3DQPA

Crystal structure of the oxidoreductase ylbe from lactococcus lactis, northeast structural genomics consortium target kr121.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
219
structure length
219
Chain Sequence
MKIFIVGSTGRVGKSLLKSLSTTDYQIYAGARKVEQVPQYNNVKAVHFDVDWTPEEMAKQLHGMDAIINVSGSGGKSLLKVDLYGAVKLMQAAEKAEVKRFILLSTIFSLQPEKWIGAGFDALKDYYIAKHFADLYLTKETNLDYTIIQPGALTEEEATGLIDINDEVSASNTIGDVADTIKELVMTDHSIGKVISMHNGKTAIKEALESLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase ylbE
publication title Crystal structure of the oxidoreductase ylbE from Lactococcus lactis, Northeast Structural Genomics Consortium Target KR121.
rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Oxidoreductase
total genus 72
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13460 NAD_binding_10 NAD(P)H-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dqpA00
3EAGA 2B0JA 3HG7A 1HE3A 1O94A 3WWYA 1ZBQA 1KEVA 4IXTA 4I9HA 4C7KA 3PFWO 3JV7A 5IN5A 2EEZA 3P2YA 4J43A 4R01A 1D4FA 3H4VA 4RF2A 3U3XA 4Q39A 4CM6A 3ZNOA 1C1XA 4OL9A 3MJVA 2Q2QA 3DO5A 3CMMA 3QHAA 4NR0A 5L40A 3GPDG 3SXPA 1T2AA 4JX8A 3UKOA 2FSSA 4JBGA 4YJGA 2JHGA 2EHDA 4R54A 3ZW8A 5BNTA 1R0SA 3JQCA 2O3TA 2C82A 2C54A 2B4TO 1A4UA 1W8DA 3R3JA 3Q6IA 5ITWA 4HNHA 2Z1MA 4RVDA 1PZGA 3MEQA 4BNHA 2X9VA 4HWKA 4L9RA 3HNPA 2HMUA 5H81A 2IRWA 4KWIA 4OMUA 4UVHA 3FPCA 1ZIDA 1E3EA 2NM0A 1FK8A 1U8FO 3RC7A 1XSEA 1ZEJA 4NDNE 3ST7A 4ZU3A 3ZDFA 1U3VA 4WCDA 1NTOA 1TT7A 4N5NA 3U4IA 1P74A 3GHHA 3BHJA 1ISJA 1YS4A 1ZW1A 3C7AA 3U4DA 1DRWA 4NHEA 1LSSA 1YOVB 3TOXA 4R9SA 4CV0A 4O63O 1ISHA 1DIHA 2NACA 5A04A 4F6CA 2B5VA 3JQ7A 4GVXA 5TS3A 4LW8A 4BO9A 2YJZA 4CM8A 4CUZA 4CQMA 3HDYA 4J4TA 3CSDA 3PJFA 3QRWA 4UUNA 4RPGA 3WGOA 5KOIA 4DREA 5DOVA 5A9TA 1HTBA 3QV1A 3LLVA 3HN7A 2ZYDA 2HJSA 3GN1A 3OM9A 5KNLA 1UXKA 1UXHA 4CM7A 4B4UA 1WPQA 4BV9A 3VKUA 1I30A 3JQAB 4OSPA 1ZJZA 3U4HA 1NXQA 2OBYA 3SBOA 3S2FA 3FTPA 4GGOA 5A06A 1ISGA 5T8KA 4J0EA 4XYLA 2YZ7A 9LDBA 1DDOA 2H6EA 4UVEA 1YQXA 4ESOA 4LSWA 1DPGA 3TFOA 4D0RA 3DHYA 3E9QA 1NFFA 3ENKA 2HMSA 3WGIA 3RUIA 3OEWA 1ZO8A 1FDUA 3X2FA 1CETA 2E6UX 2IE0A 2WD7B 4NIMA 3NJ8A 4NFSA 3TF5A 1CYDA 1C0PA 3OQBA 1JTVA 3HB5X 5IXSA 2CVOA 2QRLA 4A0SA 4UVDA 1I36A 1N2SA 2HJRA 4ZRMA 5G4KA 1BWSA 2QX7A 1TB4A 3UXYA 4XQGA 1WXDA 1XQ6A 3GRPA 1V8BA 4UAGA 4EUEA 5L4LA 3E5MA 2GERA 5A4DA 2FZWA 4ALMA 1YJQA 3MZ0A 5F5LA 3PYXA 3QWFA 3SEFA 3TN7A 4BNKA 4LRSB 4BUCA 4R1NA 4CR8A 4FJ2A 3OICA 4EUHA 2GNAA 4RVUA 2I5PO 5KTKA 3OJEA 3S2IA 1X7HA 1EBFA 2VWGA 3DBLA 1SB8A 2G1UA 5T57A 4XQ9A 4BO7A 1LI4A 4Z3KA 2PV7A 3HWRA 3ITDA 3MJCA 2DUWA 4B4WA 3I3OA 2BGLA 5L4NA 2D5AA 3UHAA 3FHLA 1OI7A 3D4PA 4E2XA 2QYTA 1XDWA 1HDOA 1I2BA 2VNSA 3ICCA 3CINA 2AQHA 3DFUA 2BHLA 3DTYA 5KVVA 4CMEC 3K9QO 3TDKA 1X15A 1WMBA 3P2OA 3L9XA 1GR0A 3CH6A 3LK7A 1PJTA 4CQLA 4NNJA 1DIAA 2OHXA 4XIJA 5LDHA 4FIZA 3ZH2A 2IYPA 2R6JA 2ZKLA 1NAIA 1OC2A 3GDGA 4NJMA 2FOIA 2HK8A 4W6ZA 5B4TA 3W6ZA 4D46A 3H3FA 1E1KA 1R15A 1I24A 4O0LA 3KYDB 3VDQA 4RVHA 1DHTA 2CF6A 4YRDA 2YDXA 1LDYA 1JQBA 2BFAA 5AXBA 1U8XX 3PIDA 3ABIA 3AI3A 4MDHA 5CDYA 2IXAA 4B79A 2YFQA 5LDGA 5DBFA 5L53A 2A9FA 4ND4A 3PQFA 4NZ9A 2RAFA 3K2BA 5G0SA 4AJNA 1EBUA 4L4XA 1VSUA 4U0KA 4A2CA 4ALJA 3IKTA 3RQSA 3MTGA 1JVBA 2PZKA 4ROSA 1K6XA 1QORA 3LU1A 3OQ1A 4IDCA 2O7SA 4E6PA 1YQDA 3HQ4O 1CWUA 1E0DA 4YQYA 1Z82A 3HUDA 3BMNB 3D5QA 3I6QA 5TNXA 3WFIA 3AOEA 4QTZA 4OH1A 4XJSA 1QYDA 4YB8A 4YT2A 1BG6A 3VOSA 2UDPA 2YW9A 1YXMA 4HKTA 4WK6A 4PCVA 4X54A 4YAJA 2SCUA 2PH5A 4YAEA 4E33A 4WEOA 1CIVA 2DVMA 4N5MA 4LVUA 1C1XB 3ETDA 1XELA 5EL0A 3RWBA 5B4VA 1EVYA 2WM3A 4LVCA 5JCJD 1MC5A 4R41A 3HDJA 3KLPX 4XEHA 3GA0A 1E7MA 1YGYA 2W2LA 3AK4A 3ZHYA 4PLHA 1F0YA 1N7HA 4YJDA 4ZQBA 3RUCA 3JQGA 2QYSA 4YJGB 3UN1A 4QT0A 5KJ1A 3KXDA 2DFDA 4Y8VA 4A26A 1LDMA 2P9EA 2X4GA 1NQTA 2JFHA 4HV4A 1DBVO 1LDNA 2GO1A 4Y67A 2O50A 1FF9A 3H3JA 2AE1A 4NMHA 2O2YA 1ID1A 3DMTC 3JQEA 4B7CA 3AOEC 2VWHA 4Z3DA 2NU9A 3DB2A 3GZNB 5GZ6A 2DUUA 1UDCA 2GLXA 1H6BA 4RF5A 2Y0DA 1MXHA 2YQ5A 1E7YA 3ROMA 1PJLA 5AXCA 1ULSA 5COQA 4CLDA 1UXJA 4BGIA 3F4BA 1B7GO 2FZEA 3R1IA 2VZ9A 4ND5A 3KHUA 1ENOA 2C07A 4CQMB 4FS3A 1EEHA 2FN7A 1R4MA 1R66A 4YEDA 4YDRA 2GN9A 1HZZA 3S1LA 3TSCA 3ZV6A 4RJTA 1P0CA 3WQRA 5CHEA 1JU9A 3GEMA 3PQEA 3VZRA 4YRAA 4LK3A 1KBZA 4A27A 3BTOA 2BFPA 3ONFA 1YVEI 4EUFA 3PHGA 2OGUA 5AXDA 1HZJA 1NQOA 1HT0A 1U3TA 3E8XA 6LDHA 3TL3A 1DHRA 1KEWA 3X2EA 1KOLA 3ASUA 3ASVA 5IDXA 2ZB8A 4FSHA 4CLRA 3B1KA 4DUPA 3GG9A 3VC7A 4LGVA 4Q3EA 5DOZA 2GD1O 3BAZA 3G79A 4YPOA 4YJHB 1H5QA 5FYDA 2GPTA 1Y8RA 4WCFC 4CMIB 1FDSA 1QV6A 4S1VA 4KTVE 1J5PA 5G4KB 1AE1A 1DC3A 5C7IO 1LSUA 3GDOA 1F14A 1MG5A 4U7WA 2B35A 4PG4A 4EITA 4LSMA 3AY6A 1HSOA 4GH5A 1C1DB 3DZGA 1HDYA 3QWBA 4OHUA 5JAQA 1PL6A 3PHLA 3PXXA 1CEQA 3TZQA 3W8DA 3O03A 3E48A 2JCYA 1J49A 1HE5A 2B4QA 2C5AA 4JLWA 2XF8A 4DLLA 1YB1A 5I9LA 1T1SA 3WLFA 4J0FA 4B7UA 4YT8A 2DLDA 4FFPA 2P68A 1BDBA 4OQYA 3L77A 3PYMA 3VVCA 1JWAB 1TVEA 2GASA 4B3JA 3JQDA 3Q9UA 1UZMA 5MGBA 4XD2A 4XYMA 5EJ2A 1M67A 4IJWA 2NSDA 4FQ8A 5AVOA 3G0OA 3S2GA 2CMDA 4FFNA 3B1JA 1LDEA 4CMJA 4CQLB 4IGFA 4FB5A 4NJMB 3PJDA 2Z95A 2HRZA 1DOHA 1CF2O 3AUSA 1YJ8A 2EV9A 4XDYA 