3DQVA

Structural insights into nedd8 activation of cullin-ring ligases: conformational control of conjugation
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
GSMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKIMGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords NEDD8
total genus 19
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dqvA00
2DAFA 1C1YB 2IY1B 2DZMA 4LCDE 4BBNF 3PRPB 4BOZB 3VUYA 2MWSB 3JSVB 3BY4B 3ZW3A 1I35A 4IC7B 4B6WA 3EFUA 4DWFA 1WR6E 3TIXA 5HKHA 2KHWB 4HPMB 1RFAA 2K6DB 4PYUA 3H9DA 1WGGA 3WA0A 2OJRA 3KYCD 3N30A 5KHOA 2DHZA 3VTWA 3PS6A 2ZVOA 3H6NA 4ZRIA 5EDSA 3APDA 3M3JA 2UWQA 1EUVB 4MJSA 4WAAA 2O6VB 1WM3A 3UIPB 4A3OA 4FJYA 2L0FA 3SDLC 2C9WB 4FJVB 2I1JA 1V81A 3L0WB 4X57B 4XX5A 3A1QB 1WJ4A 1IPGA 2XK5B 2D11A 2FIFA 2V1YA 4ICVA 4KDIC 5E6OA 3VUXA 5JHBA 4KZCA 4W9IA 2KTRB 5GMVA 4KIKB 4IWOA 4KVGB 2ZVNA 3QK0A 3V6CB 3ZTDA 2FCNA 2KMCA 1OTRB 1GJZA 1KJTA 3JVZX 2K25A 5DPWA 1E7VA 3PVLA 2KANA 2XBBC 2JRIB 1WXAA 4HLEA 1X1MA 3PRMB 2KVRA 1U4AA 3LJ3A 1WJUA 4NQLB 4TUUA 2LUEA 4GDKB 1WY8A 4KV2A 3LDZE 2L05A 4I6NB 3M95A 4ICUA 3TL5A 2MLBA 3OAWA 4NAWA 2AWTA 4HWIB 2D07B 4II3B 4FADA 2KTFA 3QA8A 2RPQA 4GN1A 3R7QA 1Q1OA 3JYUA 3PHWB 4OVUA 5FR6A 4DHZB 2G3QB 3OJ4B 4G11A 2Z0EB 3L10B 2Z59B 1E8XA 4RMAA 1VCBA 2D3GA 2DAJA 4CO7A 1P98A 4TKNA 1BT0A 4TV3A 1YIWA 2BYEA 4LDTB 4EFOA 4PS8A 3V62A 2XK5A 4JL9A 3PLUA 2GBMA 4JGHB 1YD8U 2ZEQA 4A20A 1WYWB 5LXIB 4BVUC 1R4MI 4EEWA 3QHTA 2BPSA 2PE9A 5BO4B 2KWCA 3ZNID 4IWQA 1I42A 3PLVA 2DYMA 3A1QA 5IAAC 3U30A 2G45B 2LGXA 1WF9A 2KD0A 1UGMA 1R4NI 2HD5B 2O2VB 3SHQA 1WMHB 4F8CB 4GOCA 2BYFA 1SE9A 3H7PA 3HIZA 3H1UA 2ASQA 2K8BA 2KWVB 1P3QU 1V2YA 3ONSA 2LZ6A 4W9EA 2O6VD 2FCSA 2MBEA 3ENEA 1ZW7A 1J19A 2GBRA 2N9PC 2LASA 3Q3JA 4IUMB 4ANVA 1SIFA 4FBJB 5AEKB 1LXDA 4J6IA 4DHJB 3CMMB 1V86A 4EZKA 3VUWA 2KX3A 4AJWA 4HXDA 4HCPB 2BKRB 3AULA 2KWUB 3PGEA 4KDLB 2EKEC 3APFA 4MJSB 3MJWA 4OVVA 4K7UA 1P0RA 2GOWA 5KHQA 2MP2B 3EC8A 3PT2B 5DPTA 2QHOA 1WGHA 3B08A 3VTVA 2A4ZA 1WRDB 1WIAA 2C7MB 2KJHB 3IBEA 3VAWA 3A33B 2LXAA 2J0KA 4A3PA 4BKGA 2KTRA 3CSFA 2KX0A 4PYZA 1UBIA 2Z0DB 5AZHA 4RM8A 4TQ0A 1AARA 3IHPC 3ZRFA 2V3SA 1VD2A 3ALBA 3M62B 3A4SC 1G6JA 4WJQA 2G4DB 4B9KA 1GC7A 3TJPA 3VVWB 2CS4A 2M0XA 2DENB 2C7HA 1WZ3A 3NS8A 2MBHA 2IZVB 3AU5A 2MA9B 4WJOA 5LLIA 4ANUA 1A5RA 1QZEA 2J0JA 2JZZA 3A9JB 1WE6A 4BBNC 2HE7A 4WWNA 3QWZB 4GMVA 4BKTA 3CSTA 1S1QB 2KFKB 1WXMA 1WMHA 3DBLI 1V9JA 3A9JA 2KJ6A 3DVNV 4PS3A 3N3KB 4HCNB 4W9KA 3T8MA 4EZJA 2MQJA 5DPSA 5JZEB 2CR5A 5CTRC 1E90A 4ZYNA 1GG3A 3ZO5B 4E3CA 1RRBA 2L76A 5C23A 4II2B 1EF1A 2ZNVC 1UELA 4AJYB 3KVFB 3ZKJC 5E6NA 1Y8RC 3QC8B 1E8WA 3Q3FA 4MGIE 3ZTCA 2UYZB 4GGQA 2FNJB 3QAQA 2MP2A 2KDBA 3KH0A 3MHSD 4MDKE 2WX0A 1WX9A 2L3ZA 2Y5BB 2MRPA 4BOSC 3U8ZA 3RD2A 4ZRJA 1WJ6A 1TBEA 3ML9A 4FN2A 3RCZA 4W9DA 4XC2A 1V6EA 2CHWA 2K39A 3VQIA 3VTUA 1M94A 3W1SC 1WX7A 5IA7A 1S3SG 2N9EB 4DHZE 3PRZA 3X0WA 2KC1A 2WYQA 3SD5A 3VH3B 5J2RA 2FAZA 3HM3A 2O2VA 4W9HA 5CX3A 2IY0B 3R7RA 1IYFA 1UBQA 1C3TA 1Q5WB 4EUTA 1YX6B 4HK2A 3WANA 2KDIA 4MSQB 4E71A 1UD7A 4NNJB 1RAXA 1WX8A 2DZKA 2N1VA 4K7SA 4MH0E 3KUDB 4FLHA 3WALA 2ZCBA 2CKHB 1XT9B 2CU1A 3WAOA 4BKSA 2JT4B 3RULA 1L7YA 4NAWB 3DBSA 2OOBB 3W1SA 4M8NA 1KLVA 3H7PB 3D32A 4IW0A 2JZ3B 3HK0A 2AYOB 3RZFA 3ZDTA 3O65B 3VHTC 2BWES 2CHZA 3NOBA 3ZDMC 2DYBA 2KNBA 4LDTD 3NY5A 3K9OB 4KZ0A 2KOXA 4LJPB 5AZGA 3L16A 2LGYA 1KM7A 1TZ1A 2C7NB 3DDCB 4WJPA 1WGYA 4DDGD 2BGFA 2D10A 2N7EA 1V80A 2NPTA 2A5UA 3I3TB 2KLCA 2KC2A 1PQSA 5CHVC 3ZUNA 3QARA 2PE6B 4FHKA 1OQYA 2IO3B 3HHMA 3PPAA 3PREA 4TQ1A 1E8YA 2ZPNA 1XQQA 3WAPA 1FXTB 2IYDB 3R3MA 4XZ4A 4MGZE 1RLFA 2GBKA 3PSEB 5C1ZA 4IM2A 2PEAA 2C60A 2MBQA 3DOWA 3TCAA 3OJ3A 4CHKA 4JQWC 1UZXB 4W9FA 3OLMD 1J0GA 2I1KA 2R2OA 3L54A 1WGRA 2JF5A 4NJ7A 2N7DA 3N32A 3L08A 4K1RB 3C0RB 4AOFA 1IP9A 2RSUA 3L13A 2LGDA 2REXA 4EOYA 1WZ0A 4I6LB 4HDQA 2GBNA 2KFKA 2KKCA 5G2NA 2KJRA 3AU4A 2N9XA 3EECA 4FULA 1V5TA 3UQAA 2KDFB 4LJOB 3IFWB 2NS5A 1GUAB 2LXCA 4HDOA 4KSKC 4CYEA 5JHAA 4PS7A 2GMIC 3KW5B 4KSLC 4HJKA 4W9CA 4MELA 4IG7B 3RZWC 3VH4B 1OEYJ 3PTFC 2BF8B 2JXXA 4BKSD 1XD3B 2L8JA 4RM9A 3SU8X 3TBLD 3V60A 5J18A 1WFYA 2DZIA 4NY0A 2CHXA 2LVQA 2LRWA 5D7GA 2FCMA 3UGBB 3W1YA 4G0NB 2JUOA 4AWJA 4NJ6A 3HM6X 4DHJD 1E8ZA 1JRUA 2EMSA 2M1MA 3QX1A 2ZNVB 4JLCA 2JVCA 5TR5A 1LFDA 1F9JA 4URKA 1WGDA 4WJNA 4K81A 3ZVVA 2LJ5A 3ZLZA 1SGHA 2AEHA 4DK5A 2K1FA 1EO6A 3PHXB 2W9NA 4GSWA 2NR2A 3DCGA 3QJZA 2HTHA 2M8SA 3RT3B 5D94A 3DBHI 2NBWB 2WX1A 2KZRA 2G4SA 1J8CA 3V6EB 2IO1B 3DVGX 3PV1A 2RGFA 2M4NA 3NZUA 1L2NA 2KMAA 1V5OA 3WAMA 1WI0A 4BFRA 3VFKA 1UH6A 4M8MA 3B1LX 4AP4C 5J17A 4GB9A 2N1WA 3KYDD 4IM0A 5AZFA 3DQVA 2J7QB 1ZKHA 3KUZA 5D2MB 2DYOA 1Z2MA 1MG8A 3QCAA 4F7ZA 2VRRB 3NZSA 3MTNB 3H7SA 3T9LA 1EF5A 4ZDVA 1HE8A 2NVUI 2K6QA 3VXWA 2KO3A 4DXAB 3RYTA 2D2QA 2IBIB 4FA6A 4GU2A 2L00B 2JPHA 1ZGUB 2FIDA 4W9GA 4G50A 1H8CA 3ZNZB 4DBGA 2DZJA 2MSED 2MX2A 4P7IA 3S2AA 2LRUA 2LI5A 2BYVE 4MSMB 5JH5C 4W9JA 4G3XB 2ZJDA 3APCA 1TTNA 2L7RA 3DVGY 4WWPA 2V4LA 1Q0WB 2JWZA 1WXVA 2RR9A 3AXCA 3BINA 4WWOA 4NPNA 2MBBB 3ZIMA 2C5LC 3ZNGC 1K8RB 4JIOU 1WM2A 4ANXA 5L95C 1WE7A 4W9LA 2IO0B 3A4RA 2WWZA 1NI2A 4GDLA 5LXHA 2LVOA 1NDDA 2PJHA 2YLMA 2MBOA 2N4FA 4KIKA 2NBUA 3ZNHB 4GDLB 1CMXB 2J0MA 4N9F4 4AUQC 3EHVA 4GDKA 4GIVA 4IM3A 1GC6A 1V49A 1WXSA 1H4RA 1P1AA 4B95A 4M0WB 1NBFC 1Z5SB 2KN5A 2FUHB 3K9PB 2K8CA 3JSVA 3QIJA 4FJZA 2ZCCA 4FHJA 3UQBA 2KFJA 1E5WA 1WR1A 2AL6A 2JRHA 5CHFA 5L83A 2DX5B 2KDEB 2LWPA 4ANWA 1E7UA 1YJ1A 5G55A 2L0TA 2ZPYA 1LM8B 2YVCA 2NBVB 2LVPA 2HJ8A 2BWFA 2KK8A 2KQ7A 4YL8A 1OGWA 3V61A 2RD0A 3CF6E 3GZNI 4EKUA 1LQBA 2K8HA 3TMPB 2O6VA 4EZLA 4WQOB 2MCNB 3RUIB 3X23A 2NPTB 3L17A 3NHEB 5D6JB 3ZRCA 3WIMA 4MM3A 3QQ8B 2BKFA 4HVBA 4MGKE 1KOTA 4E74A 1TGZB 2KXJA 1OEYA 3IVFA 2KLGA 3ML8A 2WDTB 4I6PA 3B0AA 2IO2B 2M17A 1WH3A 2GBJA 4ASWC 3A9KB 1YQBA 3IG3A 3U7DA 2MW5A 2XEWA 5DPRA 3R66C 3A9KA 3P2BA 3ECIA 2KQSA 3VDZA 3GOEA 3DBRI 3JW0X 3KUCB 4IWPA 4NQKE 1WJNA 3M63B 2B3AA 5DCNA 2AL3A 1T0YA 3DPDA 5CHWA 2JY6A 4DDID 2R2QA 2ZZPB 2NCNA 1GNUA 2EMTA 4K7WA 1P9DU 4GXBA 4ZRKA 2LD9A 5E6PA 4F1SA 1D3ZA 3AI5A 4MEMA 2PPHA 1ISNA 2FCQA 4HPLB 3UF8A 1YX5B 3UIOB 3UINB 4MGYE 3PZDA 3DVNU
chains in the Genus database with same CATH superfamily
