXA 1P74A 1Y7LA 1TYCA 2OFPA 2RI0A 3OPVA 3SN6A 4DLTA 4KLNA 4EVQA 4FBGA 5IH7A 3MGCA 2IS1A 4DXAA 1LLFA 1MT3A 1X7GA 1JALA 1Y4DE 1GPH1 4IOKA 1HH4A 3T94A 1II8A 1PSZA 3OCYA 2XNKA 4JFRA 1T0PA 1LBTA 2AN1A 2VWPA 4MI1A 2Z6AA 1WNFA 5GGXA 1QB7A 3F6PA 4HZGA 2BI4A 4WOKA 2ZCJA 4GQBA 1USKA 4BUCA 3RT1A 4BCDA 5FUVA 1J7JA 1DTWB 3ZIDA 4QTXA 5CFLA 5AW2A 2IGTA 4WSOA 3FSEA 3RS2A 4EKYA 1ZSVA 3G2PA 4EMSA 3EIHA 2NU6A 3EIXA 3FM9A 4R8RA 1FUUA 1XTTA 3E8SA 3H5NA 3A7EA 1HZZC 2A0XA 3OZDA 4MITA 4B6OA 1NP6A 3AHHA 1NMZA 3N8HA 2ZR8A 1ICEA 3IEUA 1WX1A 1IZYA 5BN4B 4EGSA 1N2JA 3TLXA 4YT8A 4XSVA 6LDHA 2Q3BA 5KJ6A 2IBTA 2FSIA 1J21A 1TO1E 3P0FA 2PJRA 1RHRA 5L7YA 4UZFA 1ADJA 1U7TA 4DIFA 3LK7A 1VYTA 2J87A 4EH1A 4J2OA 1BEUB 4KRGA 1XZKA 4DCCA 1CUXA 1R16A 1LC0A 5EZYB 5AM5A 3BA6A 4I1IA 2GK3A 1L5LA 3WIEA 3UXMA 3TLAA 3PKJA 2AI1A 1ZAKA 2DHEA 2ZTLA 3NOXA 3VU1A 4CMEC 3KB8A 3YASA 4CF5A 5ES3A 3IV6A 2ZWPA 1U4SA 1UJCA 5DHAA 1SCIA 2XMBA 1WMAA 3M33A 3G13A 5TMDA 5J47A 2R6AA 3CH7A 3LY8A 2VF7A 2YJTD 2IKQA 5D7BA 3EZFA 2NZJA 3DZGA 3UMSA 5DTQA 3DKIA 2X14A 1YS9A 2BCJQ 4AJ1A 1ULTA 4JI3B 3SKVA 5D5HA 1S8NA 1NFQA 1O96A 3HJRA 3KHKA 4ZTZB 1Z18A 1SWVA 2VZ0A 3SSOA 4C4TA 1M2NA 4Y6SA 2XCTB 5JXHA 4UDOA 1QV7A 4Y2QA 4LOLA 3O2QB 1EX9A 4NE7A 4B46A 4RC9A 3BF8A 4YJ2F 1WY7A 3LC0A 5EMLA 2NTNA 2VAVA 3EE6A 4L15A 1D9XA 3HYNA 3VGJA 2BC9A 4C4RA 1ENYA 4HYYA 4H1TA 1PFGA 4JIMA 4RTLA 5JNVA 5LYJB 4QUHA 4O8CA 1U3CA 3M3PA 4XYBA 5C1OA 4JCOA 3T3OA 2CMDA 4TWAA 2EZ4A 4IIXA 4XFKA 4Y6PA 3H42B 3PDJA 3ROKA 4DM7A 1OWNA 4KQ6A 2YCLA 4PRKA 5LJIA 4DIDA 4KR2A 2A9KA 4Y3UA 3UMYA 3FLAA 4YRAA 4QFCA 2JFZA 3NM5A 4YALA 4DWJA 1KY2A 2KMLA 1AG9A 1I0ZA 3AESA 4IVRA 4R9VA 4E6EA 2B5OA 1KDVA 3TDNA 3RBVA 2ID8A 4AZWA 4DDUA 2IVZA 2GX6A 3E84A 3IV7A 4B4WA 5B3KA 1H5QA 4JUFA 1DLJA 2YMQA 4FILA 1HKUA 4LUCA 2G6TA 1XSEA 2BEUA 4ESEA 5A03A 1GPJA 3JWIA 3ABSB 3QFRA 3S55A 2BEKA 1YKGA 3H4VA 4K6OA 5JUWA 2BHSA 1XVVA 2FSVC 1N77A 4RPJA 4YVFA 5C53B 1OLUB 1E32A 4YB8A 5CT5A 1R0ZA 4BCCA 5JNWA 5FFFA 3HNRA 3O8LA 4MO9A 4UXIA 4X91A 4RM2A 4DIEA 4QYWA 1CP2A 1VBKA 2V6MA 1QFSA 3IUYA 