4D3FA 2OP0A 1SB9A 3DR3A 5K6AA 3S2EA 3PFFA 2AMFA 1T4DA 4YJFA 2BRUA 4Q3AA 3C24A 2WYWA 4R1SA 3OBBA 4L4SA 1SC6A 4RV9A 1ZJYA 1RYEA 3IP1A 5A3VA 2JD0A 4A10A 2X5KO 3WYEA 4BHTA 1E1NA 1GV0A 4GLOA 2BFOA 1HXHA 1NQAO 4ZRNA 3GEDA 4MVJM 1N9GB 1Q0QA 4J6FA 1VKOA 3QQPA 5AOVA 3VZSA 3PGJA 4NFYA 2OO5A 4E2YA 4OO3A 3VH4A 4RLSA 2W90A 1A9YA 4II3A 3B70A 3NT4A 4IUYA 2WWRA 2Y99A 3ANNA 4L4RA 5JNLA 1Q2XA 3HDQA 3CPSA 1EVJA 4ALLA 3LLSA 2G82A 2AG5A 2HK7A 3MJEA 4IDAA 4WGGA 2VYVA 1GY8A 3BTUA 5IN4A 4HP8A 5IDQA 2X0NA 4RPKA 1U5CA 3H8VA 3ROKA 4IDGA 4YRBA 2RIRA 1NPDA 3NUGA 1LQUA 5DBIA 3BMCA 3TL2A 1B8VA 2ZB4A 5I7FA 3RVDA 2HRBA 5ITVA 1X13A 5K6AC 3CXRA 3BXXA 4XR4A 4Q3BA 3GMDA 3WYCA 1T26A 4L73A 1DSSG 1EQ2A 3DL2A 3GDFA 4FJ0A 3VPSA 2Z5LA 4CJXA 4E3ZA 3IJPA 4BNUA 5GMOA 2YFHA 1OOEA 4BO4A 1EE9A 1R12A 3V1YA 2O3RA 3MOIA 4HUJA 1SNYA 3KV3O 3T7EA 2GN4A 5COBA 1FDTA 3ZW9A 1GCOA 3Q1LA 1GZ4A 2H9IA 4D3DA 1Z73A 4DWVA 1HE4A 4MJLA 2VUUA 1GYPA 3ULKA 5L4SA 4L76A 3WIEA 1DIRA 4CMCA 4DPKA 4BB6A 5BSEA 4XJTA 4JP3A 3L6DA 2W2LD 1P1RA 3OQ6A 1KYQA 3FPLA 1FDVA 5IAAA 4CM9D 1U7TA 1A9ZA 4PZCA 3WNQA 5KVQA 2ZTLA 4TWRA 4CLXA 1E3JA 3RJ9A 3WYBA 5I9NA 2X86A 5I9MA 1PJ4A 4EW6A 4AJOA 3TNLA 5TLSA 4BNWA 2W8ZA 3WJ7A 4B3IA 3IMFA 3GAZA 1FDWA 1NVMB 4E12A 4WCFB 1IE3A 4DVJA 1Y9EA 5A03A 3GF4A 1PZFA 3EDMA 1YL7A 3GH3A 4J1SA 3ONEA 4BNLA 1X14A 1U1IA 2ZB3A 4MKXA 4RPLA 5HRUA 2W2KB 2B5WA 4NBWA 1SEVA 1PJCA 1IB6A 4ZQGA 2A35A 2Y1CA 3AU8A 5DDIP 2GZ2A 5JW6A 2QRJA 2VUTA 1HRDA 5ER6A 2OOSA 4UVIA 1VL6A 2TMGA 3VHRA 5DF1A 3L07A 1GUFA 4OQZA 1Z45A 2B83A 5A3JA 3FNGA 1PQPA 2VQ3A 2RH4A 3JQAA 4MVJE 2PA3A 3DHNA 4LN1A 5A1TA 3QWIA 3AI2A 2WD8A 4E2ZA 4FN4A 5DCUA 3F1KA 3AUAA 3RUEA 1BVRA 4BNGA 4O5OA 1NHGA 2AA3A 3VH3A 5BR7A 1NAHA 1I2CA 3DQPA 2PLAA 2HAEA 1PJ3A 3E18A 3P19A 5TGDA 1WDKA 5CPBA 3VPHA 2WD7A 4OKIA 3F5QA 4XRGA 2DTEA 4JJGA 1R6DA 3A1NA 3GLQA 4XWYA 1U3UA 3CKYA 3WFJA 4DBZA 1NYTA 4ZQFA 1H6DA 5KJCA 4E30A 3QW2A 2GYYA 3RFXA 1I10A 2F1KA 1N1GA 3F1LA 1NFRA 3F4LA 3JD0A 3WQSB 4CM5A 3GR6A 3LC1O 3PP8A 1QR6A 4HFRA 1F8GA 1LDGA 1Y5MA 1C0KA 4IZHA 1X1TA 3BIOA 1CJCA 3EYWA 3H9QA 1M66A 5U4QA 2HSDA 2WDZA 5FF9A 4FDAA 4XYEA 2ILTA 5KIAA 1YKFA 4A5OA 4DMMA 2Q1SA 2VHZA 1E7WA 1YH3A 3EUWA 4BO3A 4P4LA 1YBAA 4F6LA 5ENDA 4J7UA 5JY1A 1DIGA 2G76A 3PZRA 3FR7A 1SOVA 1VJTA 4DTIA 4L74A 4ZA2A 5BSHA 2LDBA 1U7HA 2GR9A 1A72A 4FR5A 4H16A 4I5FA 3RKUA 1F06A 2WMDA 5JDCA 1ZKMA 3TZCA 3NDIA 3ORFA 1GZ3A 3DEYX 4R68A 3UGKA 2P2SA 2ZIZA 3F6YA 4HADA 4J4HA 3ICPA 4MP8A 3OFSA 2BH9A 3D64A 4NBTA 5JCJA 2DQ4A 1DFHA 3G17A 4AJ4A 3KYDA 1UXIA 3GGGA 4QX6A 3C1TA 4XGIA 1G0OA 2JD1A 4DC0A 2BF7A 3B6ZA 2XAAA 3L4SO 4E13A 2X5OA 3IL2A 2EIHA 3A28A 4GVLA 1N7GA 2BI7A 1BTOA 1I8TA 1K6IA 2JHFA 3FNEA 3QWHA 4R3NA 3WLEA 1I3NA 4MVJG 1F8FA 2OZPA 3VKVA 2ZCUA 3Q2IA 5TJ9A 5HTOA 1HDRA 1H2HA 4U6QA 2GSDA 4K6FA 1W73A 1H0KA 2NU7A 4BNZA 3M6IA 4MIOA 4ZD6A 3CUKA 1H9BA 3HE3A 3I9JA 3T4EA 1ZH8A 3GVPA 3BTSA 3QVOA 5JBIA 1ZMOA 3I83A 4JJFA 3ZV3A 4MVJF 2UVDA 5FEUA 2BLLA 2WE7A 4BO0A 1IY8A 1E6WA 4JJIA 4ZHSA 1O89A 4FOOA 4P4NA 4DIOA 4WE3A 1EFKA 3WR5A 1B3BA 1UP6A 4R3WA 4ZVVA 3ZWYA 2UV8A 5HM8A 2QQ5A 1ISFA 1HDXA 5CDGA 4O6VA 3WBBA 4E5NA 3OJ0A 3QLJA 2FMUA 4CMHA 2FR1A 3LQFA 2ZK7A 3I52A 5B1YA 1YONA 1U5AA 3U49A 4IJKA 5TC4A 2E37A 4MVJH 4CMGA 2ZATA 2FWMX 1PL8A 1GAEO 3AFNA 2NVUA 4URFA 2DAPA 2H1SA 2Q2VA 3GZNA 3NDRA 4H3VA 4K28A 3KOUA 1JKFA 1DAOA 4DIBA 3BMOB 4EDFA 1ZNQO 2O3JA 2OMEA 3OP4A 1W0CA 2PKRA 4YACA 2J6IA 3OJLA 4PLTA 4D42A 3RC1A 4KUGA 5T64A 1S7CA 2E4AA 4RPJA 3C7DB 2OFPA 5KJ6A 5CFZA 4BIIA 2WTBA 4FJ1A 4UEJA 1HSZA 4MINA 3E9NA 3PHJA 3GG2A 4YXFA 2PY6A 3VH2A 1QG6A 1GUYA 4KTTE 1OMOA 4ILKA 3ZU2A 3NTOA 1PEDA 1PGJA 1SBYA 2I3AA 4AJKA 1GDHA 2IXBA 2NV6A 1WNTA 5ILOA 1Z7EA 1JAXA 5JAMA 4K9DA 5HA5A 3OECA 1QLHA 5JYEA 3DZHA 1E1LA 2Q46A 1A4IA 4RF4A 2UUPA 1Q7CA 3LYLA 1PGPA 5JMWA 1LX6A 1WW8A 3U9LA 4E0BA 1B8UA 1GD1O 3M1LA 4A03A 4B4VA 1E6UA 4CMKA 4E5MA 4MVJI 3BHMA 1EUDA 1GZ6A 4IS2A 3QP9A 3RIHA 4PLGA 4YJHA 1DB3A 3EZYA 3BYZA 3JQAD 3W4KA 1VKNA 1EDZA 4CMIA 3PWSA 4CMEA 3O26A 3ZV4A 4BB5A 4UUOA 4YCAA 1QV7A 1C0LA 1QYWA 2UUOA 1GPDG 5JMPA 3UICA 3P5SA 2EP7A 4NG5A 1PGOA 1IYZA 3TZ6A 2X9GA 1YB4A 3D5TA 3GT0A 1SPXA 5JE8A 3V5NA 2VOJA 3GVIA 1UXGA 3E82A 1C1DA 4I5EA 1NPTO 3DWFA 1QLJA 4E2WA 5L51A 2VT3A 2I76A 3GMSA 3OEYA 1DFIA 1BSVA 3GVXA 4RORA 3HN2A 3ZNQA 5TJHA 3EVNA 1YL6A 4RVSA 4FC7A 3BMQB 7MDHA 3JQ8B 4EEZA 2V6MA 1JKIA 3IP3A 1B16A 4INAA 3DZBA 4PLWA 2Q1UA 3NT2A 4WLOA 2G17A 2FP4A 4RO0A 3EGOA 4M86A 3RCBA 5IJZA 4DQXA 1HLDA 3MTJA 1T2DA 3COSA 2FY8A 2J3IA 1YO6A 3S8MA 5JPIA 4BNYA 1MA0A 3TPCA 1GCUA 3WDSA 1P1HA 1ZK2A 4TROA 4IDEA 3MCVA 2IZZA 4N7RA 2X0JA 3UOGA 1P1JA 5CG2A 5EINA 4EEXA 1P1IA 2DC1A 2VN8A 4EJ6A 1S6YA 3ETGA 4ALNA 2OL4A 4WNCA 4UREA 4WLEA 2JAPA 1VL8A 3H5NA 4RQTA 1N9GA 3FI9A 1Y8QB 3ITKA 1BW9B 4L0QA 5BSGA 3WX0A 2HU2A 3EHEA 1HF3A 5C3MA 4GWKA 1WDLA 3H2ZA 3DAPA 3ZCXA 5JO0A 2D4AA 1B3RA 1LBEA 1B15A 5H83A 3DMTA 1DIBA 1MV8A 4NK4A 2ZQZA 3TRIA 2CFCA 5TT1A 3VZQA 1CQIA 1QSGA 1IOLA 1XEAA 4JCOA 4BNNA 3ZWOA 2X9NA 4OOEA 3QVWA 2DKNA 5FI3A 4XYGA 1K89A 2BELA 4HY3A 5ADHA 4KQXA 1R37A 3ZWXA 1XLTA 2B37A 2P5YA 4BO6A 2Z1NA 2RH8A 3EK2A 4PVDA 3R6DA 4CLEA 1JW9B 4HBGA 2VHYA 3HDHA 