3DQVA

Structural insights into nedd8 activation of cullin-ring ligases: conformational control of conjugation
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
GSMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKIMGGSVLHLVLALRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEDD8
publication title Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 19
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dqvA00
2C7HA 3VTVA 3ZW3A 4DBGA 1XQQA 2GBJA 1BT0A 1UELA 2IY1B 4DHJD 3HK0A 4HJKA 1GC7A 3HIZA 2KQSA 4WWPA 3V61A 4MGZE 2AYOB 4K7SA 1V80A 1V86A 4BBNF 4LDTB 4HXDA 5KHOA 1Y8RC 3JSVB 1S3SG 4HDQA 1J19A 4CYEA 2KFKA 4IG7B 4J6IA 2IO1B 5D6JB 3EHVA 3GZNI 3SU8X 2K8BA 3RZFA 2GBNA 2CHXA 1IP9A 2MBHA 1E8WA 4DHJB 4TQ0A 3A9KA 1KJTA 3L13A 4MEMA 3VVWB 2KNBA 2MSED 3NS8A 1Q5WB 2KFJA 3PRZA 2LGXA 3U8ZA 1ZKHA 2N9EB 4II3B 3U30A 1OTRB 3ZDMC 2FAZA 1WY8A 2DYOA 3KVFB 2WWZA 2O2VA 4WJQA 2DZMA 3NHEB 2AL3A 1GUAB 2L7RA 4BFRA 1E8XA 4MM3A 3GOEA 3ZO5B 1YJ1A 2LD9A 2KVRA 3DVNU 3DQVA 1RFAA 1WR6E 4GDKA 1EO6A 2Z0DB 4IC7B 1VD2A 4AJYB 2GMIC 4GMVA 1KOTA 4W9HA 3A9JB 4XZ4A 2KWUB 4AP4C 3O65B 1V81A 2LVQA 2DYMA 3BY4B 3PHXB 4DXAB 3M95A 3HM6X 1WGHA 4E3CA 4WJNA 4I6PA 4MJSB 4BKSA 1D3ZA 1WGDA 3W1SA 1RAXA 1WE7A 5DPRA 3PV1A 2K39A 2BGFA 3V60A 4MGIE 2MCNB 4HVBA 2OJRA 1AARA 2EMSA 5E6PA 3WANA 3VDZA 3KH0A 2G4SA 1WM2A 2MBOA 3DBHI 3R7QA 1J8CA 2ZNVC 4AJWA 4PS3A 3WA0A 2KC2A 2KQ7A 2ZPNA 1WF9A 2O6VA 2YLMA 3PVLA 2J7QB 2KTFA 3ZIMA 4MGYE 3DOWA 3DDCB 2M8SA 2KANA 2A4ZA 2KFKB 4EEWA 3H7PA 2DENB 4PYZA 3TCAA 2C7MB 4K81A 2MP2A 4TUUA 2PJHA 2M17A 3JYUA 2D10A 4WWNA 3A9KB 3W1SC 4NY0A 2JVCA 2M0XA 3ZUNA 4EFOA 2O2VB 2WX0A 3PRMB 3ZDTA 3IVFA 2N4FA 4K1RB 3ZNGC 5E6NA 2JZ3B 5D94A 2IO3B 2ZNVB 4KZCA 2KMCA 3ZRCA 5L83A 2MW5A 2PE6B 1LXDA 1WYWB 3DBRI 3KYDD 2BKFA 4GDKB 4EZLA 1TBEA 2NCNA 2V4LA 3OJ4B 4KIKA 2JRIB 2MBQA 4FHJA 4DHZE 2BYFA 1WXVA 4ZRKA 3A1QB 3SD5A 2KK8A 3T8MA 1V2YA 1YX5B 3VAWA 2ZVOA 