1F0PA 4M1SA 2EJVA 5FL7A 2J7PD 3NHRA 3G9XA 3F4LA 4QPNA 3RU7A 1XTQA 5BMVB 2QTMA 2JARA 2FQ1A 1Z4MA 3GC6A 4OFZA 3MS2A 3RW9A 3QEMA 4BMVA 1X1AA 4FCCA 4FS3A 5ILGA 4LJ9A 4IXTA 5CA1F 1F14A 5LA6A 3NLLA 2AFHE 3TQQA 3OX3A 5KJCA 4BL5A 1E0KA 2WJGA 3CPSA 1FDOA 3LWZA 3IESA 1EA5A 4GMFA 3PUHA 4OQMA 3K6SB 4BAUA 4C0WA 1F4VA 1ZN8A 1JAXA 2QTNA 3PEEA 4OHKA 4MAMA 3U0BA 3WL8A 1YR8A 4B9EA 4DG9A 2YVLA 2WM3A 5BV7A 2YVQA 5LQCA 2YUIA 1GEEA 3VYTB 3W1EA 3EMDA 1K27A 1T36A 2ZSIA 3SP1A 3HXLA 2DVMA 2EHJA 2QVGA 4M3NA 2Z6VA 1P9RA 1UFOA 3OFNA 1G0NA 3BQNB 4LX0A 2VSFA 2RMKA 3OX4A 4H4CA 1PS0A 4XM2A 1MJNA 5DT2A 3FBWA 5DX8A 1PT9A 1G8JA 4K05A 1XD9A 3CB4A 1D6JA 1GLVA 3DTYA 4QYIB 3T0FA 3VTFA 3PDIB 4JQYA 1I30A 3QW4B 4GXNA 4RV4A 4EJSB 1S4QA 1GQOA 1CY4A 1GVNB 3VZRA 5TLSA 3Q8MA 1W0KA 4OB7A 1KJQA 1B1AA 3INNA 3SD7A 3TYXA 4ABYA 4HJRA 1E7MA 3LT0A 3NIWA 5IEBA 1R4MA 4N7JA 1PWEA 3OJEA 3OPNA 4FW8A 2V7WA 3BA1A 3MJ4A 3WE7A 1AN9A 2FUG1 2YYYA 1T9AA 4MS4B 4WZAE 3ND8A 4AJOA 1MXFA 1Q11A 2FPIB 2ZB4A 5FHRA 4YMHA 2OCKA 3CGGA 1E9FA 2QYHA 3LQ4A 2XOEA 4BRZA 4LIPD 1IM5A 3QE4A 2H2DA 4XIIA 1T0JB 3AL0C 1W19A 1ZM3A 2XUFA 4P9NA 4REQA 3PYLA 1U3FA 1ONOA 2ZVDA 1W5AA 2ZCVA 3DLIA 3K7EA 1Q0ZA 4LZNA 3C24A 4PR0A 4RESA 4JLSA 4X41A 4WBXC 4R1MA 3LA8A 1T3HA 4LYJA 1BIFA 4MICA 1S8OA 3OQBA 4L4RA 5HBGA 3OF2A 1TMGE 3T99A 1G55A 1T0BA 3A6FA 3GK3A 5E2IA 4EFDA 5C8YB 5AVUA 4DV3B 2P3LA 2O2HA 5HR5A 3NGLA 2O3RA 1RQNA 4JX9A 3VSBA 3AL2A 3AY7A 4Q6BA 1LPSA 5FPQA 3H2YA 4D4LA 1A8HA 4OM8A 3A1WA 3ADPA 3DXXA 3E6AA 4JXZA 1X1SA 1OTHA 3H2ZA 1JSLA 1KAOA 1PNOA 4J3JA 4L22A 4BP9A 3V1LA 2C7RA 1I80A 1U2EA 3GCGA 3E53A 3PL5A 3E0XA 3KOZA 1JJVA 4LYAA 3KWJA 4AKSA 3A9RA 3Q7RA 3K6JA 5DLYA 3AVUA 2C83A 4DBLE 1G5TA 4IEEA 3VNRA 4LRTB 1J5XA 3BE5A 1QO0A 3ONNA 5CG1A 4FFRA 3ESDA 1XHFA 3M6LA 3NMUF 1XTVA 1O9BA 4Z8XA 3I0MA 3TR5A 1R6DA 3V8RA 3BXGA 4B6JA 3IPCA 4D3SA 4LFAB 4IR7A 2FW9A 2R11A 2XE8A 4LDZA 4HFNA 3ZV6A 4HDNB 2NYUA 2JRCA 1Z2NX 3PI6A 2HAEA 1XROA 3F9RA 2P91A 4M7WA 3ASYA 3PC6A 5EMNA 1CJTC 1FZQA 3H2KA 1CT9A 4QPDA 4RKEA 1HNXB 4HQ6A 2P1ZA 3CVJA 4B3SB 1OB2A 2XCIA 