4TQGA 3K31A 3E03A 3UAGA 2JCVA 4D7AA 3JTMA 1XU9A 4ONEA 2WYVA 3KSDO 3SC4A 5TIIA 3I9NA 3EZLA 3AWDA 4EBFA 4FGWA 1PWZA 1YDEA 3D4NA 3M1AA 5F1OA 5TX7A 2DBRA 5T67A 1HETA 1NNUA 4OOFA 4BL5A 3D3WA 4PLZA 2NVUB 1QXSA 5BNIA 1LRKA 4IDBA 1PR3A 3T4XA 3ADOA 3IIEA 4OAQA 2O23A 2YYYA 1Y7TA 5LC1A 1HE2A 1G6KA 1XCBA 2JFFA 3MOGA 4ZQHA 2I67A 3AFMA 3NAQA 4RCVA 2PZLA 5HBRA 3JQ9C 4E5KA 3L9WA 2PTGA 1E5LA 4IDFA 4ND1A 3UCEA 3GNTA 1DC5A 2Q1WA 5KKAA 2VWQA 1ZSYA 5L7YA 3QA9A 1PU2A 1CDOA 3WB9A 4GMFA 2NADA 1XYGA 3A9WA 3K8ZA 4Z0TA 3IOYA 4WCFA 4CPDA 5TF4A 5JAIA 1GQQA 4MIYA 4HXYA 1O0SA 3GNSA 2VTDA 4AJ1A 1VJ1A 4YBZA 4PVCA 1EVZA 1LC3A 2RHCA 3I5MA 4HFMA 2CSUA 2W2KA 4N54A 1GQ2A 4QFCA 2O48X 3L6EA 5THKA 4GQAA 5BSFA 4PLVA 2TMDA 3FR8A 1M2WA 3ADPA 4IJVA 3H2SA 1DEHA 3F9IA 1EDOA 2VNAA 3C85A 3ZU3A 1I3MA 3OMLA 5B4UA 3LT2A 1AXGA 4CQMD 3NGXA 1ZMTA 5DBGA 4BGEA 3JD2A 2C2YA 5JDIC 1KVTA 3PGXA 4BNFA 3FBGA 1OBFO 1KEUA 5CG1A 1KVSA 2GZ1A 2WE8A 2QZZA 4IIVA 2PK3A 3RBZA 4BNJA 1ENPA 1L1FA 3O4RA 4P22A 3ZI0A 3A06A 1E3LA 3RSHA 1JA9A 4LCEA 4G81A 2FPPA 1U4SA 5EESA 4CMBA 1ZSVA 1E6EA 4BQPA 4EJ0A 3I4FA 4KUEA 2O7QA 2LDXA 3DFZA 5H82A 4YT5A 3SC6A 3H7AA 1DAPA 4IGEA 2C20A 5F5NA 4P38A 3PDJA 5G0TA 5COAA 2AEMA 1T2EA 4MP3A 1XR3A 3VH1A 5C7OO 2XPCA 5IF3A 5GZ1A 3FD8A 4J49A 4Z9YA 2VUSA 5BNFA 1QKIA 2QZ9A 1LQTA 5THQA 1XQ1A 2VHVA 4JBHA 4CODB 5CDTA 2PD3A 3E5RA 4K1LA 3JQBA 3NKLA 4AVYA 4HNGA 4XA8A 4M49A 1NVGA 1VM6A 2EXXA 5B37A 4LMRA 4XYBA 1N92A 3STHA 1RJWA 1NPYA 3ZWBA 4D79A 2CUKA 1NX6A 2J3JA 4UEOA 5TQVA 1MG0A 2Y1FA 1U28A 3DOCA 3GZ4A 7ADHA 3EY4A 1KETA 1P45A 1RKXA 1MFZA 3ZWVA 1W4ZA 5KWEA 1PJBA 2I65A 1V6AA 4DYVA 4NU5A 1DJQA 1H93A 3I9LA 1FMCA 1GYRA 3DBVO 3K92A 3V1UA 2AQKA 4Z6KA 1EK5A 3QY9A 4DBVO 3N7UA 4WLFA 5FFFA 1QMGA 3WMXA 5F21A 1XG5A 2B4RO 3RUFA 4B8WA 3CZRA 3HJAA 4E21A 3JQBC 2GUGA 1LJ8A 3DHEA 4MOWA 1I01A 1KIFA 3GRKA 5CDSA 2ZJ1A 4UUMA 4ZQEA 3RD5A 4BO1A 2DPGA 3LT1A 1JLLA 3RJ5A 1KC3A 2HCTA 2Q4BA 2P9CA 3F3SA 4NPCA 1YWGO 4U6SA 5KCZA 3PDUA 4AG3A 4IQ0A 1PS9A 3V1TC 3I23A 4ALKA 5G4LA 5KJEA 1H2BA 1WAMA 2B69A 2FR0A 1R0LA 2QIOA 4IBOA 1YQGA 4RZIA 3TOZA 1ULUA 4KUHA 4KQWA 2OBNA 5L9AA 4Q3CA 4W99A 3ZWPA 3CMCO 1SZJG 4J7XA 4RVFA 2FPIA 1P3DA 2CF5A 2BGKA 3A14A 2DTDA 2PKQP 1E3WA 4FOSA 4PIVA 4BMNA 1C0IA 1ORRA 3JYNA 3D3WB 1NHWA 1OFGA 4IINA 3INGA 3KO8A 4OJNA 2CDBA 4I9UA 4EGFA 4D44A 1H94A 4CL8A 3DAFA 1UJMA 2FSVA 4EJMA 3FNFA 8LDHA 3W8EA 3JCZA 3C3XA 3M2TA 4I9NA 4Y6RA 3DXFA 4WLVA 2Y0EA 1ZVMA 3AM4A 3BMOA 4B4OA 2DTXA 1H9AA 2VRBA 4XRRA 1B8PA 3B20A 4TRMA 2GGSA 3RFTA 2I99A 1NP3A 1T2FA 2AQ8A 3RFVA 3VTFA 4J1TA 2PD4A 3ROPA 5IZ4A 1MP0A 3RC2A 3QWAA 3IS3A 5T5QA 2Q49A 1Y6JA 1ZXBA 3K96A 5ICSA 1DLJA 4YQZA 4GSKA 2ZJ0A 5G0VA 4ZGWA 1NR7A 5JXWA 2YY7A 2NQTA 1GADO 4TVOA 5ICMA 4W9NA 4OM8A 3KUXA 4ND3A 1R4NB 5F3RA 3F46A 4R1TA 3WXBA 3IJRA 3GFBA 3DTTA 5JFOA 3FSRA 2X7HA 3FWNA 4XQCA 3WGGA 2JJYA 4GX5A 3OH8A 1MC4A 3HZZA 1QYCA 2QRKA 5DULA 2V6BA 1VPDA 3O9ZA 5L95A 3AOGA 3OIGA 5DT9A 3C1AA 1P44A 3CIFA 4IMRA 3AU9A 1UP7A 2DT5A 2GN8A 5IDWA 4D45A 1HYGA 5C7LO 2NUAA 4IXWA 3ZU5A 1M6HA 2R00C 4J2HA 4WOKA 1FJHA 5JC1A 1JKJA 2DBZA 4BOYA 4YAIA 1RM5A 4JQCA 4BGUA 4CLOB 2C0CA 3OIDA 3RBXA 5G0UA 1XU7A 4PRLA 3ZWWA 5EQDA 4B7XA 4W9NC 3GK3A 4BKRA 1Y5RA 1N8KA 3OHSX 1H6AA 1GYQA 2EGHA 4ND2A 1YDWA 4NBUA 2HUNA 1AN9A 2VHXA 2PZMA 1EFLA 2YUTA 4RLHA 1LRJA 1HYEA 4R69A 2Y67A 2HDHA 4IJUA 1XWFA 3G1UA 2FR8A 3IKVA 4MKRA 3EMKA 1L7EA 5FWNA 1IUKA 4JBIA 3VAZA 3GC6A 1EUCA 1ZZEA 1LA2A 3BMQA 1E7QA 4CR6A 1WZIA 1GTMA 3JQ8A 3JD4A 3U09A 2YHIB 2Y05A 4DMLA 2GCGA 4ITUA 4Q9NA 4J2OA 1PIWA 3PI7A 4HX5A 4RVGA 2PGJA 3ZGYA 4NBRA 2NQ8A 3QJ5A 1QRRA 1GUZA 4ZJUA 1J0XO 3EW7A 4CV1A 2PR2A 4OSOA 2AQIA 3QVTA 3TWOA 3NX4A 4I5GA 5DZSA 3ZHBA 3VPFA 1UR5A 4W7IA 4TSKA 3D4OA 1PS8A 4Y9DA 1PX0A 1JAYA 1ML3A 2Y1EA 3KB6A 2XXBA 3SJ7A 2PD6A 1PWXA 3GUYA 4MPDA 4QQRA 1EVIA 3ZV5A 1Y81A 1DC4A 4J3FA 4FFRA 3AY3A 4O59O 1D3AA 1O6ZA 3CZMA 4RPHA 3CE6A 3HHPA 2JCXA 5BT9A 4UULA 5MDHA 3NTRA 4G65A 5K9ZA 2XXJA 1I0ZA 3FCOA 4DYDA 4KDEA 1CERA 3KYCA 2ZYGA 2RHRA 1R16A 1KVQA 1LSJA 1PR9A 2JAHA 1E7RA 5A9SB 1Y8QA 3OSUA 2IZ1A 1BW9A 1EMDA 4FFOA 4BKUA 1JVSA 4XGNA 2ZB7A 3Q9NA 2C5EA 5JS6A 2I3GA 2VT2A 4TMFA 1SOWA 3PQDA 2J3HA 4OIMA 1WWKA 2PH3A 2FRDA 2I66A 3MWEB 3H65A 5DP2A 3U62A 4I5DA 3RC9A 1UP4A 4GKBA 2XOXA 3TQHA 4QFDA 5DN9A 1RYDA 1WDMA 1ZK3A 4FD3A 4BNIA 1TA4A 4GPD1 2O3SA 2PWZA 2VTEA 3NGLA 3GVHA 2VYVD 1UDBA 1O5IA 3ON5A 1EK6A 5ILGA 1BHSA 1GEEA 3R3SA 1SAYA 2E82A 2CZCA 5JYDA 4ALIA 1D1SA 2C2XA 5CEFA 2NLOA 2EW2A 4HFJA 4YT4A 1E3WB 5L45A 4R5HA 5DCWA 2HMWA 4A73A 1ZEMA 1YRLA 3RAJA 3V2GA 1LLDA 3LT0A 4GAEA 4IS3A 1J4AA 3WOHA 3I9OA 2Q99A 3OF2A 1I3LA 1PL7A 3OA0A 4YR9A 5JSFA 4GX0A 3WG9A 1IZ0A 3DZJA 2BKAA 1PGNA 4DRYA 3LDHA 1RM3A 5CPFA 5ER9A 1YB5A 3NEPX 5EIOA 4CMAA 1G1AA 3GN2A 2E49A 2OORA 1SCUA 5L7WA 2VZ0A 3L6OO 1DFGA 2QW8A 3OA2A 4R51A 4PLCA 1O8CA 2GF2A 5IFLA 3D0OA 4Y6SA 1U9JA 1J6UA 1GEGA 1V3TA 2EJVA 4IM7A 4KP7A 4JIGA 4M8SA 1D7OA 1VC2A 1SMKA 4WLUA 1O95A 1IPFA 2D5CA 3DZIA 3GGPA 3H5AA 3WTCA 2BGMA 1VJ0A 4U0JA 1VL0A 1DO8A 2E48A 3QIVA 4GSLA 3ZNPA 2CD9A 2CDAA 1NQ5A 3W6UA 2Q2WA 2DBQA 3RASA 1DRUA 2C7GA 2VHWA 3PHHA 4GBJA 2RCYA 4U8GA 4WNIA 3FF4A 3SX2A 1KC1A 4GX2A 