4W9FA 5DPTA 1VCBA 2OOBB 4W9CA 4II2B 4W9GA 3CSTA 4ZRIA 2RPQA 1NBFC 2LXAA 2GBKA 2EKEC 3MJWA 4XX5A 1EF1A 4PYUA 2KZRA 2BYVE 2MLBA 2M1MA 2HJ8A 5C1ZA 3UINB 4FA6A 5LXHA 4W9JA 3ZTCA 2GBMA 1GG3A 1C3TA 1P0RA 2Z59B 2I1JA 3EC8A 3APDA 4EUTA 1WXAA 2WX1A 4FN2A 1YX6B 4HPLB 1WM3A 2D07B 4A3PA 2RR9A 5JH5C 4DWFA 2LZ6A 1V5TA 2NPTA 3H7PB 4ANWA 1G6JA 3BINA 2DZIA 3AXCA 2FCMA 3S2AA 4TV3A 2CHWA 3OJ3A 5J17A 2RSUA 3TMPB 4NQKE 5HKHA 3SHQA 2IYDB 2N7DA 4G0NB 3TIXA 1WGYA 3B08A 4MGKE 4G3XB 3M63B 3NY5A 4GXBA 3KUZA 2J0JA 3QWZB 4B6WA 3Q3FA 5G55A 2MBEA 2G3QB 1C1YB 4HCPB 1ISNA 4N9F4 1QZEA 3OAWA 4KIKB 4E71A 3QARA 4B95A 4A20A 2CHZA 5J2RA 2JUOA 1KM7A 2J0MA 2KKCA 2LRUA 4OVUA 1WJUA 4FJVB 3K9OB 1HE8A 4LJOB 1E7UA 2MA9B 2NR2A 5IA7A 3ONSA 1L2NA 4NAWB 3A4RA 1UGMA 4YL8A 3IBEA 3ZLZA 4IWPA 4CHKA 2BWES 3QIJA 2MRPA 3QA8A 5BO4B 2DAFA 2UYZB 4NJ6A 1WR1A 4PS8A 3X0WA 2LI5A 3ZVVA 3VTUA 4IW0A 4MDKE 2KDIA 5AZHA 4E74A 3A1QA 2ZJDA 3H1UA 1K8RB 2DZKA 4IUMB 4EZJA 2CS4A 3OLMD 4K7WA 2HD5B 2KWCA 2RGFA 4M0WB 2PE9A 4WWOA 3VFKA 3NZSA 1RRBA 2NPTB 3QHTA 4JIOU 4EOYA 2EMTA 2XK5A 4I6LB 1U4AA 4ANXA 2W9NA 1NDDA 4FLHA 4IM3A 5D2MB 3VH4B 1F9JA 2N9XA 5AZFA 3VTWA 2G4DB 4ASWC 2LGYA 1P1AA 2ZZPB 2Z0EB 4NNJB 4W9DA 4BVUC 5JHAA 4FADA 3UQBA 3R66C 3L0WB 4FJZA 3ZNHB 4WAAA 4W9KA 2AEHA 2JRHA 3H7SA 3QAQA 3DPDA 4GGQA 2KJRA 2RD0A 3X23A 3UGBB 3IHPC 1CMXB 3KYCD 4P7IA 3H6NA 4ANUA 3PZDA 5E6OA 1V6EA 4K7UA 2KOXA 3ZRFA 3ENEA 4DK5A 2KX3A 2GOWA 3EFUA 1E5WA 2D3GA 2D2QA 4F1SA 2FCNA 3ECIA 4DDGD 2BYEA 2K8HA 2M4NA 2R2QA 3L17A 5DPWA 5CX3A 3V6CB 3V62A 3HHMA 4RM8A 2AL6A 2R2OA 2K25A 2L8JA 3ML8A 3WAPA 2JPHA 5AEKB 2FCQA 4ANVA 1E7VA 4MSQB 1S1QB 2DZJA 2ZVNA 2LJ5A 3CMMB 2WDTB 4KSKC 1MG8A 4GDLA 1LQBA 3SDLC 3ALBA 2NBUA 3V6EB 2Y5BB 3RYTA 1WX7A 1WE6A 2IO2B 4BOSC 1L7YA 3VUXA 3PHWB 2LVOA 2XK5B 3I3TB 3RUIB 1XD3B 2B3AA 2REXA 4NAWA 3U7DA 2MWSB 3VUWA 5DPSA 2KC1A 2PPHA 2PEAA 2MQJA 5LXIB 2DAJA 5J18A 2KDFB 2KHWB 1IPGA 1LFDA 3APFA 1ZGUB 