4BBNF 3PRPB 4BOZB 3Q3OC 3VUYA 3JSVB 3EFUA 3TIXA 1MJDA 3H9DA 1C78A 1IUEA 3PS6A 3H6NA 3Q69A 2IGHA 3M3JA 4BAXA 3NVZA 3UIPB 2L0FA 1V81A 4XX5A 1FCCC 2KDMA 2D11A 2X8XX 4C7YA 4IWOA 2KMCA 3EFCA 2BS4B 1GJZA 1E7VA 3PVLA 2JRIB 4HLEA 1SB3C 1X1MA 3U2SC 2OJWA 4TUUA 1KFYB 1WY8A 3W5UB 2L05A 3TL5A 3OAWA 1L0VB 4HWIB 2JSVX 2HDEA 4FADA 4GN1A 3R7QA 4OVUA 3NZ3A 3FKYA 4WWMA 1VCBA 2D3GA 2DAJA 1TKGA 4TKNA 1N5WA 2WXFA 4TV3A 4YSXB 4LDTB 3AE7B 2WLBA 2XK5A 2GBMA 5MPOA 1YD8U 3DWGC 2ZW0A 2ZW1A 1WYWB 1XXGA 5LXIB 2JWUA 3QHTA 2BPSA 5BO4B 2KWCA 2DYMA 1NVID 3RPFC 1DOYA 2D3AA 3U52E 4YSZB 3KQ4A 2M56B 4MH8A 3SHQA 4GOCA 5C3JB 1PDXA 3BVGA 3HIZA 2JQRB 4C4VB 2KWVB 1P3QU 2XN9C 4R3DA 1N5XA 2TSSA 1OQQA 4IUMB 2IDYA 4ANVA 3CMMB 1RM6C 2WXGA 3KWVA 3VUWA 2BVCA 1OFFA 2BKRB 3AULA 3PGEA 4KDLB 2N9LA 3N1YC 5KHQA 4YXDB 3AEBB 5EE3A 1C4AA 2C7MB 2LXAA 2QC8A 4YTPB 3U7ZA 3CSFA 4GLSC 5BMGA 4RM8A 1AARA 1FPYA 2V3SA 3OG5A 4HPPA 3NS8A 1N63A 4BZAA 4WJOA 5LLIA 3P4RB 1LGRA 2JZZA 3A9JB 3P1MA 4WWNA 3CSTA 1S1QB 3L4PA 4M00A 1XO3A 4PS3A 1TT5B 3N3KB 2MQJA 5DPSA 4C80A 1UWMA 5CTRC 3ZGZA 1GG3A 4KGRA 3ZO5B 3AE3B 5E6JA 1FXIA 2EKIA 3UI3A 2FNJB 2KDBA 2LGIA 1WX9A 3B2GA 2MRPA 1OQRA 1UF0A 3PO0A 1TBEA 3ETRA 3GS2A 3RCZA 2J53A 1M94A 2N9EB 4DHZE 3PRZA 1SXTA 1HTQA 1GOZA 1IYFA 4W9HA 2IY0B 5EE9A 1Q5WB 4HK2A 3LYYA 3IAS1 2KDIA 1UD7A 1WX8A 2N1VA 2OHFA 5IO9A 2CKHB 4BKSA 2JT4B 4USAA 2OOBB 4IW0A 3O65B 3NOBA 4OHJA 3AN1A 5AZGA 1TZ1A 2KT7A 1RYJA 1WGYA 2N7EA 3ZQ4A 3KWLA 2KC2A 1PQSA 3GE8C 2N7JA 3ZUNA 1PGXA 1TS4A 2PE6B 4N6EB 1E8YA 3WAPA 5HFYA 4K3CA 1RLFA 4IM2A 1L6UA 2C60A 4P6VF 2IJ0A 1V97A 1TJEA 5IP4D 3P4SB 2N7DA 3N32A 3L08A 4K1RB 1IP9A 2RSUA 3L13A 3RNGC 3VR8B 2LGDA 2REXA 1WZ0A 2K5PA 2LMCA 2KJRA 2N9XA 1V5TA 3UQAA 4LJOB 4DXGA 4HJKA 1NENB 3RNCC 3Q8EA 1HTOA 3I5JC 1SE2A 3FILB 4M01A 1ZXIA 2X38A 1L5PA 2LRWA 2FCMA 5FR3A 1N61A 2QSDA 4A8XC 1E8ZA 1B9RA 1BMLC 2L1AA 2ZNVB 2JVCA 1T3QA 4XGAB 1F52A 4URKA 2FBWB 3Q3NC 1SGHA 2FE8A 3DBLB 4WAFA 2NR2A 2HTHA 3EGRA 3RT3B 4WIPA 1K52A 4ITKA 2NBWB 4TSSA 2KZRA 3V6EB 2M4NA 2GRIA 2KMAA 4BFRA 2VH1A 4M8MA 2WXMA 2ACZB 3PZ8A 1Y56A 2EELA 5AZFA 3KUZA 5D2MB 1TKEA 1Z2MA 5IN7A 1FFVA 1EF5A 1HE8A 4LLGM 2IBIB 1CQVA 3VRAB 1ZGUB 4DBGA 2DZJA 2MSED 1VLBA 4MSMB 4W9JA 4G3XB 4L1BA 3APCA 3VQIA 2PIAA 2KVZA 2V4LA 1Q0WB 1WXVA 3ZIMA 2C5LC 2QIEB 1WE7A 4W9LA 2WWZA 1T0RC 3AH7A 3AE1B 5LXHA 1QOGA 5G5GA 1NDDA 1JMLA 2YLMA 2MBOA 2N4FA 3VRBB 2NBUA 1AN8A 4N9F4 4AUQC 2J4XA 1FFUA 4M0WB 1Z5SB 2FUHB 3K9PB 3JSVA 3QIJA 3UQBA 2KFJA 1WR1A 2QEJC 3BYTB 3NRZA 4AS1A 5G55A 1LM8B 2G9HD 2NBVB 2BYTA 2LVPA 2KK8A 2UU7A 1JWAD 2K8HA 2MCNB 1KTKA 3CIRB 2D3CA 2V3NA 2BKFA 1MVKA 2KLGA 3CWIA 4PT5A 3IG3A 2MW5A 2ICIA 3A9KA 1QILA 3GOEA 1WJNA 1I4HA 2B3AA 4JWSC 3TEWA 2E3TA 2R2QA 2EMTA 1P9DU 4GXBA 1WYGA 2LD9A 4F1SA 3C8YA 2PPHA 3UF8A 1UUPA 3UINB 4MGYE 1XCTL 3PZDA 1ESFA 2IY1B 2DZMA 2WS3B 3BY4B 1I35A 1ZUD2 5BYSA 1A70A 3AEFB 2OJRA 3KYCD 2PW9A 1JCKB 2DHZA 2ZVOA 2AQ3B 4MJSA 1WM3A 4A3OA 3W9CB 4FJVB 2I1JA 5AUIA 3L0WB 3P42A 4KDIC 4QAYA 2KTRB 4WURA 3V6CB 3ZTDA 3HVDA 4KKJA 2XBBC 3PRMB 1WJUA 4GDKB 4KV2A 1ZDXA 4YT0B 2MLBA 3AE2B 2BTEA 2KTFA 2KQ4X 3RNEC 5FR6A 4DHZB 2G1EA 1NEKB 2G3QB 3OJ4B 2M19A 3L10B 4Q2JA 1JW9D 3C19A 2MHJA 2WQYB 2BYEA 3V62A 2H89B 3AB5A 3H8HA 4A20A 4BVUC 2PE9A 3PLVA 3A1QA 5IAAC 4ARIA 2G45B 1WF9A 1R4NI 2HJ1A 2KYWA 2HD5B 4ZHPA 1SE9A 4TMAB 3RNBC 2ASQA 2K8BA 4HKQA 3LB8C 4RNAA 2LZ6A 4W9EA 4C00A 2KAJA 4N59A 2KMMA 3ENEA 1ZW7A 2GBRA 2N9PC 3Q3JA 4XWTA 1C9FA 4KKIA 1LXDA 3GZNB 4J6IA 4EZKA 2ON8A 1YOVB 4NZLB 4HROA 2KX3A 4AJWA 4A9AA 4HCPB 4MM3B 2WXLA 2EKEC 4OVVA 3MC0B 4K7UA 1P0RA 3W5VB 3EC8A 1SE4A 2QHOA 1N62A 1WRDB 1WIAA 2KJHB 3VAWA 3A33B 2J0KA 3IT6B 2KX0A 1C76A 2Z0DB 2RDHA 4TQ0A 3ALBA 3M62B 3A4SC 4WJQA 4B9KA 1ET6A 2M0XA 2DENB 2MBHA 2IZVB 3AU5A 3DBHB 4ANUA 1JWSD 3TUOA 2J0JA 2PVGC 3FAHA 4GMVA 4LK0M 4BKTA 1WXMA 3EUB2 1EU4A 5BYRA 4ZYNA 2L76A 1LO5D 1EF1A 1FNUA 2WXNA 2ZNVC 1TIFA 1TS3A 3ZTCA 4GGQA 3KH0A 1L0YB 2Y5BB 3TSSA 1QOBA 1YQ4B 4ZRJA 1WJ6A 3ZYYX 4FN2A 4W9DA 2QJLA 1E7PB 1S3SG 4KGTA 2KC1A 3SD5A 3N20C 1PYWD 2V3PA 1UWXA 3R7RA 2O2VA 1UBQA 1C3TA 1GB1A 1TZOA 4NNJB 1RAXA 4K7SA 4RGTA 2AX5A 2INCC 3RULA 3DBSA 3W1SA 4M8NA 1KLVA 1FNVA 3D32A 3HK0A 3IAM1 3ZDTA 3FILA 1JALA 2BWES 2CHZA 3ZDMC 2DYBA 4LDTD 1KM7A 2M0AA 1F77A 1V80A 5FK9C 3TEXA 5CHVC 3QARA 1HZ6A 3PREA 3PPAA 5D3IB 1HQRD 2IYDB 3PSEB 5C1ZA 1WRIA 3OJ3A 4JQWC 4W9FA 2HTME 3OLMD 2YEPF 3MJ5A 1V1OA 1ZDVA 1WGRA 4NJ7A 4RCOA 3P4PB 4I6LB 4DXFA 4HDQA 2KKCA 4UDUC 2KDFB 3IFWB 2NS5A 1GUAB 4HDOA 4KSKC 4CYEA 3RI7C 5JHAA 4PS7A 3KW5B 5TSSA 3MFGA 1ZE3D 3R2IA 2GLSA 2LFIA 3VH4B 1OEYJ 1V1PB 1XD3B 4RM9A 3SU8X 4XDDA 1YNTE 2BB5A 2DZIA 4NY0A 2L83A 2JUOA 4NJ6A 3HRDD 2WXJA 2EMSA 2MJ3A 1FMAD 1V8CA 1CK1A 5T8IA 2W54A 1SIJA 3RMKC 3NVVA 1EO6A 2W9NA 1VZ6A 3QJZA 1KH0A 3U4EG 1J8CA 2BBCA 1VZ7A 1YN5A 3NZUA 1RWSA 1WI0A 2QCZA 3VFKA 1UH6A 2N1WA 1C4PA 4IM0A 1JWBD 2J7QB 2DYOA 2WGSA 1MG8A 2DLBA 3QCAA 4F7ZA 1E10A 2VRRB 2W55A 3MTNB 1L0XB 1SF0A 2K6QA 1I4GA 2KO3A 3DHIC 4JWUC 1EWYC 4GU2A 2L00B 1QF6A 2FIDA 3Q8CA 1L4DB 3S2AA 1D6EC 2LRUA 2LI5A 2LEKA 1TTNA 3DVGY 1STEA 2JWZA 4NPNA 1QLBB 1K8RB 1JQ4A 1C79A 1MHXA 3I63C 3SFDB 2K9XA 1GPXA 3ZNHB 1VZ8A 1CMXB 2J0MA 4IM3A 1V49A 1WXSA 4ZRPA 2KN5A 2ZCCA 2VZKD 4FHJA 2JRHA 1ACCA 2LWPA 2W3SA 1PGAA 2L0TA 2QMTA 1PUTA 2HJ8A 2BWFA 2KQ7A 3LXFA 1OGWA 2MH7A 3CF6E 3RUIB 3X23A 2NPTB 1DOIA 3ZRCA 4HVBA 4MGKE 3MC9A 1D5XC 1OEYA 3IVFA 3ML8A 2WDTB 2DWQA 1QKZA 2WU2B 4ASWC 2L32A 1J7CA 3A9KB 1YMHE 5DPRA 2XNAC 3R66C 3P2BA 3ECIA 4IWPA 4NQKE 1T0YA 4S0RA 4K7WA 2YEPB 4ZRKA 3AI5A 4MEMA 1JWMD 3MP9A 4BKGA 1C1YB 3HUIA 1DYQA 1F2RI 3ZW3A 5EE1A 4DWFA 1WR6E 4ZHOA 4HPMB 1RFAA 2K6DB 2V4IB 1XF5L 3ABVB 3AMZA 3VTWA 2MJEA 4HJGE 2WXRA 3APDA 2K3UA 2V9HA 4WAAA 2O6VB 3SEBA 4OZCA 2I38A 2JYEA 2C9WB 1ET9A 4X57B 4HKZE 1WJ4A 1IPGA 4ICVA 2FIFA 2V1YA 5E6OA 3VUXA 4KZCA 3QK0A 1XCQL 2FCNA 1OTRB 3JVZX 2K25A 5G5HA 5DPWA 1QOAA 2KANA 4RGMA 2KVRA 1U4AA 3LJ3A 4NQLB 3LDZE 4ICUA 5IOIA 4NAWA 1HA5A 3V05A 2R61A 3P63A 2RPQA 3SFEB 2Z0EB 4US9A 4CO7A 1P98A 1BT0A 2MEKA 4PS8A 2VZKB 4EFOA 3PLUA 2ZEQA 1R4MI 1FM0D 3ZNID 2K0PA 3AEAB 4IWQA 1I42A 2LGXA 2LJIA 3AE4B 1UGMA 2O2VB 4US8A 1WMHB 4F8CB 4XE0A 1IGCA 3H1UA 1XLNA 1V2YA 3ONSA 2PMVA 2WDQB 3AM9A 2MJDA 3RFZB 1FRRA 2K22A 1SIFA 4EE2A 4RGOS 3Q6BA 5AEKB 4DHJB 1AWDA 4MT5A 4HXDA 2KWUB 3APFA 4MJSB 3MJWA 1T6BX 2MP2B 3PT2B 1MI0A 2PTLA 2INDC 2A4ZA 2JXTA 4A3PA 2IGDA 2KTRA 1L4ZB 1MPEA 5AZHA 3IHPC 4RGNA 4WQMA 3TJPA 2BW2A 3VVWB 1CJEA 2AQ2B 1WZ3A 2C7HA 1EU3A 1PFDA 3Q8FA 2MA9B 1YN4A 5FKAC 1WE6A 5JXVA 4BBNC 2KFKB 1WMHA 3DBLI 2VH2A 1KLUD 1V9JA 3A9JA 3DVNV 1JWUD 5JZEB 1E90A 4E3CA 1RRBA 4YSYB 5C23A 1UELA 2H88B 4AJYB 2D5GA 1TS2A 3ZKJC 3HVZA 3QC8B 3Q3FA 4MGIE 2WDRB 4RH6A 3QAQA 3MHSD 5HI1A 2WX0A 3AE5B 3GP7A 1K50A 3RD2A 3T3NA 1M4VA 4XWWA 1YQ3B 1WX7A 5IA7A 3AV8A 2NTSA 2WYQA 3VH3B 5J2RA 4EUTA 1YX6B 4ZOHC 1WXQA 4MSQB 2DZKA 1TYGB 4MH0E 3WALA 4FLHA 2ZCBA 4YTNB 1XT9B 2CU1A 4A90A 1L7YA 4NAWB 2JZPA 1XEEA 2JZ3B 1P7EA 2V0GA 2AYOB 2B76B 2RMMA 3VHTC 1QT9A 1ZPSA 1VDVA 3NY5A 3K9OB 4KZ0A 2KOXA 3L16A 2LGYA 2C7NB 4LNOA 2BGFA 2D10A 3AE8B 1F2RC 1XLOA 2WXHA 2NPTA 3I3TB 2KLCA 3AEDB 4FHKA 1I4PA 2IO3B 3HHMA 1E9MA 1SSNA 1FXTB 3R3MA 2PEAA 3DOWA 1UZXB 3TEYA 1NYQA 3N9YC 2QDFA 2LHEA 4K3BA 3ZXVA 3L54A 2JF5A 2GB1A 4LNKA 5G2NA 4IKGA 3EECA 3DBRB 3BK1A 2LXCA 2GMIC 3DWMA 4KSLC 4MELA 4IG7B 1AYFA 1SE3A 2W3RA 4BKSD 2BS2B 3V60A 3TBLD 5J18A 4RF0A 3BZDB 5D7GA 4ZRQA 3W1YA 2Z8LA 4AWJA 2PVOD 1I4RA 3HM6X 1JROA 3QX1A 1JRUA 5TR5A 3B2FA 1LFDA 1F9JA 1FXAA 4WJNA 3NG0A 2LJ5A 3Q2AC 3ZLZA 2SEBD 2K1FA 3DCGA 1SJHD 2BQQA 1AW7A 1R4NB 3DBHI 2LUMA 3DVGX 3PV1A 1TY2A 2RGFA 4J3OD 1L2NA 3ZJVA 3WAMA 1V5OA 1N60A 1F0ZA 2OEDA 4OZBA 1RFKA 1N6ZA 3E56A 3B1LX 4AP4C 5J17A 3W2DA 1HZ5A 1ZKHA 3NS1A 1ZP0B 3NZSA 1VRAB 3BIID 3H7SA 2J52A 2NVUI 5AUKA 2WHIA 3RYTA 2D2QA 4FA6A 1GAQB 4DQOC 1FO4A 4W9GA 4G50A 4ARCA 1FEHA 3ZNZB 2MX2A 4P7IA 1ZXHA 2BYVE 4WWPA 4NAMA 1D5ZC 4WWOA 3AXCA 3ZNGC 1SEBD 4ANXA 2WXKA 2IO0B 2JU6X 1NI2A 2LVOA 4HEA1 4GDKA 1GC6A 1P1AA 1F1HA 2WNMA 4C56C 1NBFC 1KF6B 1XLQA 2NTTA 3EA6A 4YTMB 5CHFA 5L83A 2DX5B 4B0MA 4B0EA 4JPSA 3BK2A 3I57A 3VR9B 3NUHB 4LNIA 2ONQA 3P4QB 4YL8A 5LNK1 2RD0A 1WWTA 4EKUA 