4CM3A 1LDBA 3V8BA 5AYVA 2V65A 3PWKA 2NTVA 4FGSA 3W1VA 2O3UA 3WIDA 1L7DA 1LNQA 2P4HX 4BO2A 1IULA 3KETA 3I4CA 2X22A 2X8LA 4BKPA 1ONPA 4D3SA 4WECA 3DMYA 1XGKA 4C4OA 4NBVA 1JDJA 4GX1A 5GY7A 2IZ0A 4H15A 4J9UE 4B3HA 1Z6ZA 3K30A 3KSZO 4BO8A 1ZK1A 3UW3A 5I8ZA 4ID9A 3WWZA 2D8AA 2J8ZA 3FRJA 1AGNA 1T25A 1RM0A 1PQWA 2JKVA 3BZUA 1P0FA 1DC6A 1ZCJA 3JYLA 4IQ8A 1LSOA 1UZLA 3AM3A 3D1LA 4RL6A 1TT5B 1P77A 1T2CA 5J23A 1ZSNA 2W4QA 3OIFA 2DU8A 3F47A 4LMPA 3OJFA 1PSDA 1I5RA 1B0AA 3NRCA 2J5QA 3PJEA 3WGQA 2C29D 2ZYAA 5EPOA 4DPMA 3AY7A 3G3EA 4YA6A 3GPIA 5G0WA 2DM6A 1HDGO 1HL3A 3JD3A 4R16A 3GGOA 2PGLA 1RPNA 3AUUA 4BV8A 1ENYA 1P1KA 1G0NA 5L3ZA 3ZWCA 2HQ1A 1H6CA 2UAGA 1UAYA 3WJAA 1U2GA 2WYUA 4NJOA 3PVZA 3U0BA 4CM1A 1EQUA 4GL4A 5L7TA 2ZTMA 1RM4A 2NVBA 3DBHB 4L75A 4TKLA 2A92A 2G0TA 2OUIA 3I1JA 3ENNA 3KYBA 1FXSA 4LCJA 5T8KC 1VRWA 2ZQYA 3N74A 4G2NA 4F46A 3OETA 3E9MA 2Y68A 2DFVA 2AW5A 2JL1A 1HKUA 2AEJA 2AE2A 1X1EA 4BNVA 1LXCA 3VTZA 1AXEA 3H9UA 3PRJA 1GFSA 3DONA 3H9EO 1O9BA 3ZU4A 3GQVA 3L0DA 4GI2A 3JD1A 1N1EA 1U2DA 2CY0A 3GUCA 1ISMA 1BGVA 1QYVA 1Q0LA 1VSVA 2J5RA 1E77A 2RBEA 3KYCB 3JQ6A 5IXYA 2GZ3A 4M54A 1M75A 3ANLA 1OAAA 1LUAA 4W82A 3ROQA 5I7EA 3ZHXA 3RKRA 4WKGA 1EZ4A 3VVBA 2NNLD 1UDAA 1K0UA 4M87A 5ES3A 4GLLA 2I9PA 3IAHA 2O3QA 1A7AA 3KRTA 1W6UA 3RBVA 2Y1OA 2YHUA 3E6AA 4TRJA 2D0IA 4PLFA 3K73O 4BNMA 1P33A 1ENZA 3JSAA 1MXFA 8ADHA 1TXGA 4II2A 4XQEA 3L4BA 4KZPA 4MIEA 3LT4A 4D0SA 4XGKA 3K6JA 1NWHA 5EN4A 1MX3A 4F45A 5JCXA 2IEBA 4YTEA 3JQ9A 1JN0A 4JGBA 2IEDA 4J90A 2Q50A 2YV1A 4R9RA 4J7CA 1DLIA 4CV2A 1F12A 2IODA 4H7PA 5A02A 3ZN2A 2Y0CA 1NBOA 1X7DA 1IL0A 4CR7A 3KTDA 3U5TA 4YYZA 3ANMA 5KKCA 1ADFA 1SO8A 4IDDA 1BXZA 3UCXA 1UUFA 4AJEA 3GEGA 3WGHA 1UAGA 5I8WA 3IUSA 2VCYA 4BMVA 4Y98A 3LC2O 3WBFA 2Y1DA 1BDMA 2VRCA 1CRWG 2BMAA 3K5PA 5HS6A 4DC1A 3EVTA 1ZUD1 4L8VA 3BTVA 4K26A 1B14A 2J3KA 1E3IA 5A9RA 1OC4A 3WGYA 1E5QA 4QECA 9LDTA 2EKQA 4J91A 3RI3A 2BD0A 1C3VA 2GN6A 2EERA 3AJRA 3L4BC 4MVJA 3INRA 3DC2A 4RQUA 1BXKA 4XCVA 2V6GA 1M6WA 4CM9A 2HLPA 4IMPA 4E5YA 4EZBA 5EMHA 1MB4A 4BKOA 5IG2A 2EF1A 5JDIA 4BMSA 3CEAA 4Z9XA 3SLKA 5BQFA 4MKZA 3Q11A 3LSYA 4QEDA 1I3KA 1HDZA 2NTNA 4XB1A 3ZZNA 3UUWA 1B26A 1TI7A 4CL3A 2VWPA 3WS7A 2X0IA 4XDZA 4QUKA 4NFHA 2D1YA 3UF0A 4DXHA 5KJFA 1Z7BA 4S3MA 3JQFA 1PZHA 1N5DA 3H9JA 5TSDA 2AG8A 5LCXA 1GL3A 1ARZA 3PTZA 5DNAA 1R4NA 4PZEA 4N5LA 4DIFA 5DCYA 3O8QA 1GU7A 3RU7A 2F00A 3WGTA 4AJPA 4B8ZA 5U1PA 3ONDA 2IDZA 3DZFA 4UUPA 4IPTA 3AUTA 3MJ4A 1IZ9A 3JQ7B 1EUZA 1HEUA 4CM8B 1XIVA 4FC6A 4GWGA 4J1NA 4XR9A 1WZEA 2ET6A 1NWCA 2OXIA 5CDUA 3BA1A 2Q4EA 5EERA 4PG8A 4TRRA 2HO5A 3NJ4A 1LEHA 2D2IA 4PRKA 3ZWNA 4I8XA 1Z74A 1PZEA 5TT0A 1C14A 1LLQA 1HDCA 2AXQA 1WVGA 4CLOA 4XZ3A 5DP1A 4EI2A 5CAEA 3JQFC 4UEKA 3RU9A 4PG7A 3W4JA 2JD2A 1QP8A 4ZN6A 3QSGA 2PNFA 3QVSA 4QXMA 5JO9A 4AJIA 3VDRA 5AQ1A 2NVWA 5A5FA 1PJSA 1KVRA 1KERA 4J4BA 3INTA 3ZNNA 4E31A 4JN6B 4M89A 4PLYA 4M55A 1K3TA 6ADHA 3HFGA 3UH1A 4KDFA 5I7VA 4BNXA 3M2PA 4LRTB 4PG6A 3LVFO 3I9KA 5C5IA 2P5UA 2WEKA 4DL9A 1JWBB 2IYOA 1V3UA 3DOJA 3LZ6A 4R1UA 2QHXA 4XKJA 4CM4A 2YHIA 1AHIA 3BHIA 3JYQA 2YDYA 1LLUA 3NT5A 5A05A 1MGOA 4NI5A 4R5MA 3TZHA 3DBLB 3UCFA 1A27A 3KLMX 1X0VA 1R0KA 3V2UA 4MVJP 5KVSA 4RZHA 2H5LA 5JC8A 1XKQA 1KEPA 4PN3A 1LU9A 2X1HA 4OXYA 2JFGA 3NDJA 1MLDA 2FPGA 2X0RA 1MFPA 1D1TA 1V9LA 3S55A 4DGSA 1YBVA 1U4OA 1U3WA 2D59A 4CUJA 2I6TA 1Q7GA 3KVOA 2UYYA 4AJLA 4E32A 3IC5A 4FFMA 4TZKA 1BRMA 4QO7A 1BXGA 3UVEA 1DJNA 4G5HA 1YL5A 4BKQA 3EC7A 4KOAA 3HSKA 2P9GA 4Z9FA 5A9SA 1NASA 2EKLA 2P91A 1WP4A 5EQFA 2VZ8A 4IY1A 5CEEA 2W98A 5JDCC 1ZFNA 4JROA 1Y9AA 1BMDA 5T6BA 1YBMA 1ONNA 5IDYA 4NU6A 4BNTA 3KSUA 3C1OA 3RROA 1E92A 3LC7O 2DPHA 2WJPA 4AJ2A 4RGBA 3SVTA 3PYLA 2PKQO 2VYNA 1ADBA 1VLLA 1V3VA 3PZBA 1AHHA 2NU8A 3G1TA 1LLCA 2EW8A 4DA9A 4CUKA 4DQVA 3IDSA 3HB4X 4Z0PA 3IQDB 2ZTVA 3FNHA 4TZTA 4BO5A 4AFNA 3NTQA 1VE9A 1KY4A 3DBRA 3ETEA 3KEQA 1Z75A 3GFGA 4YAKA 1PS0A 1QYXA 2Y93A 4P4GA 3WSVA 3N58A 3GAFA 1A71A 4TRNA 1E3SA 4W4TA 3H5RA 4DPLA 3KZVA 3LF1A 2ZCVA 3R0IA 3DZKA 1M76A 1PJ2A 4AJJA 1Y1PA 1ZK4A 3ZHZA 1PTJA 4O1MA 3Q0EA 3C8MA 3JYOA 3PLRA 4LISA 3VPGA 5C37A 2CNBA 5ENVA 2Q45A 2G5CA 3E1KA 2VOEA 4OGWA 4TVBA 4XB2A 5JY6A 5K0ZA 3PWZA 1K2WA 4BQRA 1LC0A 3PJGA 2NWQA 3JQGB 4PG5A 1MUUA 3PIIA 4DLAA 2HMTA 1Q7BA 5I7SA 5AXAA 1I2ZA 2VRCD 4UVGA 3GOHA 4AL4A 1Q1NA 1CQJA 2V6FA 1KS9A 1X0XA 4FCCA 3TFQA 4WEQA 3SLGA 4YVFA 3GHYA 4KMSA 3KM0A 4C7JA 2R00A 2GDZA 4GGPA 4MVJD 2EJWA 4AICA 5B12A 4IQGA 1E1MA 3WMWA 2YV2A 3MJSA 2NTJA 1B2LA 2HMVA 3MWDB 2BFMA 3FTNA 3PEFA 3WGZA 3GY0A 2Y1GA 3QE3A 1P1FA 3TJRA 1PJQA 3TZKA 2CVZA 2P4QA 1T24A 2PGDA 4A7PA 5F1PA 2EWMA 1V0JA 1XHLA 3O8QB 4MP6A 2HK9A 3DOOA 4OXKA 2B36A 1HWYA 1T4BA 3FWZA 4OXNA 1NM5A 3AW9A 2X23A 4N18A 4I08A 2NU6A 2ZTUA 2CDCA 2HKIA 1KY5A 1RWBA 2AHRA 4Y6PA 3WICA 1R4MB 2X58A 2R2GA 1YOVA 4FFLA 3D3EA 1TLTA 3QVXA 3RUAA 4E4YA 4R4JA 2O2SA 4PLPA 1ISIA 2EGGA 3C7CB 4J9VA 4U5QA 2DBVO 1TEHA 5CEJA 4FW8A 3ZWAA 4DLBA 3P7MA 4OKNA 1LTHR 1XA0A 4XIYA 4DQUA 4IZIA 4BVAA 4WOJA 4W7HA 2FHSA 1Q0HA 1IPEA 1VI2A 1P9LA 4CLRB 4P8RA 3UFXA 2AEFA 2X5JO 1A7KA 5TRTA 3MJTA 3W4IA 1UH5A 3ZWMA 1AUPA 2POQX 2YQ4A 3W8FA 5JAZA 1SEPA 3KEOA 3WQQA 