1V9JA 3DCGA 2CU1A 3IG3A 4FJYA 3QJZA 5CTRC 3M3JA 2GBRA 1XT9B 1EF5A 4EZKA 2BPSA 2J0KA 1WGGA 2KO3A 1GJZA 4URKA 4JQWC 1WMHA 4HPMB 1WXMA 1WJNA 1YQBA 1Q1OA 3B1LX 4G11A 4DHZB 3WAMA 1R4MI 2FCSA 1R4NI 2IO0B 4IWQA 2C7NB 4F7ZA 2DX5B 3A4SC 1Z5SB 3KUCB 3ZNZB 3EECA 1LM8B 4NQLB 3UQAA 1WIAA 2YVCA 1X1MA 3A33B 4BOZB 4WJPA 4XC2A 4HDOA 2MBBB 4WJOA 1H4RA 3N30A 4FULA 2NBWB 1WX8A 1E8ZA 2K8CA 2KLCA 4BKTA 5IAAC 3M62B 4ICVA 1E90A 5C23A 3DVNV 1V5OA 2IZVB 2N1WA 3B0AA 2JZZA 3PLUA 2KDBA 2K6DB 1E8YA 2N7EA 4GDLB 4G50A 5G2NA 3CSFA 1P9DU 2C5LC 3WIMA 1SE9A 4IM0A 4HLEA 4GN1A 1NI2A 1UBIA 1WX9A 2D11A 1RLFA 1OEYJ 2VRRB 1OGWA 1IYFA 2KTRA 4HK2A 2AWTA 2LASA 4LJPB 3TJPA 4GU2A 4M8NA 4MSMB 1WZ0A 3JW0X 3RZWC 5JHBA 3NOBA 2KJ6A 4KDLB 3RCZA 3W1YA 3QCAA 1J0GA 1WFYA 3T9LA 1WXSA 2ASQA 3MTNB 3UF8A 4HCNB 1WMHB 2L0FA 3TBLD 4EKUA 2HTHA 3UIOB 1V49A 2NVUI 1YIWA 3PREA 4ZRJA 5LLIA 4TQ1A 3DVGX 1H8CA 1I42A 3AU4A 1JRUA 1SIFA 2FIDA 1GNUA 5JZEB 2K6QA 2K1FA 3DBLI 3L10B 3AULA 4AWJA 3IFWB 1EUVB 4JLCA 2LRWA 2L05A 3VUYA 3ZTDA 2N1VA 2WYQA 3PT2B 3QC8B 1WJ6A 2I1KA 2IBIB 3ZNID 4AUQC 2KMAA 2LVPA 4NPNA 1UZXB 1P3QU 4BBNC 4CO7A 1GC6A 4FBJB 3LDZE 4KDIC 2CR5A 3C0RB 5FR6A 3ZKJC 3RULA 4B9KA 1PQSA 3KUDB 1WZ3A 4M8MA 3N3KB 3LJ3A 3QX1A 2ZPYA 1WH3A 3UIPB 2C9WB 3PS6A 2LXCA 3PRPB 2CKHB 4KSLC 3RD2A 5TR5A 1TGZB 2V3SA 3PGEA 4LCDE 5CHWA 3AI5A 4I6NB 5CHVC 5EDSA 1KLVA 4WQOB 2L0TA 2LUEA 2NBVB 2KD0A 2ZEQA 3QK0A 3DBSA 5D7GA 2KTRB 4AOFA 4OVVA 4ZYNA 4DDID 3MHSD 4HWIB 4RMAA 3KW5B 2FNJB 3NZUA 2IY0B 1Q0WB 2NS5A 3DVGY 1Z2MA 2L76A 3VXWA 3R7RA 4PS7A 2JWZA 3R3MA 2DYBA 2V1YA 1WI0A 1M94A 1UD7A 2HE7A 4JL9A 5DCNA 2KWVB 4TKNA 3K9PB 2A5UA 4MH0E 4MELA 3VQIA 4W9IA 2LGDA 2G45B 2QHOA 2UWQA 2L3ZA 2XBBC 3WAOA 4BKSD 5CHFA 3JVZX 3JSVA 5L95C 2ZCBA 3TL5A 2KN5A 1I35A 2BKRB 4GB9A 2KXJA 3AU5A 4W9EA 2JXXA 2KJHB 1TTNA 3PPAA 4F8CB 3PTFC 1TZ1A 4NJ7A 4JGHB 1WJ4A 5KHQA 2JY6A 4ZDVA 2O6VD 2XEWA 4IWOA 4A3OA 3N32A 4KV2A 2JF5A 2FUHB 2KX0A 