3DQVA

Structural insights into nedd8 activation of cullin-ring ligases: conformational control of conjugation
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
GSMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKIMGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords NEDD8
total genus 19
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dqvA00
2LVOA 2NPTB 4K81A 4MGYE 2KN5A 2W9NA 1V86A 1Z2MA 5FR6A 3QX1A 5D7GA 1IYFA 3U7DA 3N32A 1E8WA 3RT3B 3UIOB 4M0WB 1WYWB 2N7DA 1E8ZA 4DHZE 2Z0EB 1OQYA 4E71A 1WXSA 2FIDA 2K1FA 4FULA 4HVBA 5E6OA 1YX6B 3SHQA 2JUOA 2LWPA 1WMHB 4BOZB 3M95A 3VUYA 1E7UA 3M62B 4RM8A 1WX8A 4MSMB 1RRBA 4DWFA 3VUWA 1WIAA 4EUTA 3A9KA 5DPTA 3NOBA 4FJVB 3VVWB 1L2NA 2KMAA 3ZRCA 2LRWA 4TKNA 1A5RA 3H7PB 2KFKA 2BF8B 1WR1A 3TBLD 1SGHA 4NAWA 4GXBA 2FCSA 4LCDE 2J0MA 2XBBC 4MM3A 1FXTB 4JIOU 3VAWA 1J0GA 3W1SA 2MW5A 3DCGA 3DDCB 4GGQA 4BOSC 2O2VA 2XK5A 3B08A 1S3SG 3VTWA 5LXHA 3APDA 3NZSA 1I42A 4K7SA 1NI2A 2MBQA 2KVRA 3A4RA 3PVLA 2BYVE 5AZGA 3DVNV 2BKRB 2MLBA 2D07B 2FIFA 4NQLB 2DAJA 2GBMA 2KDIA 1OEYJ 2NCNA 4NJ6A 2KK8A 4WJNA 4HCPB 3HK0A 5G55A 3KUZA 4BFRA 3VQIA 2DYOA 3MHSD 1WJ6A 4MGIE 1WZ3A 3M63B 4GN1A 4GMVA 2NPTA 4WJQA 1WM3A 1H8CA 2FNJB 3KYDD 3D32A 4MH0E 4IC7B 2M8SA 1E7VA 1LFDA 2JPHA 1ZKHA 3ZNZB 1LM8B 2CKHB 1D3ZA 1G6JA 2KHWB 4JGHB 4KIKA 4LDTB 1YIWA 2Z0DB 4JLCA 2C7HA 3ZDTA 3PS6A 4TUUA 2OJRA 2M4NA 3H7SA 1P3QU 1MG8A 4X57B 3VH3B 4A3OA 2NR2A 2UWQA 3PLVA 4GIVA 4HXDA 5KHOA 3SU8X 2V1YA 5JZEB 4EFOA 3ML8A 4E3CA 1P1AA 3QQ8B 5CHWA 2LXAA 5G2NA 4G0NB 4W9LA 2FCNA 3UQAA 3A4SC 3PT2B 3DBHI 4GDKB 2D11A 2O6VB 3ZNID 1WE6A 4ICVA 1S1QB 4G50A 2MBHA 4WQOB 4KV2A 4ANXA 3JYUA 3OJ4B 4HPMB 3VTUA 4MGKE 2FCMA 4K7WA 3C0RB 1YD8U 2D10A 4K1RB 2K25A 3I3TB 3R7RA 3A1QA 2FAZA 2ZNVB 3UIPB 1AARA 4TQ0A 2PE9A 3PGEA 2IY1B 2V3SA 2KDFB 4NJ7A 2G4DB 3ZTDA 1TZ1A 4MDKE 1ISNA 1UBIA 1V80A 3DVGY 2I1KA 2KJRA 2R2OA 2VRRB 3R3MA 5AZFA 4BBNF 4NQKE 2PJHA 3N3KB 3R66C 3X23A 2LUEA 2ZPNA 4HCNB 1E8XA 2N9EB 4ZRIA 2AWTA 3APCA 4NPNA 3NZUA 3JW0X 3L17A 1R4MI 2NBWB 5GMVA 3MJWA 2KJ6A 4G11A 2LD9A 2N1WA 2CR5A 2O6VA 2LXCA 4CYEA 4EZJA 1WX7A 1WX9A 3ZKJC 3UF8A 3ZW3A 4FA6A 3QC8B 4DHZB 2BKFA 2AL3A 2WX0A 2KWCA 1HE8A 5CX3A 3V62A 1WXVA 2J7QB 2PE6B 5D6JB 1E90A 2DENB 1KM7A 1WE7A 2KWUB 4FHJA 5KHQA 1C1YB 2L8JA 3KUDB 2MP2A 1EF1A 3A33B 3ZUNA 1T0YA 3W1YA 2MCNB 2G3QB 3R7QA 1GNUA 3NHEB 3RZFA 3GOEA 1EO6A 3DOWA 2ZZPB 3QA8A 2JVCA 1WF9A 2KFJA 1XT9B 2IZVB 3IBEA 4GDLA 2DYBA 3UGBB 5AEKB 1YJ1A 2AL6A 2ASQA 3PRZA 4DHJB 2JZZA 3QARA 5IA7A 2XK5B 2DYMA 2J0KA 5L95C 4CO7A 3KVFB 2HD5B 3U30A 1V5TA 4PS3A 4ZRKA 4W9HA 2KO3A 4OVUA 3DBLI 3ZIMA 2C9WB 2KWVB 2IO2B 3VTVA 2DHZA 2MX2A 2O6VD 3A1QB 5JH5C 4FLHA 3PSEB 3KH0A 2CHXA 4WWPA 3ZRFA 2KTFA 2ZEQA 1C3TA 1OTRB 3HIZA 1PQSA 3TJPA 4HWIB 4LJPB 1UD7A 4GOCA 3BINA 2IYDB 3L10B 1RLFA 4IWPA 5HKHA 2D3GA 3GZNI 3NS8A 2V4LA 3PHXB 4W9GA 5DPSA 1SE9A 1J19A 2LJ5A 3B1LX 5CTRC 4A20A 4M8NA 2FCQA 2KJHB 4P7IA 4ICUA 1EF5A 3K9PB 4J6IA 4A3PA 4GDLB 4FADA 2QHOA 2KZRA 2RSUA 3MTNB 1UBQA 2L0FA 3AULA 3OLMD 3Q3JA 2LZ6A 2DZMA 3DVNU 1LXDA 4KSKC 4ANVA 1LQBA 2KNBA 1WMHA 3ZNHB 1TBEA 3M3JA 2IY0B 3DVGX 1WGDA 3A9JA 3ZNGC 4GDKA 4M8MA 4W9EA 4W9JA 3A9KB 3QK0A 1WR6E 3UQBA 3Q3FA 5J18A 2M1MA 3ZVVA 4W9DA 1GC7A 3CSFA 1WJ4A 2EKEC 2OOBB 2RPQA 1WGYA 3H7PA 2G4SA 1H4RA 2KX3A 4EZKA 3PPAA 5J17A 2ZCCA 3JVZX 4LDTD 4KZ0A 2G45B 4EOYA 4ANWA 1M94A 2LGYA 3RULA 2CHZA 4GSWA 3DBRI 3WANA 1UGMA 2RGFA 3AU5A 3L16A 4BKTA 3U8ZA 3V6EB 4DDGD 1GG3A 1NDDA 2PEAA 3DQVA 2GBRA 1JRUA 4HDQA 3W1SC 1P98A 1UZXB 4IM3A 4F7ZA 3HHMA 5LXIB 1TGZB 3DPDA 3PZDA 4ZDVA 4W9FA 5JHAA 4FN2A 2BPSA 3EC8A 2MQJA 4IG7B 2NVUI 3ECIA 2K8HA 2N4FA 2FUHB 3HM6X 3KW5B 5D2MB 5JHBA 1GJZA 3ML9A 1WH3A 2WYQA 1ZW7A 4RM9A 3APFA 2MRPA 4TQ1A 1GUAB 5BO4B 2A4ZA 4IW0A 2JRHA 1P0RA 4LJOB 4HJKA 4W9CA 4DBGA 1WM2A 3LJ3A 1WGGA 3RUIB 1Q1OA 3T8MA 5E6PA 2I1JA 4AJYB 1UELA 2IO3B 2C7NB 3H1UA 4AJWA 4MELA 3RZWC 2KC1A 2JXXA 2N1VA 1WGRA 4KZCA 4AWJA 2CU1A 1KLVA 4II3B 1ZGUB 2CS4A 2MBOA 2KD0A 4W9KA 2LRUA 1UH6A 4BKSD 4KDIC 1Y8RC 4DHJD 2BGFA 2XEWA 2O2VB 3WAMA 2KLCA 4KIKB 1WZ0A 1L7YA 3WAOA 4IWQA 2Z59B 2MSED 3IFWB 2RR9A 5IAAC 4W9IA 4MSQB 4MGZE 4WJOA 3KYCD 1F9JA 2KDEB 1EUVB 3A9JB 1WXAA 2N7EA 2L76A 2LGDA 4WWNA 3ZTCA 5DPRA 1NBFC 3N30A 4WAAA 3RYTA 4AUQC 2N9PC 2IO0B 2LVQA 4IUMB 2KKCA 2LVPA 5J2RA 1E5WA 3CF6E 4KVGB 4ZYNA 3T9LA 5EDSA 1KOTA 4XC2A 4NNJB 2KTRA 4XZ4A 4FBJB 1IPGA 1WJNA 2Y5BB 2GBNA 3QHTA 4HDOA 4I6LB 3WIMA 4BBNC 1WJUA 4JQWC 4I6PA 1VCBA 4YL8A 5DCNA 4BVUC 2LI5A 3HM3A 1WRDB 3BY4B 1Z5SB 3L13A 3VHTC 1WY8A 1V6EA 2GMIC 3EECA 4AP4C 2KLGA 3VUXA 2WWZA 2MWSB 3PTFC 3PREA 1WXMA 3RD2A 4XX5A 2C5LC 2EMTA 2JF5A 4E74A 4I6NB 2M17A 2KX0A 2PPHA 2J0JA 4II2B 1V5OA 2ZJDA 2ZPYA 3X0WA 4B6WA 4MJSB 2JZ3B 3TCAA 1XD3B 2JWZA 2KQ7A 1Q0WB 3AXCA 2L3ZA 5CHVC 4ZRJA 1V2YA 3QCAA 2WX1A 3UINB 2WDTB 1V9JA 3H6NA 2YVCA 5L83A 4RMAA 2BYFA 2KDBA 4DXAB 3JSVA 3VH4B 2REXA 1I35A 2K6QA 2KFKB 2YLMA 2HTHA 3EHVA 2GBJA 4CHKA 4NAWB 1U4AA 2L0TA 5LLIA 2GOWA 4TV3A 2ZVOA 1WI0A 1IP9A 4AOFA 3WAPA 2BWES 4PYUA 2LGXA 3OAWA 2MBEA 3IHPC 4HK2A 3VFKA 2UYZB 2HJ8A 3NY5A 4KDLB 2K6DB 3PRMB 1K8RB 2CHWA 2MBBB 2N9XA 3EFUA 4EEWA 1WGHA 2K8BA 2ZNVC 3CSTA 4N9F4 4ASWC 1X1MA 2M0XA 2LASA 2R2QA 1P9DU 3VDZA 4IM2A 4FJZA 1TTNA 4MJSA 2HE7A 3PLUA 1YX5B 3IVFA 4G3XB 2JT4B 3WALA 3B0AA 3AI5A 3PRPB 4IM0A 1E8YA 2DX5B 2IBIB 2MA9B 4WJPA 3TMPB 3QIJA 4F8CB 3DBSA 4EKUA 3JSVB 2KOXA 4K7UA 4JL9A 2K8CA 1RAXA 3S2AA 1YQBA 3V61A 4HLEA 1J8CA 3PHWB 1OEYA 1V81A 5CHFA 2L05A 3TL5A 2DAFA 2C7MB 3QWZB 4PS8A 4MEMA 3K9OB 4DK5A 3V60A 3ALBA 2KANA 4BKGA 2EMSA 3ZDMC 2KQSA 5C1ZA 2MP2B 5C23A 3H9DA 3PV1A 3ZLZA 2KXJA 4PS7A 3L0WB 1VD2A 1RFAA 1QZEA 2ZCBA 2K39A 1WFYA 3LDZE 2JY6A 3KUCB 2DZKA 5AZHA 3AU4A 2BYEA 3V6CB 2JRIB 2AYOB 2L00B 3ENEA 1V49A 2IO1B 3L54A 3SDLC 4WWOA 4F1SA 2BWFA 4FHKA 4ANUA 3QJZA 2KC2A 2AEHA 2DZJA 4GU2A 2NBUA 1CMXB 3QAQA 4PYZA 2L7RA 5DPWA 4HPLB 4DDID 4B95A 2B3AA 4URKA 4FJYA 1KJTA 5E6NA 3OJ3A 3O65B 4KSLC 1R4NI 2NBVB 3IG3A 1SIFA 5TR5A 4B9KA 2RD0A 2A5UA 4OVVA 2D2QA 2DZIA 3SD5A 4EZLA 3VXWA 3WA0A 2KMCA 3ZO5B 3TIXA 3L08A 2GBKA 1XQQA 2ZVNA 3CMMB 4IWOA 1OGWA 3RCZA 3P2BA 1Q5WB 4NY0A 4BKSA 3ONSA 1BT0A 1GC6A 2KTRB 2C60A 4GB9A 5D94A 2NS5A
chains in the Genus database with same CATH superfamily