3SJUA 4RF3A 2J5KA 4PGFA 4FPXA 1TT5A 1Y8RB 3KBOA 3H9GA 3O38A 4JP2A 2EP5A 3AI1A 4Z0HO 4OYRA 2QG4A 5G2OA 4JNKA 2A94A 3RUHA 3NV9A 1BVUA 1K5HA 4I1IA 2Y66A 3D7LA 4K6CA 4ZICA 1ADGA 4HFNA 3FN4A 4WUVA 3FBTA 4WJZA 2A4KA 4CM4B 1DXYA 1EE2A 1E7SA 3CTMA 4Q3NA 1I32A 4IIUA 1F17A 2O4CA 1DRVA 4J1QA 1HYHA 1IHYA 3F5SA 4D41A 4FBGA 5CP8A 2Q3EA 4F3YA 3PK0A 4PZDA 1V35A 2H63A 4CLHA 4WASA 3DBHA 1LRLA 1WLYA 4YAGA 3Q2KA 4MO2A 3PHIA 1ZK0A 4BS9A 3OJOA 5FI5A 4KWHA 4EYEA 3I6IA 1PGQA 2Q1TA 5HS4A 5A5EA 4NH4A 2O4UX 2C7VA 3DDNA 3I9MA 1WMAA 3DAGA 3WNVA 5IZCA 3HFSA 1ADCA 1IHXA 5HWSA 1P31A 1GQYA 2BI8A 3LF2A 3T7CA 3Q3CA 5GZ3A 3GVCA 4PFJA 3AM5A 1BXGB 4GMGA 5KVCA 4JK3A 2V7PA 2C59A 2WSBA 4TKMA 1NR1A 2X6TA 4E5PA 2EG9A 3PLNA 1NFQA 4YJFB 1OZAA 3H6KA 3IUPA 4RDIA 4BGVA 1KVUA 4YWJA 3PPIA 4WPGA 1GPJA 1K6JA 2D3TA 3JYPA 4Q3DA 3B1FA 4AJHA 2EKPA 4J16A 4D43A 5F1KA 3WSWA 3K2EA 1X7GA 4QSMA 1GV1A 3G49A 1I33A 1HLPA 4WLNA 2OP1A 4XX0A 4JXKA 3V2HA 3VZPA 1YE3A 2PZJA 1UZNA 3WTBA 1D8AA 3NYWA 4QO8A 1T1RA 4M1QA 1NVTA 3VPXA 3A4VA 3HADA 5IZCC 1A5ZA 4NQZA 4CV3A 1ZXLA 2YV3A 3RUDA 2PFGA 3U4CA 2CVQA 1ONOA 1PQUA 2GRAA 3DBRB 5JLAA 5U9CA 4NK5A 4GKVA 3BMCB 2VYND 4RDHA 3BMNA 3GNQA
chains in the Genus database with same CATH superfamily
2JC3A 4ISBA 3ZHCA 3UK0A 5LMZA 2B0JA 4DEVA 4AP9A 3RVNA 2B8JA 4UDYX 1V71A 1YCDA 3ZLTA 1ULTA 5KHOC 3ZW7A 3GLFB 2GX6A 4QDJA 2HLHA 4KRGA 4H6WA 5K99A 4B35A 1K98A 3PFWO 1YI0A 2CVPA 1RPJA 2ZYTX 4U2FA 4URVR 4UTNA 1KIMA 3V33A 1SKAA 4AXBA 2XTNA 2J7PA 2CT8A 5JEDA 3H4VA 2GK7A 4Q39A 1L5SA 1QQAA 3JR7A 3ZNOA 4OL9A 3D8SA 1HT2E 4JGIA 1GP2A 4YRQA 2P2ZA 3DO5A 2H5JA 4IX1A 4PPNA 2XJ9A 3B53X 4PBRA 3NJRA 5ICFA 3SXPA 4RZUA 3CY6A 2XB2A 3R5KA 4O2BA 3SF8A 3ZE6A 1EWQA 2Q28A 1G5IA 2XQKA 3AR6A 1E61A 4YONB 4YJGA 2X40A 1K7CA 3ABZA 2N3ZA 3JQCA 1WSBA 2O3TA 3M4NA 4YPFA 4MK4A 4OJYA 2LCFA 2IZOA 4M36A 3DKVA 4CCWA 2F67A 2ADOA 1G7CA 4EPXA 5CYOA 2QBYB 4C6TA 3R3JA 2HIHA 2PM8A 3FPJA 2Q4OA 2QM7A 3Q6IA 5CRIA 4K05A 5J2UA 1Z2NX 1F6WA 1T34A 4BNHA 1TKRA 2X9VA 1WDWB 2J3DA 4MRRA 1T8RA 4UE2A 4K9KA 3HDGA 1L4MA 2IRWA 4KWIA 5JQGF 1T43A 1R10A 1V2HE 1ZIDA 3GLIA 1ZI9A 4D82A 2ZYWX 2NM0A 1G5TA 2ZWPA 2FCRA 3RC7A 3Q5EA 5J4LA 1ZEJA 2C9MA 4NDNE 5DFAA 3ST7A 3U37A 4HGYA 1U3VA 4CZ2A 2FSPA 1Q6ZA 2HN9A 1KYYA 3DEAA 3HRKA 3PL1A 3TRKA 1GQSA 3GHHA 3BHJA 4QBTA 4BP8A 3ZD7A 1ZCZA 2FI1A 3OIYA 4LZJA 5ECDA 3U4DA 1LSSA 4R9SA 4RAQA 4CV0A 4O63O 1DIHA 1J9GA 2NACA 4U2EA 2D3WA 4H18A 1L4YA 1V8FA 4NF2A 5A04A 2B5VA 2QMQA 2I34A 4LGYA 2GD0A 4EGSA 2G1JA 1EA7A 3LPDA 1TNDA 5CDFA 4G36A 1GUDA 2WOOA 1VDMA 3P2EA 1F1JA 3PE6A 5KOIA 1Q44A 2QN8A 5C53B 4GOLD 4PC6A 4GEKA 4R2KA 2GKGA 4YRRA 2KS6A 3VHLB 3HL4A 3HN7A 3MTEA 3OM9A 5KNLA 4TL8A 2JAQA 4D0LB 1A1SA 1YB7A 3M34A 4ILEA 4PO3X 4B4UA 1Y6GA 2QUHA 3VKUA 3OOWA 4FBLA 1I30A 4DIMA 1TAUA 2H54A 5FTKA 1WZUA 4JBYA 1E8DA 1MJGM 2V58A 3DD5A 3G8YA 3V00A 3MQFA 1OYVA 1GLVA 1NVDA 1IHPA 1L7PA 4WA8A 3S2FA 3UC5A 1VMKA 5J63A 3L7MA 4G0VA 5BN1A 1SXQA 2YFYA 3PENA 2PLWA 3O4FA 2H6EA 4X45A 3VPBA 4TQUS 3AEUA 3DTVD 1PN3A 4OQXA 2QGZA 3E9QA 1ZBDA 1L3IA 4CU2A 3ENKA 1B6GA 4US1R 1W49A 4CFYA 3WL6A 4A0HA 5AI9A 5ILQA 3VV2A 4LJAA 2VJCA 3X2FA 4C3UA 5HZHA 3OM0A 4M53A 4N3NA 3R40A 3FYUB 3EA5A 4OHWA 3NTXA 3UJDA 3HGMA 3O8BA 5I7RA 1DIOB 4GBED 1E99A 3HB5X 2DUNA 4DR3B 2A5JA 5CITA 3GEPA 2B8TA 5FBHA 5EI5A 4ZC8A 4MGKR 3PTAA 1N2SA 1SVMA 5JJ5A 1K1EA 1O97C 1TB4A 4JLKA 2WMNB 4XQGA 2L0XA 1WXDA 4S12A 4B31A 4Q1BA 3DT9A 5L4LA 5KSZA 3E5MA 4RJIA 2KMLA 5IU6A 1M34E 4HEA6 5A4DA 1KMMA 2FZWA 3OKFA 1YJQA 3SEFA 3HMKA 3PYXA 4J0KA 2WPDA 4LZNA 3KS9A 4R1NA 4L16A 5D6OA 3CZQA 4CR8A 1BQ4A 1C8KA 5KTKA 3S2IA 1Q83A 3VOBA 1EBFA 1V96A 1P6XA 2HU5A 1LI4A 1M8KA 1RRGA 3BGOS 1QK5A 3ITDA 3M1IA 4AS1A 3IHTA 2YMLA 2CYCA 1U3DA 3GUZA 7REQA 2R4QA 1J8YF 2VO1A 4QRHA 4BPBA 3GGSA 4KHZA 1I2BA 3ICCA 1QHFA 4RX1A 2EZUA 3CINA 4D9KA 5CA1A 3LM8A 2QN3A 1NQUA 5F51A 1EG7A 2WJ4A 2F1RA 1FBTA 4IDOA 4ZYZA 3PXBA 2XIJA 3N5KA 3ZS9A 1WTCA 1JEYA 1Y34E 1THGA 2PMWB 3CH6A 3KPJA 3VR3A 4DDKA 5B57C 4CQLA 3UMFA 1DIAA 2OHXA 3G5UA 4HAUA 5BYAA 3ZH2A 3U56A 2IYPA 2R6JA 4PWZA 3W5BA 2ZKLA 3C5CA 2Y1WA 1Y8ZA 1Y4SA 3IQEA 3QEMB 3EGCA 4HDMA 2A0UA 2ZT5A 2EP8A 3BEOA 3KYDB 4NZYA 3FVQA 3DV9A 3NH9A 4RVHA 1E4OA 3HKBA 5JBNA 5JHGB 5JTTA 2BTEA 1HX7A 1NXPA 4E7OA 4MCIA 3WRXA 1JIVA 2C00A 2FEMA 2VSXA 3ABIA 2ZBUA 4QYTA 2FJ0A 2G9UA 3JALA 3QMVA 1X7ZA 2IXAA 4FE7A 3CLTC 5DBFA 4QLOA 1JHZA 1PNTA 5F7OA 4AKGA 5D00A 3K2BA 1TCUA 1BXRB 1ZUNA 4BBPA 4L4XA 1VSUA 4M46A 4A2CA 2X1MA 5FEMA 4C2UA 2QRVB 3FSJX 3A4LA 1GNSA 1NUTA 2F17A 4ROSA 4TZ6A 1QORA 2YCBA 1EESA 3VO2A 1QRDA 3A9UA 3NM4A 3SSMA 1OV6A 4E6PA 2CK3A 2HSEA 3BQNB 3HQ4O 4H0FA 4UMEA 5FBZA 4YQYA 5C4GB 3K0AB 2NU7B 3BMNB 3EDRA 4DXAA 4EK9A 4KU4A 1NXXA 5GGXA 1QYDA 1ATZA 3IULA 4O08A 3IXLA 4YB8A 2OOKA 5KQSA 3GD7A 1JHUA 3BVPA 4GP9A 5EPUA 1YXMA 4BVEA 2W0MA 4F92B 1JYEA 3PDWA 2YS6A 1PHRA 2GYWA 5KNCA 2AOUB 3LXXA 3PFIA 4LVUA 2HRCA 2QM3A 3NIFB 3UMRA 3ETDA 5B4VA 1WL8A 3DM9B 4QU8A 1MC5A 5LNK1 2EAUA 5FI1B 4RJKA 2OY0A 2JEOA 3L79A 3E15A 2NNWB 5B3KA 3SQWA 3EA0A 3VM6A 1E63A 1KNQA 1N7HA 3PFHA 2BZSA 4E1BA 4MYUA 5KJ1A 2FE1A 2V55B 1XJWA 2DFDA 1D2EA 3G7SA 4Q4HB 4A26A 4Z8YA 2JFHA 3B9RA 1DBVO 2J7PD 3ZZ1A 