2C96A 4DCNA 3KVYA 2GZRA 4KX5A 4CIYA 1E2PA 3QELB 2FMKA 3PJRA 1JDUA 1E1DA 4WV3A 5AT1A 5H5JA 4PZUA 1HM5A 4J1TC 4EHIA 1RXEA 2EJWA 2QSZA 4XYEA 5AYVA 1C0PA 4P86A 3ABQB 3QPBA 1BE6A 4TT8A 1VJCA 3V7FA 3ED5A 3KLBA 3OOHA 1HGXA 4UUOA 1E64A 3W34A 1QQTA 3W6NA 5AP9A 2HYIC 1XDSA 4QLAA 1I2DA 1C3VA 4J3FA 2EHDA 4MPTA 3R5XA 1M73E 5F23A 1NMQA 1BWRA 2VKTA 4K9LA 3B6ZA 3S3TA 4Y9SA 2P2GA 5C3UA 4XCXA 5KWIA 5CYGA 1L1QA 3KAQA 4PNEA 4J4BA 4WJZA 4XWGA 1M8GA 3WMEA 2VHJA 1HYHA 4WZAB 1U2GA 1E3SA 5JVDF 5I7AA 2NT4A 4X8MA 3ADCA 1R0RE 5BN1A 1ULZA 3HJCA 1CS4C 1Z5ZA 3HSYA 2B6HA 1LLDA 2G5GX 2PXCA 4CCYB 5C5EA 4LSGA 1IWOA 1U7XA 2RGNC 5BPFA 1VLQA 1BS2A 4I1OA 1VKJA 5B55A 1GR0A 2JI6A 1D2AA 2A3RA 3NIDB 2H5LA 2GNAA 3E1GA 3KBOA 4JV5B 2VYND 3MG9A 4IKPA 3W9UA 5BVHA 1BS1A 3EUFA 2Q5QA 1P4RA 1W96A 1LW7A 5LDGA 4TZ0A 1P5RA 2PEYA 4PZDA 3WGTA 1RTKA 3THYB 2ZK7A 3EW7A 1JHPA 1OC2A 4OHFA 2VBGA 4W5WA 1HQYE 1QFJA 4ZI7A 2OUKA 4RIHA 5CAEA 3UWOA 1QYXA 1G9SA 3FUTA 3HCEA 4YUWA 5K2MA 5JRJA 1MIHA 2GZAA 1XF9A 4I5EA 3WQRA 4DA8A 3BBLA 5IVPA 5JCPA 3IO5A 4DMMA 3DOOA 4LV8B 4HYQA 1G42A 1RXIA 1GHTA 3FSJX 3K2BA 5EXXA 4N40A 4YLYA 3A3OA 2RKOA 3IEKA 2QPOA 4M86A 3L3BA 2I66A 1RHUA 2OV2A 1PJQA 3ISVA 4JUDX 4TSRA 5KBYA 3OZAA 2ZJAA 4LBZA 5H3HA 4CEHB 1V4VA 5JQGB 3W5DA 5IS2A 1RI2A 2O8DA 2AZTA 2WNIA 3R5HA 2JFPA 4JLMA 4L57A 2WF7A 2A2ZA 4O33A 1UBTS 4GI1A 3FWNA 1KXZA 1A69A 3GF4A 1NLYA 3KZNA 4BNHA 3L77A 2DWUA 2GN4A 3ZLTA 4D9GA 5LPNA 2I4NA 2JIZA 2NO4A 3B8HA 4M21A 2BHNA 1OJLA 1X8JA 3OLWA 3LT2A 4P92A 3C7DB 4TN1A 2XA2A 2E4YA 3EBLA 3PJDA 4YLEA 3J80A 2W9XA 2I9KA 1QUFA 2H3EA 4E1AA 1U2GC 3VO2A 1T5IA 4URFA 2BJWA 3LAWA 1FYWA 4ZMSA 521PA 5TPWB 3KETA 1FRZA 3SZOA 3FI9A 2GRJA 4ZO6A 1QCDA 1YCHA 1P1HA 1YBHA 3IOEA 4M54A 3WB1A 1FC0A 1FTWA 1Q7CA 3UBMA 3RRZA 1DKLA 4ALIA 2NO5A 3ZY6A 4KP7A 5TY0A 4UJ5A 1Z26A 4ZCIA 1JTVA 2NSYA 3SF8A 5G4KA 4U7DA 4AP6A 2ROQA 3FHLA 1WVMA 5DBFA 4ZJYA 2BRUA 2ZUEA 1N2XA 3A1DA 3SFZA 2RONA 3NS7A 4J91A 2OGWA 1MX5A 4YRRA 4MDEA 4CR6A 3FTEA 2I1QA 1G6Q1 1V1MB 3N8GA 5HOEA 2EWVA 4AF8A 3L6RA 4Z7NB 4DQLA 4KREA 1K97A 2WJAA 