2KN5A 2GRIA 1V86A 1CJEA 2WXQA 3UIOB 3RT3B 1VRAB 2QIEB 3OG5A 2WNMA 4E71A 2K1FA 5E6OA 1YX6B 3RNCC 2WDRB 3M62B 3U2SC 2PMVA 3MP9A 1D5ZC 3VUWA 1V97A 1UF0A 2K5PA 4H2AA 3ZRCA 3H7PB 4N6EB 3TBLD 2FCSA 5EE1A 1FXTB 1HZ6A 1J0GA 3DHHC 2IDYA 4BOSC 2PLPA 3APDA 3NZSA 4M0WA 1NI2A 1C78A 2MBQA 1ZOYB 3A4RA 2MLBA 2FIFA 4NQLB 2DAJA 2GBMA 5HHDG 2G9HD 4YWGG 4RGTA 2NPTA 3KYDD 2M8SA 4HJGE 1LFDA 1ZKHA 1FCLA 1DGJA 1LM8B 1UWMA 4WAFA 4JGHB 1YIWA 2FBWB 4JLCA 1P3QU 2UWQA 3DWMA 3PLVA 4HXDA 1CQVA 2QC8A 3ML8A 1P1AA 2AQ1B 3AEBB 3N1YC 2O6VB 3BVZA 1ZUD2 1S1QB 1FRDA 1UGJA 4MM3B 1JALA 4HPMB 3RNAC 4MGKE 1NYRA 3R7RA 3A1QA 4TQ0A 3LXFA 2IY1B 4MACA 1AN8A 2KJRA 2R2OA 2VRRB 3FKYA 5BMHA 4NAMA 2LUEA 4HPPA 2N9EB 2AWTA 3APCA 2LD9A 4S0RA 2LXCA 4CYEA 3P63A 1WX7A 1E0ZA 1WX9A 4FA6A 2BKFA 5BYRA 5CX3A 2KN4A 3V62A 2J7QB 4C56C 5D6JB 1MPEA 5TSSA 4YTPB 5HI1A 2Y3AA 3KUDB 2MP2A 3A33B 2MCNB 2G3QB 4ZHOA 3R7QA 3RZFA 3GOEA 3DOWA 3QA8A 5BMGA 2YEPF 2KFJA 1YJ1A 1V1PA 4KKJA 4BAXA 4LLGM 4OZCA 4CO7A 1SJHD 2HD5B 3KVFB 1SB3C 4P16A 2KO3A 2D3CA 1K53A 5JH5C 3PSEB 3AE5B 3IT6B 2L83A 3SFDB 4DXGA 2KTFA 1C3TA 4OZBA 1Y56A 1UD7A 4S17A 3L10B 2LUMA 1E6EB 2W82A 3NS8A 4W9GA 2N0SB 1SE9A 3B1LX 4A20A 5C3JB 2KJHB 4P7IA 4A3PA 4GDLB 1I7HA 1UBQA 2ONQA 3Q3JA 2ACZB 3DVNU 2CU3A 1A70A 1QOFA 3ZNHB 1RM6C 4YXDB 3A9JA 4W9EA 4W9JA 3RPFC 3Q3FA 5J18A 1EU3A 4W9DA 2LJIA 2ZW0A 2OOBB 2W54A 4EZKA 4O1NA 2LGYA 2CHZA 3WANA 3DBRI 3L16A 4BKTA 3V6EB 4B0MA 1GG3A 3I63C 2V4IB 4IM3A 3R2IA 2QILA 1MHXA 3DPDA 1YN5A 1SIJA 5JHAA 1XLNA 3EC8A 1ET9A 2MQJA 1QQRA 5D2MB 3ECIA 3KW5B 2K8HA 4HKQA 1GJZA 2WYQA 3UI3A 4RNAA 3V05A 2RMMA 1GUAB 4IW0A 2JRHA 4DBGA 3GZNB 4HJKA 1WM2A 3RUIB 4C4VA 1FRRA 2DNFA 5E6PA 1UELA 1BMLC 2C7NB 1FD6A 1ZDXA 2N1VA 4AWJA 1XO3A 4II3B 1ZGUB 2MBOA 2KD0A 4DQOC 4HRSA 4BKSD 3GP7A 3N1ZC 4DHJD 2BGFA 2XEWA 3DBLB 4KIKB 2Z59B 2MSED 3H8HA 4A8XC 5IAAC 4MGZE 1SE4A 3ABVB 3NRZA 1ZPSA 5DPRA 4WAAA 2N9PC 1DOIA 2IO0B 2KKCA 5T8IA 4KVGB 3T9LA 5EDSA 4XZ4A 1WJNA 2Y5BB 2GBNA 1M4VA 4I6LB 3DHGC 1KH0A 4YL8A 4BVUC 3L13A 3BY4B 3VHTC 1FXIA 2K22A 2GMIC 3EECA 3HVZA 2BYTA 2W55A 1J7BA 1UUPA 3PTFC 2BS3B 2KVZA 2PPHA 4II2B 2MJDA 3X0WA 4MJSB 1XLQA 2L1AA 2BTEA 1Q0WB 2L3ZA 4ZRJA 1C9FA 3QCAA 2WX1A 2WDTB 1V9JA 3R2TA 2BQQA 3SR6A 4RMAA 2BYFA 5EE9A 2KDBA 1IBXA 3EHVA 4CHKA 4NAWB 1U4AA 2GOWA 3C19A 4TV3A 3CWIA 3ZGZA 2KQ4X 2LGXA 3LYYA 3AE8B 1K8RB 2MBBB 2N9XA 1DOXA 4ASWC 2M0XA 2R2QA 3ZJUA 3PLUA 3IVFA 3B0AA 2DX5B 4WJPA 2N9LA 1ET6A 3DBSA 2X38A 2K8CA 2PTLA 4UDUC 1YQBA 1J8CA 1V81A 2XNAC 3RFZB 2DAFA 2QMTA 3FAHA 4DK5A 3NZ3A 3ALBA 4BKGA 3ZDMC 2KQSA 2MP2B 3U7ZA 4YSYB 1J7CA 2KXJA 1VD2A 1SJED 4KKIA 1TKYA 1RFAA 1QZEA 1WFYA 1AW7A 2JY6A 3KUCB 2L00B 3RN9C 3L54A 4JX1C 4KGSA 3VRAB 4B95A 3T3OA 2B3AA 2V3NA 3O65B 5AUIA 1R4NI 4WQMA 1HTQA 3CIRB 2DZIA 4JPSA 3TIXA 1PDXA 3CMMB 3RCZA 2MJEA 4NY0A 3ONSA 1L4DB 5D94A 4GB9A 2NS5A 1SSNA 1Z2MA 1IYFA 3MC9A 4DHZE 2V3PA 5FR3A 3SHQA 3Q3MC 4BOZB 3M95A 5AUKA 2PVGC 1WX8A 1RRBA 4DWFA 1JWBD 1WIAA 4EUTA 4DXFA 3VVWB 4AS1A 2QCZA 2BW2A 2LRWA 3AB5A 4TKNA 1L6UA 4GXBA 3W9CB 3DDCB 3AEFB 4P1BC 1QF6A 2O2VA 2XK5A 3B08A 2K0PA 4L1BA 3BVGA 1S3SG 2G1EA 3VTWA 1OQQA 3PVLA 1KLUD 5IOIA 3EUB2 2KDIA 2KK8A 5G55A 1HTOA 3N1XC 1WJ6A 4MGIE 1SEBD 3ZNZB 3FC4A 2BBCA 2KHWB 4KIKA 2Z0DB 4LNKA 3HRDD 3PS6A 4TUUA 3H7SA 1TKEA 3ZYYX 1RWSA 3VH3B 4A3OA 4M00A 4GIVA 1L0YB 4EFOA 2FCNA 3DBHB 3A4SC 3AECB 3DBHI 2WXKA 2DLBA 4KV2A 2K3UA 3NG0A 2FCMA 3ZJTA 3VRBB 1AARA 4RGOS 5G5HA 2G4DB 1TZ1A 3R3MA 2I1KA 5AZFA 4NQKE 5G5GA 3N3KB 2ZPNA 4HCNB 2MHJA 4ZRIA 1FXAA 3NZUA 3L17A 1R4MI 2NBWB 1ZXIA 2KJ6A 1EU4A 4G11A 4EZJA 2KT7A 4DHZB 2AL3A 2WX0A 1HEZE 2KWCA 1QT9A 1I4QA 1FEHA 2DENB 1KM7A 3I5JC 1WE7A 1QOAA 2KWUB 5KHQA 3W1YA 3IXSA 2W3SA 4XWWA 1GNUA 3NHEB 1EO6A 1K50A 2ZZPB 3IBEA 1XT9B 1E7PB 2KMMA 5IA7A 2DYMA 3U30A 1V5TA 3E56A 4ZRKA 4OVUA 5GXGB 3B9JA 2C9WB 3RNGC 2IO2B 2DHZA 2MX2A 3A1QB 2M56B 3AE6B 2WLBA 4FLHA 3KH0A 2CHXA 2INCC 4ZOHC 4WWPA 2J53A 2QJLA 3ZRFA 1PQSA 1D5XC 4LJPB 3BINA 2LGSA 2MEKA 2LHEA 1JQ4A 5CTRC 1L5PA 2PW9A 2FCQA 1XLPA 2JYEA 4ICUA 1EF5A 3K9PB 4LNNA 3MTNB 2L0FA 3AULA 2BS2B 2LZ6A 3ETRA 4ANVA 2IGHA 1WMHA 1JRPA 1TBEA 3VR9B 1WGDA 1KTKA 4M8MA 1MI0A 3A9KB 5BMIA 1WR6E 3ZVVA 1WJ4A 1WGYA 1H4RA 2KX3A 3AE1B 5J17A 4P1CC 4EOYA 1B9RA 4ANWA 3I9V1 4GSWA 1C76A 2RGFA 3U8ZA 5BYQA 1JRUA 4HDQA 1XEEA 4P6VF 3HHMA 5LXIB 4WWMA 1TGZB 4ZDVA 2BB6A 3Q8AA 4IOIE 4IG7B 4TMAB 2N4FA 3AN1A 3N9YC 2RPVA 5HG2A 1C4AA 2EELA 1TKGA 3LJ3A 2H88B 1WGGA 3T8MA 4AJYB 2IO3B 3GE3C 1PGBA 4PT5A 3URYA 1TZOA 1UH6A 1T3QA 1Y8RC 2O2VB 1I4XA 3WAMA 2KLCA 1WZ0A 3WAOA 4IWQA 2GB1A 3IAS1 4MSQB 2INDC 1JWUD 3A9JB 2N7EA 2HJ1A 3TUOA 2KYWA 2WXLA 4US9A 1WRIA 2E6XA 4AUQC 2LVQA 4IUMB 1V1OA 2NTSA 1KFYB 1KOTA 4XC2A 1TIFA 4BBNC 1PYWD 1VCBA 3P4RB 1WY8A 4AP4C 4BZAA 1SE3A 5IO9A 3PREA 1WXMA 1R4MB 4XX5A 2C5LC 2JF5A 2KX0A 2J0JA 2ZJDA 4B6WA 4RCOA 2JZ3B 3TCAA 1XF5L 2JWZA 1K51A 2J4XA 3H6NA 2JQRB 2YVCA 4LNFA 2JX5A 4DXAB 1TJEA 3VH4B 2REXA 2KFKB 4LNOA 2HTHA 5LLIA 4YTMB 1IP9A 5E6JA 4AOFA 3VFKA 4HK2A 2MBEA 3IHPC 4M01A 4KDLB 2HJ8A 3PRMB 1GOZA 2CHWA 1NYQA 2I38A 4N9F4 4XWTA 3VDZA 4IM2A 4FJZA 1TTNA 2JT4B 1FCCC 2JWUA 1F52A 2IBIB 3TMPB 4MT5A 4EKUA 3JSVB 4ZYSA 4FXCA 2OEDA 3V61A 4HLEA 3O13A 1OEYA 5CHFA 2L05A 3TL5A 1WYGA 1AYFA 2AQ3B 4WURA 1OQRA 3K9OB 3DBRB 1WWTA 5C23A 1QOBA 3ZLZA 2LFIA 1SE2A 2INNE 2OJWA 4OZAA 5AZHA 2BYEA 4YT0B 2BT6A 4C00A 2IO1B 3HVDA 4F1SA 4RH6A 4ANUA 4PYZA 4GU2A 2NBUA 1CMXB 2L7RA 4HPLB 1F77A 4URKA 2I2YA 1BUIC 2NBVB 3IG3A 1SIFA 2RD0A 2WXIA 2A5UA 2D2QA 2LEKA 3WA0A 4JWUC 2IJ0A 4LK0M 3L08A 2D3BA 2NMQA 4R3DA 1P7FA 3TEWA 4RGNA 4US8A 3R8BA 2C60A 3V3XA 1KRHA 1RFKA 4XDCA 2LVOA 2LHDA 5FR6A 1JROA 1QKZA 3U7DA 3W2DA 1E8WA 1VJKA 4M0WB 1WYWB 1N62A 1P7EA 4FULA 4HVBA 2LWPA 1WMHB 3Q3NC 3VUYA 4RM8A 1N5XA 4JWSC 1IUEA 3A9KA 4FJVB 1L2NA 2KMAA 3EA6A 4ARIA 1A5RA 1SGHA 4NAWA 1VZ7A 2XBBC 3BZDB 3VAWA 2MW5A 4HEA1 1JWMD 4A9AA 5LXHA 5FKAC 4K7SA 2KVRA 2BYVE 1E10A 2BKRB 2D07B 1AWDA 3AEGB 4HCPB 2WHIA 2DYOA 3MHSD 3T3NA 1PUTA 4GMVA 3DHIC 1WM3A 1H8CA 2FNJB 3D32A 1FNUA 3TEZA 2WS3B 4D2KA 1D3ZA 4USAA 3AE2B 2KAJA 4LDTB 1JWSD 2C7HA 3GE8C 3ZDTA 4X57B 1PGXA 1YJJA 5D3DA 4LNIA 5CHWA 2LXAA 2WQYB 5G2NA 2Z8LA 4G0NB 4W9LA 3UQAA 3RNFC 4GDKB 2D11A 3TSSA 1WE6A 2WXRA 4WQOB 1T5XD 2L32A 3I57A 3JYUA 3OJ4B 3VTUA 3C0RB 1YD8U 1MVKA 2D10A 4K1RB 4J3OD 2ZNVB 5H92C 2PE9A 3PGEA 1KLGD 3IAM1 2WXOA 4OHJA 1ACCA 3EFCA 3PZ8A 5IKCM 4MDKE 3ZQ4A 1UBIA 1V80A 1C79A 3AEEB 4XYCA 3AE3B 2QSDA 2N1WA 1GPXA 2CR5A 2O6VA 2E3TA 3P1MA 3UF8A 3QC8B 2CJNA 1HE8A 1EWYC 2WDQB 3SEBA 4ZRQA 1EF1A 3ZUNA 1D5MC 2V9HA 1L0VB 5D3IB 2JVCA 1WF9A 1WSPA 4GDLA 4Q2JA 5AEKB 1N61A 2XK5B 5L95C 2J0KA 5LNK1 3KWVA 2VZKB 4W9HA 5EE0A 4ZHPA 3ZIMA 3VTVA 2KWVB 2KACA 3HIZA 3KQ4A 4HWIB 1LGRA 4GOCA 4IWPA 3VR8B 2D3GA 5BYSA 2V4LA 1DOYA 3PHXB 2WXMA 2WXNA 4M8NA 4IDIA 3KWLA 4HROA 3P4PB 2QHOA 1YN3A 3NJTA 4KSKC 1F1HA 3AMZA 4RGMA 1LQBA 1SBBB 3M3JA 2IY0B 3DVGX 1HXYD 2JZPA 3UQBA 2M1MA 5MPOA 1GC7A 3CSFA 2G4SA 1IGCA 4LDTD 2WP9B 1M94A 1RYJA 1JCKB 4DDGD 1N5WA 1FO4A 1P98A 3PZDA 3BK2A 4FN2A 5EE3A 3HM6X 5JHBA 3ML9A 4KX6B 1WH3A 1ZW7A 2RDGA 4XE0A 2MRPA 5BO4B 3AM9A 4LJOB 1P0RA 1Q1OA 1SF0A 2I1JA 2EKIA 2HTME 4MELA 3RI7C 3RZWC 2KC1A 2JXXA 4KZCA 2CU1A 2CS4A 4W9KA 3NUHB 1VR9A 3IFWB 2RR9A 3BVMA 4WJOA 2KWDA 3PZ7A 1F9JA 3Q2AC 2B76B 1MJDA 2JSVX 1EUVB 2LGDA 1IBXB 2K9XA 1QOGA 3N30A 3RYTA 3C8YA 3U52E 2LVPA 3B2FA 5J2RA 3CF6E 1GB1A 2KTRA 4FBJB 2JYTA 3WIMA 1WJUA 3P42A 4JQWC 3HUIA 1KF6B 5DCNA 3HM3A 1WRDB 1Z5SB 1FNWA 1V6EA 1ZE3D 2KLGA 2WWZA 2MWSB 1ZDVA 5JXVA 3RD2A 3MC0B 2EMTA 4E74A 1YQ4B 4I6NB 2M17A 1FMAD 1V5OA 2ZPYA 4YSZB 1XD3B 2KQ7A 2WDVB 1D6EC 3UINB 2QDFA 1PFDA 2HDEA 1I35A 1HZ5A 2YLMA 2L0TA 1HA5A 2ZVOA 2PIAA 4YSXB 4PYUA 2KDMA 3GB1A 4REZA 3NY5A 3PO0A 1I4GA 1VDVA 1HQRD 1FIQA 2K8BA 1VLBA 2ZNVC 3CSTA 3Q3OC 1X1MA 1ZP0B 1I4HA 2LASA 1YN4A 1P9DU 1ROEA 3L4PA 4MJSA 3WALA 4N58A 3AI5A 1R4NB 2MA9B 2UU7A 1I4PA 2ON8A 3MC8A 2KOXA 4K7UA 1RAXA 3Q6BA 2LMCA 4MEMA 1TYGB 3V60A 3J9CA 2EMSA 1ZXHA 1R7SA 3H9DA 4WH4A 3ZXVA 4PS7A 2ZCBA 4WIPA 1MG4A 2VZKD 2M19A 3AU4A 3V6CB 2AYOB 3ENEA 1V49A 3SDLC 2IGGA 4FHKA 2SEBD 2AEHA 2DZJA 4A90A 5DPWA 3P4QB 1SXTA 4FJYA 2WGSA 5E6NA 4KSLC 1CK1A 3AEDB 1F2RI 3ZXRA 4EZLA 3VXWA 