4P5DA 4Y67A 3OIVA 2O50A 4ZCRA 1MT3A 2F8LA 2W2VA 2QI9C 1K86A 1T36B 1ID1A 2AFHE 2O2YA 2PGNA 3MOSA 1PAUA 1T5OA 2M6RA 3KKLA 4KH1A 3AOEC 4BMPB 2G67A 2NSJA 3DB2A 3CM0A 5LP6F 1JIKA 5GZ6A 1PP4A 4YX9A 2H9AA 1JEJA 1ZNYA 2C2KA 5E7QA 2R6AA 2X77A 1U98A 5EUQB 1VGRA 3NATA 2ECQA 3G2OA 4Z9BA 3OT5A 1OASA 1JHOA 1U2SA 2ZM6B 3CUYA 3UV3A 1OLSB 1RVDA 3E4CA 2KLBA 3KP1A 4JXXA 1J8MF 4TV9A 1T9GS 2FJUA 4CLDA 2QRQA 3SOZA 3ZHRA 3VTKA 4I1VA 1OLXA 4BGIA 1R8SA 4TTIA 4AAYA 4JUBA 4D3YA 3HLTA 2G06A 1RW4A 2YVAA 3R1IA 4HR7A 3VVLA 5ERYA 2FLWA 3KHUA 4GUDA 1M3SA 4JJEA 4G1MB 1KSJA 3ADKA 2RGAA 3DOHA 3MMSA 1WCYA 3O3NB 1ENOA 4BV3A 1CS0B 1REQB 4DCTA 2UYGA 1GAWA 1G5FA 2GN9A 2J67A 1L3CA 3CX7A 5K2MA 4YDSA 3ESQA 4DNFA 3SZUA 3BTOA 3UJ3X 1R9GA 3HY6A 4F7DA 1TF2A 4IVQA 5K3DA 4EUFA 1GILA 5K51A 1E9VA 3HCFA 3ZI4A 3PFCA 5IWAB 4QHTA 4UBMA 1FLDA 1HT0A 1JQ5A 4XCXA 1FP4B 3IVAA 4YQFA 5AW4A 1PDOA 2YIDA 2I22A 1Z5PA 2ZIXB 3PE4A 3GEIA 3H8SA 4HRAA 4A2PA 1KJYA 6PFKA 3BJRA 2HPZA 2V7EA 1YUBA 3ASVA 3D0RA 1EKXA 2X8AA 4LYYA 4U7JA 4CLRA 3VC7A 3TG2A 2VQSA 4LGVA 2FW1A 4Q3EA 4YRIA 2X8WA 2Y71A 1DINA 1GXSB 2GD1O 2QN1A 4U4AA 3OE1A 4LQ4A 1O1YA 2EFYA 1QH0A 3G79A 1P80A 3SEQA 4EY3A 4S05A 5FOTA 1XN4A 4CMIB 3QBJA 1E9DA 1FDSA 2JLBA 1FQKA 2ZITA 3VQTA 2HJGA 4S1VA 3RIGA 4FN5A 3E27A 1RCUA 1XTUA 5G4KB 1AE1A 3Q2OA 2OQVA 3VDXA 1N3LA 1LSUA 1YTLA 5IAGA 1PWHA 2DXIA 4FGLA 1O96A 1EK1A 3IUBA 2ZBFA 3GLIE 4C88A 2JAUA 4RD4A 1B6TA 4BCCA 4I99A 4G25A 2GXUA 3GARA 3IFSA 4GH5A 4REQB 2YY6A 4FWBA 1G2PA 1YMVA 5K09A 3BC1A 2DULA 2IUSA 4LQLA 2XQFA 1PL6A 3GUUA 3MWFA 1NBMA 4GT1A 3VYUB 2PQMA 3W8DA 1G16A 2QTVA 3O03A 5JANA 2QQ0A 4RPCA 3E48A 1HE5A 3JVVA 4WD3A 3MRSA 4JLWA 1YB1A 4JUAA 5I9LA 2Z9BA 1XDBA 4J0FA 3R0JA 3MTBA 1CKEA 4TKVB 4ZREA 3IIKA 3WLFA 4B7UA 4YT8A 3MFQA 5CDFE 1QF7A 1OAOA 5JISA 1PQ4A 1JQ3A 1Y1LA 3QUAA 4KXVA 4F3CA 3BB3A 3Q9LA 4QA9A 4ZOAA 2WPDD 2QM0A 1JWAB 2ZRAA 3ROTA 5JJIA 3ODPA 4LMAA 2O8EA 3Q9UA 1UZMA 1TC1A 2C61A 4L5YA 4PHHA 4XYMA 3S2GA 3TIGA 4FQ8A 2QTGA 3G0OA 3IAM6 1CV2A 4BV2A 1LDEA 2ZUTA 2HNKA 4CMJA 2IKSA 4R84A 1OSNA 2QSZA 1A7JA 4J2TA 4NJMB 4UQPA 2DHEA 3M6AA 1G18A 4F8EA 2QLLA 3H4TA 4CF4A 2Q5HA 4TSFA 3S68A 1QJ4A 2OP0A 1O3YA 4C7MA 3MG9A 3DR3A 4QYMA 2WHEA 4HLNA 3W79A 4K81B 3FTEA 2BRUA 1GL7A 4Q3AA 3RVKA 2ONCA 4WQMA 2XLBA 2Z8YA 3HMQA 3FG9A 1SC6A 2BISA 1A95A 1RYEA 2VAMA 4RV9A 3AESB 2X5KO 2B92A 3BG5A 1EDDA 4P53A 3VR3D 4YRGA 5BW4A 4GLOA 4MVJM 4F1WA 1N9GB 1Q0QA 4OQ4A 2FG7C 2ZVDA 2GJ8A 4RKRA 2E89A 3QMPA 3VZSA 2JBWA 3N2NA 821PA 4E2YA 4OO3A 3CIOA 3UG6A 4WY2A 4BFSA 2VPZA 4N48A 4OBWA 1FRNA 1BS1A 4FGKA 2OCDA 2PLRA 3DFFA 1AV6A 1UJNA 2Y99A 1Q2XA 5JS8A 2LCQA 2EBFX 1EVJA 3CPSA 4HRVA 2G82A 3QPAA 4A2QA 4WGGA 3AKEA 4X8OA 5IXJA 3MHPA 5IN4A 3QVKA 4FE3A 2KI5A 1TIPA 1CYEA 2LIVA 2Q0HA 5IDQA 2P8JA 3AEYA 3ZIAD 3IPLA 4CTMA 2X0NA 1U5CA 2A5FA 2XCQA 2J46A 4HXEB 4JQOA 3T9DA 4YRBA 2VQDA 2XWSA 2EZTA 3CRVA 2XR1A 2HRBA 4XX1A 3GCDA 1XP8A 4MCAA 4XR4A 2SCUB 5BQ3A 4EPRA 4Q3BA 3GMDA 5D6NA 3P0JA 3GLFA 1W5FA 3DAOA 2O57A 1R64A 4P1ZA 2YRWA 4JI3B 1SKMA 1AK1A 3L02A 5P8WA 1FJ2A 1G5PA 3KBBA 4HWPA 4UU8A 3RS0A 5GIPE 3IJPA 4RNDB 4MWSA 1XYVA 2ID4A 4BLRA 4CN8A 5SY6A 1JXMA 3GJ8A 1ZD9A 2P5TB 4Q24A 2O3RA 3OURA 5DI9A 5B36A 2Q5LA 4G0PA 4I55F 4QVKA 2YWBA 4PYMA 2ZUFA 3PX7A 5LWHA 1FDTA 1RJ9B 4YP1A 3U3ZA 1OQAA 4DCJA 4DWVA 1X3SA 3VR5D 5K05A 3KQHA 5DGCA 1TYZA 2Q5EA 5KNCD 2HF9A 2BYTA 3AF3A 3L5KA 3R3ZA 1JHXA 1W5SA 3WKBA 3ORYA 1JILA 4MJLA 4CKCB 1UIMA 3PQ4A 4LWOA 2BGIA 1UKYA 4L76A 3JVIA 4BB6A 4O25A 1OU0A 4TWIA 1TVKB 4TLAA 5EHIA 2OC4A 3MVEA 2SKEA 4LOAA 3RTCA 3FPLA 1FDVA 3ZS8A 1ISSA 4A1OA 5TPZA 3HXPA 4CM9D 2QBYA 2OXEA 1VLZA 1U7TA 1Y7LA 3PB3A 1GZ5A 3ROZA 3RC8A 4Q1FA 3KSBC 1LD3A 1T6XA 5DVZA 3WYBA 2W6MA 3VXKA 2GZRA 3A26A 5I9MA 3CUUA 1H0HA 3N0WA 4MVXA 3AV0B 2H59A 2W6JA 5DWDA 4AJOA 6ABPA 1CHDA 2W8ZA 4BNWA 3UK6A 3ZBTA 1R6UA 4LWZA 3MGAA 3MHTA 10MHA 1XF9A 4Y9TA 2FPXA 3OC6A 3GPLA 3SJAA 5A03A 2M9MA 1YL7A 2PCJA 4MW4A 1P4GA 1T4CB 3GH3A 2NZXA 4KE6A 1PSZA 1U1IA 1X14A 4EABA 5JAPA 5KYWB 2MCFA 4QULA 4RPLA 3PICA 3LBNA 3F90A 1E6MA 2W2KB 2B5WA 2Z3WA 3FJOA 3Q8WA 1RYMA 3ERCA 3Q1KA 2C04A 3AU8A 5DDIP 5DLPA 1ESNA 2QB5A 1JMVA 1SVNA 4EY5A 5ER6A 4C0QC 2R0QC 2OOSA 4RGQA 1ZM7A 3K9FC 3W5IA 1VB3A 4YK7A 3RVQA 4MYTA 5M7EA 3L07A 1GUFA 3FJ1A 3NRJA 4FFSA 4D9CA 1KQOA 3FNGA 4L51A 3ELDA 5EP4A 1V7QA 1PQPA 3FDFA 1UC4B 1W46A 1WO8A 4W1QA 3CJQA 4HQOA 1NQXA 3R5FA 4LN1A 2FPRA 3JZMA 3QKUA 4ANFA 4F5ZA 3FOWA 3A3OA 3F1KA 4PO9A 1AKWA 1M1YE 4PR0A 1J1IA 3B89A 5F3WB 3V1MA 5DEIA 2O1EA 1H2EA 1ODKA 1KIAA 4O5OA 3W77A 3B52X 2YNMA 5AK5A 1ODJA 3UMGA 4TYYA 1NAHA 3OCJA 3IO5A 1WDKA 3GJQA 4QGBA 4MGEA 5KNDH 3IOEA 2PKEA 4JLMA 3F5QA 3O9MA 2IY7A 1GQRA 5TB5A 1HRKA 3UHFA 4Z8XA 3SYMA 1NBAA 2OVFA 4MARA 5HF6A 1M0SA 4LNUB 1LBSA 5HCUA 5B7NA 1EYZA 3CKYA 2WHPB 4QGHA 1ODIA 1P4AA 1RYZA 3EZXA 4RWZA 1YAJA 3JR3A 4ARBA 4LF5B 1GKUB 2GYYA 1OZFA 4S1NA 2QD1A 5B1HA 3HPRA 4PPQA 1SU8A 4GF5A 2XGJA 3JD0A 2P3QA 4BFTA 1Q14A 4CM5A 1XEXB 3PP8A 5I5GA 4US2R 1O54A 2OLEA 3INNA 4HPWA 1Y5MA 5DJ5A 3FYTA 1DAHA 3NHYA 4KIFA 3V2IA 1C8VB 1X19A 1WQ1R 4ZODA 3EYWA 3H9QA 3QUQA 2XGMA 5LQNA 4KPYA 2IGBA 2WDZA 5U4QA 1WG8A 2PE5A 1FTYA 1X86B 4FDAA 4Q9IA 2ZWMA 4E5UA 