1O95D 1W6UA 1R0WA 3C16C 3OE7D 4MYTA 4C04A 1WP9A 4WKCA 1O0SA 2O7NA 1EVKA 1U9YA 3R2JA 1QC5A 4R41A 3E8XA 4B6RA 4K6CA 2AA3A 1EP3B 1P2SA 3CY6A 3NHAA 3HYSA 1CYEA 3SZUA 3VUEA 4IIFA 2W37A 4TOIA 3L8EA 5C4GB 4A03A 3KJGA 1DL5A 1FFEA 1PR2A 3I9LA 5EP1A 3TSOA 2I3BA 5JBNA 4KCGA 4NJOA 1E2DA 3V8EA 4IJ6A 1VDZA 4DV4B 1ZQ9A 3R5KA 4IIYA 1SUFA 5BOSB 1RZRD 1JU9A 4JI7B 2W11A 4LV5B 1UDXA 2C2XA 2FN9A 1LU9A 4M0MA 1G5PA 2V45A 2X86A 3HP7A 1E6KA 3SX4A 5KQSA 4YRZA 2CDAA 4NX2A 5JYEA 4UJ3A 3VNVA 1P3JA 2FJPA 4GECA 4R69A 3T38A 1X7DA 2C98A 2PJUA 5JS7A 2OXEA 2P77A 2BFMA 1UWCA 1QZTA 3KLPX 3TCXB 4GF5A 4QE3A 3JAWA 4Q1DA 2B1RA 2GN8A 3I6ZA 2X0KA 3C1TA 2QW0X 4Z2AA 2ODNA 1RT9A 1TUGA 1QOPB 4WFKA 5KUTA 4PIPA 2FX2A 4L9AA 1ST3A 4ZV9A 1P81A 3PG5A 2XW6A 1SA0A 3H65A 1CNFA 1M6NA 4G01B 4W5JA 4X1YA 5FWXA 3WHIA 4A8JC 4RXMA 3IT2A 4DR3B 3A2MA 3WGOA 1L7NA 1N6KA 4GGPA 4DCMA 1RW4A 2OZLA 5EOVA 4XQ9A 2AXNA 2YZMA 2YN4A 5EC8A 3PGVA 3AFOA 4HUQB 1V5WA 4EHNA 3T34A 3WKCA 4LJ6A 4TKVB 1K2VN 3QPVA 2FPIA 3BWCA 4KE7A 4FFOA 2C5SA 4W1PA 1CF9A 1S9DA 1ENPA 1SY7A 4MK4A 2ERXA 3KKOA 5JZVA 2P8SA 3SDSA 4II3A 4UTZA 3COZA 3QNMA 1WB5A 2VG8A 1KRWA 2XCQA 2PUHA 4ANFA 2XRFA 2FFAA 4QUDA 1QIJA 2ZRGA 1OZGA 1J25A 2FLVA 1JG7A 3P9CA 1JDVA 2FJ0A 4I4CA 1X1QA 2G5CA 1L5RA 4BJ5A 3W3AH 5THQA 1ZICA 4ZDJA 2I2WA 4GPZA 2J48A 5CEEA 1AKRA 4CL0A 4O4JF 3PFWO 2PT7A 2WQ7A 4LWOA 2DPYA 1RTTA 2VQFB 4HQ0A 1GNLA 4NATA 5ALEA 3HL4A 4TMTA 3ESCA 5E95A 5JDIC 1MAVA 1NKTA 3H1FA 3AILA 3CLSC 3L7MA 2EOAA 3CXRA 4BX3A 4JK3A 2IIBA 2YXEA 2BT4A 3CV3A 5M34A 2M9MA 3S7ZA 3N07A 2W2NA 1I01A 3LT1A 3IXMA 5IJXA 4D4GA 3OURA 1FXUA 3FUXA 3S2GA 1KWKA 3CUEF 3Q98A 5HS6A 3KKQA 1DFHA 3RJZA 4NWIA 1NJGA 3VTKA 5J4YA 3AVYA 1M1XB 1OAKA 1L4MA 2GN0A 2VYFA 3LL4A 4ES6A 5AOVA 5HRCA 1UPTA 1MG0A 4HMOA 4HQKA 2ADFA 4AX4A 3FOFC 3CLSD 3ETEA 3GT3A 3Q3JB 2H8KA 4X8OA 3AM3A 5B4TA 4CQMB 2B2CA 2GI4A 2WR8A 4R1SA 4QOJA 5F7OA 1KJIA 5EIOA 4CLOA 3IAS6 3TUJC 4P82A 3S2IA 3QH4A 2RHMA 4BNWA 4ZT4A 2AR9A 2OGTA 3IE0A 2BUAA 3HO6A 3IBTA 3DZCA 3QK7A 1GL6A 2ZJFA 1KR2A 4QQKA 3RUHA 2G6BA 2REBA 3MXOA 3PXCX 4RKYA 