1LQBA 3E9SA 3TMPB 4WQOB 2JX5A 3L17A 2RDBC 5D6JB 3TEZA 3WIMA 3QQ8B 1KOTA 4E74A 2INPE 2KXJA 3MC8A 3J9CA 2IO2B 2KN4A 1WH3A 1YQBA 3URYA 3U7DA 4P16A 1B1ZA 1QQRA 3M63B 3Q3MC 3GB1A 2AL3A 3DPDA 2JY6A 2NCNA 1GNUA 1P7FA 1D3ZA 5HG2A 2FCQA 1FCLA 3Q14C 2GI9A 3DVNU 2DAFA 4C4VA 4LCDE 2MWSB 4IC7B 4B6WA 3GE3C 5HKHA 2KHWB 4PYUA 1WGGA 3WA0A 3N30A 4OVZA 5KHOA 4M02A 4ZRIA 5EDSA 2DNFA 4ACFA 2UWQA 1EUVB 4RFBA 3AEGB 4FJYA 3RNFC 3SDLC 1IBXB 2L52A 3A1QB 2XK5B 5JHBA 4W9IA 1IBXA 5GMVA 4KIKB 4KVGB 2ZVNA 1D5MC 4LNFA 2QILA 2WDVB 1KJTA 3N1ZC 1WXAA 2LUEA 1EWCA 1NYRA 1SBBB 4I6NB 3M95A 1V1PA 5C2TB 2AWTA 2D07B 4II3B 2CJNA 3QA8A 1JRPA 1Q1OA 3JYUA 3PHWB 3ZJTA 4G11A 3AECB 2Z59B 1E8XA 4RMAA 1L6VA 1BXTA 4H2AA 1YIWA 4JL9A 4JGHB 2WXQA 1GB4A 1VR9A 4EEWA 1CZPA 2PLPA 5D3DA 3U30A 3DHHC 4LNNA 4KX6B 2KD0A 2BB6A 4FXCA 2Y5CA 2BYFA 3H7PA 5HHDG 4OZAA 1UGJA 3KLSX 5I4DA 4XYCA 2O6VD 2FCSA 2MBEA 1J19A 1E0ZA 2LASA 4FBJB 1TY0A 1V86A 4OW0A 1TS5A 3ZXRA 1T0SC 1Q10A 2GOWA 2NMQA 1TKYA 5DPTA 1VJKA 1WGHA 3B08A 3VTVA 3IBEA 2D3BA 3OWEB 4WH4A 1MG4A 2WXIA 4PYZA 1UBIA 3ZRFA 1VD2A 4RF1A 1ENFA 1G6JA 2G4DB 1GC7A 4C7ZA 1FIQA 2CS4A 4XDCA 2WXOA 1WGKA 1A5RA 1QZEA 1C4CA 2HE7A 3QWZB 4A6QA 1PGBA 2KJ6A 4W9KA 4EZJA 4HCNB 3T8MA 1XLPA 4L2YA 2CR5A 4II2B 4N58A 1KRHA 3KVFB 5E6NA 1Y8RC 1E8WA 2UYZB 2MP2A 5H92C 4MDKE 1D4BA 2L3ZA 1I4QA 4BOSC 3U8ZA 2W82A 1WSPA 3ML9A 1R4MB 4XC2A 1V6EA 2CHWA 2K39A 3VTUA 1YJJA 3W1SC 2N0SB 3X0WA 2DBYA 4JX1C 2FAZA 3HM3A 5CX3A 2WU5B 2Q5WD 3AEEB 3IXSA 1E6EB 4CQNA 3WANA 2I2YA 4E71A 4O1NA 3KUDB 3WAOA 1ZOYB 3H7PB 4A55A 3RZFA 2BT6A 2KNBA 1C77A 4LJPB 2FUG1 3V3XA 1UNSA 5BMIA 3DDCB 4WJPA 4DDGD 1YJIA 1IGDA 2A5UA 3RNAC 3N1XC 3RN9C 4NJCA 3AE6B 1OQYA 4TQ1A 1ROEA 2IPKD 2ZPNA 1XQQA 4XZ4A 4MGZE 2GBKA 2KACA 2RDGA 2MBQA 3TCAA 4CHKA 1J0GA 4IOIE 2I1KA 4JE3B 2R2OA 4AOFA 3C0RB 1T5XD 3ZJUA 4EOYA 3B9JA 2INNE 2GBNA 2KFKA 2AQ1B 2N9KA 3AU4A 4FULA 4M0WA 1DOXA 2WP9B 4PK1A 1I4XA 1FNWA 4W9CA 3WCQA 1QOFA 3RZWC 3PTFC 2BF8B 2JXXA 3IT4B 2L8JA 1HEZE 1I7HA 1K51A 3SR6A 1WFYA 4LTUA 3Q8BA 2CHXA 2LVQA 3UGBB 4G0NB 5IKCM 4DHJD 1MFWA 1HXYD 2M1MA 4JLCA 4P1BC 3FC4A 1WGDA 4K81A 3Q8AA 3ZVVA 3BWUD 2AEHA 4DK5A 4GSWA 3PHXB 4AQ7A 2M8SA 5D94A 2SAKA 4L23A 2WX1A 5BMHA 2G4SA 3AE9B 2CJOA 2IO1B 1R7SA 4P1CC 1EM7A 4REZA 4GB9A 3KYDD 3MHZA 1NI3A 3DQVA 4KGSA 2WXPA 4HRSA 4IDIA 3BYYB 3BVZA 3T9LA 4ZDVA 4MACA 3VXWA 4DXAB 2LHDA 2JPHA 1H8CA 2LGSA 3DHGC 3O13A 1FD6A 5JH5C 3BVMA 2ZJDA 2L7RA 2RR9A 3BINA 2MBBB 2J42A 4JIOU 1WM2A 5L95C 3A4RA 1J7AA 4GDLA 3PZ7A 2PJHA 5GXGB 4S17A 1FRDA 4KIKA 3NVWA 2RPVA 5EE0A 4GDLB 5BYQA 3EHVA 4GIVA 2KWDA 1H4RA 1YN3A 4B95A 2E6XA 2K8CA 4FJZA 3R8BA 2CU3A 1E5WA 2AL6A 2KDEB 1MHHE 4ANWA 2Y5PA 1E7UA 4ZYSA 1YJ1A 2ZPYA 2YVCA 3V61A 3R2TA 2BS3B 3GZNI 4EZLA 3I9V1 2O6VA 1DGJA 3NHEB 2Y3AA 4MM3A 1TGZB 4D2KA 1SJED 3T3OA 4I6PA 3B0AA 5H8YE 2M17A 2GBJA 1KLGD 2XEWA 2PKOA 2JYTA 4YWGG 2KQSA 1J7BA 3VDZA 3JW0X 3DBRI 3KUCB 1T0QC 1K53A 5DCNA 5CHWA 3NVYA 4DDID 2ZZPB 5E6PA 1BUIC 2IGGA 1ISNA 4HPLB 1YX5B 3UIOB 3NJTA
chains in the Genus database with same CATH topology
2DAFA 1C1YB 2IY1B 2DZMA 4LCDE 4BBNF 3PRPB 4BOZB 3VUYA 2MWSB 3JSVB 3BY4B 3ZW3A 1I35A 4IC7B 4B6WA 3EFUA 4DWFA 1WR6E 3TIXA 5HKHA 2KHWB 4HPMB 1RFAA 2K6DB 4PYUA 3H9DA 1WGGA 3WA0A 2OJRA 3KYCD 3N30A 5KHOA 2DHZA 3VTWA 3PS6A 2ZVOA 3H6NA 4ZRIA 5EDSA 3APDA 3M3JA 2UWQA 1EUVB 4MJSA 4WAAA 2O6VB 1WM3A 3UIPB 4A3OA 4FJYA 2L0FA 3SDLC 2C9WB 4FJVB 2I1JA 1V81A 3L0WB 4X57B 4XX5A 3A1QB 1WJ4A 1IPGA 2XK5B 2D11A 2FIFA 2V1YA 4ICVA 4KDIC 5E6OA 3VUXA 5JHBA 4KZCA 4W9IA 2KTRB 5GMVA 4KIKB 4IWOA 4KVGB 2ZVNA 3QK0A 3V6CB 3ZTDA 2FCNA 2KMCA 1OTRB 1GJZA 1KJTA 3JVZX 2K25A 5DPWA 1E7VA 3PVLA 2KANA 2XBBC 2JRIB 1WXAA 4HLEA 1X1MA 3PRMB 2KVRA 1U4AA 3LJ3A 1WJUA 4NQLB 4TUUA 2LUEA 4GDKB 1WY8A 4KV2A 3LDZE 2L05A 4I6NB 3M95A 4ICUA 3TL5A 2MLBA 3OAWA 4NAWA 2AWTA 4HWIB 2D07B 4II3B 4FADA 2KTFA 3QA8A 2RPQA 4GN1A 3R7QA 1Q1OA 3JYUA 3PHWB 4OVUA 5FR6A 4DHZB 2G3QB 3OJ4B 4G11A 2Z0EB 3L10B 2Z59B 1E8XA 4RMAA 1VCBA 2D3GA 2DAJA 4CO7A 1P98A 4TKNA 1BT0A 4TV3A 1YIWA 2BYEA 4LDTB 4EFOA 4PS8A 3V62A 2XK5A 4JL9A 3PLUA 2GBMA 4JGHB 1YD8U 2ZEQA 4A20A 1WYWB 5LXIB 4BVUC 1R4MI 4EEWA 3QHTA 2BPSA 2PE9A 5BO4B 2KWCA 3ZNID 4IWQA 1I42A 3PLVA 2DYMA 3A1QA 5IAAC 3U30A 2G45B 2LGXA 1WF9A 2KD0A 1UGMA 1R4NI 2HD5B 2O2VB 3SHQA 1WMHB 4F8CB 4GOCA 2BYFA 1SE9A 3H7PA 3HIZA 3H1UA 2ASQA 2K8BA 2KWVB 1P3QU 1V2YA 3ONSA 2LZ6A 4W9EA 2O6VD 2FCSA 2MBEA 3ENEA 1ZW7A 1J19A 2GBRA 2N9PC 2LASA 3Q3JA 4IUMB 4ANVA 1SIFA 4FBJB 5AEKB 1LXDA 4J6IA 4DHJB 3CMMB 1V86A 4EZKA 3VUWA 2KX3A 4AJWA 4HXDA 4HCPB 2BKRB 3AULA 2KWUB 3PGEA 4KDLB 2EKEC 3APFA 4MJSB 3MJWA 4OVVA 4K7UA 1P0RA 2GOWA 5KHQA 2MP2B 3EC8A 3PT2B 5DPTA 2QHOA 1WGHA 3B08A 3VTVA 2A4ZA 1WRDB 1WIAA 2C7MB 2KJHB 3IBEA 3VAWA 3A33B 2LXAA 2J0KA 4A3PA 4BKGA 2KTRA 3CSFA 2KX0A 4PYZA 1UBIA 2Z0DB 5AZHA 4RM8A 4TQ0A 1AARA 3IHPC 3ZRFA 2V3SA 1VD2A 3ALBA 3M62B 3A4SC 1G6JA 4WJQA 2G4DB 4B9KA 1GC7A 3TJPA 3VVWB 2CS4A 2M0XA 2DENB 2C7HA 1WZ3A 3NS8A 2MBHA 2IZVB 3AU5A 2MA9B 4WJOA 5LLIA 4ANUA 1A5RA 1QZEA 2J0JA 2JZZA 3A9JB 1WE6A 4BBNC 2HE7A 4WWNA 3QWZB 4GMVA 4BKTA 3CSTA 1S1QB 2KFKB 1WXMA 1WMHA 3DBLI 1V9JA 3A9JA 2KJ6A 3DVNV 4PS3A 3N3KB 4HCNB 4W9KA 3T8MA 4EZJA 2MQJA 5DPSA 5JZEB 2CR5A 5CTRC 1E90A 4ZYNA 1GG3A 3ZO5B 4E3CA 1RRBA 2L76A 5C23A 4II2B 1EF1A 2ZNVC 1UELA 4AJYB 3KVFB 3ZKJC 5E6NA 1Y8RC 3QC8B 1E8WA 3Q3FA 4MGIE 3ZTCA 2UYZB 4GGQA 2FNJB 3QAQA 2MP2A 2KDBA 3KH0A 3MHSD 4MDKE 2WX0A 1WX9A 2L3ZA 2Y5BB 2MRPA 4BOSC 3U8ZA 3RD2A 4ZRJA 1WJ6A 1TBEA 3ML9A 4FN2A 3RCZA 4W9DA 4XC2A 1V6EA 2CHWA 2K39A 3VQIA 3VTUA 1M94A 3W1SC 1WX7A 5IA7A 1S3SG 2N9EB 4DHZE 3PRZA 3X0WA 2KC1A 2WYQA 3SD5A 3VH3B 5J2RA 2FAZA 3HM3A 2O2VA 4W9HA 5CX3A 2IY0B 3R7RA 1IYFA 1UBQA 1C3TA 1Q5WB 4EUTA 1YX6B 4HK2A 3WANA 2KDIA 4MSQB 4E71A 1UD7A 4NNJB 1RAXA 1WX8A 2DZKA 2N1VA 4K7SA 4MH0E 3KUDB 4FLHA 3WALA 2ZCBA 2CKHB 1XT9B 2CU1A 3WAOA 4BKSA 2JT4B 3RULA 1L7YA 4NAWB 3DBSA 2OOBB 3W1SA 4M8NA 1KLVA 3H7PB 3D32A 4IW0A 2JZ3B 3HK0A 2AYOB 3RZFA 3ZDTA 3O65B 3VHTC 2BWES 2CHZA 3NOBA 3ZDMC 2DYBA 2KNBA 4LDTD 3NY5A 3K9OB 4KZ0A 2KOXA 4LJPB 5AZGA 3L16A 2LGYA 1KM7A 1TZ1A 2C7NB 3DDCB 4WJPA 1WGYA 4DDGD 2BGFA 2D10A 2N7EA 1V80A 2NPTA 2A5UA 3I3TB 2KLCA 2KC2A 1PQSA 5CHVC 3ZUNA 3QARA 2PE6B 4FHKA 1OQYA 2IO3B 3HHMA 3PPAA 3PREA 4TQ1A 1E8YA 2ZPNA 1XQQA 3WAPA 1FXTB 2IYDB 3R3MA 4XZ4A 4MGZE 1RLFA 2GBKA 3PSEB 5C1ZA 4IM2A 2PEAA 2C60A 2MBQA 3DOWA 3TCAA 3OJ3A 4CHKA 4JQWC 1UZXB 4W9FA 3OLMD 1J0GA 2I1KA 2R2OA 3L54A 1WGRA 2JF5A 4NJ7A 2N7DA 3N32A 3L08A 4K1RB 3C0RB 4AOFA 1IP9A 2RSUA 3L13A 2LGDA 2REXA 4EOYA 1WZ0A 4I6LB 4HDQA 2GBNA 2KFKA 2KKCA 5G2NA 2KJRA 3AU4A 2N9XA 3EECA 4FULA 1V5TA 3UQAA 2KDFB 4LJOB 3IFWB 2NS5A 1GUAB 2LXCA 4HDOA 4KSKC 4CYEA 5JHAA 4PS7A 2GMIC 3KW5B 4KSLC 4HJKA 4W9CA 4MELA 4IG7B 3RZWC 3VH4B 1OEYJ 3PTFC 2BF8B 2JXXA 4BKSD 1XD3B 2L8JA 4RM9A 3SU8X 3TBLD 3V60A 5J18A 1WFYA 2DZIA 4NY0A 2CHXA 2LVQA 2LRWA 5D7GA 2FCMA 3UGBB 3W1YA 4G0NB 2JUOA 4AWJA 4NJ6A 3HM6X 4DHJD 1E8ZA 1JRUA 2EMSA 2M1MA 3QX1A 2ZNVB 4JLCA 2JVCA 5TR5A 1LFDA 1F9JA 4URKA 1WGDA 4WJNA 4K81A 3ZVVA 2LJ5A 3ZLZA 1SGHA 2AEHA 4DK5A 2K1FA 1EO6A 3PHXB 2W9NA 4GSWA 2NR2A 3DCGA 3QJZA 2HTHA 2M8SA 3RT3B 5D94A 3DBHI 2NBWB 2WX1A 2KZRA 2G4SA 1J8CA 3V6EB 2IO1B 3DVGX 3PV1A 2RGFA 