2KMCA 1YMHE 2V0GA 2H89B 2ZVNA 1K52A 4A6QA 4BKSA 1QLBB 4OW0A 5HFYA 3AH7A 2MH7A 2NPTB 4K81A 4N59A 4MGYE 2W9NA 3QX1A 5D7GA 1CZPA 3N32A 3Q8EA 2N7DA 1E8ZA 2OHFA 2Z0EB 2BVCA 1OQYA 1WXSA 1XCQL 2FIDA 4JE3B 1STEA 2JUOA 1FFUA 1E7UA 1YNTE 2X8XX 4MSMB 2XN9C 3AV8A 3NVWA 5DPTA 3NOBA 1ENFA 2KFKA 2BF8B 1WR1A 3NVVA 4GLSC 4A55A 2GLSA 4LCDE 2J0MA 4MM3A 4JIOU 3W1SA 1V1PB 3AE9B 3DCGA 4QAYA 4GGQA 2WXFA 3MFGA 2IGDA 2PVOD 3ZJVA 1PGAA 1I42A 1WXQA 4OVZA 5AZGA 1T0RC 3DVNV 5FK9C 4XGAB 1IGDA 1OFFA 3KLSX 2RDHA 1OEYJ 1TS4A 2NCNA 1F2RC 2D3AA 4NJ6A 4WJNA 3HK0A 3KUZA 4BFRA 3VQIA 2INPE 1MFWA 1L0XB 1WZ3A 3M63B 4GN1A 3RMKC 3DWGC 1B1ZA 4WJQA 3MHZA 4MH0E 1D4BA 4IC7B 1E7VA 2JPHA 1G6JA 2CKHB 1TS3A 3SFEB 2MJ3A 2OJRA 2M4NA 2Y5PA 1MG8A 3FILA 2NR2A 3SU8X 1TS2A 2BS4B 5KHOA 2V1YA 4YTNB 5JZEB 4E3CA 2FUG1 2GI9A 2WU2B 3QQ8B 4ARCA 3PT2B 3ZNID 3W5UB 1WGKA 1NEKB 2FE8A 4ICVA 1T0SC 4G50A 2L52A 2MBHA 2WXJA 4ANXA 4K7WA 2K25A 3I3TB 2FAZA 1VZ6A 3UIPB 2V3SA 2KDFB 1XCTL 4NJ7A 4ITKA 3ZTDA 1JW9D 3MJ5A 1ISNA 3DVGY 4BBNF 4ZRPA 2PJHA 3X23A 3R66C 1E8XA 1N6ZA 4NPNA 3JW0X 5GMVA 3RNEC 3MJWA 4C4VB 2D5GA 3Q14C 2JXTA 3ZKJC 3ZW3A 3Q8BA 1WXVA 2PE6B 3TEYA 2WXGA 1E90A 3Q8FA 1T0QC 4HKZE 4TSSA 4FHJA 4ACFA 2VH1A 1C1YB 2Q5WD 2L8JA 2WXHA 1T0YA 2RDBC 2IZVB 3UGBB 2DYBA 2AL6A 2ASQA 3PRZA 2Y5CA 4DHJB 2JZZA 3QARA 1GB4A 4PS3A 2WU5B 5I4DA 1UNSA 3DBLI 2O6VD 1UWXA 3B2GA 1NVID 2ZEQA 1OTRB 3TJPA 1JMLA 2IYDB 5IP4D 1RLFA 5HKHA 4CQNA 3GZNI 1Q10A 5DPSA 4NZLB 1J19A 2LJ5A 1J7AA 1NI3A 4J6IA 4RFBA 4FADA 2KZRA 2RSUA 2LGIA 3OLMD 2DZMA 1LXDA 1GAQB 2KNBA 3AE7B 1C4PA 2J52A 2DWQA 3ZNGC 2N7JA 4GDKA 3IT4B 5IN7A 3QK0A 1V8CA 5H8YE 2EKEC 2RPQA 3H7PA 1TY0A 3PPAA 2ZCCA 5C2TB 3JVZX 4KZ0A 2G45B 2JU6X 3RULA 1DYQA 1UGMA 3AU5A 1NDDA 2PEAA 1BXTA 3DQVA 1L4ZB 2GBRA 1TS5A 3W1SC 1UZXB 4F7ZA 2M0AA 1VZ8A 4W9FA 1FFVA 4NJCA 2BPSA 3N20C 2NVUI 2FUHB 2BB5A 4RM9A 1QILA 2QEJC 3APFA 4TQ1A 2A4ZA 4W9CA 2AX5A 1FNVA 4B0EA 4LTUA 1NENB 4AJWA 3H1UA 1EM7A 4PK1A 4C80A 2ICIA 1WGRA 1KLVA 2LRUA 4KDIC 1TT5B 1L7YA 3BK1A 4W9IA 3KYCD 2KDEB 1WXAA 3P4SB 2L76A 1XLOA 4WWNA 4IKGA 4M02A 3ZTCA 1NBFC 1ESFA 4C7YA 2CJOA 1E5WA 3U4EG 4ZYNA 3AEAB 4NNJB 1IPGA 3LB8C 3QHTA 4HDOA 1YOVB 4I6PA 3BWUD 2LI5A 3BYYB 3VUXA 1E9MA 1FM0D 3OWEB 3FILB 3W5VB 1MHHE 1TY2A 3AXCA 5CHVC 1V2YA 2ZW1A 5L83A 1LO5D 3JSVA 2K6QA 2IPKD 2GBJA 1WI0A 4L23A 3WAPA 2BWES 3OAWA 3WCQA 2UYZB 2N9KA 2K6DB 1N60A 4RF0A 1L6VA 4EEWA 4RF1A 3EFUA 1WGHA 2W3RA 3E9SA 2PKOA 4KGTA 1C77A 4MH8A 3NVZA 1XXGA 2HE7A 4G3XB 1YX5B 3TEXA 3PRPB 4IM0A 1E8YA 4C7ZA 3QIJA 4F8CB 2AQ2B 2TSSA 2SAKA 4JL9A 3RNBC 2VH2A 3AE4B 3EGRA 3S2AA 3PHWB 2C7MB 3BIID 3QWZB 2YEPB 4PS8A 1N63A 3Q69A 4XDDA 1YJIA 2KANA 3NS1A 5C1ZA 2R61A 4AQ7A 3PV1A 3L0WB 2NTTA 4L2YA 2K39A 3LDZE 3NVYA 2DZKA 2JRIB 4EE2A 4WWOA 1F0ZA 1C4CA 3GS2A 2BWFA 1I4RA 3QJZA 2KC2A 3QAQA 4DDID 2DBYA 1KJTA 3OJ3A 1T6BX 2WXPA 2J42A 1FPYA 5TR5A 4B9KA 4OVVA 1EWCA 3SD5A 1YQ3B 3ZO5B 1JWAD 2GBKA 1XQQA 3Q8CA 4IWOA 1OGWA 3P2BA 1Q5WB 1BT0A 4K3BA 1GC6A 2KTRB 4KGRA 3BYTB 4K3CA
chains in the Genus database with same CATH topology
2LVOA 2NPTB 4K81A 4MGYE 2KN5A 2W9NA 1V86A 1Z2MA 5FR6A 3QX1A 5D7GA 1IYFA 3U7DA 3N32A 1E8WA 3RT3B 3UIOB 4M0WB 1WYWB 2N7DA 1E8ZA 4DHZE 2Z0EB 1OQYA 4E71A 1WXSA 2FIDA 2K1FA 4FULA 4HVBA 5E6OA 1YX6B 3SHQA 2JUOA 2LWPA 1WMHB 4BOZB 3M95A 3VUYA 1E7UA 3M62B 4RM8A 1WX8A 4MSMB 1RRBA 4DWFA 3VUWA 1WIAA 4EUTA 3A9KA 5DPTA 3NOBA 4FJVB 3VVWB 1L2NA 2KMAA 3ZRCA 2LRWA 4TKNA 1A5RA 3H7PB 2KFKA 2BF8B 1WR1A 3TBLD 1SGHA 4NAWA 4GXBA 2FCSA 4LCDE 2J0MA 2XBBC 4MM3A 1FXTB 4JIOU 3VAWA 1J0GA 3W1SA 2MW5A 3DCGA 3DDCB 4GGQA 4BOSC 2O2VA 2XK5A 3B08A 1S3SG 3VTWA 5LXHA 3APDA 3NZSA 1I42A 4K7SA 1NI2A 2MBQA 2KVRA 3A4RA 3PVLA 2BYVE 5AZGA 3DVNV 2BKRB 2MLBA 2D07B 2FIFA 4NQLB 2DAJA 2GBMA 2KDIA 1OEYJ 2NCNA 4NJ6A 2KK8A 4WJNA 4HCPB 3HK0A 5G55A 3KUZA 4BFRA 3VQIA 2DYOA 3MHSD 1WJ6A 4MGIE 1WZ3A 3M63B 4GN1A 4GMVA 2NPTA 4WJQA 1WM3A 1H8CA 2FNJB 3KYDD 3D32A 4MH0E 4IC7B 2M8SA 1E7VA 1LFDA 2JPHA 1ZKHA 3ZNZB 1LM8B 2CKHB 1D3ZA 1G6JA 2KHWB 4JGHB 4KIKA 4LDTB 1YIWA 2Z0DB 4JLCA 2C7HA 3ZDTA 3PS6A 4TUUA 2OJRA 2M4NA 3H7SA 1P3QU 1MG8A 4X57B 3VH3B 4A3OA 2NR2A 2UWQA 3PLVA 4GIVA 4HXDA 5KHOA 3SU8X 2V1YA 5JZEB 4EFOA 3ML8A 4E3CA 1P1AA 3QQ8B 5CHWA 2LXAA 5G2NA 4G0NB 4W9LA 2FCNA 3UQAA 3A4SC 3PT2B 3DBHI 4GDKB 2D11A 2O6VB 3ZNID 1WE6A 4ICVA 1S1QB 4G50A 2MBHA 4WQOB 4KV2A 4ANXA 3JYUA 3OJ4B 4HPMB 3VTUA 4MGKE 2FCMA 4K7WA 3C0RB 1YD8U 2D10A 4K1RB 2K25A 3I3TB 3R7RA 3A1QA 2FAZA 2ZNVB 3UIPB 1AARA 4TQ0A 2PE9A 3PGEA 2IY1B 2V3SA 2KDFB 4NJ7A 2G4DB 3ZTDA 1TZ1A 4MDKE 1ISNA 1UBIA 1V80A 3DVGY 2I1KA 2KJRA 2R2OA 2VRRB 3R3MA 5AZFA 4BBNF 4NQKE 2PJHA 3N3KB 3R66C 3X23A 2LUEA 2ZPNA 4HCNB 1E8XA 2N9EB 4ZRIA 2AWTA 3APCA 4NPNA 3NZUA 3JW0X 3L17A 1R4MI 2NBWB 5GMVA 3MJWA 2KJ6A 4G11A 2LD9A 2N1WA 2CR5A 2O6VA 2LXCA 4CYEA 4EZJA 1WX7A 1WX9A 3ZKJC 3UF8A 3ZW3A 4FA6A 3QC8B 4DHZB 2BKFA 2AL3A 2WX0A 2KWCA 1HE8A 5CX3A 3V62A 1WXVA 2J7QB 2PE6B 5D6JB 1E90A 2DENB 1KM7A 1WE7A 2KWUB 4FHJA 5KHQA 1C1YB 2L8JA 3KUDB 2MP2A 1EF1A 3A33B 3ZUNA 1T0YA 3W1YA 2MCNB 2G3QB 3R7QA 1GNUA 3NHEB 3RZFA 3GOEA 1EO6A 3DOWA 2ZZPB 3QA8A 2JVCA 1WF9A 2KFJA 1XT9B 2IZVB 3IBEA 4GDLA 2DYBA 3UGBB 5AEKB 1YJ1A 2AL6A 2ASQA 3PRZA 4DHJB 2JZZA 3QARA 5IA7A 2XK5B 2DYMA 2J0KA 5L95C 4CO7A 3KVFB 2HD5B 3U30A 1V5TA 4PS3A 4ZRKA 4W9HA 2KO3A 4OVUA 3DBLI 3ZIMA 2C9WB 2KWVB 2IO2B 3VTVA 2DHZA 2MX2A 2O6VD 3A1QB 5JH5C 4FLHA 3PSEB 3KH0A 2CHXA 4WWPA 3ZRFA 2KTFA 2ZEQA 1C3TA 1OTRB 3HIZA 1PQSA 3TJPA 4HWIB 4LJPB 1UD7A 4GOCA 3BINA 2IYDB 3L10B 1RLFA 4IWPA 5HKHA 2D3GA 3GZNI 3NS8A 2V4LA 3PHXB 4W9GA 5DPSA 1SE9A 1J19A 2LJ5A 3B1LX 5CTRC 4A20A 4M8NA 2FCQA 2KJHB 4P7IA 4ICUA 1EF5A 3K9PB 4J6IA 4A3PA 4GDLB 4FADA 2QHOA 2KZRA 2RSUA 3MTNB 1UBQA 2L0FA 3AULA 3OLMD 3Q3JA 2LZ6A 2DZMA 3DVNU 1LXDA 4KSKC 4ANVA 1LQBA 2KNBA 1WMHA 3ZNHB 1TBEA 3M3JA 2IY0B 3DVGX 1WGDA 3A9JA 3ZNGC 4GDKA 4M8MA 4W9EA 4W9JA 3A9KB 3QK0A 1WR6E 3UQBA 3Q3FA 5J18A 2M1MA 3ZVVA 4W9DA 1GC7A 3CSFA 1WJ4A 2EKEC 2OOBB 2RPQA 1WGYA 3H7PA 2G4SA 1H4RA 2KX3A 4EZKA 3PPAA 5J17A 2ZCCA 3JVZX 4LDTD 4KZ0A 2G45B 4EOYA 4ANWA 1M94A 2LGYA 3RULA 2CHZA 4GSWA 3DBRI 3WANA 1UGMA 2RGFA 3AU5A 3L16A 4BKTA 3U8ZA 3V6EB 4DDGD 1GG3A 1NDDA 2PEAA 3DQVA 2GBRA 1JRUA 4HDQA 3W1SC 1P98A 1UZXB 4IM3A 4F7ZA 3HHMA 5LXIB 1TGZB 3DPDA 3PZDA 4ZDVA 4W9FA 5JHAA 4FN2A 2BPSA 3EC8A 2MQJA 4IG7B 2NVUI 3ECIA 2K8HA 2N4FA 2FUHB 3HM6X 3KW5B 5D2MB 5JHBA 1GJZA 3ML9A 1WH3A 2WYQA 1ZW7A 4RM9A 3APFA 2MRPA 4TQ1A 1GUAB 5BO4B 2A4ZA 4IW0A 2JRHA 1P0RA 4LJOB 4HJKA 4W9CA 4DBGA 1WM2A 3LJ3A 1WGGA 3RUIB 1Q1OA 3T8MA 5E6PA 2I1JA 4AJYB 1UELA 2IO3B 2C7NB 3H1UA 4AJWA 4MELA 3RZWC 2KC1A 2JXXA 2N1VA 1WGRA 4KZCA 4AWJA 2CU1A 1KLVA 4II3B 1ZGUB 2CS4A 2MBOA 2KD0A 4W9KA 2LRUA 1UH6A 4BKSD 4KDIC 1Y8RC 4DHJD 2BGFA 2XEWA 2O2VB 3WAMA 2KLCA 4KIKB 1WZ0A 1L7YA 3WAOA 4IWQA 2Z59B 2MSED 3IFWB 2RR9A 5IAAC 4W9IA 4MSQB 4MGZE 4WJOA 3KYCD 1F9JA 2KDEB 1EUVB 3A9JB 1WXAA 2N7EA 2L76A 2LGDA 4WWNA 3ZTCA 5DPRA 1NBFC 3N30A 4WAAA 3RYTA 4AUQC 2N9PC 2IO0B 2LVQA 4IUMB 2KKCA 2LVPA 5J2RA 1E5WA 3CF6E 4KVGB 4ZYNA 3T9LA 5EDSA 1KOTA 4XC2A 4NNJB 2KTRA 4XZ4A 4FBJB 1IPGA 1WJNA 2Y5BB 2GBNA 3QHTA 4HDOA 4I6LB 3WIMA 4BBNC 1WJUA 4JQWC 4I6PA 1VCBA 4YL8A 5DCNA 4BVUC 2LI5A 3HM3A 1WRDB 3BY4B 1Z5SB 3L13A 