2IWRA 4AM8A 1FOEB 2RC5A 1DAFA 1O94A 3TSCA 4IX9A 1GSAA 2ABWA 4XR9A 4BZQA 5B3JC 5K3SA 3I8OA 3BSSA 3HUTA 4Y2SA 1DQSA 3AVWA 1P0IA 4LMBA 4HWOA 2C94A 3RYIB 1UOOA 2QRHA 5ECYA 1VA5A 4I4TB 3IT0A 3TNYA 4GRDA 4DJTA 4EITA 3MT9A 1EFRD 1O94D 5LKAA 3ZJUA 2WP0A 3L1UA 5CXSA 3W5IA 3FB1A 2VZ9A 1PJAA 2N1BA 4L5JA 4P3OA 1Z63A 4FFNA 3F5FA 3FIJA 3P45A 4X85A 5BWBA 4C4AA 5FWNA 3KR0A 4OLFA 4RV5A 3U4QA 5FBKA 1HL3A 2ODPA 2XD9A 4IDNA 5FI0B 4Q4JA 1XKXA 1IFXA 2DPXA 5ALRA 2O05A 4KRFA 4G36A 3BYZA 4TMXA 5DTMA 1Z3IX 1ZX1A 2XI4A 4K9DA 3V1YA 1UT6A 1GRVA 2LV8A 3M81A 4HADA 2C5GA 4Q03A 4TXNA 3VX3A 1PT7A 1Z13A 1PL7A 1ACMA 1C1DA 2BKAA 4DLWA 3QITA 5E1BA 3U4IA 1WMEA 5L3QA 1G21B 2KPOA 2FG5A 4OK6A 4PE5B 2F6RA 2L69A 3ELDA 3HWRA 1VL1A 4FWIB 3HWSA 3ESXA 4LDNA 4LAFA 1BGXT 4OXNA 2WLSA 4O4LF 5DV9A 2VDUE 2VPPA 4FFDA 3W77A 4CVNA 1UPCA 1SRQA 1LX7A 3GEDA 3MILA 2XJ4A 1RYYA 2X0NA 3OIVA 4RAOA 1Z4QA 3HCCA 4TKMA 3QYFA 1DS6A 2AG6A 4W5NA 4QHYA 4URWR 5J1SB 3WGIA 3BB4A 5SZKB 4G09A 3LQ1A 3L0CA 3JQ8B 1QV6A 3KQTA 5G3ZA 3UHFA 3V34A 4AWBA 2A67A 1X9HA 1N6OA 2QA5A 1B41A 3JWJA 8LDHA 3I12A 1FDTA 1CS0B 1U2ZA 2ZIWB 2ZWOA 1YB7A 4QPJC 1T9GS 3UGTA 4B6EA 1EVJA 2G0NA 4JGBA 5JJIA 1UOQA 4Q9JA 1L7MA 1REQB 3FMFA 4WOJA 4RIFA 3I6MA 4PYKA 3TOCA 5IXSA 2OHFA 5AKXA 4N9QA 3C5WP 4PZ0A 2IS4A 2AJBA 5DNCA 2QUKA 4JLJA 1N57A 2QORA 1DVRA 2EBFX 4ZVTA 1O89A 4HZUB 1O0BA 4ILEA 4JBYA 3TQFA 1U63A 3C1OA 4ND7A 4ZCSA 1SQ6A 3R3WA 3HJAA 3DDHA 2WMYA 2PR2A 3DBRA 3UATA 4K9NA 1M2OA 1NG1A 1JKXA 3I2HA 3R0QA 1UZLA 2YW9A 1BFKA 1Z15A 4U2DA 1IUNA 3DD1A 3D9QX 1CZOA 5TT0A 1MA0A 1VL8A 4OYHA 5SYAA 5JWHA 1Q0RA 4KVGA 2WWXA 2JJ1D 4MQ5A 5HOQA 1CZRA 5AI4A 1ENZA 5IZCA 4WJKB 1YVDA 1TKRA 1NYQA 2ZBDA 2EBUA 1QZZA 1QIFA 4U3JB 3HKDB 2XTJA 3D3NA 1EUCB 2CK3A 1MNQA 2VPIA 2GZ3A 3L8CA 1UMCA 1QGED 3A1NA 3UVEA 2O23A 1ZNXA 2BDEA 1LJ8A 2YBEA 4HDCA 1AS2A 3PNQA 4OBBA 5HA5A 1DAIA 2ZBPA 3LQQA 1HDCA 2A84A 2OZVA 4K1LA 3U4DA 4RD6A 4E07A 1VKZA 2WAYA 4U7WA 4E5VA 3BD6A 1NUHA 3RBAA 1EGVB 3ZVRA 4G5OA 1K6IA 5IARA 5GADl 4QUKA 2ZVJA 1PFWA 3T4PA 4DQ0A 2YDYA 3A70A 3LLCA 4B3MB 1GZUA 1LLCA 