2M4NA 3NZUA 1L2NA 2KMAA 1V5OA 3WAMA 1WI0A 4BFRA 3VFKA 1UH6A 4M8MA 3B1LX 4AP4C 5J17A 4GB9A 2N1WA 3KYDD 4IM0A 5AZFA 3DQVA 2J7QB 1ZKHA 3KUZA 5D2MB 2DYOA 1Z2MA 1MG8A 3QCAA 4F7ZA 2VRRB 3NZSA 3MTNB 3H7SA 3T9LA 1EF5A 4ZDVA 1HE8A 2NVUI 2K6QA 3VXWA 2KO3A 4DXAB 3RYTA 2D2QA 2IBIB 4FA6A 4GU2A 2L00B 2JPHA 1ZGUB 2FIDA 4W9GA 4G50A 1H8CA 3ZNZB 4DBGA 2DZJA 2MSED 2MX2A 4P7IA 3S2AA 2LRUA 2LI5A 2BYVE 4MSMB 5JH5C 4W9JA 4G3XB 2ZJDA 3APCA 1TTNA 2L7RA 3DVGY 4WWPA 2V4LA 1Q0WB 2JWZA 1WXVA 2RR9A 3AXCA 3BINA 4WWOA 4NPNA 2MBBB 3ZIMA 2C5LC 3ZNGC 1K8RB 4JIOU 1WM2A 4ANXA 5L95C 1WE7A 4W9LA 2IO0B 3A4RA 2WWZA 1NI2A 4GDLA 5LXHA 2LVOA 1NDDA 2PJHA 2YLMA 2MBOA 2N4FA 4KIKA 2NBUA 3ZNHB 4GDLB 1CMXB 2J0MA 4N9F4 4AUQC 3EHVA 4GDKA 4GIVA 4IM3A 1GC6A 1V49A 1WXSA 1H4RA 1P1AA 4B95A 4M0WB 1NBFC 1Z5SB 2KN5A 2FUHB 3K9PB 2K8CA 3JSVA 3QIJA 4FJZA 2ZCCA 4FHJA 3UQBA 2KFJA 1E5WA 1WR1A 2AL6A 2JRHA 5CHFA 5L83A 2DX5B 2KDEB 2LWPA 4ANWA 1E7UA 1YJ1A 5G55A 2L0TA 2ZPYA 1LM8B 2YVCA 2NBVB 2LVPA 2HJ8A 2BWFA 2KK8A 2KQ7A 4YL8A 1OGWA 3V61A 2RD0A 3CF6E 3GZNI 4EKUA 1LQBA 2K8HA 3TMPB 2O6VA 4EZLA 4WQOB 2MCNB 3RUIB 3X23A 2NPTB 3L17A 3NHEB 5D6JB 3ZRCA 3WIMA 4MM3A 3QQ8B 2BKFA 4HVBA 4MGKE 1KOTA 4E74A 1TGZB 2KXJA 1OEYA 3IVFA 2KLGA 3ML8A 2WDTB 4I6PA 3B0AA 2IO2B 2M17A 1WH3A 2GBJA 4ASWC 3A9KB 1YQBA 3IG3A 3U7DA 2MW5A 2XEWA 5DPRA 3R66C 3A9KA 3P2BA 3ECIA 2KQSA 3VDZA 3GOEA 3DBRI 3JW0X 3KUCB 4IWPA 4NQKE 1WJNA 3M63B 2B3AA 5DCNA 2AL3A 1T0YA 3DPDA 5CHWA 2JY6A 4DDID 2R2QA 2ZZPB 2NCNA 1GNUA 2EMTA 4K7WA 1P9DU 4GXBA 4ZRKA 2LD9A 5E6PA 4F1SA 1D3ZA 3AI5A 4MEMA 2PPHA 1ISNA 2FCQA 4HPLB 3UF8A 1YX5B 3UIOB 3UINB 4MGYE 3PZDA 3DVNU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAF A;  1C1Y B;  2IY1 B;  2DZM A;  4LCD E;  4BBN F;  3PRP B;  4BOZ B;  3VUY A;  2MWS B;  3JSV B;  3BY4 B;  3ZW3 A;  1I35 A;  4IC7 B;  4B6W A;  3EFU A;  4DWF A;  1WR6 E;  3TIX A;  5HKH A;  2KHW B;  4HPM B;  1RFA A;  2K6D B;  4PYU A;  3H9D A;  1WGG A;  3WA0 A;  2OJR A;  3KYC D;  3N30 A;  5KHO A;  2DHZ A;  3VTW A;  3PS6 A;  2ZVO A;  3H6N A;  4ZRI A;  5EDS A;  3APD A;  3M3J A;  2UWQ A;  1EUV B;  4MJS A;  4WAA A;  2O6V B;  1WM3 A;  3UIP B;  4A3O A;  4FJY A;  2L0F A;  3SDL C;  2C9W B;  4FJV B;  2I1J A;  1V81 A;  3L0W B;  4X57 B;  4XX5 A;  3A1Q B;  1WJ4 A;  1IPG A;  2XK5 B;  2D11 A;  2FIF A;  2V1Y A;  4ICV A;  4KDI C;  5E6O A;  3VUX A;  5JHB A;  4KZC A;  4W9I A;  2KTR B;  5GMV A;  4KIK B;  4IWO A;  4KVG B;  2ZVN A;  3QK0 A;  3V6C B;  3ZTD A;  2FCN A;  2KMC A;  1OTR B;  1GJZ A;  1KJT A;  3JVZ X;  2K25 A;  5DPW A;  1E7V A;  3PVL A;  2KAN A;  2XBB C;  2JRI B;  1WXA A;  4HLE A;  1X1M A;  3PRM B;  2KVR A;  1U4A A;  3LJ3 A;  1WJU A;  4NQL B;  4TUU A;  2LUE A;  4GDK B;  1WY8 A;  4KV2 A;  3LDZ E;  2L05 A;  4I6N B;  3M95 A;  4ICU A;  3TL5 A;  2MLB A;  3OAW A;  4NAW A;  2AWT A;  4HWI B;  2D07 B;  4II3 B;  4FAD A;  2KTF A;  3QA8 A;  2RPQ A;  4GN1 A;  3R7Q A;  1Q1O A;  3JYU A;  3PHW B;  4OVU A;  5FR6 A;  4DHZ B;  2G3Q B;  3OJ4 B;  4G11 A;  2Z0E B;  3L10 B;  2Z59 B;  1E8X A;  4RMA A;  1VCB A;  2D3G A;  2DAJ A;  4CO7 A;  1P98 A;  4TKN A;  1BT0 A;  4TV3 A;  1YIW A;  2BYE A;  4LDT B;  4EFO A;  4PS8 A;  3V62 A;  2XK5 A;  4JL9 A;  3PLU A;  2GBM A;  4JGH B;  1YD8 U;  2ZEQ A;  4A20 A;  1WYW B;  5LXI B;  4BVU C;  1R4M I;  4EEW A;  3QHT A;  2BPS A;  2PE9 A;  5BO4 B;  2KWC A;  3ZNI D;  4IWQ A;  1I42 A;  3PLV A;  2DYM A;  3A1Q A;  5IAA C;  3U30 A;  2G45 B;  2LGX A;  1WF9 A;  2KD0 A;  1UGM A;  1R4N I;  2HD5 B;  2O2V B;  3SHQ A;  1WMH B;  4F8C B;  4GOC A;  2BYF A;  1SE9 A;  3H7P A;  3HIZ A;  3H1U A;  2ASQ A;  2K8B A;  2KWV B;  1P3Q U;  1V2Y A;  3ONS A;  2LZ6 A;  4W9E A;  2O6V D;  2FCS A;  2MBE A;  3ENE A;  1ZW7 A;  1J19 A;  2GBR A;  2N9P C;  2LAS A;  3Q3J A;  4IUM B;  4ANV A;  1SIF A;  4FBJ B;  5AEK B;  1LXD A;  4J6I A;  4DHJ B;  3CMM B;  1V86 A;  4EZK A;  3VUW A;  2KX3 A;  4AJW A;  4HXD A;  4HCP B;  2BKR B;  3AUL A;  2KWU B;  3PGE A;  4KDL B;  2EKE C;  3APF A;  4MJS B;  3MJW A;  4OVV A;  4K7U A;  1P0R A;  2GOW A;  5KHQ A;  2MP2 B;  3EC8 A;  3PT2 B;  5DPT A;  2QHO A;  1WGH A;  3B08 A;  3VTV A;  2A4Z A;  1WRD B;  1WIA A;  2C7M B;  2KJH B;  3IBE A;  3VAW A;  3A33 B;  2LXA A;  2J0K A;  4A3P A;  4BKG A;  2KTR A;  3CSF A;  2KX0 A;  4PYZ A;  1UBI A;  2Z0D B;  5AZH A;  4RM8 A;  4TQ0 A;  1AAR A;  3IHP C;  3ZRF A;  2V3S A;  1VD2 A;  3ALB A;  3M62 B;  3A4S C;  1G6J A;  4WJQ A;  2G4D B;  4B9K A;  1GC7 A;  3TJP A;  3VVW B;  2CS4 A;  2M0X A;  2DEN B;  2C7H A;  1WZ3 A;  3NS8 A;  2MBH A;  2IZV B;  3AU5 A;  2MA9 B;  4WJO A;  5LLI A;  4ANU A;  1A5R A;  1QZE A;  2J0J A;  2JZZ A;  3A9J B;  1WE6 A;  4BBN C;  2HE7 A;  4WWN A;  3QWZ B;  4GMV A;  4BKT A;  3CST A;  1S1Q B;  2KFK B;  1WXM A;  1WMH A;  3DBL I;  1V9J A;  3A9J A;  2KJ6 A;  3DVN V;  4PS3 A;  3N3K B;  4HCN B;  4W9K A;  3T8M A;  4EZJ A;  2MQJ A;  5DPS A;  5JZE B;  2CR5 A;  5CTR C;  1E90 A;  4ZYN A;  1GG3 A;  3ZO5 B;  4E3C A;  1RRB A;  2L76 A;  5C23 A;  4II2 B;  1EF1 A;  2ZNV C;  1UEL A;  4AJY B;  3KVF B;  3ZKJ C;  5E6N A;  1Y8R C;  3QC8 B;  1E8W A;  3Q3F A;  4MGI E;  3ZTC A;  2UYZ B;  4GGQ A;  2FNJ B;  3QAQ A;  2MP2 A;  2KDB A;  3KH0 A;  3MHS D;  4MDK E;  2WX0 A;  1WX9 A;  2L3Z A;  2Y5B B;  2MRP A;  4BOS C;  3U8Z A;  3RD2 A;  4ZRJ A;  1WJ6 A;  1TBE A;  3ML9 A;  4FN2 A;  3RCZ A;  4W9D A;  4XC2 A;  1V6E A;  2CHW A;  2K39 A;  3VQI A;  3VTU A;  1M94 A;  3W1S C;  1WX7 A;  5IA7 A;  1S3S G;  2N9E B;  4DHZ E;  3PRZ A;  3X0W A;  2KC1 A;  2WYQ A;  3SD5 A;  3VH3 B;  5J2R A;  2FAZ A;  3HM3 A;  2O2V A;  4W9H A;  5CX3 A;  2IY0 B;  3R7R A;  1IYF A;  1UBQ A;  1C3T A;  1Q5W B;  4EUT A;  1YX6 B;  4HK2 A;  3WAN A;  2KDI A;  4MSQ B;  4E71 A;  1UD7 A;  4NNJ B;  1RAX A;  1WX8 A;  2DZK A;  2N1V A;  4K7S A;  4MH0 E;  3KUD B;  4FLH A;  3WAL A;  2ZCB A;  2CKH B;  1XT9 B;  2CU1 A;  3WAO A;  4BKS A;  2JT4 B;  3RUL A;  1L7Y A;  4NAW B;  3DBS A;  2OOB B;  3W1S A;  4M8N A;  1KLV A;  3H7P B;  3D32 A;  4IW0 A;  2JZ3 B;  3HK0 A;  2AYO B;  3RZF A;  3ZDT A;  3O65 B;  3VHT C;  2BWE S;  2CHZ A;  3NOB A;  3ZDM C;  2DYB A;  2KNB A;  4LDT D;  3NY5 A;  3K9O B;  4KZ0 A;  2KOX A;  4LJP B;  5AZG A;  3L16 A;  2LGY A;  1KM7 A;  1TZ1 A;  2C7N B;  3DDC B;  4WJP A;  1WGY A;  4DDG D;  2BGF A;  2D10 A;  2N7E A;  1V80 A;  2NPT A;  2A5U A;  3I3T B;  2KLC A;  2KC2 A;  1PQS A;  5CHV C;  3ZUN A;  3QAR A;  2PE6 B;  4FHK A;  1OQY A;  2IO3 B;  3HHM A;  3PPA A;  3PRE A;  4TQ1 A;  1E8Y A;  2ZPN A;  1XQQ A;  3WAP A;  1FXT B;  2IYD B;  3R3M A;  4XZ4 A;  4MGZ E;  1RLF A;  2GBK A;  3PSE B;  5C1Z A;  4IM2 A;  2PEA A;  2C60 A;  2MBQ A;  3DOW A;  3TCA A;  3OJ3 A;  4CHK A;  4JQW C;  1UZX B;  4W9F A;  3OLM D;  1J0G A;  2I1K A;  2R2O A;  3L54 A;  1WGR A;  2JF5 A;  4NJ7 A;  2N7D A;  3N32 A;  3L08 A;  4K1R B;  3C0R B;  4AOF A;  1IP9 A;  2RSU A;  3L13 A;  2LGD A;  2REX A;  4EOY A;  1WZ0 A;  4I6L B;  4HDQ A;  2GBN A;  2KFK A;  2KKC A;  5G2N A;  2KJR A;  3AU4 A;  2N9X A;  3EEC A;  4FUL A;  1V5T A;  3UQA A;  2KDF B;  4LJO B;  3IFW B;  2NS5 A;  1GUA B;  2LXC A;  4HDO A;  4KSK C;  4CYE A;  5JHA A;  4PS7 A;  2GMI C;  3KW5 B;  4KSL C;  4HJK A;  4W9C A;  4MEL