3VHTC 1WY8A 1V6EA 2GMIC 3EECA 4AP4C 2KLGA 3VUXA 2WWZA 2MWSB 3PTFC 3PREA 1WXMA 3RD2A 4XX5A 2C5LC 2EMTA 2JF5A 4E74A 4I6NB 2M17A 2KX0A 2PPHA 2J0JA 4II2B 1V5OA 2ZJDA 2ZPYA 3X0WA 4B6WA 4MJSB 2JZ3B 3TCAA 1XD3B 2JWZA 2KQ7A 1Q0WB 3AXCA 2L3ZA 5CHVC 4ZRJA 1V2YA 3QCAA 2WX1A 3UINB 2WDTB 1V9JA 3H6NA 2YVCA 5L83A 4RMAA 2BYFA 2KDBA 4DXAB 3JSVA 3VH4B 2REXA 1I35A 2K6QA 2KFKB 2YLMA 2HTHA 3EHVA 2GBJA 4CHKA 4NAWB 1U4AA 2L0TA 5LLIA 2GOWA 4TV3A 2ZVOA 1WI0A 1IP9A 4AOFA 3WAPA 2BWES 4PYUA 2LGXA 3OAWA 2MBEA 3IHPC 4HK2A 3VFKA 2UYZB 2HJ8A 3NY5A 4KDLB 2K6DB 3PRMB 1K8RB 2CHWA 2MBBB 2N9XA 3EFUA 4EEWA 1WGHA 2K8BA 2ZNVC 3CSTA 4N9F4 4ASWC 1X1MA 2M0XA 2LASA 2R2QA 1P9DU 3VDZA 4IM2A 4FJZA 1TTNA 4MJSA 2HE7A 3PLUA 1YX5B 3IVFA 4G3XB 2JT4B 3WALA 3B0AA 3AI5A 3PRPB 4IM0A 1E8YA 2DX5B 2IBIB 2MA9B 4WJPA 3TMPB 3QIJA 4F8CB 3DBSA 4EKUA 3JSVB 2KOXA 4K7UA 4JL9A 2K8CA 1RAXA 3S2AA 1YQBA 3V61A 4HLEA 1J8CA 3PHWB 1OEYA 1V81A 5CHFA 2L05A 3TL5A 2DAFA 2C7MB 3QWZB 4PS8A 4MEMA 3K9OB 4DK5A 3V60A 3ALBA 2KANA 4BKGA 2EMSA 3ZDMC 2KQSA 5C1ZA 2MP2B 5C23A 3H9DA 3PV1A 3ZLZA 2KXJA 4PS7A 3L0WB 1VD2A 1RFAA 1QZEA 2ZCBA 2K39A 1WFYA 3LDZE 2JY6A 3KUCB 2DZKA 5AZHA 3AU4A 2BYEA 3V6CB 2JRIB 2AYOB 2L00B 3ENEA 1V49A 2IO1B 3L54A 3SDLC 4WWOA 4F1SA 2BWFA 4FHKA 4ANUA 3QJZA 2KC2A 2AEHA 2DZJA 4GU2A 2NBUA 1CMXB 3QAQA 4PYZA 2L7RA 5DPWA 4HPLB 4DDID 4B95A 2B3AA 4URKA 4FJYA 1KJTA 5E6NA 3OJ3A 3O65B 4KSLC 1R4NI 2NBVB 3IG3A 1SIFA 5TR5A 4B9KA 2RD0A 2A5UA 4OVVA 2D2QA 2DZIA 3SD5A 4EZLA 3VXWA 3WA0A 2KMCA 3ZO5B 3TIXA 3L08A 2GBKA 1XQQA 2ZVNA 3CMMB 4IWOA 1OGWA 3RCZA 3P2BA 1Q5WB 4NY0A 4BKSA 3ONSA 1BT0A 1GC6A 2KTRB 2C60A 4GB9A 5D94A 2NS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVO A;  2NPT B;  4K81 A;  4MGY E;  2KN5 A;  2W9N A;  1V86 A;  1Z2M A;  5FR6 A;  3QX1 A;  5D7G A;  1IYF A;  3U7D A;  3N32 A;  1E8W A;  3RT3 B;  3UIO B;  4M0W B;  1WYW B;  2N7D A;  1E8Z A;  4DHZ E;  2Z0E B;  1OQY A;  4E71 A;  1WXS A;  2FID A;  2K1F A;  4FUL A;  4HVB A;  5E6O A;  1YX6 B;  3SHQ A;  2JUO A;  2LWP A;  1WMH B;  4BOZ B;  3M95 A;  3VUY A;  1E7U A;  3M62 B;  4RM8 A;  1WX8 A;  4MSM B;  1RRB A;  4DWF A;  3VUW A;  1WIA A;  4EUT A;  3A9K A;  5DPT A;  3NOB A;  4FJV B;  3VVW B;  1L2N A;  2KMA A;  3ZRC A;  2LRW A;  4TKN A;  1A5R A;  3H7P B;  2KFK A;  2BF8 B;  1WR1 A;  3TBL D;  1SGH A;  4NAW A;  4GXB A;  2FCS A;  4LCD E;  2J0M A;  2XBB C;  4MM3 A;  1FXT B;  4JIO U;  3VAW A;  1J0G A;  3W1S A;  2MW5 A;  3DCG A;  3DDC B;  4GGQ A;  4BOS C;  2O2V A;  2XK5 A;  3B08 A;  1S3S G;  3VTW A;  5LXH A;  3APD A;  3NZS A;  1I42 A;  4K7S A;  1NI2 A;  2MBQ A;  2KVR A;  3A4R A;  3PVL A;  2BYV E;  5AZG A;  3DVN V;  2BKR B;  2MLB A;  2D07 B;  2FIF A;  4NQL B;  2DAJ A;  2GBM A;  2KDI A;  1OEY J;  2NCN A;  4NJ6 A;  2KK8 A;  4WJN A;  4HCP B;  3HK0 A;  5G55 A;  3KUZ A;  4BFR A;  3VQI A;  2DYO A;  3MHS D;  1WJ6 A;  4MGI E;  1WZ3 A;  3M63 B;  4GN1 A;  4GMV A;  2NPT A;  4WJQ A;  1WM3 A;  1H8C A;  2FNJ B;  3KYD D;  3D32 A;  4MH0 E;  4IC7 B;  2M8S A;  1E7V A;  1LFD A;  2JPH A;  1ZKH A;  3ZNZ B;  1LM8 B;  2CKH B;  1D3Z A;  1G6J A;  2KHW B;  4JGH B;  4KIK A;  4LDT B;  1YIW A;  2Z0D B;  4JLC A;  2C7H A;  3ZDT A;  3PS6 A;  4TUU A;  2OJR A;  2M4N A;  3H7S A;  1P3Q U;  1MG8 A;  4X57 B;  3VH3 B;  4A3O A;  2NR2 A;  2UWQ A;  3PLV A;  4GIV A;  4HXD A;  5KHO A;  3SU8 X;  2V1Y A;  5JZE B;  4EFO A;  3ML8 A;  4E3C A;  1P1A A;  3QQ8 B;  5CHW A;  2LXA A;  5G2N A;  4G0N B;  4W9L A;  2FCN A;  3UQA A;  3A4S C;  3PT2 B;  3DBH I;  4GDK B;  2D11 A;  2O6V B;  3ZNI D;  1WE6 A;  4ICV A;  1S1Q B;  4G50 A;  2MBH A;  4WQO B;  4KV2 A;  4ANX A;  3JYU A;  3OJ4 B;  4HPM B;  3VTU A;  4MGK E;  2FCM A;  4K7W A;  3C0R B;  1YD8 U;  2D10 A;  4K1R B;  2K25 A;  3I3T B;  3R7R A;  3A1Q A;  2FAZ A;  2ZNV B;  3UIP B;  1AAR A;  4TQ0 A;  2PE9 A;  3PGE A;  2IY1 B;  2V3S A;  2KDF B;  4NJ7 A;  2G4D B;  3ZTD A;  1TZ1 A;  4MDK E;  1ISN A;  1UBI A;  1V80 A;  3DVG Y;  2I1K A;  2KJR A;  2R2O A;  2VRR B;  3R3M A;  5AZF A;  4BBN F;  4NQK E;  2PJH A;  3N3K B;  3R66 C;  3X23 A;  2LUE A;  2ZPN A;  4HCN B;  1E8X A;  2N9E B;  4ZRI A;  2AWT A;  3APC A;  4NPN A;  3NZU A;  3JW0 X;  3L17 A;  1R4M I;  2NBW B;  5GMV A;  3MJW A;  2KJ6 A;  4G11 A;  2LD9 A;  2N1W A;  2CR5 A;  2O6V A;  2LXC A;  4CYE A;  4EZJ A;  1WX7 A;  1WX9 A;  3ZKJ C;  3UF8 A;  3ZW3 A;  4FA6 A;  3QC8 B;  4DHZ B;  2BKF A;  2AL3 A;  2WX0 A;  2KWC A;  1HE8 A;  5CX3 A;  3V62 A;  1WXV A;  2J7Q B;  2PE6 B;  5D6J B;  1E90 A;  2DEN B;  1KM7 A;  1WE7 A;  2KWU B;  4FHJ A;  5KHQ A;  1C1Y B;  2L8J A;  3KUD B;  2MP2 A;  1EF1 A;  3A33 B;  3ZUN A;  1T0Y A;  3W1Y A;  2MCN B;  2G3Q B;  3R7Q A;  1GNU A;  3NHE B;  3RZF A;  3GOE A;  1EO6 A;  3DOW A;  2ZZP B;  3QA8 A;  2JVC A;  1WF9 A;  2KFJ A;  1XT9 B;  2IZV B;  3IBE A;  4GDL A;  2DYB A;  3UGB B;  5AEK B;  1YJ1 A;  2AL6 A;  2ASQ A;  3PRZ A;  4DHJ B;  2JZZ A;  3QAR A;  5IA7 A;  2XK5 B;  2DYM A;  2J0K A;  5L95 C;  4CO7 A;  3KVF B;  2HD5 B;  3U30 A;  1V5T A;  4PS3 A;  4ZRK A;  4W9H A;  2KO3 A;  4OVU A;  3DBL I;  3ZIM A;  2C9W B;  2KWV B;  2IO2 B;  3VTV A;  2DHZ A;  2MX2 A;  2O6V D;  3A1Q B;  5JH5 C;  4FLH A;  3PSE B;  3KH0 A;  2CHX A;  4WWP A;  3ZRF A;  2KTF A;  2ZEQ A;  1C3T A;  1OTR B;  3HIZ A;  1PQS A;  3TJP A;  4HWI B;  4LJP B;  1UD7 A;  4GOC A;  3BIN A;  2IYD B;  3L10 B;  1RLF A;  4IWP A;  5HKH A;  2D3G A;  3GZN I;  3NS8 A;  2V4L A;  3PHX B;  4W9G A;  5DPS A;  1SE9 A;  1J19 A;  2LJ5 A;  3B1L X;  5CTR C;  4A20 A;  4M8N A;  2FCQ A;  2KJH B;  4P7I A;  4ICU A;  1EF5 A;  3K9P B;  4J6I A;  4A3P A;  4GDL B;  4FAD A;  2QHO A;  2KZR A;  2RSU A;  3MTN B;  1UBQ A;  2L0F A;  3AUL A;  3OLM D;  3Q3J A;  2LZ6 A;  2DZM A;  3DVN U;  1LXD A;  4KSK C;  4ANV A;  1LQB A;  2KNB A;  1WMH A;  3ZNH B;  1TBE A;  3M3J A;  2IY0 B;  3DVG X;  1WGD A;  3A9J A;  3ZNG C;  4GDK A;  4M8M A;  4W9E A;  4W9J A;  3A9K B;  3QK0 A;  1WR6 E;  3UQB A;  3Q3F A;  5J18 A;  2M1M A;  3ZVV A;  4W9D A;  1GC7 A;  3CSF A;  1WJ4 A;  2EKE C;  2OOB B;  2RPQ A;  1WGY A;  3H7P A;  2G4S A;  1H4R A;  2KX3 A;  4EZK A;  3PPA A;  5J17 A;  2ZCC A;  3JVZ X;  4LDT D;  4KZ0 A;  2G45 B;  4EOY A;  4ANW A;  1M94 A;  2LGY A;  3RUL A;  2CHZ A;  4GSW A;  3DBR I;  3WAN A;  1UGM A;  2RGF A;  3AU5 A;  3L16 A;  4BKT A;  3U8Z A;  3V6E B;  4DDG D;  1GG3 A;  1NDD A;  2PEA A;  3DQV A;  2GBR A;  1JRU A;  4HDQ A;  3W1S C;  1P98 A;  1UZX B;  4IM3 A;  4F7Z A;  3HHM A;  5LXI B;  1TGZ B;  3DPD A;  3PZD A;  4ZDV A;  4W9F A;  5JHA A;  4FN2 A;  2BPS A;  3EC8 A;  2MQJ A;  4IG7 B;  2NVU I;  3ECI A;  2K8H A;  2N4F A;  2FUH B;  3HM6 X;  3KW5 B;  5D2M B;  5JHB A;  1GJZ A;  3ML9 A;  1WH3 A;  2WYQ A;  1ZW7 A;  4RM9 A;  3APF A;  2MRP A;  4TQ1 A;  1GUA B;  5BO4 B;  2A4Z A;  4IW0 A;  2JRH A;  1P0R A;  4LJO B;  4HJK A;  4W9C A;  4DBG A;  1WM2 A;  3LJ3 A;  1WGG A;  3RUI B;  1Q1O A;  3T8M A;  5E6P A;  2I1J A;  4AJY B;  1UEL A;  2IO3 B;  2C7N B;  3H1U A;  4AJW A;  4MEL A;  3RZW C;  2KC1 A;  2JXX A;  2N1V A;  1WGR A;  4KZC A;  4AWJ A;  2CU1 A;  1KLV A;  4II3 B;  1ZGU B;  2CS4 A;  2MBO A;  2KD0 A;  4W9K A;  2LRU A;  1UH6 A;  4BKS D;  4KDI C;  1Y8R C;  4DHJ D;  2BGF A;  2XEW A;  2O2V