5KIAA 1NBMD 2ACVA 4KXWA 1QFMA 1KOGA 3PXUA 2FK7A 4JI0B 3NHKA 4A5OA 1WHTB 2C9BA 5HQTA 1U8AA 3PUVA 3V7FA 1H22A 2JHPA 1HE8B 5ENDA 1G8KA 4UMFA 4EX6A 4W5QA 1KQFA 5L3QB 2IHUA 1M8GA 5BSHA 4ZA2A 3SFZA 2KW5A 3JRWA 5EXTA 2LDBA 2XRYA 4UOQA 3RKUA 4BEBA 3I5UA 4DY6A 1N78A 1F06A 2WMDA 3H1GA 4HNQA 3U3RA 4DNOA 4EH1A 3D6VA 4ARIA 1NKSA 3NDIA 1NOIA 3ORFA 4R68A 1N1DA 3DEYX 4RSGA 3UGKA 2Y0PA 3FAKA 3KZOA 2FMXA 3BIJA 4J4HA 3MLAA 4PYNA 1W25A 3ICPA 1VL1A 3D64A 4TMXA 4AC9A 2DQ4A 1DFHA 2W4MA 3B78A 3S2ZA 3UBMA 3KYDA 1UXIA 4YDHB 4ZDIA 5KQMA 1ZM3A 1E5VA 2AR0A 4PCUA 1YZKA 3DG9A 5G1PA 2P30A 4HMPA 2VP5A 4DC0A 3I73A 2BF7A 4NZPA 3B6ZA 5FADA 5CXUA 3ES9A 1QGZA 2VXCA 1W44A 2NTEA 4IFBA 4MW9A 4TSFD 1ZG3A 2XRMA 2C7RA 4UJ5A 1BH6A 3O7WA 1I8TA 1K6IA 4DARA 2YASA 1YI8A 1Z29A 3RS4A 5JZOA 4L0CA 2AYXA 2O0LA 3WLEA 2ZYVX 1BXRA 2QNIA 1ONBA 2BM9A 3I42A 3IBYA 2ZCUA 2QRVA 3L7LA 1A1VA 4X7PA 3E2IA 2P4SA 2I7TA 1CPYA 5C4MA 1HDRA 1H2HA 1U0LA 3HS3A 3P94A 2PQ0A 4LZPA 2J0UB 2N42A 3FX2A 1RS0A 2KSQA 3R77A 1VYUA 4QL3A 1W59A 2ZDHA 5L3SA 1YVDA 1ZH0A 3K0AA 2NU7A 3R2JA 3OCCA 4DLSA 2Q4RA 5F2NA 1ETHA 1ZH6A 3KAPA 2JIQA 3V7YA 3JZAA 4R3UC 2BFWA 4JP8A 3RS5A 2AYZA 4KH0A 3BE5A 3FVRA 2HW8A 2WILA 1OZGA 1TK2A 3QMMA 2Q3CA 4MVJF 2UVDA 4H7EA 3TKLA 4IIHA 5FEUA 2NW6A 5K8TA 4A8JC 4IIGA 1E6WA 1IOZA 4XGRA 4V0KA 3MMXA 1DBWA 4DIOA 4QDZA 3Q3IA 3P9SA 1UP6A 1C80A 2BY4A 4G1VA 4KQ1A 3ZWYA 2P4UA 3X1KA 4GOMD 1ISFA 2FPIB 1UWLA 4LDNA 4O6VA 5CDGA 1N3IA 4E5NA 4CIAA 2QV0A 4DAOA 4G5OA 2XUDA 4PGMA 3SC3A 4CMHA 1MB3A 1X9GA 3RRJA 1IN7A 1BQEA 1I80A 4M6WB 2I3ZA 3NIBA 4Q4HA 4BLSA 1YT5A 1GRQA 4YLGA 3DH0A 5GINE 3LCCA 3N2IA 4R6WA 1KP9A 4G8BA 2ZATA 1T36A 3FFXA 1J06A 3G13A 3H5WA 3MTDA 3U7QB 3U19A 3U1BA 1GAEO 2I2XB 3COJA 1E0AA 621PA 3ZQ4A 3AFNA 1S9DA 2NVUA 2OR3A 2H1SA 2NUPB 2LUOA 1JKFA 3KOUA 4GC5A 1IHUA 3BMOB 2CXHA 3MILA 4ECAA 4EDFA 1Z0IA 3EWSA 4OUDB 1C29B 2PKRA 4YACA 4WINA 2W9XA 4QAQA 2P65A 3NTUA 3DO8A 3ZKAA 2H8GA 2RGWA 3G0GA 3L04A 3T61A 1SQ5A 5AW7A 1OLSA 2PBZA 4G0WA 2O8CB 5E4TA 5T64A 1S7CA 3D3QA 2GZAA 3GD5A 3AMVA 5TPZD 1QP4A 4RD3A 1QO9A 2BCJQ 3ESBA 2OFPA 3VYTB 4BIIA 3SAJA 2WTBA 4GMKA 4UEJA 5DLDA 2DWOA 2PLFA 3KVYA 1RBQA 3PHJA 1Q3TA 1RJGA 3GG2A 3DBIA 5AOBA 4V0MA 4D8VA 4JUFA 1GUYA 1ORIA 2GCNA 4LJ9A 1ES9A 4WT7A 3NTOA 2A4MA 2PO7A 3N6RA 4B85A 4KKVA 3EPJA 1J5XA 4LF9B 3FMIA 1Z7EA 2GSWA 1YS7A 4CQNA 4ENPA 5HA5A 3WYGA 5JYEA 2DQSA 3DZHA 2AC2A 3OC0A 3QVVA 1OX5A 4PC1A 4DV5B 1R0WA 3NV7A 3R6GA 4BE7B 3P4YA 1FP4A 5JXGA 2G83A 2UUPA 1O77A 1N9ZA 2ZIXA 1A4XA 3BQMB 3LKBA 4N0DA 3D6UA 4PHTA 1B8UA 4ASUA 3M1LA 4B82A 4E0BA 2O8DA 2BZ1A 4EAAA 2WINI 1EJ0A 4E5MA 2Q1XA 2RGRA 5JS1A 3G9ZA 4GRIA 3UMVA 4KAAA 2NXWA 1IJBA 1GXSA 4E09A 2JCSA 2VRWA 1EUDA 3ZJVA 1Q19A 2EFJA 1HV8A 5C5DA 1YHZA 1T2UA 2X9LA 4G84A 2OQIA 4M9RA 4TT3A 3IQWA 3Q6NA 1E2IA 2VUIB 3F8TA 4CMIA 3K0SA 1DAGA 3VUFA 1GNLA 5JMPA 3O92A 4P2GA 3SE7A 3UMBA 1G38A 2CW5A 1AS3A 2IEAA 2R44A 4OJQA 1IYZA 1UDWA 3TZ6A 4WXPA 1YB4A 3GT0A 1QGDA 1CRLA 3L1IA 4KQ2A 3UUGA 3V5NA 1EVQA 3PCRB 4REQA 2BW0A 4OU5A 1W34A 3HP4A 4WKPA 2QJRA 4G2TA 4RPIA 5BR4A 4HMQA 1OROA 4YDQA 2I76A 3GMSA 1OYYA 1UBFA 3OEYA 3EULA 3GVXA 1RQ2A 4YRLA 5KOJB 1Q2UA 4MXDA 3TVTA 1DRKA 2ZI4A 3EVNA 2C3MA 3H17A 2Y0BA 5KSWB 3AGQA 3D31A 1KYVA 4KFTA 4Q1CA 4X24A 2R86A 4RY8A 3HTXA 4IX9A 3IRVA 3FPSA 4KR7A 2Q1UA 1NW4A 2GK3A 2YH2A 2FWJA 4X1OA 1RZ3A 1VKRA 2B25A 5D3QA 4Q05A 2CN1A 2R84A 3I61A 4IUDS 2IE8A 4DT1B 3UFBA 4DQXA 3MTJA 1T2DA 2NN3C 1INLA 3IJ5A 2J3IA 1YO6A 3S8MA 1MU0A 4LRWA 4PPGA 4GP7A 4Y7CA 5JPIA 4A0QA 2O19A 1WXEA 3BOSA 4N82A 4PNHA 4ZOCA 3M82A 1P1HA 3SX0A 3DP9A 2ZM5A 4KI7A 3MCVA 3QTLA 4N7RA 2C78A 2X0JA 4B48A 4UHHA 3RO7A 2VT7A 4PSUA 3SKYA 1II8B 1ZH4A 3IQFA 5CD1A 3C4JA 3LG2A 3J7AC 3AERB 3FGPA 4WXHA 4F93B 1QKKA 1JI3A 2QAGC 4WNCA 1G8JA 2PGAA 4EG3A 1YVRA 2FQWA 1KRWA 3GFSA 4US0R 3JAMA 3HJNA 4V1CI 1ZU4A 2F55A 1VP3A 1ZH2A 3H5NA 4NCNA 1GTVA 1N9GA 1PFKA 3PQ8A 2HRRA 1MV5A 2X6RA 1TUBA 2O8DB 1Y8QB 5CLFA 2V54A 3HCDA 2CGEA 4TTRA 2P9ZA 4JC4A 2GZDA 1U63A 4LUCA 3RADC 1HF3A 2WDPA 3IIIA 4GWKA 3BWDD 1YQTA 4CDNA 4WTOA 1V5EA 3DAPA 3H2ZA 2V9ZA 3VHQA 4DFDA 1LBEA 1U04A 3DJFA 3DMTA 1JPUA 5H83A 2PWAA 2HWXA 1G60A 4RTOA 4OK5A 1TFRA 3BRQA 1JJAA 5AO9A 3TRIA 1C41A 2BPOA 2VRNA 3T7KA 1Z13A 5J5VA 1T5HX 1ST3A 1RRVA 1IOLA 3AFGA 3B13B 3VZQA 2Z3ZA 1UMBA 2WP0A 4R2MA 3MNFA 5IVDA 4AZWA 3BZWA 1G8MA 5AK3A 1ZKDA 5FI3A 5F7XA 1QCZA 1UPBA 3OF5A 5EVCA 3JASB 3K0FA 3G5TA 1WMFA 2NVOA 3PNKA 1FW6A 3EDQA 1PW5A 5DW0A 2ZAGA 4PHGA 4BO6A 3EK2A 1C7QA 3K70B 5AJYA 3GJRA 3MW8A 3QEBZ 2NUTB 4AS2A 1CVIA 1YS9A 4WW0A 3D7SA 2QN7A 5CT6A 1ZVJA 4FCWA 1U99A 2C88A 1TU3A 1WB4A 1XNRB 2NYAA 2V1XA 1XRQA 2GPAA 2YX1A 2HSGA 3GT3A 4ONEA 3IP8A 3R7BA 1M5TA 1RJ9A 2EQ5A 3AXSA 5EXSA 2COKA 2H07A 2INGX 2YV5A 3KU1A 3LGAA 2G5GX 1D6NA 3DAYA 5KSPA 4EBFA 1PWZA 3F67A 2OC9A 3L18A 2QLNA 4ZMRA 2DBRA 4CKCA 5T67A 5BNWA 4HLUC 1NNUA 5BR8B 2Y3IA 4PLZA 4YHBA 4ZANA 2RGYA 4OJTA 3Q8LA 4OHZA 5BNIA 1PSWA 1TVKA 1ZISA 1BYUA 1TTHA 1PR3A 1XQVA 3D9QX 4C87A 1SCUB 3ADOA 2OHGA 4XUDA 2B9EA 2O23A 5A1JA 1HE2A 1G6KA 2YXBA 3F5FA 2XKBA 5HGXA 1WBDA 3E3MA 3EXHC 4OK3A 2BBOA 4ZQHA 1CCWA 3NAQA 3VX3A 4I55B 5HBRA 2Y4NA 5IYZF 3PUHA 4ND1A 5FWYB 1FFCA 2BEJA 