3H9DA 3WALA 1WGRA 2C60A 4BKGA 4ICUA 2DHZA 3VH3B 2FIFA 4KVGB 2BWFA 1YD8U 3L08A 1OQYA 4RM9A 3PLVA 1A5RA 1ZW7A 3CF6E 5GMVA 3A9JA 1P98A 5AZGA 1T0YA 1UBQA 2ZCCA 3HM3A 4KZ0A 2O6VB 2LWPA 4W9LA 1SGHA 2L00B 3P2BA 4FHKA 2N9PC 3PSEB 2JT4B 3RT3B 3ML9A 2KLGA 3VHTC 4MJSA 3QQ8B 4X57B 4LDTD 3L16A 3Q3JA 3APCA 2MP2B 4GOCA 4GSWA 1UH6A 4GIVA 1OEYA 3L54A 1FXTB 2MX2A 3D32A 4IM2A 2KDEB 1WRDB 2BF8B
chains in the Genus database with same CATH superfamily
1XQQA 1C76A 1XEEA 1V80A 1V86A 4HXDA 3ABVB 1Y8RC 4HDQA 2RDHA 2QEJC 5D6JB 2BW2A 3EHVA 2K8BA 2CHXA 1E8WA 3VVWB 2KNBA 2MSED 1Q5WB 1AN8A 3PRZA 1ZKHA 2N9EB 3Q8EA 2O2VA 2NTSA 1E8XA 2WLBA 4MM3A 5HHDG 4BZAA 2KVRA 1F2RC 1VD2A 4GMVA 4W9HA 3Q8CA 3A9JB 1MJDA 2LVQA 2R61A 4I6PA 1VZ8A 5BMHA 4BKSA 1D3ZA 1WGDA 5H92C 1QOFA 1TZOA 2K39A 4MGIE 1AARA 3GP7A 2EMSA 2CJNA 1F2RI 3EUB2 2MBOA 4PS3A 2KQ7A 3AE6B 3ZIMA 3DOWA 3AEEB 3DDCB 3P4RB 2KANA 4RCOA 3P1MA 3TCAA 4K81A 2N9KA 2M17A 1JRPA 3AE1B 1ESFA 1WXQA 1SIJA 1N63A 3ZUNA 3I57A 4WWMA 2O2VB 4MM3B 5E6NA 1GAQB 1ZUD2 4S17A 2L1AA 5AUIA 4FHJA 4DHZE 1WXVA 2KK8A 1V2YA 1K51A 4IDIA 4W9FA 4WIPA 1MI0A 2M1MA 5C1ZA 4UDUC 4FA6A 1C3TA 1EM7A 1B9RA 3V3XA 1YX6B 2CJOA 3TUOA 5JH5C 4DWFA 2QC8A 2WXHA 3BINA 4TV3A 3OJ3A 1AW7A 3TIXA 3NY5A 2K22A 1YN3A 5IN7A 2PLPA 5HFYA 2QIEB 2CHZA 4A20A 5J2RA 1C4AA 1F77A 1VRAB 1J7BA 2J0MA 3K9OB 3R2TA 1HE8A 4LJOB 1E7UA 1CK1A 1FFVA 1UGMA 3IBEA 3U52E 4CHKA 2BWES 3ZXVA 2DAFA 4NJ6A 3X0WA 3ZVVA 3VTUA 4MDKE 2K5PA 2BBCA 4K7WA 2RGFA 1KRHA 4M01A 2PMVA 2V0GA 1JROA 3VFKA 3NZSA 1RRBA 3QHTA 1QF6A 4A9AA 5G5HA 4I6LB 2XK5A 1J7AA 3VH4B 2WXQA 2INNE 1NENB 1DGJA 3DWGC 1F9JA 4ASWC 3HVZA 4C4VB 2LGYA 2ICIA 3E56A 1SB3C 5JHAA 4YT0B 4NZLB 3ZNHB 1FXIA 4WAAA 1XXGA 3QAQA 3EA6A 1L0XB 3UGBB 1CMXB 2ONQA 3PZDA 2L32A 5E6OA 2GI9A 4K7UA 2KOXA 3N1ZC 4MT5A 3ENEA 5D3IB 1ET6A 4RH6A 2GOWA 3EFUA 1E5WA 3WCQA 3ECIA 1K53A 4R3DA 5DPWA 4RM8A 2KT7A 3EFCA 4ANVA 3NUHB 1S1QB 2ZVNA 5T8IA 3SDLC 4N58A 