B;  3WAM A;  2KLC A;  4KIK B;  1WZ0 A;  1L7Y A;  3WAO A;  4IWQ A;  2Z59 B;  2MSE D;  3IFW B;  2RR9 A;  5IAA C;  4W9I A;  4MSQ B;  4MGZ E;  4WJO A;  3KYC D;  1F9J A;  2KDE B;  1EUV B;  3A9J B;  1WXA A;  2N7E A;  2L76 A;  2LGD A;  4WWN A;  3ZTC A;  5DPR A;  1NBF C;  3N30 A;  4WAA A;  3RYT A;  4AUQ C;  2N9P C;  2IO0 B;  2LVQ A;  4IUM B;  2KKC A;  2LVP A;  5J2R A;  1E5W A;  3CF6 E;  4KVG B;  4ZYN A;  3T9L A;  5EDS A;  1KOT A;  4XC2 A;  4NNJ B;  2KTR A;  4XZ4 A;  4FBJ B;  1IPG A;  1WJN A;  2Y5B B;  2GBN A;  3QHT A;  4HDO A;  4I6L B;  3WIM A;  4BBN C;  1WJU A;  4JQW C;  4I6P A;  1VCB A;  4YL8 A;  5DCN A;  4BVU C;  2LI5 A;  3HM3 A;  1WRD B;  3BY4 B;  1Z5S B;  3L13 A;  3VHT C;  1WY8 A;  1V6E A;  2GMI C;  3EEC A;  4AP4 C;  2KLG A;  3VUX A;  2WWZ A;  2MWS B;  3PTF C;  3PRE A;  1WXM A;  3RD2 A;  4XX5 A;  2C5L C;  2EMT A;  2JF5 A;  4E74 A;  4I6N B;  2M17 A;  2KX0 A;  2PPH A;  2J0J A;  4II2 B;  1V5O A;  2ZJD A;  2ZPY A;  3X0W A;  4B6W A;  4MJS B;  2JZ3 B;  3TCA A;  1XD3 B;  2JWZ A;  2KQ7 A;  1Q0W B;  3AXC A;  2L3Z A;  5CHV C;  4ZRJ A;  1V2Y A;  3QCA A;  2WX1 A;  3UIN B;  2WDT B;  1V9J A;  3H6N A;  2YVC A;  5L83 A;  4RMA A;  2BYF A;  2KDB A;  4DXA B;  3JSV A;  3VH4 B;  2REX A;  1I35 A;  2K6Q A;  2KFK B;  2YLM A;  2HTH A;  3EHV A;  2GBJ A;  4CHK A;  4NAW B;  1U4A A;  2L0T A;  5LLI A;  2GOW A;  4TV3 A;  2ZVO A;  1WI0 A;  1IP9 A;  4AOF A;  3WAP A;  2BWE S;  4PYU A;  2LGX A;  3OAW A;  2MBE A;  3IHP C;  4HK2 A;  3VFK A;  2UYZ B;  2HJ8 A;  3NY5 A;  4KDL B;  2K6D B;  3PRM B;  1K8R B;  2CHW A;  2MBB B;  2N9X A;  3EFU A;  4EEW A;  1WGH A;  2K8B A;  2ZNV C;  3CST A;  4N9F 4;  4ASW C;  1X1M A;  2M0X A;  2LAS A;  2R2Q A;  1P9D U;  3VDZ A;  4IM2 A;  4FJZ A;  1TTN A;  4MJS A;  2HE7 A;  3PLU A;  1YX5 B;  3IVF A;  4G3X B;  2JT4 B;  3WAL A;  3B0A A;  3AI5 A;  3PRP B;  4IM0 A;  1E8Y A;  2DX5 B;  2IBI B;  2MA9 B;  4WJP A;  3TMP B;  3QIJ A;  4F8C B;  3DBS A;  4EKU A;  3JSV B;  2KOX A;  4K7U A;  4JL9 A;  2K8C A;  1RAX A;  3S2A A;  1YQB A;  3V61 A;  4HLE A;  1J8C A;  3PHW B;  1OEY A;  1V81 A;  5CHF A;  2L05 A;  3TL5 A;  2DAF A;  2C7M B;  3QWZ B;  4PS8 A;  4MEM A;  3K9O B;  4DK5 A;  3V60 A;  3ALB A;  2KAN A;  4BKG A;  2EMS A;  3ZDM C;  2KQS A;  5C1Z A;  2MP2 B;  5C23 A;  3H9D A;  3PV1 A;  3ZLZ A;  2KXJ A;  4PS7 A;  3L0W B;  1VD2 A;  1RFA A;  1QZE A;  2ZCB A;  2K39 A;  1WFY A;  3LDZ E;  2JY6 A;  3KUC B;  2DZK A;  5AZH A;  3AU4 A;  2BYE A;  3V6C B;  2JRI B;  2AYO B;  2L00 B;  3ENE A;  1V49 A;  2IO1 B;  3L54 A;  3SDL C;  4WWO A;  4F1S A;  2BWF A;  4FHK A;  4ANU A;  3QJZ A;  2KC2 A;  2AEH A;  2DZJ A;  4GU2 A;  2NBU A;  1CMX B;  3QAQ A;  4PYZ A;  2L7R A;  5DPW A;  4HPL B;  4DDI D;  4B95 A;  2B3A A;  4URK A;  4FJY A;  1KJT A;  5E6N A;  3OJ3 A;  3O65 B;  4KSL C;  1R4N I;  2NBV B;  3IG3 A;  1SIF A;  5TR5 A;  4B9K A;  2RD0 A;  2A5U A;  4OVV A;  2D2Q A;  2DZI A;  3SD5 A;  4EZL A;  3VXW A;  3WA0 A;  2KMC A;  3ZO5 B;  3TIX A;  3L08 A;  2GBK A;  1XQQ A;  2ZVN A;  3CMM B;  4IWO A;  1OGW A;  3RCZ A;  3P2B A;  1Q5W B;  4NY0 A;  4BKS A;  3ONS A;  1BT0 A;  1GC6 A;  2KTR B;  2C60 A;  4GB9 A;  5D94 A;  2NS5 A; 
#chains in the Genus database with same CATH topology
 2KN5 A;  2GRI A;  1V86 A;  1CJE A;  2WXQ A;  3UIO B;  3RT3 B;  1VRA B;  2QIE B;  3OG5 A;  2WNM A;  4E71 A;  2K1F A;  5E6O A;  1YX6 B;  3RNC C;  2WDR B;  3M62 B;  3U2S C;  2PMV A;  3MP9 A;  1D5Z C;  3VUW A;  1V97 A;  1UF0 A;  2K5P A;  4H2A A;  3ZRC A;  3H7P B;  4N6E B;  3TBL D;  2FCS A;  5EE1 A;  1FXT B;  1HZ6 A;  1J0G A;  3DHH C;  2IDY A;  4BOS C;  2PLP A;  3APD A;  3NZS A;  4M0W A;  1NI2 A;  1C78 A;  2MBQ A;  1ZOY B;  3A4R A;  2MLB A;  2FIF A;  4NQL B;  2DAJ A;  2GBM A;  5HHD G;  2G9H D;  4YWG G;  4RGT A;  2NPT A;  3KYD D;  2M8S A;  4HJG E;  1LFD A;  1ZKH A;  1FCL A;  1DGJ A;  1LM8 B;  1UWM A;  4WAF A;  4JGH B;  1YIW A;  2FBW B;  4JLC A;  1P3Q U;  2UWQ A;  3DWM A;  3PLV A;  4HXD A;  1CQV A;  2QC8 A;  3ML8 A;  1P1A A;  2AQ1 B;  3AEB B;  3N1Y C;  2O6V B;  3BVZ A;  1ZUD 2;  1S1Q B;  1FRD A;  1UGJ A;  4MM3 B;  1JAL A;  4HPM B;  3RNA C;  4MGK E;  1NYR A;  3R7R A;  3A1Q A;  4TQ0 A;  3LXF A;  2IY1 B;  4MAC A;  1AN8 A;  2KJR A;  2R2O A;  2VRR B;  3FKY A;  5BMH A;  4NAM A;  2LUE A;  4HPP A;  2N9E B;  2AWT A;  3APC A;  2LD9 A;  4S0R A;  2LXC A;  4CYE A;  3P63 A;  1WX7 A;  1E0Z A;  1WX9 A;  4FA6 A;  2BKF A;  5BYR A;  5CX3 A;  2KN4 A;  3V62 A;  2J7Q B;  4C56 C;  5D6J B;  1MPE A;  5TSS A;  4YTP B;  5HI1 A;  2Y3A A;  3KUD B;  2MP2 A;  3A33 B;  2MCN B;  2G3Q B;  4ZHO A;  3R7Q A;  3RZF A;  3GOE A;  3DOW A;  3QA8 A;  5BMG A;  2YEP F;  2KFJ A;  1YJ1 A;  1V1P A;  4KKJ A;  4BAX A;  4LLG M;  4OZC A;  4CO7 A;  1SJH D;  2HD5 B;  3KVF B;  1SB3 C;  4P16 A;  2KO3 A;  2D3C A;  1K53 A;  5JH5 C;  3PSE B;  3AE5 B;  3IT6 B;  2L83 A;  3SFD B;  4DXG A;  2KTF A;  1C3T A;  4OZB A;  1Y56 A;  1UD7 A;  4S17 A;  3L10 B;  2LUM A;  1E6E B;  2W82 A;  3NS8 A;  4W9G A;  2N0S B;  1SE9 A;  3B1L X;  4A20 A;  5C3J B;  2KJH B;  4P7I A;  4A3P A;  4GDL B;  1I7H A;  1UBQ A;  2ONQ A;  3Q3J A;  2ACZ B;  3DVN U;  2CU3 A;  1A70 A;  1QOF A;  3ZNH B;  1RM6 C;  4YXD B;  3A9J A;  4W9E A;  4W9J A;  3RPF C;  3Q3F A;  5J18 A;  1EU3 A;  4W9D A;  2LJI A;  2ZW0 A;  2OOB B;  2W54 A;  4EZK A;  4O1N A;  2LGY A;  2CHZ A;  3WAN A;  3DBR I;  3L16 A;  4BKT A;  3V6E B;  4B0M A;  1GG3 A;  3I63 C;  2V4I B;  4IM3 A;  3R2I A;  2QIL A;  1MHX A;  3DPD A;  1YN5 A;  1SIJ A;  5JHA A;  1XLN A;  3EC8 A;  1ET9 A;  2MQJ A;  1QQR A;  5D2M B;  3ECI A;  3KW5 B;  2K8H A;  4HKQ A;  1GJZ A;  2WYQ A;  3UI3 A;  4RNA A;  3V05 A;  2RMM A;  1GUA B;  4IW0 A;  2JRH A;  4DBG A;  3GZN B;  4HJK A;  1WM2 A;  3RUI B;  4C4V A;  1FRR A;  2DNF A;  5E6P A;  1UEL A;  1BML C;  2C7N B;  1FD6 A;  1ZDX A;  2N1V A;  4AWJ A;  1XO3 A;  4II3 B;  1ZGU B;  2MBO A;  2KD0 A;  4DQO C;  4HRS A;  4BKS D;  3GP7 A;  3N1Z C;  4DHJ D;  2BGF A;  2XEW A;  3DBL B;  4KIK B;  2Z59 B;  2MSE D;  3H8H A;  4A8X C;  5IAA C;  4MGZ E;  1SE4 A;  3ABV B;  3NRZ A;  1ZPS A;  5DPR A;  4WAA A;  2N9P C;  1DOI A;  2IO0 B;  2KKC A;  5T8I A;  4KVG B;  3T9L A;  5EDS A;  4XZ4 A;  1WJN A;  2Y5B B;  2GBN A;  1M4V A;  4I6L B;  3DHG C;  1KH0 A;  4YL8 A;  4BVU C;  3L13 A;  3BY4 B;  3VHT C;  1FXI A;  2K22 A;  2GMI C;  3EEC A;  3HVZ A;  2BYT A;  2W55 A;  1J7B A;  1UUP A;  3PTF C;  2BS3 B;  2KVZ A;  2PPH A;  4II2 B;  2MJD A;  3X0W A;  4MJS B;  1XLQ A;  2L1A A;  2BTE A;  1Q0W B;  2L3Z A;  4ZRJ A;  1C9F A;  3QCA A;  2WX1 A;  2WDT B;  1V9J A;  3R2T A;  2BQQ A;  3SR6 A;  4RMA A;  2BYF A;  5EE9 A;  2KDB A;  1IBX A;  3EHV A;  4CHK A;  4NAW B;  1U4A A;  2GOW A;  3C19 A;  4TV3 A;  3CWI A;  3ZGZ A;  2KQ4 X;  2LGX A;  3LYY A;  3AE8 B;  1K8R B;  2MBB B;  2N9X A;  1DOX A;  4ASW C;  2M0X A;  2R2Q A;  3ZJU A;  3PLU A;  3IVF A;  3B0A A;  2DX5 B;  4WJP A;  2N9L A;  1ET6 A;  3DBS A;  2X38 A;  2K8C A;  2PTL A;  4UDU C;  1YQB A;  1J8C A;  1V81 A;  2XNA C;  3RFZ B;  2DAF A;  2QMT A;  3FAH A;  4DK5 A;  3NZ3 A;  3ALB A;  4BKG A;  3ZDM C;  2KQS A;  2MP2 B;  3U7Z A;  4YSY B;  1J7C A;  2KXJ A;  1VD2 A;  1SJE D;  4KKI A;  1TKY A;  1RFA