2PN1A 4B0OA 4D8YA 4EUKA 2VTBB 3GNTA 2XUPA 3C15C 5KKAA 1KI6A 2VWQA 1ZSYA 2CXUA 4JZYA 4A2WA 2R11A 1PU2A 4DAEA 5JYBA 3SQLA 5BXQC 1Y4ZA 3C3AA 4IQFA 3TXXA 3WB9A 4RTRA 2HPAA 1CEEA 3CRRA 3IOYA 3FDIA 1RC0A 2X2OA 5TF4A 3ETLA 5ALMA 3S2YA 5FV4A 5I9IA 5JAIA 4AKHA 2Q3HA 4QYWA 1T4CA 4R7TA 4X1YB 4F60A 2VYQA 4YBZA 2YWHA 2C2OA 1L7OA 2P2CA 4HFMA 5B1IA 2SHKA 2W2KA 1PK8A 1VLMA 2WVJA 3ICVA 3A6FA 4OHBA 1N2XA 3WJ2A 3LBAA 3WV4A 4C4RA 4DEYA 3IPXA 2VVTA 4OMDA 1W88B 2WB2A 4AO7A 1UFOA 4UTOA 2V96A 3ADPA 3ZR4B 1FVFA 5BUSA 1A2OA 4HAWA 4BQFA 4P3YA 3FUVA 4DE5A 5B4UA 3P9YA 4FNMA 1CUSA 5IFKA 3TD9A 1XNGA 2GOYA 2G6BA 1HUQA 2R751 3CN7A 3EIOA 5F77A 1C5KA 1IEQA 1M2GA 1ZMTA 1JECA 3QJYA 3UAWA 9MHTA 3HEBA 3KSRA 4IW3B 5E7JA 1DWPA 2WAYA 3PGXA 3FBGA 1YA4A 4G67A 1OBFO 4QDUA 4UD6A 5UKDA 4IIFA 1E79A 2WE8A 1YBHA 2FLVA 1QVRA 2ECOA 2X0EA 3DOUA 3EGXB 5LLSA 4IIVA 1YZNA 3LQRA 3R0QA 1ENPA 2ZLBA 3O4RA 3E3LA 1B0UA 3A06A 2ODNA 4P7KA 2BEWB 4C03A 5BVHB 5HJ7A 2H17A 4X8MA 5JADA 4G81A 5AK4A 3MIZA 5JQWA 4UASA 3HI6A 1MO2A 3RVRA 3B1VA 2HJVA 2PZEA 4RQBA 4WFKA 4YLEA 4F7WA 5F9FA 4JNCA 3K4QA 1X1SA 1NC3A 3I4FA 4EJ0A 4NICA 4KUEA 5BYBA 2O0MA 4AU1A 2O7QA 2LDXA 1JG4A 1RKBA 1IIRA 1MAAA 2WHPA 3FBWA 4HX9A 3IRUA 5H82A 4AKIA 4KXFB 1AQYA 3GQBB 3SC6A 1WY7A 1RWWA 1ZGHA 1OWOA 5TQ2B 1TYEB 4GMDA 1E2MA 1DAPA 2WBLC 3V4SA 1QRUA 2C20A 3W9SA 2I7VA 2AEMA 1QRTA 4IYRA 2A7QA 1FMFA 3OE5A 2Q9AA 1OIWA 2P9BA 3AINA 5AICA 5K0EA 3M6LA 5IF3A 1WRBA 1E6CA 4GGMX 4V0ME 3FD8A 3BIXA 4J49A 3ZY5A 3PT9A 3EFOA 1TC2A 1BE1A 3HP7A 5BNFA 2XUOA 1UFKA 1TQ4A 2YFKA 1PUJA 4TRNA 4AQYB 1E3MA 3HGQA 1Y3FE 4CODB 1R5JA 5H7XA 1ZHFA 4FGJA 4ZKEA 5I5EA 4YNBA 2LRHA 3NKLA 4RMIA 2WYIA 4F9EA 4RABA 5ARDA 1HG1A 1KSHA 3GEHA 5GAJA 4JP5A 2WPNA 4XYBA 1TE2A 1Q0RA 1XJ5A 2C03A 3H2GA 4X5OA 3UWPA 4UQLA 5LBIA 4RENA 1WSDA 3C5VA 1LK5A 3OJCA 3PXEA 4NAVA 3KAJA 2JBHA 4BE4A 5A4FS 4EY6A 1CF9A 1Z6AA 2ZSUA 5C1PA 1TZJA 2J3JA 5MFZA 4KO2S 2QWXA 1AMUA 3V8RA 1LTQA 1KETA 5ICEA 2E21A 2JGJA 4O4LB 2NSLA 1JIQA 3A4TA 1W4ZA 3KOXA 4MB2A 3UA3A 2IOYA 1XZLA 1V6AA 2I65A 4DYVA 4H7DA 1BU5A 2FFRA 4CCSA 3QE9Y 4OP1A 3I6MA 3CF2A 2YWDA 1T3GA 3OOHA 4EW1A 4LHEA 1DL5A 4CIDA 5DWQA 3V1UA 2VJDA 1IU9A 1KZYC 3EISA 3SS9X 8ABPA 3L0CA 1B74A 1JWLA 2X8BA 2VTKA 3IYLW 4PYLA 4LDAA 1B43A 1U3GA 3N7UA 4WLFA 4URXR 4ZP1A 2NZ2A 5F21A 5I7WA 2B4RO 3C7KA 3FIJA 5JRJA 2QTWB 1CDZA 4B8WA 3CZRA 2DJIA 3HYTA 3BXEA 3JQBC 4NEQA 3ICQB 5A5DA 4BZQA 5JAOA 3ENZA 3OCVA 4R8LA 1ZY2A 5GIOE 1QIGA 1NRIA 1Z5NA 5EWLB 3LGXA 5AVWA 1LJ8A 2GPSA 3DHEA 3HXMA 2XUIA 3SYTA 2AF4C 2ZWAA 4JR1A 2J0UA 2ZJ1A 4KNYA 1B73A 3VSDA 3D7RA 3Q88A 2AS0A 4I0WB 3V8EA 3H1PA 4EZEA 2ENUA 1Z4KA 5LBTA 2GPYA 1IMOA 2P9CA 1L5HB 4MHOA 4B3BA 1VJDA 5KWSA 3EGIA 3PDUA 4AG3A 4QVIA 3M5WA 3I23A 3JTEA 4BWGA 3CWZA 4AK9A 3DDUA 3ND5A 1TZCA 1H66A 2W48A 4NONA 5F98A 4TQAA 3TOZA 3KVNA 2AEEA 1SCJA 2EOAA 4P3XA 4W99A 1A8PA 1DWOA 2FOLA 3ZH9B 4I4IA 3IUNA 3CMCO 3KELA 3L8YA 4W5WA 1S89A 2FPIA 1P3DA 2V4MA 4JKYA 1N2JA 1NW6A 1L7QA 2DTDA 3UAOA 4ZVNA 1E3WA 3BB4A 4FOSA 5EIWA 4QUAA 4PIVA 2BOVA 3T3DA 2HJWA 1Q0UA 5C1BA 4FYIA 4M6WA 1NUQA 4OHXA 4MS1B 3Q5DA 1NV8A 3T9EA 3KO8A 4AB1A 3EQ6A 2WFMA 4OJNA 4D9FA 3PHBE 1H94A 2PGXA 2RIPA 3Q12A 4EG1A 4MKFA 2PXHA 3DSRA 3U7QA 2HV9A 4Q82A 4DG5A 3GGJA 4EJMA 2NXNA 5GVRA 1Y1RA 5AWFC 3K6KA 3W8EA 4JS0A 4G0UA 2NUPA 3ANYB 4HDOB 1ADYA 1ZVMA 3BMOA 2A2ZA 2GBPA 1WQ4A 2UYOA 2ZR9A 4XWTA 1I14A 1EP3B 1TJYA 1RKQA 3GX1A 1AG9A 5LOVF 3GLUA 3FLBA 3MGKA 2GGSA 4KK4A 3A1CA 1QHHB 2AUTA 2PL3A 4L4ZA 3GLRA 1J0EA 1MP0A 4PZ0A 4RD1A 3E7XA 5IZ4A 2O8CA 7YASA 4M8IA 2OB1A 5ICSA 4GSKA 1NR7A 1R9MA 1SCDA 2YCLA 5B64A 5JXWA 3VNSA 4TVOA 2WIAA 3PJRA 3HL0A 3BWMA 4JITA 4W9NA 3B3QA 4RUKA 4OM8A 4IYJA 5LP6A 1PTJC 5IWCA 3PLAE 2GARA 1F8XA 1L1QA 5F3RA 2W2OA 3J7TA 3UEOA 3GFBA 4RFSA 4MVWA 3FSRA 3JS5A 4QGGA 2ORWA 3CNLA 3WGGA 2ATCA 3AHEA 4GX5A 1QCCA 4OLBA 1MC4A 3IIMA 4F1JA 4M1MA 1K75A 3TIXB 4DJDC 4F4JA 5JCZA 3HVRA 1IK6A 3OJWA 4EO7A 1E89A 5BWOA 1THMA 2H2HA 1VPDA 2H9YA 2V6BA 2ZEJA 1B42A 2HBYA 3K0KA 1P44A 5IMSA 1FIUA 3DS8A 4F91B 1EVEA 1WY5A 4S2UA 1YAHA 5IDWA 3E0QA 5C7LO 4GFDA 3ZU5A 5A3QA 2UVPB 2R00C 2J9GA 4MPTA 4EHAA 1V6SA 2A9VA 5JC1A 2CVFA 3R7WA 1RM5A 3RJTA 3PGMA 4BGUA 2HEGA 2CYBA 2P1ZA 4JZKA 2ODAA 5CAEB 3W1EA 2I1WA 5BYKA 4QOSA 4XIIA 4B7XA 3V34A 5JFGA 2KBFA 4BKRA 1NTRA 1RYBA 1N8KA 1TZ2A 2IYXA 3DC7A 3PV0A 2EGHA 4ND2A 1E79D 3GDWA 1A82A 2DG2A 2Z83A 5HCIA 5E6UA 4C01A 4NENB 3KLOA 3G2JA 1AN9A 5BRAA 2H2GA 4NTZA 1XQWA 4C5AA 1LRJA 4X65B 2W4IA 5EJ4A 5FXMA 4R69A 2GMWA 4IJUA 1XWFA 2B1QA 5DRTA 2CVHA 1YS2X 2E0IA 1MAUA 3OOEA 4D6PA 2WIJA 2GKSA 2QTFA 3IAEA 4YRKA 1OKKA 1ZZEA 2NO9A 2UYQA 1XCMA 5EJ6A 3BGSA 1QQBA 3U09A 3FZGA 1RJEA 2Y05A 2GCGA 4ITUA 4J2OA 4KRFA 1WEKA 1LS6A 1HTTA 1ZIXA 2IEIA 1EVLA 1JFSA 5JZBA 4RVGA 2PGJA 1RE0A 5FUVA 1KHHA 3NS7A 5B5SA 1L5FA 1AMNA 1Z8NA 1WXHA 2ATVA 3GAAA 3IVXA 1GNQA 1ESCA 1ZN2A 4WA7A 2VF7A 4XGQA 2W58A 3O1LA 4NZMA 1V95A 3AZPA 2PR2A 4CV1A 8ATCA 2AQIA 3QVTA 1MO3A 1MJGA 3Q5GA 5DZSA 3O7MA 2RGUA 4Y2JA 1G2QA 4TSKA 4WESB 1O9HA 2GTHA 2H00A 1GITA 2ODQA 3U2QA 1PS8A 2PIDA 3K3PA 3CKLA 5AHXA 3TI9A 1J0CA 2XVXA 2P9HA 3R9XB 2FMTA 1II8A 2KQUA 3CC8A 3RT9A 1QX3A 5KBYA 1GA6A 1JR4A 4MPDA 5CT9A 1TA0A