2Y5BB 4RF1A 4BOSC 4OHJA 1CJEA 1C4CA 3VUXA 2XK5B 1GOZA 3RUIB 4NAWA 3RNGC 2KC1A 2PEAA 2MQJA 5LXIB 2DAJA 3APFA 3DCGA 5CTRC 1XT9B 2KO3A 2D3CA 4URKA 4JQWC 4HPMB 2QMTA 4B0MA 1WJNA 1YQBA 1UNSA 4DHZB 1R4MI 2FCSA 2PIAA 1TS3A 2IO0B 3CIRB 3AE7B 2C7NB 1HTQA 1HTOA 1LM8B 2L83A 4NQLB 4C7YA 1JCKB 1DOXA 1WX8A 1E8ZA 2K8CA 5IAAC 2V3PA 4KGSA 1KFYB 2BS3B 3B0AA 2N9LA 1L6UA 1AWDA 5G2NA 3CSFA 3WIMA 1RLFA 1OEYJ 1OGWA 2KTRA 4LTUA 2D5GA 2LUMA 1SJED 2WDVB 2KJ6A 4KDLB 1PUTA 2L52A 3NG0A 2ASQA 2JX5A 4EKUA 4ZRJA 5BMIA 4TQ1A 5D3DA 4DQOC 3EGRA 2WU2B 5JZEB 3DBLI 2IGHA 3MC9A 1EUVB 4JLCA 3VUYA 2N1VA 2WYQA 2RPVA 1WJ6A 5IOIA 2KMAA 1TKEA 2WHIA 1E0ZA 4FBJB 3LDZE 4B9KA 2CR5A 3C0RB 3RULA 1PQSA 4A6QA 4ITKA 5E6JA 1TKGA 3UIPB 5TR5A 4LCDE 2LHEA 3AI5A 5EDSA 2JZPA 2LUEA 2NBVB 1LO5D 2ZEQA 2KTRB 3N20C 3AMZA 4AOFA 1FRDA 1YN4A 4ZYNA 3MHSD 4HWIB 3KW5B 2K0PA 3NZUA 2WDRB 3LXFA 1FXAA 1Z2MA 3VXWA 3R7RA 4PS7A 1M94A 2HE7A 4JL9A 5DCNA 2KWVB 5FKAC 4HROA 3VQIA 1JW9D 4OZAA 2Z8LA 5CHFA 4LNKA 3GE3C 1D5ZC 5I4DA 5L95C 1E7PB 1F1HA 3TL5A 4ACFA 3U2SC 2KXJA 3AU5A 4W9EA 2JXXA 1EWYC 1JWMD 2WXNA 4WH4A 4NJ7A 2W54A 4JGHB 2JY6A 4ZDVA 2O6VD 2PW9A 4A3OA 1SBBB 3H9DA 1PGAA 1UGJA 2DHZA 4RGTA 3ZQ4A 1MHHE 3OWEB 1V1OA 2HDEA 1T0RC 1KF6B 1ZW7A 3CF6E 5GMVA 1A5RA 5AZGA 2ZCCA 2O6VB 2IDYA 3B2FA 3P2BA 3AM9A 3RFZB 2W55A 3RNCC 1RM6C 3ML9A 3R8BA 4X57B 3AEFB 4LDTD 3L16A 4OZCA 3RN9C 3H8HA 1UH6A 3D32A 1PYWD 3IT4B 2BS2B 3ZW3A 2GBJA 4P6VF 2IY1B 4DHJD 4ARCA 3HK0A 4YWGG 2KQSA 2MJEA 4DXGA 4LDTB 1N60A 1J19A 2KFKA 4LK0M 1T6BX 2IO1B 1IP9A 2MBHA 4DHJB 3L13A 4MEMA 5GXGB 4MACA 3ZDMC 3U30A 5BMGA 3KVFB 2DZMA 2SEBD 3NHEB 4DXFA 4BFRA 4ZHPA 5C2TB 1YJ1A 3LYYA 2OHFA 3DQVA 1QOBA 4GDKA 1EO6A 2Z0DB 1I4QA 2M19A 2KYWA 2KWUB 1V81A 2DYMA 3BY4B 3PHXB 3M95A 3HM6X 4WJNA 1OQQA 1T5XD 5DPRA 3PV1A 2MCNB 4HVBA 2OJRA 3TEYA 3VDZA 1WWTA 4AS1A 2G4SA 2PKOA 1J8CA 1BXTA 5G5GA 3W5UB 2WXJA 1WF9A 2J7QB 1N62A 4LNFA 2KFKB 2DENB 5EE1A 2C7MB 3V05A 