A;  1QZE A;  1WFY A;  1AW7 A;  2JY6 A;  3KUC B;  2L00 B;  3RN9 C;  3L54 A;  4JX1 C;  4KGS A;  3VRA B;  4B95 A;  3T3O A;  2B3A A;  2V3N A;  3O65 B;  5AUI A;  1R4N I;  4WQM A;  1HTQ A;  3CIR B;  2DZI A;  4JPS A;  3TIX A;  1PDX A;  3CMM B;  3RCZ A;  2MJE A;  4NY0 A;  3ONS A;  1L4D B;  5D94 A;  4GB9 A;  2NS5 A;  1SSN A;  1Z2M A;  1IYF A;  3MC9 A;  4DHZ E;  2V3P A;  5FR3 A;  3SHQ A;  3Q3M C;  4BOZ B;  3M95 A;  5AUK A;  2PVG C;  1WX8 A;  1RRB A;  4DWF A;  1JWB D;  1WIA A;  4EUT A;  4DXF A;  3VVW B;  4AS1 A;  2QCZ A;  2BW2 A;  2LRW A;  3AB5 A;  4TKN A;  1L6U A;  4GXB A;  3W9C B;  3DDC B;  3AEF B;  4P1B C;  1QF6 A;  2O2V A;  2XK5 A;  3B08 A;  2K0P A;  4L1B A;  3BVG A;  1S3S G;  2G1E A;  3VTW A;  1OQQ A;  3PVL A;  1KLU D;  5IOI A;  3EUB 2;  2KDI A;  2KK8 A;  5G55 A;  1HTO A;  3N1X C;  1WJ6 A;  4MGI E;  1SEB D;  3ZNZ B;  3FC4 A;  2BBC A;  2KHW B;  4KIK A;  2Z0D B;  4LNK A;  3HRD D;  3PS6 A;  4TUU A;  3H7S A;  1TKE A;  3ZYY X;  1RWS A;  3VH3 B;  4A3O A;  4M00 A;  4GIV A;  1L0Y B;  4EFO A;  2FCN A;  3DBH B;  3A4S C;  3AEC B;  3DBH I;  2WXK A;  2DLB A;  4KV2 A;  2K3U A;  3NG0 A;  2FCM A;  3ZJT A;  3VRB B;  1AAR A;  4RGO S;  5G5H A;  2G4D B;  1TZ1 A;  3R3M A;  2I1K A;  5AZF A;  4NQK E;  5G5G A;  3N3K B;  2ZPN A;  4HCN B;  2MHJ A;  4ZRI A;  1FXA A;  3NZU A;  3L17 A;  1R4M I;  2NBW B;  1ZXI A;  2KJ6 A;  1EU4 A;  4G11 A;  4EZJ A;  2KT7 A;  4DHZ B;  2AL3 A;  2WX0 A;  1HEZ E;  2KWC A;  1QT9 A;  1I4Q A;  1FEH A;  2DEN B;  1KM7 A;  3I5J C;  1WE7 A;  1QOA A;  2KWU B;  5KHQ A;  3W1Y A;  3IXS A;  2W3S A;  4XWW A;  1GNU A;  3NHE B;  1EO6 A;  1K50 A;  2ZZP B;  3IBE A;  1XT9 B;  1E7P B;  2KMM A;  5IA7 A;  2DYM A;  3U30 A;  1V5T A;  3E56 A;  4ZRK A;  4OVU A;  5GXG B;  3B9J A;  2C9W B;  3RNG C;  2IO2 B;  2DHZ A;  2MX2 A;  3A1Q B;  2M56 B;  3AE6 B;  2WLB A;  4FLH A;  3KH0 A;  2CHX A;  2INC C;  4ZOH C;  4WWP A;  2J53 A;  2QJL A;  3ZRF A;  1PQS A;  1D5X C;  4LJP B;  3BIN A;  2LGS A;  2MEK A;  2LHE A;  1JQ4 A;  5CTR C;  1L5P A;  2PW9 A;  2FCQ A;  1XLP A;  2JYE A;  4ICU A;  1EF5 A;  3K9P B;  4LNN A;  3MTN B;  2L0F A;  3AUL A;  2BS2 B;  2LZ6 A;  3ETR A;  4ANV A;  2IGH A;  1WMH A;  1JRP A;  1TBE A;  3VR9 B;  1WGD A;  1KTK A;  4M8M A;  1MI0 A;  3A9K B;  5BMI A;  1WR6 E;  3ZVV A;  1WJ4 A;  1WGY A;  1H4R A;  2KX3 A;  3AE1 B;  5J17 A;  4P1C C;  4EOY A;  1B9R A;  4ANW A;  3I9V 1;  4GSW A;  1C76 A;  2RGF A;  3U8Z A;  5BYQ A;  1JRU A;  4HDQ A;  1XEE A;  4P6V F;  3HHM A;  5LXI B;  4WWM A;  1TGZ B;  4ZDV A;  2BB6 A;  3Q8A A;  4IOI E;  4IG7 B;  4TMA B;  2N4F A;  3AN1 A;  3N9Y C;  2RPV A;  5HG2 A;  1C4A A;  2EEL A;  1TKG A;  3LJ3 A;  2H88 B;  1WGG A;  3T8M A;  4AJY B;  2IO3 B;  3GE3 C;  1PGB A;  4PT5 A;  3URY A;  1TZO A;  1UH6 A;  1T3Q A;  1Y8R C;  2O2V B;  1I4X A;  3WAM A;  2KLC A;  1WZ0 A;  3WAO A;  4IWQ A;  2GB1 A;  3IAS 1;  4MSQ B;  2IND C;  1JWU D;  3A9J B;  2N7E A;  2HJ1 A;  3TUO A;  2KYW A;  2WXL A;  4US9 A;  1WRI A;  2E6X A;  4AUQ C;  2LVQ A;  4IUM B;  1V1O A;  2NTS A;  1KFY B;  1KOT A;  4XC2 A;  1TIF A;  4BBN C;  1PYW D;  1VCB A;  3P4R B;  1WY8 A;  4AP4 C;  4BZA A;  1SE3 A;  5IO9 A;  3PRE A;  1WXM A;  1R4M B;  4XX5 A;  2C5L C;  2JF5 A;  2KX0 A;  2J0J A;  2ZJD A;  4B6W A;  4RCO A;  2JZ3 B;  3TCA A;  1XF5 L;  2JWZ A;  1K51 A;  2J4X A;  3H6N A;  2JQR B;  2YVC A;  4LNF A;  2JX5 A;  4DXA B;  1TJE A;  3VH4 B;  2REX A;  2KFK B;  4LNO A;  2HTH A;  5LLI A;  4YTM B;  1IP9 A;  5E6J A;  4AOF A;  3VFK A;  4HK2 A;  2MBE A;  3IHP C;  4M01 A;  4KDL B;  2HJ8 A;  3PRM B;  1GOZ A;  2CHW A;  1NYQ A;  2I38 A;  4N9F 4;  4XWT A;  3VDZ A;  4IM2 A;  4FJZ A;  1TTN A;  2JT4 B;  1FCC C;  2JWU A;  1F52 A;  2IBI B;  3TMP B;  4MT5 A;  4EKU A;  3JSV B;  4ZYS A;  4FXC A;  2OED A;  3V61 A;  4HLE A;  3O13 A;  1OEY A;  5CHF A;  2L05 A;  3TL5 A;  1WYG A;  1AYF A;  2AQ3 B;  4WUR A;  1OQR A;  3K9O B;  3DBR B;  1WWT A;  5C23 A;  1QOB A;  3ZLZ A;  2LFI A;  1SE2 A;  2INN E;  2OJW A;  4OZA A;  5AZH A;  2BYE A;  4YT0 B;  2BT6 A;  4C00 A;  2IO1 B;  3HVD A;  4F1S A;  4RH6 A;  4ANU A;  4PYZ A;  4GU2 A;  2NBU A;  1CMX B;  2L7R A;  4HPL B;  1F77 A;  4URK A;  2I2Y A;  1BUI C;  2NBV B;  3IG3 A;  1SIF A;  2RD0 A;  2WXI A;  2A5U A;  2D2Q A;  2LEK A;  3WA0 A;  4JWU C;  2IJ0 A;  4LK0 M;  3L08 A;  2D3B A;  2NMQ A;  4R3D A;  1P7F A;  3TEW A;  4RGN A;  4US8 A;  3R8B A;  2C60 A;  3V3X A;  1KRH A;  1RFK A;  4XDC A;  2LVO A;  2LHD A;  5FR6 A;  1JRO A;  1QKZ A;  3U7D A;  3W2D A;  1E8W A;  1VJK A;  4M0W B;  1WYW B;  1N62 A;  1P7E A;  4FUL A;  4HVB A;  2LWP A;  1WMH B;  3Q3N C;  3VUY A;  4RM8 A;  1N5X A;  4JWS C;  1IUE A;  3A9K A;  4FJV B;  1L2N A;  2KMA A;  3EA6 A;  4ARI A;  1A5R A;  1SGH A;  4NAW A;  1VZ7 A;  2XBB C;  3BZD B;  3VAW A;  2MW5 A;  4HEA 1;  1JWM D;  4A9A A;  5LXH A;  5FKA C;  4K7S A;  2KVR A;  2BYV E;  1E10 A;  2BKR B;  2D07 B;  1AWD A;  3AEG B;  4HCP B;  2WHI A;  2DYO A;  3MHS D;  3T3N A;  1PUT A;  4GMV A;  3DHI C;  1WM3 A;  1H8C A;  2FNJ B;  3D32 A;  1FNU A;  3TEZ A;  2WS3 B;  4D2K A;  1D3Z A;  4USA A;  3AE2 B;  2KAJ A;  4LDT B;  1JWS D;  2C7H A;  3GE8 C;  3ZDT A;  4X57 B;  1PGX A;  1YJJ A;  5D3D A;  4LNI A;  5CHW A;  2LXA A;  2WQY B;  5G2N A;  2Z8L A;  4G0N B;  4W9L A;  3UQA A;  3RNF C;  4GDK B;  2D11 A;  3TSS A;  1WE6 A;  2WXR A;  4WQO B;  1T5X D;  2L32 A;  3I57 A;  3JYU A;  3OJ4 B;  3VTU A;  3C0R B;  1YD8 U;  1MVK A;  2D10 A;  4K1R B;  4J3O D;  2ZNV B;  5H92 C;  2PE9 A;  3PGE A;  1KLG D;  3IAM 1;  2WXO A;  4OHJ A;  1ACC A;  3EFC A;  3PZ8 A;  5IKC M;  4MDK E;  3ZQ4 A;  1UBI A;  1V80 A;  1C79 A;  3AEE B;  4XYC A;  3AE3 B;  2QSD A;  2N1W A;  1GPX A;  2CR5 A;  2O6V A;  2E3T A;  3P1M A;  3UF8 A;  3QC8 B;  2CJN A;  1HE8 A;  1EWY C;  2WDQ B;  3SEB A;  4ZRQ A;  1EF1 A;  3ZUN A;  1D5M C;  2V9H A;  1L0V B;  5D3I B;  2JVC A;  1WF9 A;  1WSP A;  4GDL A;  4Q2J A;  5AEK B;  1N61 A;  2XK5 B;  5L95 C;  2J0K A;  5LNK 1;  3KWV A;  2VZK B;  4W9H A;  5EE0 A;  4ZHP A;  3ZIM A;  3VTV A;  2KWV B;  2KAC A;  3HIZ A;  3KQ4 A;  4HWI B;  1LGR A;  4GOC A;  4IWP A;  3VR8 B;  2D3G A;  5BYS A;  2V4L A;  1DOY A;  3PHX B;  2WXM A;  2WXN A;  4M8N A;  4IDI A;  3KWL A;  4HRO A;  3P4P B;  2QHO A;  1YN3 A;  3NJT A;  4KSK C;  1F1H A;  3AMZ A;  4RGM A;  1LQB A;  1SBB B;  3M3J A;  2IY0 B;  3DVG X;  1HXY D;  2JZP A;  3UQB A;  2M1M A;  5MPO A;  1GC7 A;  3CSF A;  2G4S A;  1IGC A;  4LDT D;  2WP9 B;  1M94 A;  1RYJ A;  1JCK B;  4DDG D;  1N5W A;  1FO4 A;  1P98 A;  3PZD A;  3BK2 A;  4FN2 A;  5EE3 A;  3HM6 X;  5JHB A;  3ML9 A;  4KX6 B;  1WH3 A;  1ZW7 A;  2RDG A;  4XE0 A;  2MRP A;  5BO4 B;  3AM9 A;  4LJO B;  1P0R A;  1Q1O A;  1SF0 A;  2I1J A;  2EKI A;  2HTM E;  4MEL A;  3RI7 C;  3RZW C;  2KC1 A;  2JXX A;  4KZC A;  2CU1 A;  2CS4 A;  4W9K A;  3NUH B;  1VR9 A;  3IFW B;  2RR9 A;  3BVM A;  4WJO A;  2KWD A;  3PZ7 A;  1F9J A;  3Q2A C;  2B76 B;  1MJD A;  2JSV X;  1EUV B;  2LGD A;  1IBX B;  2K9X A;  1QOG A;  3N30 A;  3RYT A;  3C8Y A;  3U52 E;  2LVP A;  3B2F A;  5J2R A;  3CF6 E;  1GB1 A;  2KTR A;  4FBJ B;  2JYT A;  3WIM A;  1WJU A;  3P42 A;  4JQW C;  3HUI A;  1KF6 B;  5DCN A;  3HM3 A;  1WRD B;  1Z5S