A;  4IG7 B;  3RZW C;  3VH4 B;  1OEY J;  3PTF C;  2BF8 B;  2JXX A;  4BKS D;  1XD3 B;  2L8J A;  4RM9 A;  3SU8 X;  3TBL D;  3V60 A;  5J18 A;  1WFY A;  2DZI A;  4NY0 A;  2CHX A;  2LVQ A;  2LRW A;  5D7G A;  2FCM A;  3UGB B;  3W1Y A;  4G0N B;  2JUO A;  4AWJ A;  4NJ6 A;  3HM6 X;  4DHJ D;  1E8Z A;  1JRU A;  2EMS A;  2M1M A;  3QX1 A;  2ZNV B;  4JLC A;  2JVC A;  5TR5 A;  1LFD A;  1F9J A;  4URK A;  1WGD A;  4WJN A;  4K81 A;  3ZVV A;  2LJ5 A;  3ZLZ A;  1SGH A;  2AEH A;  4DK5 A;  2K1F A;  1EO6 A;  3PHX B;  2W9N A;  4GSW A;  2NR2 A;  3DCG A;  3QJZ A;  2HTH A;  2M8S A;  3RT3 B;  5D94 A;  3DBH I;  2NBW B;  2WX1 A;  2KZR A;  2G4S A;  1J8C A;  3V6E B;  2IO1 B;  3DVG X;  3PV1 A;  2RGF A;  2M4N A;  3NZU A;  1L2N A;  2KMA A;  1V5O A;  3WAM A;  1WI0 A;  4BFR A;  3VFK A;  1UH6 A;  4M8M A;  3B1L X;  4AP4 C;  5J17 A;  4GB9 A;  2N1W A;  3KYD D;  4IM0 A;  5AZF A;  3DQV A;  2J7Q B;  1ZKH A;  3KUZ A;  5D2M B;  2DYO A;  1Z2M A;  1MG8 A;  3QCA A;  4F7Z A;  2VRR B;  3NZS A;  3MTN B;  3H7S A;  3T9L A;  1EF5 A;  4ZDV A;  1HE8 A;  2NVU I;  2K6Q A;  3VXW A;  2KO3 A;  4DXA B;  3RYT A;  2D2Q A;  2IBI B;  4FA6 A;  4GU2 A;  2L00 B;  2JPH A;  1ZGU B;  2FID A;  4W9G A;  4G50 A;  1H8C A;  3ZNZ B;  4DBG A;  2DZJ A;  2MSE D;  2MX2 A;  4P7I A;  3S2A A;  2LRU A;  2LI5 A;  2BYV E;  4MSM B;  5JH5 C;  4W9J A;  4G3X B;  2ZJD A;  3APC A;  1TTN A;  2L7R A;  3DVG Y;  4WWP A;  2V4L A;  1Q0W B;  2JWZ A;  1WXV A;  2RR9 A;  3AXC A;  3BIN A;  4WWO A;  4NPN A;  2MBB B;  3ZIM A;  2C5L C;  3ZNG C;  1K8R B;  4JIO U;  1WM2 A;  4ANX A;  5L95 C;  1WE7 A;  4W9L A;  2IO0 B;  3A4R A;  2WWZ A;  1NI2 A;  4GDL A;  5LXH A;  2LVO A;  1NDD A;  2PJH A;  2YLM A;  2MBO A;  2N4F A;  4KIK A;  2NBU A;  3ZNH B;  4GDL B;  1CMX B;  2J0M A;  4N9F 4;  4AUQ C;  3EHV A;  4GDK A;  4GIV A;  4IM3 A;  1GC6 A;  1V49 A;  1WXS A;  1H4R A;  1P1A A;  4B95 A;  4M0W B;  1NBF C;  1Z5S B;  2KN5 A;  2FUH B;  3K9P B;  2K8C A;  3JSV A;  3QIJ A;  4FJZ A;  2ZCC A;  4FHJ A;  3UQB A;  2KFJ A;  1E5W A;  1WR1 A;  2AL6 A;  2JRH A;  5CHF A;  5L83 A;  2DX5 B;  2KDE B;  2LWP A;  4ANW A;  1E7U A;  1YJ1 A;  5G55 A;  2L0T A;  2ZPY A;  1LM8 B;  2YVC A;  2NBV B;  2LVP A;  2HJ8 A;  2BWF A;  2KK8 A;  2KQ7 A;  4YL8 A;  1OGW A;  3V61 A;  2RD0 A;  3CF6 E;  3GZN I;  4EKU A;  1LQB A;  2K8H A;  3TMP B;  2O6V A;  4EZL A;  4WQO B;  2MCN B;  3RUI B;  3X23 A;  2NPT B;  3L17 A;  3NHE B;  5D6J B;  3ZRC A;  3WIM A;  4MM3 A;  3QQ8 B;  2BKF A;  4HVB A;  4MGK E;  1KOT A;  4E74 A;  1TGZ B;  2KXJ A;  1OEY A;  3IVF A;  2KLG A;  3ML8 A;  2WDT B;  4I6P A;  3B0A A;  2IO2 B;  2M17 A;  1WH3 A;  2GBJ A;  4ASW C;  3A9K B;  1YQB A;  3IG3 A;  3U7D A;  2MW5 A;  2XEW A;  5DPR A;  3R66 C;  3A9K A;  3P2B A;  3ECI A;  2KQS A;  3VDZ A;  3GOE A;  3DBR I;  3JW0 X;  3KUC B;  4IWP A;  4NQK E;  1WJN A;  3M63 B;  2B3A A;  5DCN A;  2AL3 A;  1T0Y A;  3DPD A;  5CHW A;  2JY6 A;  4DDI D;  2R2Q A;  2ZZP B;  2NCN A;  1GNU A;  2EMT A;  4K7W A;  1P9D U;  4GXB A;  4ZRK A;  2LD9 A;  5E6P A;  4F1S A;  1D3Z A;  3AI5 A;  4MEM A;  2PPH A;  1ISN A;  2FCQ A;  4HPL B;  3UF8 A;  1YX5 B;  3UIO B;  3UIN B;  4MGY E;  3PZD A;  3DVN U; 
#chains in the Genus database with same CATH topology
 4BBN F;  3PRP B;  4BOZ B;  3Q3O C;  3VUY A;  3JSV B;  3EFU A;  3TIX A;  1MJD A;  3H9D A;  1C78 A;  1IUE A;  3PS6 A;  3H6N A;  3Q69 A;  2IGH A;  3M3J A;  4BAX A;  3NVZ A;  3UIP B;  2L0F A;  1V81 A;  4XX5 A;  1FCC C;  2KDM A;  2D11 A;  2X8X X;  4C7Y A;  4IWO A;  2KMC A;  3EFC A;  2BS4 B;  1GJZ A;  1E7V A;  3PVL A;  2JRI B;  4HLE A;  1SB3 C;  1X1M A;  3U2S C;  2OJW A;  4TUU A;  1KFY B;  1WY8 A;  3W5U B;  2L05 A;  3TL5 A;  3OAW A;  1L0V B;  4HWI B;  2JSV X;  2HDE A;  4FAD A;  4GN1 A;  3R7Q A;  4OVU A;  3NZ3 A;  3FKY A;  4WWM A;  1VCB A;  2D3G A;  2DAJ A;  1TKG A;  4TKN A;  1N5W A;  2WXF A;  4TV3 A;  4YSX B;  4LDT B;  3AE7 B;  2WLB A;  2XK5 A;  2GBM A;  5MPO A;  1YD8 U;  3DWG C;  2ZW0 A;  2ZW1 A;  1WYW B;  1XXG A;  5LXI B;  2JWU A;  3QHT A;  2BPS A;  5BO4 B;  2KWC A;  2DYM A;  1NVI D;  3RPF C;  1DOY A;  2D3A A;  3U52 E;  4YSZ B;  3KQ4 A;  2M56 B;  4MH8 A;  3SHQ A;  4GOC A;  5C3J B;  1PDX A;  3BVG A;  3HIZ A;  2JQR B;  4C4V B;  2KWV B;  1P3Q U;  2XN9 C;  4R3D A;  1N5X A;  2TSS A;  1OQQ A;  4IUM B;  2IDY A;  4ANV A;  3CMM B;  1RM6 C;  2WXG A;  3KWV A;  3VUW A;  2BVC A;  1OFF A;  2BKR B;  3AUL A;  3PGE A;  4KDL B;  2N9L A;  3N1Y C;  5KHQ A;  4YXD B;  3AEB B;  5EE3 A;  1C4A A;  2C7M B;  2LXA A;  2QC8 A;  4YTP B;  3U7Z A;  3CSF A;  4GLS C;  5BMG A;  4RM8 A;  1AAR A;  1FPY A;  2V3S A;  3OG5 A;  4HPP A;  3NS8 A;  1N63 A;  4BZA A;  4WJO A;  5LLI A;  3P4R B;  1LGR A;  2JZZ A;  3A9J B;  3P1M A;  4WWN A;  3CST A;  1S1Q B;  3L4P A;  4M00 A;  1XO3 A;  4PS3 A;  1TT5 B;  3N3K B;  2MQJ A;  5DPS A;  4C80 A;  1UWM A;  5CTR C;  3ZGZ A;  1GG3 A;  4KGR A;  3ZO5 B;  3AE3 B;  5E6J A;  1FXI A;  2EKI A;  3UI3 A;  2FNJ B;  2KDB A;  2LGI A;  1WX9 A;  3B2G A;  2MRP A;  1OQR A;  1UF0 A;  3PO0 A;  1TBE A;  3ETR A;  3GS2 A;  3RCZ A;  2J53 A;  1M94 A;  2N9E B;  4DHZ E;  3PRZ A;  1SXT A;  1HTQ A;  1GOZ A;  1IYF A;  4W9H A;  2IY0 B;  5EE9 A;  1Q5W B;  4HK2 A;  3LYY A;  3IAS 1;  2KDI A;  1UD7 A;  1WX8 A;  2N1V A;  2OHF A;  5IO9 A;  2CKH B;  4BKS A;  2JT4 B;  4USA A;  2OOB B;  4IW0 A;  3O65 B;  3NOB A;  4OHJ A;  3AN1 A;  5AZG A;  1TZ1 A;  2KT7 A;  1RYJ A;  1WGY A;  2N7E A;  3ZQ4 A;  3KWL A;  2KC2 A;  1PQS A;  3GE8 C;  2N7J A;  3ZUN A;  1PGX A;  1TS4 A;  2PE6 B;  4N6E B;  1E8Y A;  3WAP A;  5HFY A;  4K3C A;  1RLF A;  4IM2 A;  1L6U A;  2C60 A;  4P6V F;  2IJ0 A;  1V97 A;  1TJE A;  5IP4 D;  3P4S B;  2N7D A;  3N32 A;  3L08 A;  4K1R B;  1IP9 A;  2RSU A;  3L13 A;  3RNG C;  3VR8 B;  2LGD A;  2REX A;  1WZ0 A;  2K5P A;  2LMC A;  2KJR A;  2N9X A;  1V5T A;  3UQA A;  4LJO B;  4DXG A;  4HJK A;  1NEN B;  3RNC C;  3Q8E A;  1HTO A;  3I5J C;  1SE2 A;  3FIL B;  4M01 A;  1ZXI A;  2X38 A;  1L5P A;  2LRW A;  2FCM A;  5FR3 A;  1N61 A;  2QSD A;  4A8X C;  1E8Z A;  1B9R A;  1BML C;  2L1A A;  2ZNV B;  2JVC A;  1T3Q A;  4XGA B;  1F52 A;  4URK A;  2FBW B;  3Q3N C;  1SGH A;  2FE8 A;  3DBL B;  4WAF A;  2NR2 A;  2HTH A;  3EGR A;  3RT3 B;  4WIP A;  1K52 A;  4ITK A;  2NBW B;  4TSS A;  2KZR A;  3V6E B;  2M4N A;  2GRI A;  2KMA A;  4BFR A;  2VH1 A;  4M8M A;  2WXM A;  2ACZ B;  3PZ8 A;  1Y56 A;  2EEL A;  5AZF A;  3KUZ A;  5D2M B;  1TKE A;  1Z2M A;  5IN7 A;  1FFV A;  1EF5 A;  1HE8 A;  4LLG M;  2IBI B;  1CQV A;  3VRA B;  1ZGU B;  4DBG A;  2DZJ A;  2MSE D;  1VLB A;  4MSM B;  4W9J A;  4G3X B;  4L1B A;  3APC A;  3VQI A;  2PIA A;  2KVZ A;  2V4L A;  1Q0W B;  1WXV A;  3ZIM A;  2C5L C;  2QIE B;  1WE7 A;  4W9L A;  2WWZ A;  1T0R C;  3AH7 A;  3AE1 B;  5LXH A;  1QOG A;  5G5G A;  1NDD A;  1JML A;  2YLM A;  2MBO A;  2N4F A;  3VRB B;  2NBU A;  1AN8 A;  4N9F 4;  4AUQ C;  2J4X A;  1FFU A;  4M0W B;  1Z5S B;  2FUH B;  3K9P B;  3JSV A;  3QIJ A;  3UQB A;  2KFJ A;  1WR1 A;  2QEJ C;  3BYT B;  3NRZ A;  4AS1 A;  5G55 A;  1LM8 B;  2G9H D;  2NBV B;  2BYT A;  2LVP A;  2KK8 A;  2UU7 A;  1JWA D;  2K8H A;  2MCN B;  1KTK A;  3CIR B;  2D3C A;  2V3N A;  2BKF A;  1MVK