1ACCA 1I4RA 3JYUA 2D10A 4WWNA 3BYYB 4NY0A 2JVCA 3AEDB 3IT6B 2M0XA 1CZPA 4EFOA 2RMMA 3PRMB 3IVFA 2N4FA 4K1RB 3Q8AA 1SEBD 2AQ2B 2JZ3B 3ZRCA 4KZCA 2KMCA 4HRSA 3DBRI 2WXFA 4GDKB 2NCNA 2V4LA 1FCCC 3DBRB 1EU3A 2BYFA 3SD5A 1YX5B 3BIID 3TEZA 4W9CA 4W9GA 3CSTA 3HVDA 4XX5A 2KZRA 2BYVE 3MHZA 1MPEA 2MLBA 4KKIA 3VRBB 3HUIA 3UINB 1XLNA 5LXHA 2GBMA 1SE4A 1P0RA 3EC8A 3APDA 1PFDA 1L5PA 2WU5B 4HPLB 3T3NA 4A3PA 2H89B 3N9YC 2DZIA 3S2AA 5J17A 1SE2A 3SHQA 2N7DA 2RDGA 1WGYA 3B08A 3NVWA 4EE2A 4MGKE 1F0ZA 3B9JA 3MFGA 4B6WA 3Q3FA 1UWXA 1ENFA 5G55A 1FO4A 1ISNA 1IBXA 1ZOYB 4O1NA 1YJIA 2JUOA 1NYQA 3IXSA 2LRUA 4OVUA 1WJUA 4ZOHC 4YSXB 1SE3A 2NR2A 4JPSA 3QA8A 5BO4B 2UYZB 1WR1A 4PS8A 2MJDA 3U4EG 1QLBB 3AB5A 3H1UA 2CS4A 2KWCA 2PTLA 1T3QA 1QOGA 1U4AA 4ANXA 2MH7A 2N9XA 3VTWA 1HZ5A 1P1AA 2YEPF 3Q6BA 3DHIC 4NNJB 2KMMA 4FADA 1JWUD 4W9KA 3H7SA 3DPDA 4GGQA 2JYTA 1HZ6A 3X23A 4ANUA 4P7IA 1IBXB 1TT5B 1YNTE 4RFBA 3FAHA 3ZRFA 4YSZB 1PGXA 2EKIA 2BTEA 2D3GA 2D2QA 4F1SA 1V1PA 2FCNA 2MEKA 2BYEA 3DHGC 2WS3B 2R2QA 3L17A 3HHMA 3WAPA 2JPHA 1E7VA 2DZJA 2LGIA 2DNFA 2WXMA 2WDTB 4GDLA 3RPFC 3ALBA 2NBUA 3RYTA 1WE6A 4LNNA 2I2YA 1I4PA 4XE0A 4HPPA 1XD3B 2B3AA 2JXTA 1VZ6A 2REXA 3J9CA 2FUG1 1ZDXA 1CQVA 5J18A 1K52A 4JX1C 1LFDA 3GS2A 2X38A 2GBRA 3ETRA 3BYTB 2M0AA 1K50A 1HQRD 1WXMA 1WSPA 1Q1OA 2Y5CA 3WAMA 1ZP0B 3A4SC 3ZNZB 3ZXRA 1Q10A 3UQAA 4C4VA 3RMKC 1X1MA 4BOZB 4WJPA 4XC2A 2MBBB 3N30A 3AE8B 1V1PB 1TKYA 2EELA 4ICVA 5C23A 1L0YB 2IGDA 2N1WA 2TSSA 3OG5A 2JZZA 1E8YA 4L1BA 4GDLB 4G50A 1P9DU 3Q3OC 4WURA 1NI2A 1UBIA 1IYFA 1ZPSA 2ON8A 2AWTA 2LASA 4LJPB 5JHBA 3NOBA 3AEBB 2GLSA 3W1YA 1KLGD 3IAM1 2L0FA 5C3JB 1V49A 3GE8C 3PREA 1I42A 2WXPA 3AU4A 1SIFA 4YTNB 2K6QA 4KX6B 3IFWB 2LRWA 4YXDB 3QC8B 2I1KA 3VRAB 1BUIC 3KWVA 1GC6A 3UI3A 3BWUD 4KDIC 5FR6A 3ZKJC 1N61A 2JU6X 3PS6A 2LXCA 3PRPB 2CKHB 3E9SA 3L4PA 3RD2A 1TGZB 5CHWA 5CHVC 1L6VA 1KLVA 4WQOB 1OQRA 3DBSA 5D7GA 4OVVA 4FXCA 4DDID 3N1XC 