B;  1FNW A;  1V6E A;  1ZE3 D;  2KLG A;  2WWZ A;  2MWS B;  1ZDV A;  5JXV A;  3RD2 A;  3MC0 B;  2EMT A;  4E74 A;  1YQ4 B;  4I6N B;  2M17 A;  1FMA D;  1V5O A;  2ZPY A;  4YSZ B;  1XD3 B;  2KQ7 A;  2WDV B;  1D6E C;  3UIN B;  2QDF A;  1PFD A;  2HDE A;  1I35 A;  1HZ5 A;  2YLM A;  2L0T A;  1HA5 A;  2ZVO A;  2PIA A;  4YSX B;  4PYU A;  2KDM A;  3GB1 A;  4REZ A;  3NY5 A;  3PO0 A;  1I4G A;  1VDV A;  1HQR D;  1FIQ A;  2K8B A;  1VLB A;  2ZNV C;  3CST A;  3Q3O C;  1X1M A;  1ZP0 B;  1I4H A;  2LAS A;  1YN4 A;  1P9D U;  1ROE A;  3L4P A;  4MJS A;  3WAL A;  4N58 A;  3AI5 A;  1R4N B;  2MA9 B;  2UU7 A;  1I4P A;  2ON8 A;  3MC8 A;  2KOX A;  4K7U A;  1RAX A;  3Q6B A;  2LMC A;  4MEM A;  1TYG B;  3V60 A;  3J9C A;  2EMS A;  1ZXH A;  1R7S A;  3H9D A;  4WH4 A;  3ZXV A;  4PS7 A;  2ZCB A;  4WIP A;  1MG4 A;  2VZK D;  2M19 A;  3AU4 A;  3V6C B;  2AYO B;  3ENE A;  1V49 A;  3SDL C;  2IGG A;  4FHK A;  2SEB D;  2AEH A;  2DZJ A;  4A90 A;  5DPW A;  3P4Q B;  1SXT A;  4FJY A;  2WGS A;  5E6N A;  4KSL C;  1CK1 A;  3AED B;  1F2R I;  3ZXR A;  4EZL A;  3VXW A;  2KMC A;  1YMH E;  2V0G A;  2H89 B;  2ZVN A;  1K52 A;  4A6Q A;  4BKS A;  1QLB B;  4OW0 A;  5HFY A;  3AH7 A;  2MH7 A;  2NPT B;  4K81 A;  4N59 A;  4MGY E;  2W9N A;  3QX1 A;  5D7G A;  1CZP A;  3N32 A;  3Q8E A;  2N7D A;  1E8Z A;  2OHF A;  2Z0E B;  2BVC A;  1OQY A;  1WXS A;  1XCQ L;  2FID A;  4JE3 B;  1STE A;  2JUO A;  1FFU A;  1E7U A;  1YNT E;  2X8X X;  4MSM B;  2XN9 C;  3AV8 A;  3NVW A;  5DPT A;  3NOB A;  1ENF A;  2KFK A;  2BF8 B;  1WR1 A;  3NVV A;  4GLS C;  4A55 A;  2GLS A;  4LCD E;  2J0M A;  4MM3 A;  4JIO U;  3W1S A;  1V1P B;  3AE9 B;  3DCG A;  4QAY A;  4GGQ A;  2WXF A;  3MFG A;  2IGD A;  2PVO D;  3ZJV A;  1PGA A;  1I42 A;  1WXQ A;  4OVZ A;  5AZG A;  1T0R C;  3DVN V;  5FK9 C;  4XGA B;  1IGD A;  1OFF A;  3KLS X;  2RDH A;  1OEY J;  1TS4 A;  2NCN A;  1F2R C;  2D3A A;  4NJ6 A;  4WJN A;  3HK0 A;  3KUZ A;  4BFR A;  3VQI A;  2INP E;  1MFW A;  1L0X B;  1WZ3 A;  3M63 B;  4GN1 A;  3RMK C;  3DWG C;  1B1Z A;  4WJQ A;  3MHZ A;  4MH0 E;  1D4B A;  4IC7 B;  1E7V A;  2JPH A;  1G6J A;  2CKH B;  1TS3 A;  3SFE B;  2MJ3 A;  2OJR A;  2M4N A;  2Y5P A;  1MG8 A;  3FIL A;  2NR2 A;  3SU8 X;  1TS2 A;  2BS4 B;  5KHO A;  2V1Y A;  4YTN B;  5JZE B;  4E3C A;  2FUG 1;  2GI9 A;  2WU2 B;  3QQ8 B;  4ARC A;  3PT2 B;  3ZNI D;  3W5U B;  1WGK A;  1NEK B;  2FE8 A;  4ICV A;  1T0S C;  4G50 A;  2L52 A;  2MBH A;  2WXJ A;  4ANX A;  4K7W A;  2K25 A;  3I3T B;  2FAZ A;  1VZ6 A;  3UIP B;  2V3S A;  2KDF B;  1XCT L;  4NJ7 A;  4ITK A;  3ZTD A;  1JW9 D;  3MJ5 A;  1ISN A;  3DVG Y;  4BBN F;  4ZRP A;  2PJH A;  3X23 A;  3R66 C;  1E8X A;  1N6Z A;  4NPN A;  3JW0 X;  5GMV A;  3RNE C;  3MJW A;  4C4V B;  2D5G A;  3Q14 C;  2JXT A;  3ZKJ C;  3ZW3 A;  3Q8B A;  1WXV A;  2PE6 B;  3TEY A;  2WXG A;  1E90 A;  3Q8F A;  1T0Q C;  4HKZ E;  4TSS A;  4FHJ A;  4ACF A;  2VH1 A;  1C1Y B;  2Q5W D;  2L8J A;  2WXH A;  1T0Y A;  2RDB C;  2IZV B;  3UGB B;  2DYB A;  2AL6 A;  2ASQ A;  3PRZ A;  2Y5C A;  4DHJ B;  2JZZ A;  3QAR A;  1GB4 A;  4PS3 A;  2WU5 B;  5I4D A;  1UNS A;  3DBL I;  2O6V D;  1UWX A;  3B2G A;  1NVI D;  2ZEQ A;  1OTR B;  3TJP A;  1JML A;  2IYD B;  5IP4 D;  1RLF A;  5HKH A;  4CQN A;  3GZN I;  1Q10 A;  5DPS A;  4NZL B;  1J19 A;  2LJ5 A;  1J7A A;  1NI3 A;  4J6I A;  4RFB A;  4FAD A;  2KZR A;  2RSU A;  2LGI A;  3OLM D;  2DZM A;  1LXD A;  1GAQ B;  2KNB A;  3AE7 B;  1C4P A;  2J52 A;  2DWQ A;  3ZNG C;  2N7J A;  4GDK A;  3IT4 B;  5IN7 A;  3QK0 A;  1V8C A;  5H8Y E;  2EKE C;  2RPQ A;  3H7P A;  1TY0 A;  3PPA A;  2ZCC A;  5C2T B;  3JVZ X;  4KZ0 A;  2G45 B;  2JU6 X;  3RUL A;  1DYQ A;  1UGM A;  3AU5 A;  1NDD A;  2PEA A;  1BXT A;  3DQV A;  1L4Z B;  2GBR A;  1TS5 A;  3W1S C;  1UZX B;  4F7Z A;  2M0A A;  1VZ8 A;  4W9F A;  1FFV A;  4NJC A;  2BPS A;  3N20 C;  2NVU I;  2FUH B;  2BB5 A;  4RM9 A;  1QIL A;  2QEJ C;  3APF A;  4TQ1 A;  2A4Z A;  4W9C A;  2AX5 A;  1FNV A;  4B0E A;  4LTU A;  1NEN B;  4AJW A;  3H1U A;  1EM7 A;  4PK1 A;  4C80 A;  2ICI A;  1WGR A;  1KLV A;  2LRU A;  4KDI C;  1TT5 B;  1L7Y A;  3BK1 A;  4W9I A;  3KYC D;  2KDE B;  1WXA A;  3P4S B;  2L76 A;  1XLO A;  4WWN A;  4IKG A;  4M02 A;  3ZTC A;  1NBF C;  1ESF A;  4C7Y A;  2CJO A;  1E5W A;  3U4E G;  4ZYN A;  3AEA B;  4NNJ B;  1IPG A;  3LB8 C;  3QHT A;  4HDO A;  1YOV B;  4I6P A;  3BWU D;  2LI5 A;  3BYY B;  3VUX A;  1E9M A;  1FM0 D;  3OWE B;  3FIL B;  3W5V B;  1MHH E;  1TY2 A;  3AXC A;  5CHV C;  1V2Y A;  2ZW1 A;  5L83 A;  1LO5 D;  3JSV A;  2K6Q A;  2IPK D;  2GBJ A;  1WI0 A;  4L23 A;  3WAP A;  2BWE S;  3OAW A;  3WCQ A;  2UYZ B;  2N9K A;  2K6D B;  1N60 A;  4RF0 A;  1L6V A;  4EEW A;  4RF1 A;  3EFU A;  1WGH A;  2W3R A;  3E9S A;  2PKO A;  4KGT A;  1C77 A;  4MH8 A;  3NVZ A;  1XXG A;  2HE7 A;  4G3X B;  1YX5 B;  3TEX A;  3PRP B;  4IM0 A;  1E8Y A;  4C7Z A;  3QIJ A;  4F8C B;  2AQ2 B;  2TSS A;  2SAK A;  4JL9 A;  3RNB C;  2VH2 A;  3AE4 B;  3EGR A;  3S2A A;  3PHW B;  2C7M B;  3BII D;  3QWZ B;  2YEP B;  4PS8 A;  1N63 A;  3Q69 A;  4XDD A;  1YJI A;  2KAN A;  3NS1 A;  5C1Z A;  2R61 A;  4AQ7 A;  3PV1 A;  3L0W B;  2NTT A;  4L2Y A;  2K39 A;  3LDZ E;  3NVY A;  2DZK A;  2JRI B;  4EE2 A;  4WWO A;  1F0Z A;  1C4C A;  3GS2 A;  2BWF A;  1I4R A;  3QJZ A;  2KC2 A;  3QAQ A;  4DDI D;  2DBY A;  1KJT A;  3OJ3 A;  1T6B X;  2WXP A;  2J42 A;  1FPY A;  5TR5 A;  4B9K A;  4OVV A;  1EWC A;  3SD5 A;  1YQ3 B;  3ZO5 B;  1JWA D;  2GBK A;  1XQQ A;  3Q8C A;  4IWO A;  1OGW A;  3P2B A;  1Q5W B;  1BT0 A;  4K3B A;  1GC6 A;  2KTR B;  4KGR A;  3BYT B;  4K3C A; 
#chains in the Genus database with same CATH homology
 2LVO A;  2NPT B;  4K81 A;  4MGY E;  2KN5 A;  2W9N A;  1V86 A;  1Z2M A;  5FR6 A;  3QX1 A;  5D7G A;  1IYF A;  3U7D A;  3N32 A;  1E8W A;  3RT3 B;  3UIO B;  4M0W B;  1WYW B;  2N7D A;  1E8Z A;  4DHZ E;  2Z0E B;  1OQY A;  4E71 A;  1WXS A;  2FID A;  2K1F A;  4FUL A;  4HVB A;  5E6O A;  1YX6 B;  3SHQ A;  2JUO A;  2LWP A;  1WMH B;  4BOZ B;  3M95 A;  3VUY A;  1E7U A;  3M62 B;  4RM8 A;  1WX8 A;  4MSM B;  1RRB A;  4DWF A;  3VUW A;  1WIA A;  4EUT A;  3A9K A;  5DPT A;  3NOB A;  4FJV B;  3VVW B;  1L2N A;  2KMA A;  3ZRC A;  2LRW A;  4TKN A;  1A5R A;  3H7P B;  2KFK A;  2BF8 B;  1WR1 A;  3TBL D;  1SGH A;  4NAW A;  4GXB A;  2FCS A;  4LCD E;  2J0M A;  2XBB C;  4MM3 A;  1FXT B;  4JIO U;  3VAW A;  1J0G A;  3W1S A;  2MW5 A;  3DCG A;  3DDC B;  4GGQ A;  4BOS C;  2O2V A;  2XK5 A;  3B08 A;  1S3S G;  3VTW A;  5LXH A;  3APD A;  3NZS A;  1I42 A;  4K7S A;  1NI2 A;  2MBQ A;  2KVR A;  3A4R A;  3PVL A;  2BYV E;  5AZG A;  3DVN V;  2BKR B;  2MLB A;  2D07 B;  2FIF A;  4NQL B;  2DAJ A;  2GBM A;  2KDI A;  1OEY J;  2NCN A;  4NJ6 A;  2KK8 A;  4WJN A;  4HCP B;  3HK0 A;  5G55 A;  3KUZ A;  4BFR A;  3VQI A;  2DYO A;  3MHS D;  1WJ6 A;  4MGI E;  1WZ3 A;  3M63 B;  4GN1 A;  4GMV A;  2NPT A;  4WJQ A;  1WM3 A;  1H8C A;  2FNJ B;  3KYD D;  3D32 A;  4MH0 E;  4IC7 B;  2M8S A;  1E7V A;  1LFD A;  2JPH A;  1ZKH A;  3ZNZ B;  1LM8 B;  2CKH B;  1D3Z A;  1G6J A;  2KHW B;  4JGH B;  4KIK A;  4LDT B;  1YIW A;  2Z0D B;  4JLC A;  2C7H A;  3ZDT A;  3PS6 A;  4TUU A;  2OJR A;  2M4N A;  3H7S A;  1P3Q