A;  2KLG A;  3CWI A;  4PT5 A;  3IG3 A;  2MW5 A;  2ICI A;  3A9K A;  1QIL A;  3GOE A;  1WJN A;  1I4H A;  2B3A A;  4JWS C;  3TEW A;  2E3T A;  2R2Q A;  2EMT A;  1P9D U;  4GXB A;  1WYG A;  2LD9 A;  4F1S A;  3C8Y A;  2PPH A;  3UF8 A;  1UUP A;  3UIN B;  4MGY E;  1XCT L;  3PZD A;  1ESF A;  2IY1 B;  2DZM A;  2WS3 B;  3BY4 B;  1I35 A;  1ZUD 2;  5BYS A;  1A70 A;  3AEF B;  2OJR A;  3KYC D;  2PW9 A;  1JCK B;  2DHZ A;  2ZVO A;  2AQ3 B;  4MJS A;  1WM3 A;  4A3O A;  3W9C B;  4FJV B;  2I1J A;  5AUI A;  3L0W B;  3P42 A;  4KDI C;  4QAY A;  2KTR B;  4WUR A;  3V6C B;  3ZTD A;  3HVD A;  4KKJ A;  2XBB C;  3PRM B;  1WJU A;  4GDK B;  4KV2 A;  1ZDX A;  4YT0 B;  2MLB A;  3AE2 B;  2BTE A;  2KTF A;  2KQ4 X;  3RNE C;  5FR6 A;  4DHZ B;  2G1E A;  1NEK B;  2G3Q B;  3OJ4 B;  2M19 A;  3L10 B;  4Q2J A;  1JW9 D;  3C19 A;  2MHJ A;  2WQY B;  2BYE A;  3V62 A;  2H89 B;  3AB5 A;  3H8H A;  4A20 A;  4BVU C;  2PE9 A;  3PLV A;  3A1Q A;  5IAA C;  4ARI A;  2G45 B;  1WF9 A;  1R4N I;  2HJ1 A;  2KYW A;  2HD5 B;  4ZHP A;  1SE9 A;  4TMA B;  3RNB C;  2ASQ A;  2K8B A;  4HKQ A;  3LB8 C;  4RNA A;  2LZ6 A;  4W9E A;  4C00 A;  2KAJ A;  4N59 A;  2KMM A;  3ENE A;  1ZW7 A;  2GBR A;  2N9P C;  3Q3J A;  4XWT A;  1C9F A;  4KKI A;  1LXD A;  3GZN B;  4J6I A;  4EZK A;  2ON8 A;  1YOV B;  4NZL B;  4HRO A;  2KX3 A;  4AJW A;  4A9A A;  4HCP B;  4MM3 B;  2WXL A;  2EKE C;  4OVV A;  3MC0 B;  4K7U A;  1P0R A;  3W5V B;  3EC8 A;  1SE4 A;  2QHO A;  1N62 A;  1WRD B;  1WIA A;  2KJH B;  3VAW A;  3A33 B;  2J0K A;  3IT6 B;  2KX0 A;  1C76 A;  2Z0D B;  2RDH A;  4TQ0 A;  3ALB A;  3M62 B;  3A4S C;  4WJQ A;  4B9K A;  1ET6 A;  2M0X A;  2DEN B;  2MBH A;  2IZV B;  3AU5 A;  3DBH B;  4ANU A;  1JWS D;  3TUO A;  2J0J A;  2PVG C;  3FAH A;  4GMV A;  4LK0 M;  4BKT A;  1WXM A;  3EUB 2;  1EU4 A;  5BYR A;  4ZYN A;  2L76 A;  1LO5 D;  1EF1 A;  1FNU A;  2WXN A;  2ZNV C;  1TIF A;  1TS3 A;  3ZTC A;  4GGQ A;  3KH0 A;  1L0Y B;  2Y5B B;  3TSS A;  1QOB A;  1YQ4 B;  4ZRJ A;  1WJ6 A;  3ZYY X;  4FN2 A;  4W9D A;  2QJL A;  1E7P B;  1S3S G;  4KGT A;  2KC1 A;  3SD5 A;  3N20 C;  1PYW D;  2V3P A;  1UWX A;  3R7R A;  2O2V A;  1UBQ A;  1C3T A;  1GB1 A;  1TZO A;  4NNJ B;  1RAX A;  4K7S A;  4RGT A;  2AX5 A;  2INC C;  3RUL A;  3DBS A;  3W1S A;  4M8N A;  1KLV A;  1FNV A;  3D32 A;  3HK0 A;  3IAM 1;  3ZDT A;  3FIL A;  1JAL A;  2BWE S;  2CHZ A;  3ZDM C;  2DYB A;  4LDT D;  1KM7 A;  2M0A A;  1F77 A;  1V80 A;  5FK9 C;  3TEX A;  5CHV C;  3QAR A;  1HZ6 A;  3PRE A;  3PPA A;  5D3I B;  1HQR D;  2IYD B;  3PSE B;  5C1Z A;  1WRI A;  3OJ3 A;  4JQW C;  4W9F A;  2HTM E;  3OLM D;  2YEP F;  3MJ5 A;  1V1O A;  1ZDV A;  1WGR A;  4NJ7 A;  4RCO A;  3P4P B;  4I6L B;  4DXF A;  4HDQ A;  2KKC A;  4UDU C;  2KDF B;  3IFW B;  2NS5 A;  1GUA B;  4HDO A;  4KSK C;  4CYE A;  3RI7 C;  5JHA A;  4PS7 A;  3KW5 B;  5TSS A;  3MFG A;  1ZE3 D;  3R2I A;  2GLS A;  2LFI A;  3VH4 B;  1OEY J;  1V1P B;  1XD3 B;  4RM9 A;  3SU8 X;  4XDD A;  1YNT E;  2BB5 A;  2DZI A;  4NY0 A;  2L83 A;  2JUO A;  4NJ6 A;  3HRD D;  2WXJ A;  2EMS A;  2MJ3 A;  1FMA D;  1V8C A;  1CK1 A;  5T8I A;  2W54 A;  1SIJ A;  3RMK C;  3NVV A;  1EO6 A;  2W9N A;  1VZ6 A;  3QJZ A;  1KH0 A;  3U4E G;  1J8C A;  2BBC A;  1VZ7 A;  1YN5 A;  3NZU A;  1RWS A;  1WI0 A;  2QCZ A;  3VFK A;  1UH6 A;  2N1W A;  1C4P A;  4IM0 A;  1JWB D;  2J7Q B;  2DYO A;  2WGS A;  1MG8 A;  2DLB A;  3QCA A;  4F7Z A;  1E10 A;  2VRR B;  2W55 A;  3MTN B;  1L0X B;  1SF0 A;  2K6Q A;  1I4G A;  2KO3 A;  3DHI C;  4JWU C;  1EWY C;  4GU2 A;  2L00 B;  1QF6 A;  2FID A;  3Q8C A;  1L4D B;  3S2A A;  1D6E C;  2LRU A;  2LI5 A;  2LEK A;  1TTN A;  3DVG Y;  1STE A;  2JWZ A;  4NPN A;  1QLB B;  1K8R B;  1JQ4 A;  1C79 A;  1MHX A;  3I63 C;  3SFD B;  2K9X A;  1GPX A;  3ZNH B;  1VZ8 A;  1CMX B;  2J0M A;  4IM3 A;  1V49 A;  1WXS A;  4ZRP A;  2KN5 A;  2ZCC A;  2VZK D;  4FHJ A;  2JRH A;  1ACC A;  2LWP A;  2W3S A;  1PGA A;  2L0T A;  2QMT A;  1PUT A;  2HJ8 A;  2BWF A;  2KQ7 A;  3LXF A;  1OGW A;  2MH7 A;  3CF6 E;  3RUI B;  3X23 A;  2NPT B;  1DOI A;  3ZRC A;  4HVB A;  4MGK E;  3MC9 A;  1D5X C;  1OEY A;  3IVF A;  3ML8 A;  2WDT B;  2DWQ A;  1QKZ A;  2WU2 B;  4ASW C;  2L32 A;  1J7C A;  3A9K B;  1YMH E;  5DPR A;  2XNA C;  3R66 C;  3P2B A;  3ECI A;  4IWP A;  4NQK E;  1T0Y A;  4S0R A;  4K7W A;  2YEP B;  4ZRK A;  3AI5 A;  4MEM A;  1JWM D;  3MP9 A;  4BKG A;  1C1Y B;  3HUI A;  1DYQ A;  1F2R I;  3ZW3 A;  5EE1 A;  4DWF A;  1WR6 E;  4ZHO A;  4HPM B;  1RFA A;  2K6D B;  2V4I B;  1XF5 L;  3ABV B;  3AMZ A;  3VTW A;  2MJE A;  4HJG E;  2WXR A;  3APD A;  2K3U A;  2V9H A;  4WAA A;  2O6V B;  3SEB A;  4OZC A;  2I38 A;  2JYE A;  2C9W B;  1ET9 A;  4X57 B;  4HKZ E;  1WJ4 A;  1IPG A;  4ICV A;  2FIF A;  2V1Y A;  5E6O A;  3VUX A;  4KZC A;  3QK0 A;  1XCQ L;  2FCN A;  1OTR B;  3JVZ X;  2K25 A;  5G5H A;  5DPW A;  1QOA A;  2KAN A;  4RGM A;  2KVR A;  1U4A A;  3LJ3 A;  4NQL B;  3LDZ E;  4ICU A;  5IOI A;  4NAW A;  1HA5 A;  3V05 A;  2R61 A;  3P63 A;  2RPQ A;  3SFE B;  2Z0E B;  4US9 A;  4CO7 A;  1P98 A;  1BT0 A;  2MEK A;  4PS8 A;  2VZK B;  4EFO A;  3PLU A;  2ZEQ A;  1R4M I;  1FM0 D;  3ZNI D;  2K0P A;  3AEA B;  4IWQ A;  1I42 A;  2LGX A;  2LJI A;  3AE4 B;  1UGM A;  2O2V B;  4US8 A;  1WMH B;  4F8C B;  4XE0 A;  1IGC A;  3H1U A;  1XLN A;  1V2Y A;  3ONS A;  2PMV A;  2WDQ B;  3AM9 A;  2MJD A;  3RFZ B;  1FRR A;  2K22 A;  1SIF A;  4EE2 A;  4RGO S;  3Q6B A;  5AEK B;  4DHJ B;  1AWD A;  4MT5 A;  4HXD A;  2KWU B;  3APF A;  4MJS B;  3MJW A;  1T6B X;  2MP2 B;  3PT2 B;  1MI0 A;  2PTL A;  2IND C;  2A4Z A;  2JXT A;  4A3P A;  2IGD A;  2KTR A;  1L4Z B;  1MPE A;  5AZH A;  3IHP C;  4RGN A;  4WQM A;  3TJP A;  2BW2 A;  3VVW B;  1CJE A;  2AQ2 B;  1WZ3 A;  2C7H A;  1EU3 A;  1PFD A;  3Q8F A;  2MA9 B;  1YN4 A;  5FKA C;  1WE6 A;  5JXV A;  4BBN C;  2KFK B;  1WMH A;  3DBL I;  2VH2 A;  1KLU D;  1V9J A;  3A9J A;  3DVN V;  1JWU D;  5JZE B;  1E90 A;  4E3C A;  1RRB A;  4YSY B;  5C23 A;  1UEL A;  2H88 B;  4AJY B;  2D5G A;  1TS2 A;  3ZKJ C;  3HVZ A;  3QC8 B;  3Q3F A;  4MGI E;  2WDR B;  4RH6 A;  3QAQ A;  3MHS D;  5HI1 A;  2WX0 A;  3AE5 B;  3GP7 A;  1K50 A;  3RD2 A;  3T3N A;  1M4V A;  4XWW A;  1YQ3 B;  1WX7 A;  5IA7 A;  3AV8 A;  2NTS A;  2WYQ A;  3VH3 B;  5J2R A;  4EUT A;  1YX6 B;  4ZOH C;  1WXQ A;  4MSQ B;  2DZK A;  1TYG B;  4MH0 E;  3WAL A;  4FLH A;  2ZCB A;  4YTN B;  1XT9 B;  2CU1 A;  4A90 A;  1L7Y A;  4NAW B;  2JZP A;  1XEE A;  2JZ3 B;  1P7E A;  2V0G A;  2AYO B;  2B76 B;  2RMM A;  3VHT C;  1QT9 A;  1ZPS A;  1VDV A;  3NY5 A;  3K9O B;  4KZ0 A;  2KOX A;  3L16 A;  2LGY A;  2C7N B;  4LNO A;  2BGF A;  2D10 A;  3AE8 B;  1F2R C;  1XLO A;  2WXH A;  2NPT A;  3I3T B;  2KLC A;  3AED B;  4FHK A;  1I4P A;  2IO3 B;  3HHM A;  1E9M A;  1SSN A;  1FXT B;  3R3M A;  2PEA A;  3DOW A;  1UZX B;  3TEY A;  1NYQ A;  3N9Y C;  2QDF A;  2LHE A;  4K3B A;  3ZXV A;  3L54 A;  2JF5 A;  2GB1 A;  4LNK A;  5G2N A;  4IKG A;  3EEC A;  3DBR B;  3BK1 A;  2LXC A;  2GMI C;  3DWM A;  4KSL C;  4MEL A;  4IG7 B;  1AYF A;  1SE3 A;  2W3R A;  4BKS D;  2BS2 B;  3V60 A;  3TBL D;  5J18 A;  4RF0 A;  3BZD B;  5D7G A;  4ZRQ A;  3W1Y A;  2Z8L A;  4AWJ A;  2PVO D;  1I4R