1ROEA 2FNJB 2IY0B 4US8A 1Q0WB 1E10A 4D2KA 2HTME 3T3OA 3BZDB 2V1YA 1UD7A 3P63A 2L3ZA 4RGNA 2DWQA 1TS2A 2KDMA 3JVZX 3JSVA 2ZCBA 3P4PB 4GB9A 2AQ1B 3AE4B 4F8CB 5JXVA 3AH7A 4J3OD 5KHQA 1TIFA 5BYQA 2XEWA 4IWOA 1R4MB 4KV2A 2JF5A 2W3SA 1WGRA 4KVGB 1YD8U 4OZBA 4RM9A 1YQ3B 1T0YA 1UBQA 3HM3A 4FHKA 1JALA 2KLGA 2MP2B 1OEYA 2BF8B 3VTVA 1UELA 1XF5L 1IGCA 5IKCM 1IUEA 4HJKA 1GC7A 2MHJA 4HKZE 3V61A 4MGZE 4BBNF 3JSVB 4LLGM 4TSSA 3SU8X 3NVVA 2GBNA 3P4SB 2PVGC 3W9CB 1KJTA 4C00A 2QDFA 2LGXA 3U8ZA 4II3B 1OTRB 2FAZA 1WY8A 4WJQA 2WWZA 3NS1A 3AE9B 2AL3A 1GUAB 1FPYA 3ZO5B 3DBLB 4US9A 1RFAA 2OJWA 4QAYA 2GMIC 1KOTA 4XZ4A 2WGSA 3I63C 4AP4C 3O65B 4C7ZA 4DXAB 2J4XA 4B0EA 3KWLA 4E3CA 1NYRA 4LNOA 3W1SA 3MP9A 1MVKA 1RYJA 4JWUC 5IO9A 3DBHI 1WM2A 2ZNVC 4AJWA 1ET9A 2KC2A 2V4IB 2O6VA 2YLMA 3PVLA 2CU3A 3Q14C 4MGYE 2A4ZA 3H7PA 4PYZA 4TUUA 1JWSD 3RI7C 4H2AA 2JYEA 3W1SC 2VH2A 3ZGZA 4L2YA 2BVCA 2WX0A 3ZDTA 2QSDA 3ZNGC 3RNFC 4AQ7A 2IO3B 2ZNVB 1UWMA 5BYRA 1WYWB 3KYDD 1HEZE 4KIKA 2MBQA 3A1QB 1IGDA 3T8MA 3VAWA 2ZVOA 4II2B 2LXAA 2GBKA 2EKEC 1EF1A 4PYUA 1JQ4A 1EU4A 2HJ8A 4W9JA 1GG3A 2B76B 2YEPB 4REZA 2I1JA 1QQRA 4EUTA 4FN2A 3NVYA 4RF0A 1WM3A 4M0WA 2KQ4X 2RR9A 2H88B 3H7PB 4ANWA 1G6JA 2CHWA 2DBYA 2WXOA 4HJGE 3TMPB 4NQKE 3FC4A 1FNWA 2ZW0A 1F52A 4G3XB 3M63B 2J0JA 3QWZB 2MBEA 4N6EB 2G3QB 1C1YB 4HCPB 3MC0B 1QZEA 4KIKB 4E71A 4USAA 4B95A 4TMAB 2LEKA 3U7ZA 2KKCA 4A55A 2VH1A 5IA7A 1L2NA 1TS5A 3ZLZA 3I9V1 1QILA 2GRIA 1D5MC 3ZYYX 2AQ3B 3Q3NC 5AZHA 4E74A 2DZKA 4IUMB 2HD5B 4M0WB 2MJ3A 2N7JA 4EOYA 2EMTA 3ZJTA 4FLHA 2BT6A 5AZFA 2G4DB 1L0VB 2J53A 4JE3B 1AYFA 2JRHA 1SXTA 3PZ8A 2RD0A 4S0RA 3IHPC 3KYCD 2M56B 1PGBA 4XWWA 1V6EA 1ZDVA 2RDBC 3MC8A 1C79A 4DDGD 1C9FA 2J52A 5CX3A 3V6CB 3V62A 1YJJA 3ML8A 2L8JA 4KSKC 2LJ5A 3R2IA 3V6EB 2LJIA 1WX7A 2IO2B 1N6ZA 3PHWB 1NEKB 4KKJA 3U7DA 2MWSB 5DPSA 3DWMA 2PPHA 3P42A 5EE9A 1ZGUB 3IG3A 3QJZA 3M3JA 1EF5A 2BPSA 2J0KA 1WGGA 2X8XX 1GJZA 1FNUA 