1XZ8A 5KYUB 4J6EA 1WXQA 4NFYA 4X6UA 3BFVA 1IM2A 4RH0A 1AGPA 2PVPA 2XNDD 1XZAA 1QG4A 2ZT6A 4PGMA 5KOJA 1V5FA 2JI8A 2BUCA 4Y0NA 1ZU4A 4ZOAA 4BRWA 2AD5A 2EZTA 3DL2A 4R7ZA 2F9FA 3ROZA 3I42A 4CETA 1Z39A 1ZJ4A 3MTDA 4TYYA 4YBRA 2X1HA 2JVIA 1M0SA 1ZG3A 3AESB 4GXRA 1RWOA 1DO2A 4RD0A 1T9BA 4BQRA 4WKNA 1MO2A 3MUEA 1ZP6A 1WXDA 5DXAA 3TBKA 1JIUA 1GEGA 4R8VA 1RHKA 1O5OA 2H4JA 4YV2A 3GL9A 1SZJG 2W2KB 4ZCLA 4L0QA 1JHVA 3MAAC 1H2EA 2G36A 2X7JA 2EP5A 1V3VA 2WKRA 1P5ZB 4GWLA 5AKHA 3URMA 2FP3A 1WG8A 3ZCRA 4ALKA 4YCMA 5DHTA 3QUTA 5E3JA 5F52A 1TUBB 5AHOA 6NULA 2WSSA 5H8WA 3RVPA 5DX0A 1JDPA 3R5FA 4CCYA 2YC4C 3OEYA 4FGZA 3U3DA 5KEIA 1X7YB 2C8VA 2ZJ7A 4X95A 4DZRA 2GEBA 1Q0QA 2AFHB 4G1UC 2FEAA 1I4WA 4WHMA 1I4LD 1QQ7A 1RWXA 3R3VA 3MRVA 5I48A 4JJAA 1XCMA 3OM8A 5BR7A 2AOTA 1AMUA 2XUJA 1UXGA 3JYLA 1H66A 5IJZA 2XTZA 5KB3A 4TMFA 1UBUS 1UWKA 1C9MA 4IIDA 4D42A 4QT0A 5TQ2B 1C4WA 2Z57A 4E1VA 5TDHA 2HRZA 2QG9A 3K2IA 1EESA 1XTSA 2QP4A 3CYFA 2B92A 2QSUA 2Q3CA 1O6FA 3TLEA 1MAAA 2YWCA 1KE2A 2RGAA 4P35A 4RNCA 4GAEA 2QRLA 4Q7MB 4W9NA 4D8YA 2RG7A 4PAQA 4PR3A 3RS8A 2X4LA 1JHQA 3V4ZA 3MJFA 2DYKA 1SULA 2LWIA 4JP2A 1XF1A 1N2HA 2DBQA 3OO1A 1TC2A 2J3LA 2Z4SA 5HF6A 2HMWA 3H83A 3RRMA 2O6HA 6REQB 1ZMXA 2BAGA 1U6IA 5BO5A 3BXOA 1USUA 3EY9A 3V48A 4UVDA 4YCCA 2UZ4A 1Z4LA 3PT9A 2YHBA 3KQOA 4CKBB 2Y8EA 4X5OA 5LD2B 3N1UA 5EESA 1T2EA 3AI2A 3GPBA 2VP2A 3QWHA 2O0HA 3QWAA 3O8NA 4JBXA 4P84A 4QREA 2HO5A 2CY0A 4C5BA 1XZLA 3VJKA 1GPYA 2CJFA 3ZGZA 4LTNA 2O5EA 4K9PA 1S96A 4XVCA 1A4RA 1DC3A 4LECA 1FUKA 4IFTA 1Q0HA 1BD3A 1IL0A 3MRTA 4UQOA 4YRJA 4DLLA 5KWVA 1YR9A 1CP3A 3KJIA 2WU1A 3IO3A 2J8ZA 3TDKA 4KLAA 5BSWA 3DEFA 3U7QB 2AX3A 3TQTA 1Z6ZA 1CJVC 1K5DA 1LFAA 1YZYA 1QOQB 2FMUA 5KYVA 1YB2A 3CRZA 1XZIA 3E3LA 1IHYA 3I58A 1ANKA 1WEKA 2NZVG 4LTDA 5LBIA 5EG5A 1IY2A 4G24A 5B1YA 2QNIA 4N7MA 5IBQA 1P6UA 1PL8A 3IDAA 5ALYA 2WIDA 3OH8A 2I2FA 4MYRA 5FJIA 5JI2E 2J5KA 4HLDA 2FRXA 1XELA 1JKJA 1CNEA 2ZB2A 3HDTA 2DLNA 3N0VA 3NEPX 3ZHTA 4B84A 5F2EA 3IILA 1TT7A 4NICA 4DRXA 2YV1A 4EP1A 1MJHA 2NQ8A 5LNK6 3JW8A 1H0RA 