A;  3HM6 X;  1JRO A;  3QX1 A;  1JRU A;  5TR5 A;  3B2F A;  1LFD A;  1F9J A;  1FXA A;  4WJN A;  3NG0 A;  2LJ5 A;  3Q2A C;  3ZLZ A;  2SEB D;  2K1F A;  3DCG A;  1SJH D;  2BQQ A;  1AW7 A;  1R4N B;  3DBH I;  2LUM A;  3DVG X;  3PV1 A;  1TY2 A;  2RGF A;  4J3O D;  1L2N A;  3ZJV A;  3WAM A;  1V5O A;  1N60 A;  1F0Z A;  2OED A;  4OZB A;  1RFK A;  1N6Z A;  3E56 A;  3B1L X;  4AP4 C;  5J17 A;  3W2D A;  1HZ5 A;  1ZKH A;  3NS1 A;  1ZP0 B;  3NZS A;  1VRA B;  3BII D;  3H7S A;  2J52 A;  2NVU I;  5AUK A;  2WHI A;  3RYT A;  2D2Q A;  4FA6 A;  1GAQ B;  4DQO C;  1FO4 A;  4W9G A;  4G50 A;  4ARC A;  1FEH A;  3ZNZ B;  2MX2 A;  4P7I A;  1ZXH A;  2BYV E;  4WWP A;  4NAM A;  1D5Z C;  4WWO A;  3AXC A;  3ZNG C;  1SEB D;  4ANX A;  2WXK A;  2IO0 B;  2JU6 X;  1NI2 A;  2LVO A;  4HEA 1;  4GDK A;  1GC6 A;  1P1A A;  1F1H A;  2WNM A;  4C56 C;  1NBF C;  1KF6 B;  1XLQ A;  2NTT A;  3EA6 A;  4YTM B;  5CHF A;  5L83 A;  2DX5 B;  4B0M A;  4B0E A;  4JPS A;  3BK2 A;  3I57 A;  3VR9 B;  3NUH B;  4LNI A;  2ONQ A;  3P4Q B;  4YL8 A;  5LNK 1;  2RD0 A;  1WWT A;  4EKU A;  1LQB A;  3E9S A;  3TMP B;  4WQO B;  2JX5 A;  3L17 A;  2RDB C;  5D6J B;  3TEZ A;  3WIM A;  3QQ8 B;  1KOT A;  4E74 A;  2INP E;  2KXJ A;  3MC8 A;  3J9C A;  2IO2 B;  2KN4 A;  1WH3 A;  1YQB A;  3URY A;  3U7D A;  4P16 A;  1B1Z A;  1QQR A;  3M63 B;  3Q3M C;  3GB1 A;  2AL3 A;  3DPD A;  2JY6 A;  2NCN A;  1GNU A;  1P7F A;  1D3Z A;  5HG2 A;  2FCQ A;  1FCL A;  3Q14 C;  2GI9 A;  3DVN U;  2DAF A;  4C4V A;  4LCD E;  2MWS B;  4IC7 B;  4B6W A;  3GE3 C;  5HKH A;  2KHW B;  4PYU A;  1WGG A;  3WA0 A;  3N30 A;  4OVZ A;  5KHO A;  4M02 A;  4ZRI A;  5EDS A;  2DNF A;  4ACF A;  2UWQ A;  1EUV B;  4RFB A;  3AEG B;  4FJY A;  3RNF C;  3SDL C;  1IBX B;  2L52 A;  3A1Q B;  2XK5 B;  5JHB A;  4W9I A;  1IBX A;  5GMV A;  4KIK B;  4KVG B;  2ZVN A;  1D5M C;  4LNF A;  2QIL A;  2WDV B;  1KJT A;  3N1Z C;  1WXA A;  2LUE A;  1EWC A;  1NYR A;  1SBB B;  4I6N B;  3M95 A;  1V1P A;  5C2T B;  2AWT A;  2D07 B;  4II3 B;  2CJN A;  3QA8 A;  1JRP A;  1Q1O A;  3JYU A;  3PHW B;  3ZJT A;  4G11 A;  3AEC B;  2Z59 B;  1E8X A;  4RMA A;  1L6V A;  1BXT A;  4H2A A;  1YIW A;  4JL9 A;  4JGH B;  2WXQ A;  1GB4 A;  1VR9 A;  4EEW A;  1CZP A;  2PLP A;  5D3D A;  3U30 A;  3DHH C;  4LNN A;  4KX6 B;  2KD0 A;  2BB6 A;  4FXC A;  2Y5C A;  2BYF A;  3H7P A;  5HHD G;  4OZA A;  1UGJ A;  3KLS X;  5I4D A;  4XYC A;  2O6V D;  2FCS A;  2MBE A;  1J19 A;  1E0Z A;  2LAS A;  4FBJ B;  1TY0 A;  1V86 A;  4OW0 A;  1TS5 A;  3ZXR A;  1T0S C;  1Q10 A;  2GOW A;  2NMQ A;  1TKY A;  5DPT A;  1VJK A;  1WGH A;  3B08 A;  3VTV A;  3IBE A;  2D3B A;  3OWE B;  4WH4 A;  1MG4 A;  2WXI A;  4PYZ A;  1UBI A;  3ZRF A;  1VD2 A;  4RF1 A;  1ENF A;  1G6J A;  2G4D B;  1GC7 A;  4C7Z A;  1FIQ A;  2CS4 A;  4XDC A;  2WXO A;  1WGK A;  1A5R A;  1QZE A;  1C4C A;  2HE7 A;  3QWZ B;  4A6Q A;  1PGB A;  2KJ6 A;  4W9K A;  4EZJ A;  4HCN B;  3T8M A;  1XLP A;  4L2Y A;  2CR5 A;  4II2 B;  4N58 A;  1KRH A;  3KVF B;  5E6N A;  1Y8R C;  1E8W A;  2UYZ B;  2MP2 A;  5H92 C;  4MDK E;  1D4B A;  2L3Z A;  1I4Q A;  4BOS C;  3U8Z A;  2W82 A;  1WSP A;  3ML9 A;  1R4M B;  4XC2 A;  1V6E A;  2CHW A;  2K39 A;  3VTU A;  1YJJ A;  3W1S C;  2N0S B;  3X0W A;  2DBY A;  4JX1 C;  2FAZ A;  3HM3 A;  5CX3 A;  2WU5 B;  2Q5W D;  3AEE B;  3IXS A;  1E6E B;  4CQN A;  3WAN A;  2I2Y A;  4E71 A;  4O1N A;  3KUD B;  3WAO A;  1ZOY B;  3H7P B;  4A55 A;  3RZF A;  2BT6 A;  2KNB A;  1C77 A;  4LJP B;  2FUG 1;  3V3X A;  1UNS A;  5BMI A;  3DDC B;  4WJP A;  4DDG D;  1YJI A;  1IGD A;  2A5U A;  3RNA C;  3N1X C;  3RN9 C;  4NJC A;  3AE6 B;  1OQY A;  4TQ1 A;  1ROE A;  2IPK D;  2ZPN A;  1XQQ A;  4XZ4 A;  4MGZ E;  2GBK A;  2KAC A;  2RDG A;  2MBQ A;  3TCA A;  4CHK A;  1J0G A;  4IOI E;  2I1K A;  4JE3 B;  2R2O A;  4AOF A;  3C0R B;  1T5X D;  3ZJU A;  4EOY A;  3B9J A;  2INN E;  2GBN A;  2KFK A;  2AQ1 B;  2N9K A;  3AU4 A;  4FUL A;  4M0W A;  1DOX A;  2WP9 B;  4PK1 A;  1I4X A;  1FNW A;  4W9C A;  3WCQ A;  1QOF A;  3RZW C;  3PTF C;  2BF8 B;  2JXX A;  3IT4 B;  2L8J A;  1HEZ E;  1I7H A;  1K51 A;  3SR6 A;  1WFY A;  4LTU A;  3Q8B A;  2CHX A;  2LVQ A;  3UGB B;  4G0N B;  5IKC M;  4DHJ D;  1MFW A;  1HXY D;  2M1M A;  4JLC A;  4P1B C;  3FC4 A;  1WGD A;  4K81 A;  3Q8A A;  3ZVV A;  3BWU D;  2AEH A;  4DK5 A;  4GSW A;  3PHX B;  4AQ7 A;  2M8S A;  5D94 A;  2SAK A;  4L23 A;  2WX1 A;  5BMH A;  2G4S A;  3AE9 B;  2CJO A;  2IO1 B;  1R7S A;  4P1C C;  1EM7 A;  4REZ A;  4GB9 A;  3KYD D;  3MHZ A;  1NI3 A;  3DQV A;  4KGS A;  2WXP A;  4HRS A;  4IDI A;  3BYY B;  3BVZ A;  3T9L A;  4ZDV A;  4MAC A;  3VXW A;  4DXA B;  2LHD A;  2JPH A;  1H8C A;  2LGS A;  3DHG C;  3O13 A;  1FD6 A;  5JH5 C;  3BVM A;  2ZJD A;  2L7R A;  2RR9 A;  3BIN A;  2MBB B;  2J42 A;  4JIO U;  1WM2 A;  5L95 C;  3A4R A;  1J7A A;  4GDL A;  3PZ7 A;  2PJH A;  5GXG B;  4S17 A;  1FRD A;  4KIK A;  3NVW A;  2RPV A;  5EE0 A;  4GDL B;  5BYQ A;  3EHV A;  4GIV A;  2KWD A;  1H4R A;  1YN3 A;  4B95 A;  2E6X A;  2K8C A;  4FJZ A;  3R8B A;  2CU3 A;  1E5W A;  2AL6 A;  2KDE B;  1MHH E;  4ANW A;  2Y5P A;  1E7U A;  4ZYS A;  1YJ1 A;  2ZPY A;  2YVC A;  3V61 A;  3R2T A;  2BS3 B;  3GZN I;  4EZL A;  3I9V 1;  2O6V A;  1DGJ A;  3NHE B;  2Y3A A;  4MM3 A;  1TGZ B;  4D2K A;  1SJE D;  3T3O A;  4I6P A;  3B0A A;  5H8Y E;  2M17 A;  2GBJ A;  1KLG D;  2XEW A;  2PKO A;  2JYT A;  4YWG G;  2KQS A;  1J7B A;  3VDZ A;  3JW0 X;  3DBR I;  3KUC B;  1T0Q C;  1K53 A;  5DCN A;  5CHW A;  3NVY A;  4DDI D;  2ZZP B;  5E6P A;  1BUI C;  2IGG A;  1ISN A;  4HPL B;  1YX5 B;  3UIO B;  3NJT A; 
#chains in the Genus database with same CATH homology
 2DAF A;  1C1Y B;  2IY1 B;  2DZM A;  4LCD E;  4BBN F;  3PRP B;  4BOZ B;  3VUY A;  2MWS B;  3JSV B;  3BY4 B;  3ZW3 A;  1I35 A;  4IC7 B;  4B6W A;  3EFU A;  4DWF A;  1WR6 E;  3TIX A;  5HKH A;  2KHW B;  4HPM B;  1RFA A;  2K6D B;  4PYU A;  3H9D A;  1WGG A;  3WA0 A;  2OJR A;  3KYC D;  3N30 A;  5KHO A;  2DHZ A;  3VTW A;  3PS6 A;  2ZVO A;  3H6N A;  4ZRI A;  5EDS A;  3APD A;  3M3J A;  2UWQ A;  1EUV B;  4MJS A;  4WAA A;  2O6V B;  1WM3 A;  3UIP B;  4A3O A;  4FJY A;  2L0F A;  3SDL C;  2C9W B;  4FJV B;  2I1J A;  1V81 A;  3L0W B;  4X57 B;  4XX5 A;  3A1Q B;  1WJ4 A;  1IPG A;  2XK5 B;  2D11 A;  2FIF A;  2V1Y A;  4ICV A;  4KDI C;  5E6O A;  3VUX A;  5JHB A;  4KZC A;  4W9I A;  2KTR B;  5GMV A;  4KIK B;  4IWO A;  4KVG B;  2ZVN A;  3QK0 A;  3V6C B;  3ZTD A;  2FCN A;  2KMC A;  1OTR B;  1GJZ A;  1KJT A;  3JVZ X;  2K25 A;  5DPW A;  1E7V A;  3PVL A;  2KAN A;  2XBB C;  2JRI B;  1WXA A;  4HLE A;  1X1M A;  3PRM B;  2KVR A;  1U4A A;  3LJ3 A;  1WJU A;  4NQL B;  4TUU A;  2LUE A;  4GDK B;  1WY8 A;  4KV2 A;  3LDZ E;  2L05 A;  4I6N B;  3M95 A;  4ICU A;  3TL5 A;  2MLB A;  3OAW A;  4NAW A;  2AWT A;  4HWI B;  2D07 B;  4II3 B;  4FAD A;  2KTF A;  3QA8 A;  2RPQ A;  4GN1 A;  3R7Q A;  1Q1O A;  3JYU A;  3PHW B;  4OVU A;  5FR6 A;  4DHZ B;  2G3Q B;  3OJ4 B;  4G11 A;  2Z0E B;  3L10 B;  2Z59 B;  1E8X A;  4RMA A;  1VCB A;  2D3G A;  2DAJ A;  4CO7 A;  1P98 A;  4TKN A;  1BT0 A;  4TV3 A;  1YIW A;  2BYE A;  4LDT B;  4EFO A;  4PS8 A;  3V62 A;  2XK5 A;  4JL9 A;  3PLU A;  2GBM A;  4JGH