U;  1MG8 A;  4X57 B;  3VH3 B;  4A3O A;  2NR2 A;  2UWQ A;  3PLV A;  4GIV A;  4HXD A;  5KHO A;  3SU8 X;  2V1Y A;  5JZE B;  4EFO A;  3ML8 A;  4E3C A;  1P1A A;  3QQ8 B;  5CHW A;  2LXA A;  5G2N A;  4G0N B;  4W9L A;  2FCN A;  3UQA A;  3A4S C;  3PT2 B;  3DBH I;  4GDK B;  2D11 A;  2O6V B;  3ZNI D;  1WE6 A;  4ICV A;  1S1Q B;  4G50 A;  2MBH A;  4WQO B;  4KV2 A;  4ANX A;  3JYU A;  3OJ4 B;  4HPM B;  3VTU A;  4MGK E;  2FCM A;  4K7W A;  3C0R B;  1YD8 U;  2D10 A;  4K1R B;  2K25 A;  3I3T B;  3R7R A;  3A1Q A;  2FAZ A;  2ZNV B;  3UIP B;  1AAR A;  4TQ0 A;  2PE9 A;  3PGE A;  2IY1 B;  2V3S A;  2KDF B;  4NJ7 A;  2G4D B;  3ZTD A;  1TZ1 A;  4MDK E;  1ISN A;  1UBI A;  1V80 A;  3DVG Y;  2I1K A;  2KJR A;  2R2O A;  2VRR B;  3R3M A;  5AZF A;  4BBN F;  4NQK E;  2PJH A;  3N3K B;  3R66 C;  3X23 A;  2LUE A;  2ZPN A;  4HCN B;  1E8X A;  2N9E B;  4ZRI A;  2AWT A;  3APC A;  4NPN A;  3NZU A;  3JW0 X;  3L17 A;  1R4M I;  2NBW B;  5GMV A;  3MJW A;  2KJ6 A;  4G11 A;  2LD9 A;  2N1W A;  2CR5 A;  2O6V A;  2LXC A;  4CYE A;  4EZJ A;  1WX7 A;  1WX9 A;  3ZKJ C;  3UF8 A;  3ZW3 A;  4FA6 A;  3QC8 B;  4DHZ B;  2BKF A;  2AL3 A;  2WX0 A;  2KWC A;  1HE8 A;  5CX3 A;  3V62 A;  1WXV A;  2J7Q B;  2PE6 B;  5D6J B;  1E90 A;  2DEN B;  1KM7 A;  1WE7 A;  2KWU B;  4FHJ A;  5KHQ A;  1C1Y B;  2L8J A;  3KUD B;  2MP2 A;  1EF1 A;  3A33 B;  3ZUN A;  1T0Y A;  3W1Y A;  2MCN B;  2G3Q B;  3R7Q A;  1GNU A;  3NHE B;  3RZF A;  3GOE A;  1EO6 A;  3DOW A;  2ZZP B;  3QA8 A;  2JVC A;  1WF9 A;  2KFJ A;  1XT9 B;  2IZV B;  3IBE A;  4GDL A;  2DYB A;  3UGB B;  5AEK B;  1YJ1 A;  2AL6 A;  2ASQ A;  3PRZ A;  4DHJ B;  2JZZ A;  3QAR A;  5IA7 A;  2XK5 B;  2DYM A;  2J0K A;  5L95 C;  4CO7 A;  3KVF B;  2HD5 B;  3U30 A;  1V5T A;  4PS3 A;  4ZRK A;  4W9H A;  2KO3 A;  4OVU A;  3DBL I;  3ZIM A;  2C9W B;  2KWV B;  2IO2 B;  3VTV A;  2DHZ A;  2MX2 A;  2O6V D;  3A1Q B;  5JH5 C;  4FLH A;  3PSE B;  3KH0 A;  2CHX A;  4WWP A;  3ZRF A;  2KTF A;  2ZEQ A;  1C3T A;  1OTR B;  3HIZ A;  1PQS A;  3TJP A;  4HWI B;  4LJP B;  1UD7 A;  4GOC A;  3BIN A;  2IYD B;  3L10 B;  1RLF A;  4IWP A;  5HKH A;  2D3G A;  3GZN I;  3NS8 A;  2V4L A;  3PHX B;  4W9G A;  5DPS A;  1SE9 A;  1J19 A;  2LJ5 A;  3B1L X;  5CTR C;  4A20 A;  4M8N A;  2FCQ A;  2KJH B;  4P7I A;  4ICU A;  1EF5 A;  3K9P B;  4J6I A;  4A3P A;  4GDL B;  4FAD A;  2QHO A;  2KZR A;  2RSU A;  3MTN B;  1UBQ A;  2L0F A;  3AUL A;  3OLM D;  3Q3J A;  2LZ6 A;  2DZM A;  3DVN U;  1LXD A;  4KSK C;  4ANV A;  1LQB A;  2KNB A;  1WMH A;  3ZNH B;  1TBE A;  3M3J A;  2IY0 B;  3DVG X;  1WGD A;  3A9J A;  3ZNG C;  4GDK A;  4M8M A;  4W9E A;  4W9J A;  3A9K B;  3QK0 A;  1WR6 E;  3UQB A;  3Q3F A;  5J18 A;  2M1M A;  3ZVV A;  4W9D A;  1GC7 A;  3CSF A;  1WJ4 A;  2EKE C;  2OOB B;  2RPQ A;  1WGY A;  3H7P A;  2G4S A;  1H4R A;  2KX3 A;  4EZK A;  3PPA A;  5J17 A;  2ZCC A;  3JVZ X;  4LDT D;  4KZ0 A;  2G45 B;  4EOY A;  4ANW A;  1M94 A;  2LGY A;  3RUL A;  2CHZ A;  4GSW A;  3DBR I;  3WAN A;  1UGM A;  2RGF A;  3AU5 A;  3L16 A;  4BKT A;  3U8Z A;  3V6E B;  4DDG D;  1GG3 A;  1NDD A;  2PEA A;  3DQV A;  2GBR A;  1JRU A;  4HDQ A;  3W1S C;  1P98 A;  1UZX B;  4IM3 A;  4F7Z A;  3HHM A;  5LXI B;  1TGZ B;  3DPD A;  3PZD A;  4ZDV A;  4W9F A;  5JHA A;  4FN2 A;  2BPS A;  3EC8 A;  2MQJ A;  4IG7 B;  2NVU I;  3ECI A;  2K8H A;  2N4F A;  2FUH B;  3HM6 X;  3KW5 B;  5D2M B;  5JHB A;  1GJZ A;  3ML9 A;  1WH3 A;  2WYQ A;  1ZW7 A;  4RM9 A;  3APF A;  2MRP A;  4TQ1 A;  1GUA B;  5BO4 B;  2A4Z A;  4IW0 A;  2JRH A;  1P0R A;  4LJO B;  4HJK A;  4W9C A;  4DBG A;  1WM2 A;  3LJ3 A;  1WGG A;  3RUI B;  1Q1O A;  3T8M A;  5E6P A;  2I1J A;  4AJY B;  1UEL A;  2IO3 B;  2C7N B;  3H1U A;  4AJW A;  4MEL A;  3RZW C;  2KC1 A;  2JXX A;  2N1V A;  1WGR A;  4KZC A;  4AWJ A;  2CU1 A;  1KLV A;  4II3 B;  1ZGU B;  2CS4 A;  2MBO A;  2KD0 A;  4W9K A;  2LRU A;  1UH6 A;  4BKS D;  4KDI C;  1Y8R C;  4DHJ D;  2BGF A;  2XEW A;  2O2V B;  3WAM A;  2KLC A;  4KIK B;  1WZ0 A;  1L7Y A;  3WAO A;  4IWQ A;  2Z59 B;  2MSE D;  3IFW B;  2RR9 A;  5IAA C;  4W9I A;  4MSQ B;  4MGZ E;  4WJO A;  3KYC D;  1F9J A;  2KDE B;  1EUV B;  3A9J B;  1WXA A;  2N7E A;  2L76 A;  2LGD A;  4WWN A;  3ZTC A;  5DPR A;  1NBF C;  3N30 A;  4WAA A;  3RYT A;  4AUQ C;  2N9P C;  2IO0 B;  2LVQ A;  4IUM B;  2KKC A;  2LVP A;  5J2R A;  1E5W A;  3CF6 E;  4KVG B;  4ZYN A;  3T9L A;  5EDS A;  1KOT A;  4XC2 A;  4NNJ B;  2KTR A;  4XZ4 A;  4FBJ B;  1IPG A;  1WJN A;  2Y5B B;  2GBN A;  3QHT A;  4HDO A;  4I6L B;  3WIM A;  4BBN C;  1WJU A;  4JQW C;  4I6P A;  1VCB A;  4YL8 A;  5DCN A;  4BVU C;  2LI5 A;  3HM3 A;  1WRD B;  3BY4 B;  1Z5S B;  3L13 A;  3VHT C;  1WY8 A;  1V6E A;  2GMI C;  3EEC A;  4AP4 C;  2KLG A;  3VUX A;  2WWZ A;  2MWS B;  3PTF C;  3PRE A;  1WXM A;  3RD2 A;  4XX5 A;  2C5L C;  2EMT A;  2JF5 A;  4E74 A;  4I6N B;  2M17 A;  2KX0 A;  2PPH A;  2J0J A;  4II2 B;  1V5O A;  2ZJD A;  2ZPY A;  3X0W A;  4B6W A;  4MJS B;  2JZ3 B;  3TCA A;  1XD3 B;  2JWZ A;  2KQ7 A;  1Q0W B;  3AXC A;  2L3Z A;  5CHV C;  4ZRJ A;  1V2Y A;  3QCA A;  2WX1 A;  3UIN B;  2WDT B;  1V9J A;  3H6N A;  2YVC A;  5L83 A;  4RMA A;  2BYF A;  2KDB A;  4DXA B;  3JSV A;  3VH4 B;  2REX A;  1I35 A;  2K6Q A;  2KFK B;  2YLM A;  2HTH A;  3EHV A;  2GBJ A;  4CHK A;  4NAW B;  1U4A A;  2L0T A;  5LLI A;  2GOW A;  4TV3 A;  2ZVO A;  1WI0 A;  1IP9 A;  4AOF A;  3WAP A;  2BWE S;  4PYU A;  2LGX A;  3OAW A;  2MBE A;  3IHP C;  4HK2 A;  3VFK A;  2UYZ B;  2HJ8 A;  3NY5 A;  4KDL B;  2K6D B;  3PRM B;  1K8R B;  2CHW A;  2MBB B;  2N9X A;  3EFU A;  4EEW A;  1WGH A;  2K8B A;  2ZNV C;  3CST A;  4N9F 4;  4ASW C;  1X1M A;  2M0X A;  2LAS A;  2R2Q A;  1P9D U;  3VDZ A;  4IM2 A;  4FJZ A;  1TTN A;  4MJS A;  2HE7 A;  3PLU A;  1YX5 B;  3IVF A;  4G3X B;  2JT4 B;  3WAL A;  3B0A A;  3AI5 A;  3PRP B;  4IM0 A;  1E8Y A;  2DX5 B;  2IBI B;  2MA9 B;  4WJP A;  3TMP B;  3QIJ A;  4F8C B;  3DBS A;  4EKU A;  3JSV B;  2KOX A;  4K7U A;  4JL9 A;  2K8C A;  1RAX A;  3S2A A;  1YQB A;  3V61 A;  4HLE A;  1J8C A;  3PHW B;  1OEY A;  1V81 A;  5CHF A;  2L05 A;  3TL5 A;  2DAF A;  2C7M B;  3QWZ B;  4PS8 A;  4MEM A;  3K9O B;  4DK5 A;  3V60 A;  3ALB A;  2KAN A;  4BKG A;  2EMS A;  3ZDM C;  2KQS A;  5C1Z A;  2MP2 B;  5C23 A;  3H9D A;  3PV1 A;  3ZLZ A;  2KXJ A;  4PS7 A;  3L0W B;  1VD2 A;  1RFA A;  1QZE A;  2ZCB A;  2K39 A;  1WFY A;  3LDZ E;  2JY6 A;  3KUC B;  2DZK A;  5AZH A;  3AU4 A;  2BYE A;  3V6C B;  2JRI B;  2AYO B;  2L00 B;  3ENE A;  1V49 A;  2IO1 B;  3L54 A;  3SDL C;  4WWO A;  4F1S A;  2BWF A;  4FHK A;  4ANU A;  3QJZ A;  2KC2 A;  2AEH A;  2DZJ A;  4GU2 A;  2NBU A;  1CMX B;  3QAQ A;  4PYZ A;  2L7R A;  5DPW A;  4HPL B;  4DDI D;  4B95 A;  2B3A A;  4URK A;  4FJY A;  1KJT A;  5E6N A;  3OJ3 A;  3O65 B;  4KSL C;  1R4N I;  2NBV B;  3IG3 A;  1SIF A;  5TR5 A;  4B9K A;  2RD0 A;  2A5U A;  4OVV A;  2D2Q A;  2DZI A;  3SD5 A;  4EZL A;  3VXW A;  3WA0 A;  2KMC A;  3ZO5 B;  3TIX A;  3L08 A;  2GBK A;  1XQQ A;  2ZVN A;  3CMM B;  4IWO A;  1OGW A;  3RCZ A;  3P2B A;  1Q5W B;  4NY0 A;  4BKS A;  3ONS A;  1BT0 A;  1GC6 A;  2KTR B;  2C60 A;  4GB9 A;  5D94 A;  2NS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...