3QXCA 1XNGA 4JU8A 2QAGA 1MHPA 4UDNA 2I65A 1KZGB 4Y98A 4ENRA 5LQNA 1H6AA 4PF1A 2D4AA 2G88A 3FFXA 1GARA 3JV7A 2DFVA 3SS8A 2O3TA 4AECA 1N8TA 1I3OA 3KZMA 5K7SA 4RY0A 2IP4A 3I2JA 4GP7A 4JQOA 4LCJA 3TXXA 1U8AA 3ZY3A 1VHQA 2QM3A 2WTXA 1YMQA 3L4SO 4WINA 1IHXA 2KJQA 5EMJA 3ROXA 1XU7A 2BSXA 5EYPA 2JGIA 3TSYA 2BHTA 2XNSA 3MUNA 1UK6A 2YV2A 3K30A 2BW0A 4MQLA 4F7DA 3FHJA 2FEOA 2GNPA 5FNVA 1HNZB 3NEJA 1ECPA 2BFEB 4B74A 2YZNA 4NBKA 1RBZA 3KPYA 5ICSA 3AEQB 3OAAD 2JATA 2E89A 1E2EA 1UDCA 4AG3A 4JB8A 5CX1A 3MWFA 1Z08A 4MIYA 5JXWA 1H22A 3C6KA 2A35A 3EZ2A 4J7CA 4KMMA 2YWGA 4IJQA 3GD7A 3SKYA 4CCSA 3TO5A 5HZKA 1D1PA 2TSYB 4JA0A 4C0HA 2RFLA 1GPDG 4D0GA 1E9VA 2IHJA 2ZS7A 4NEGA 2X13A 3AG5A 1KSJA 2I87A 3QOXA 3WL7A 4GGMX 4JB2A 3PQ8A 5LM3A 1QRSA 2QBYA 1T0UA 2H31A 2P0EA 5A4IS 4ETNA 4FQ7A 1SB9A 3M1AA 3MT8A 2DM6A 1PTKA 3LX5A 4ZVPA 1NTRA 1QJ4A 4IH9A 4EY5A 2B4YA 1O6ZA 2JIZD 1UBJS 1NOIA 3J81k 2HRBA 3MN1A 3K31A 3TNLA 4R8KA 5J59A 5IZ4A 2A1UA 5A5DA 2CLDX 1OX4B 2JJ2A 5C1DA 1DAEA 2HRRA 3H75A 3QP9A 3KHTA 2Q1TA 4TQGA 1NXXA 5LDDC 1C80A 1D6NA 1FMLA 2IYVA 1BOOA 2C4UA 1XEWX 1SVNA 1VYVA 2PGLA 2WI8A 3LCJA 4H7DA 4N5HX 2COEA 2OAP1 3AZOA 1TQHA 3UG6A 2BFCB 1HLFA 2GVDC 1YA6A 1SC4A 3O8OA 5TC4A 2YVAA 4KMOA 5IC4A 3CA8A 4X61A 2EXXA 3N2LA 3T1TA 9ABPA 1N78A 2JCSA 5DGTA 3AP2A 3KAJA 5L9AA 1E6UA 1G7SA 1UWVA 2E4ZA 2Q3FA 1QXSA 4JT2A 4N8EA 2OCDA 1AQ6A 2BMWA 5HF5A 2PUEA 3V7UA 2V8BA 5C9ZA 3LDHA 4J0DA 3CCFA 5DCWA 2GPSA 4KPUA 3TNJA 1IU9A 2IIQA 2Z2ZA 3LHKA 2EFYA 2FWMX 1UKEA 3BN3A 4HLUC 4IEFB 4NMWA 4GXQA 3ZHXA 2PGIA 1Z0SA 1IEQA 3HU5A 3LOPA 4F06A 1HLGA 3KWLA 3MEQA 3QE9Y 1M1NA 3DOHA 3AF5A 1WO8A 3OCXA 3CONA 3KM0A 1ZIYA 2RIPA 3EZNA 1K6EA 2C84A 3DE6X 4M6WA 4RA6A 3UWKA 4EW6A 2YXPX 3IEMA 5CB4F 4L9RA 3PWZA 4QFBA 4C0SA 1GTRA 3VHQA 3RSOA 1L0BA 4GQIA 2Z9CA 2ZUUA 3IHTA 2HQBA 1HMYA 1SUEA 2ZIVB 1MH1A 2GOYA 2VSXA 2BR3A 3G02A 3SIRA 5BUSA 3KR2A 1GCIA 1FFGA 3H1TA 3P9KA 5TF0A 4D2IA 3H8SA 3N8KA 2I2CA 2XNDA 2CSUA 2Q07A 2Q6VA 2SKCA 2WZBA 3DDCA 4XWTA 3SG0A 5JTUA 3I61A 4O25A 1AXRA 4HVLA 2HMAA 5G1OA 1QH8A 2O3SA 3AC0A 3IKJA 