B;  1YD8 U;  2ZEQ A;  4A20 A;  1WYW B;  5LXI B;  4BVU C;  1R4M I;  4EEW A;  3QHT A;  2BPS A;  2PE9 A;  5BO4 B;  2KWC A;  3ZNI D;  4IWQ A;  1I42 A;  3PLV A;  2DYM A;  3A1Q A;  5IAA C;  3U30 A;  2G45 B;  2LGX A;  1WF9 A;  2KD0 A;  1UGM A;  1R4N I;  2HD5 B;  2O2V B;  3SHQ A;  1WMH B;  4F8C B;  4GOC A;  2BYF A;  1SE9 A;  3H7P A;  3HIZ A;  3H1U A;  2ASQ A;  2K8B A;  2KWV B;  1P3Q U;  1V2Y A;  3ONS A;  2LZ6 A;  4W9E A;  2O6V D;  2FCS A;  2MBE A;  3ENE A;  1ZW7 A;  1J19 A;  2GBR A;  2N9P C;  2LAS A;  3Q3J A;  4IUM B;  4ANV A;  1SIF A;  4FBJ B;  5AEK B;  1LXD A;  4J6I A;  4DHJ B;  3CMM B;  1V86 A;  4EZK A;  3VUW A;  2KX3 A;  4AJW A;  4HXD A;  4HCP B;  2BKR B;  3AUL A;  2KWU B;  3PGE A;  4KDL B;  2EKE C;  3APF A;  4MJS B;  3MJW A;  4OVV A;  4K7U A;  1P0R A;  2GOW A;  5KHQ A;  2MP2 B;  3EC8 A;  3PT2 B;  5DPT A;  2QHO A;  1WGH A;  3B08 A;  3VTV A;  2A4Z A;  1WRD B;  1WIA A;  2C7M B;  2KJH B;  3IBE A;  3VAW A;  3A33 B;  2LXA A;  2J0K A;  4A3P A;  4BKG A;  2KTR A;  3CSF A;  2KX0 A;  4PYZ A;  1UBI A;  2Z0D B;  5AZH A;  4RM8 A;  4TQ0 A;  1AAR A;  3IHP C;  3ZRF A;  2V3S A;  1VD2 A;  3ALB A;  3M62 B;  3A4S C;  1G6J A;  4WJQ A;  2G4D B;  4B9K A;  1GC7 A;  3TJP A;  3VVW B;  2CS4 A;  2M0X A;  2DEN B;  2C7H A;  1WZ3 A;  3NS8 A;  2MBH A;  2IZV B;  3AU5 A;  2MA9 B;  4WJO A;  5LLI A;  4ANU A;  1A5R A;  1QZE A;  2J0J A;  2JZZ A;  3A9J B;  1WE6 A;  4BBN C;  2HE7 A;  4WWN A;  3QWZ B;  4GMV A;  4BKT A;  3CST A;  1S1Q B;  2KFK B;  1WXM A;  1WMH A;  3DBL I;  1V9J A;  3A9J A;  2KJ6 A;  3DVN V;  4PS3 A;  3N3K B;  4HCN B;  4W9K A;  3T8M A;  4EZJ A;  2MQJ A;  5DPS A;  5JZE B;  2CR5 A;  5CTR C;  1E90 A;  4ZYN A;  1GG3 A;  3ZO5 B;  4E3C A;  1RRB A;  2L76 A;  5C23 A;  4II2 B;  1EF1 A;  2ZNV C;  1UEL A;  4AJY B;  3KVF B;  3ZKJ C;  5E6N A;  1Y8R C;  3QC8 B;  1E8W A;  3Q3F A;  4MGI E;  3ZTC A;  2UYZ B;  4GGQ A;  2FNJ B;  3QAQ A;  2MP2 A;  2KDB A;  3KH0 A;  3MHS D;  4MDK E;  2WX0 A;  1WX9 A;  2L3Z A;  2Y5B B;  2MRP A;  4BOS C;  3U8Z A;  3RD2 A;  4ZRJ A;  1WJ6 A;  1TBE A;  3ML9 A;  4FN2 A;  3RCZ A;  4W9D A;  4XC2 A;  1V6E A;  2CHW A;  2K39 A;  3VQI A;  3VTU A;  1M94 A;  3W1S C;  1WX7 A;  5IA7 A;  1S3S G;  2N9E B;  4DHZ E;  3PRZ A;  3X0W A;  2KC1 A;  2WYQ A;  3SD5 A;  3VH3 B;  5J2R A;  2FAZ A;  3HM3 A;  2O2V A;  4W9H A;  5CX3 A;  2IY0 B;  3R7R A;  1IYF A;  1UBQ A;  1C3T A;  1Q5W B;  4EUT A;  1YX6 B;  4HK2 A;  3WAN A;  2KDI A;  4MSQ B;  4E71 A;  1UD7 A;  4NNJ B;  1RAX A;  1WX8 A;  2DZK A;  2N1V A;  4K7S A;  4MH0 E;  3KUD B;  4FLH A;  3WAL A;  2ZCB A;  2CKH B;  1XT9 B;  2CU1 A;  3WAO A;  4BKS A;  2JT4 B;  3RUL A;  1L7Y A;  4NAW B;  3DBS A;  2OOB B;  3W1S A;  4M8N A;  1KLV A;  3H7P B;  3D32 A;  4IW0 A;  2JZ3 B;  3HK0 A;  2AYO B;  3RZF A;  3ZDT A;  3O65 B;  3VHT C;  2BWE S;  2CHZ A;  3NOB A;  3ZDM C;  2DYB A;  2KNB A;  4LDT D;  3NY5 A;  3K9O B;  4KZ0 A;  2KOX A;  4LJP B;  5AZG A;  3L16 A;  2LGY A;  1KM7 A;  1TZ1 A;  2C7N B;  3DDC B;  4WJP A;  1WGY A;  4DDG D;  2BGF A;  2D10 A;  2N7E A;  1V80 A;  2NPT A;  2A5U A;  3I3T B;  2KLC A;  2KC2 A;  1PQS A;  5CHV C;  3ZUN A;  3QAR A;  2PE6 B;  4FHK A;  1OQY A;  2IO3 B;  3HHM A;  3PPA A;  3PRE A;  4TQ1 A;  1E8Y A;  2ZPN A;  1XQQ A;  3WAP A;  1FXT B;  2IYD B;  3R3M A;  4XZ4 A;  4MGZ E;  1RLF A;  2GBK A;  3PSE B;  5C1Z A;  4IM2 A;  2PEA A;  2C60 A;  2MBQ A;  3DOW A;  3TCA A;  3OJ3 A;  4CHK A;  4JQW C;  1UZX B;  4W9F A;  3OLM D;  1J0G A;  2I1K A;  2R2O A;  3L54 A;  1WGR A;  2JF5 A;  4NJ7 A;  2N7D A;  3N32 A;  3L08 A;  4K1R B;  3C0R B;  4AOF A;  1IP9 A;  2RSU A;  3L13 A;  2LGD A;  2REX A;  4EOY A;  1WZ0 A;  4I6L B;  4HDQ A;  2GBN A;  2KFK A;  2KKC A;  5G2N A;  2KJR A;  3AU4 A;  2N9X A;  3EEC A;  4FUL A;  1V5T A;  3UQA A;  2KDF B;  4LJO B;  3IFW B;  2NS5 A;  1GUA B;  2LXC A;  4HDO A;  4KSK C;  4CYE A;  5JHA A;  4PS7 A;  2GMI C;  3KW5 B;  4KSL C;  4HJK A;  4W9C A;  4MEL A;  4IG7 B;  3RZW C;  3VH4 B;  1OEY J;  3PTF C;  2BF8 B;  2JXX A;  4BKS D;  1XD3 B;  2L8J A;  4RM9 A;  3SU8 X;  3TBL D;  3V60 A;  5J18 A;  1WFY A;  2DZI A;  4NY0 A;  2CHX A;  2LVQ A;  2LRW A;  5D7G A;  2FCM A;  3UGB B;  3W1Y A;  4G0N B;  2JUO A;  4AWJ A;  4NJ6 A;  3HM6 X;  4DHJ D;  1E8Z A;  1JRU A;  2EMS A;  2M1M A;  3QX1 A;  2ZNV B;  4JLC A;  2JVC A;  5TR5 A;  1LFD A;  1F9J A;  4URK A;  1WGD A;  4WJN A;  4K81 A;  3ZVV A;  2LJ5 A;  3ZLZ A;  1SGH A;  2AEH A;  4DK5 A;  2K1F A;  1EO6 A;  3PHX B;  2W9N A;  4GSW A;  2NR2 A;  3DCG A;  3QJZ A;  2HTH A;  2M8S A;  3RT3 B;  5D94 A;  3DBH I;  2NBW B;  2WX1 A;  2KZR A;  2G4S A;  1J8C A;  3V6E B;  2IO1 B;  3DVG X;  3PV1 A;  2RGF A;  2M4N A;  3NZU A;  1L2N A;  2KMA A;  1V5O A;  3WAM A;  1WI0 A;  4BFR A;  3VFK A;  1UH6 A;  4M8M A;  3B1L X;  4AP4 C;  5J17 A;  4GB9 A;  2N1W A;  3KYD D;  4IM0 A;  5AZF A;  3DQV A;  2J7Q B;  1ZKH A;  3KUZ A;  5D2M B;  2DYO A;  1Z2M A;  1MG8 A;  3QCA A;  4F7Z A;  2VRR B;  3NZS A;  3MTN B;  3H7S A;  3T9L A;  1EF5 A;  4ZDV A;  1HE8 A;  2NVU I;  2K6Q A;  3VXW A;  2KO3 A;  4DXA B;  3RYT A;  2D2Q A;  2IBI B;  4FA6 A;  4GU2 A;  2L00 B;  2JPH A;  1ZGU B;  2FID A;  4W9G A;  4G50 A;  1H8C A;  3ZNZ B;  4DBG A;  2DZJ A;  2MSE D;  2MX2 A;  4P7I A;  3S2A A;  2LRU A;  2LI5 A;  2BYV E;  4MSM B;  5JH5 C;  4W9J A;  4G3X B;  2ZJD A;  3APC A;  1TTN A;  2L7R A;  3DVG Y;  4WWP A;  2V4L A;  1Q0W B;  2JWZ A;  1WXV A;  2RR9 A;  3AXC A;  3BIN A;  4WWO A;  4NPN A;  2MBB B;  3ZIM A;  2C5L C;  3ZNG C;  1K8R B;  4JIO U;  1WM2 A;  4ANX A;  5L95 C;  1WE7 A;  4W9L A;  2IO0 B;  3A4R A;  2WWZ A;  1NI2 A;  4GDL A;  5LXH A;  2LVO A;  1NDD A;  2PJH A;  2YLM A;  2MBO A;  2N4F A;  4KIK A;  2NBU A;  3ZNH B;  4GDL B;  1CMX B;  2J0M A;  4N9F 4;  4AUQ C;  3EHV A;  4GDK A;  4GIV A;  4IM3 A;  1GC6 A;  1V49 A;  1WXS A;  1H4R A;  1P1A A;  4B95 A;  4M0W B;  1NBF C;  1Z5S B;  2KN5 A;  2FUH B;  3K9P B;  2K8C A;  3JSV A;  3QIJ A;  4FJZ A;  2ZCC A;  4FHJ A;  3UQB A;  2KFJ A;  1E5W A;  1WR1 A;  2AL6 A;  2JRH A;  5CHF A;  5L83 A;  2DX5 B;  2KDE B;  2LWP A;  4ANW A;  1E7U A;  1YJ1 A;  5G55 A;  2L0T A;  2ZPY A;  1LM8 B;  2YVC A;  2NBV B;  2LVP A;  2HJ8 A;  2BWF A;  2KK8 A;  2KQ7 A;  4YL8 A;  1OGW A;  3V61 A;  2RD0 A;  3CF6 E;  3GZN I;  4EKU A;  1LQB A;  2K8H A;  3TMP B;  2O6V A;  4EZL A;  4WQO B;  2MCN B;  3RUI B;  3X23 A;  2NPT B;  3L17 A;  3NHE B;  5D6J B;  3ZRC A;  3WIM A;  4MM3 A;  3QQ8 B;  2BKF A;  4HVB A;  4MGK E;  1KOT A;  4E74 A;  1TGZ B;  2KXJ A;  1OEY A;  3IVF A;  2KLG A;  3ML8 A;  2WDT B;  4I6P A;  3B0A A;  2IO2 B;  2M17 A;  1WH3 A;  2GBJ A;  4ASW C;  3A9K B;  1YQB A;  3IG3 A;  3U7D A;  2MW5 A;  2XEW A;  5DPR A;  3R66 C;  3A9K A;  3P2B A;  3ECI A;  2KQS A;  3VDZ A;  3GOE A;  3DBR I;  3JW0 X;  3KUC B;  4IWP A;  4NQK E;  1WJN A;  3M63 B;  2B3A A;  5DCN A;  2AL3 A;  1T0Y A;  3DPD A;  5CHW A;  2JY6 A;  4DDI D;  2R2Q A;  2ZZP B;  2NCN A;  1GNU A;  2EMT A;  4K7W A;  1P9D U;  4GXB A;  4ZRK A;  2LD9 A;  5E6P A;  4F1S A;  1D3Z A;  3AI5 A;  4MEM A;  2PPH A;  1ISN A;  2FCQ A;  4HPL B;  3UF8 A;  1YX5 B;  3UIO B;  3UIN B;  4MGY E;  3PZD A;  3DVN U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...