3SQMA 3A6LA 5JD4A 1JA0A 1F7VA 4IJKA 4A2CA 3G8CA 1SC6A 2XB2A 4BNXA 2V74B 2PRZA 2GMWA 2E48A 3A28A 3SVTA 2OYCA 1VLMA 1URPA 3KBBA 4Q01A 3V7YA 5GM1A 3A2LA 3DDOA 3F8TA 1RCUA 3UMJA 1RWBA 1XEWY 1R6TA 4GI2A 3BKWA 5TPZD 3CT4A 4QEKA 1ZC3A 2OG2A 1QAOA 2C2WA 3WBKA 2C97A 2XT9A 3NNNA 1R5JA 3CNEA 2UV8A 5ALUA 3E7PA 2BWJA 4AUMA 4F3RA 4Z3KA 1Z33A 3DWFA 2GXSA 4QQFA 4JI8B 4MIOA 4EX7A 3LP5A 3ZQ4A 2B8NA 3DBIA 2BFBA 1W581 1ZHFA 2ZQYA 3HDVA 5BW5A 1AN0A 3KZXA 4M2LA 3IJ5A 5KX5A 1Z5UA 1CQIA 4ZOLB 2ZFUA 1L1FA 3IEVA 2BIFA 1BQ4A 3ABZA 1FYVA 2G06A 2ZITA 3KHUA 2DH6A 3NU1A 5KOJB 4LE0A 3VDQA 4CKZA 2Y6UA 5ARBA 2YVUA 3PXDA 4AQDA 1NXWA 1NW4A 2HT1A 2H4FA 4N3NA 1ODKA 1MQ8B 3DVRX 4YROA 3SLGA 4J4HA 4JH0A 1Q95A 5CNIA 4CLEA 1NLFA 3FJYA 3SE0A 4EK9A 2ZRDA 3ZHBA 1O77A 3U3ZA 4YT2A 1H0HA 3CF0A 2FPPA 1A77A 5DNWA 2C9YA 3FWPA 3L7NA 4W8GA 1QH1A 2VOJA 1Z68A 1XL0A 1RPNA 4F4IA 1QO0D 3LTNC 1OI3A 1SRRA 4GM4A 2HNKA 5CT8A 2YL2A 3A04A 1PV2A 4LXTA 1W4ZA 4F3NA 2R85A 3Q5GA 2RAUA 2ENWA 1B4DA 5AVRA 3KOOA 3HI6A 4YAKA 3EWAA 4DGQA 1I2ZA 4MWCA 4RVCA 5C18A 2JG3A 1F7UA 4KFTA 4KXUA 2D1FA 1D2NA 1MDBA 1J2UA 3IPYA 3N2YA 3GR6A 5ALKA 3WK5A 2NSDA 1QR2A 2AFHA 1ZI6A 1CLEA 2WKSA 3GVXA 2I6GA 4KU4A 5GAJA 2YS6A 2H92A 3ZCTA 5AW4A 3VXKA 3UPUA 1WUKS 2X9QA 1IPEA 1T8SA 1E2HA 1V26A 2AHOA 2C9CA 2QSJA 2W6IA 1WD5A 2WT4A 2YV5A 3WB0A 3WLJA 4A91A 1AHIA 1SIWA 6ADHA 1TD9A 3T3GA 2IS6A 3GGPA 3SZRA 4R5MA 3H2BA 1IQ0A 2IEZA 3EGCA 3OX1A 2FFQA 1T1EA 5TEWA 3DYIA 1YE8A 1UJ2A 2O0LA 2OVBA 1U2RA 3JPWA 4FHEA 3D2LA 3QLTA 5HKLA 3VJLA 2IW1A 4F3KA 3KOMA 1JNXX 7REQA 4BZZA 3ANSA 1J8VA 4MARA 3ZJYA 1QS0B 2QRMA 3GAFA 2DETA 2DQYA 3RKSA 1O08A 1AGRA 3WDSA 1LBIA 1QOZA 2GSWA 3ZNQA 4X63A 1W1UA 1J0EA 2BMFA 1KAQA 2WJ3A 4YCDA 1AQJA 4KXNA 3IQXA 3E5RA 3I3OA 1KC3A 3LFTA 3KE9A 2ZWMA 1OA0A 4TZ6A 3ULKA 2HGZA 1YIDA 3D02A 5C8XA 3HUFA 1QJCA 3MTJA 4EDHA 2ECFA 3F96A 4JJFA 3FNQA 4CQLA 3RIGA 3BB3A 3C5HA 3PC8A 4Q3BA 2IT1A 1Z56C 3GUZA 4AJEA 1JIKA 3OJWA 5F2NA 5F77A 3QV1A 5JZMA 4HQFA 5DWDA 3W78A 2J33A 2G67A 4JITA 4X9XA 2AEFA 5MDHA 1Q77A 2X9LA 4IIJA 3KJXA 1Z37A 3QHPA 3RUPA