1JWAD 1WMHA 4XGAB 3BVMA 2KVZA 1VZ7A 1R4NI 4ZRPA 1VJKA 4F7ZA 4CQNA 1Z5SB 3KUCB 1DOIA 2KACA 2QILA 1WIAA 2YVCA 3A33B 3PO0A 4HDOA 4XDDA 4WJOA 4FULA 2NBWB 2KLCA 1LGRA 5MPOA 1E90A 3DVNV 1WRIA 4M00A 5BYSA 2XN9C 3KQ4A 4RNAA 3GB1A 4N59A 2J42A 3PLUA 2KAJA 1T0QC 3AE3B 4ARIA 4IM0A 4HLEA 2D11A 3W5VB 4ZYSA 1STEA 4HK2A 2UU7A 4GU2A 4M8NA 4MSMB 1WZ0A 2IJ0A 3RZWC 3Q3MC 2JWUA 4L23A 4NJCA 1ZE3D 1J0GA 3MTNB 3UF8A 1WMHB 2HTHA 1H8CA 1JRUA 1GNUA 1ZXIA 4AWJA 2FE8A 3ZTDA 1UUPA 3PT2B 4C80A 1R7SA 1L4DB 4NPNA 2LVPA 3NJTA 4LNIA 1UZXB 1P3QU 4BBNC 2INCC 3TEXA 3KUDB 1WZ3A 3N3KB 3QX1A 2ZPYA 1FNVA 2JSVX 1GB4A 3AV8A 3N1YC 4KSLC 1FD6A 3ZJUA 3PGEA 2BS4B 2L0TA 2KD0A 2KN4A 3QK0A 1GB1A 1PDXA 4HKQA 1XCTL 1J7CA 1Y56A 2KWDA 2NS5A 4P1CC 2LGSA 3R3MA 2DYBA 4TKNA 2JQRB 4W9IA 5FR3A 2UWQA 2NMQA 4BKSD 3C8YA 1I35A 2BKRB 4K3CA 4P16A 2KJHB 1TTNA 1E6EB 1NI3A 1TZ1A 1C77A 2WDQB 1TY0A 1FMAD 3N32A 2KX0A 3WALA 4BKGA 4ICUA 3VH3B 2QCZA 1MFWA 1OQYA 1A70A 2Y5PA 1XO3A 1EWCA 3RNBC 2IGGA 4KZ0A 2E3TA 1SGHA 2JT4B 3RNEC 4YTPB 4MJSA 3QQ8B 2K3UA 1FM0D 3AE5B 4GSWA 1FXTB 2MX2A 4BVUC 5IP4D 2C7HA 4DBGA 1MHXA 1BT0A 1HA5A 3HIZA 1FCLA 4WWPA 2AYOB 4K7SA 5HG2A 3KLSX 3SFDB 1JMLA 5KHOA 1S3SG 4CYEA 2GB1A 2INPE 4IG7B 4J6IA 3GZNI 1V8CA 3RZFA 3Q8BA 2WXLA 3GZNB 4TQ0A 3A9KA 2WXKA 3NS8A 2KFJA 5HI1A 2VZKD 2DYOA 2W3RA 1I4GA 2L7RA 3GOEA 2LD9A 3DVNU 1WR6E 4IC7B 4AJYB 1KH0A 4RGMA 2WXRA 1DOYA 2VZKB 1VDVA 1WGHA 4K3BA 2QJLA 4MJSB 1RAXA 1WE7A 3V60A 2BGFA 5E6PA 3WANA 1JWBD 3KH0A 4OVZA 5LNK1 3R7QA 2WQYB 3WA0A 2ZPNA 4HEA1 4KGRA 2KTFA 2ACZB 1SJHD 2M8SA 4EEWA 4JWSC 3Q2AC 3AE2B 2MP2A 2BB5A 2PJHA 3A9KB 4RGOS 5D94A 5L83A 1YOVB 2MW5A 2PE6B 1MG4A 1LXDA 2BKFA 4EZLA 1TBEA 1YQ4B 3OJ4B 2JRIB 3W2DA 2WP9B 4ZRKA 4NAMA 5DPTA 1VCBA 2OOBB 4ZRIA 2RPQA 1NBFC 3MJWA 1SSNA 1I7HA 5H8YE 3ZTCA 1VR9A 4ZRQA 4M02A 2Z59B 3VR9B 3SFEB 1WXAA 3AEAB 2WX1A 2D07B 1C78A 4MH8A 3NRZA 2LZ6A 3C19A 1V5TA 2NPTA 1VLBA 3AXCA 2FCMA 3P4QB 2RSUA 5HKHA 2IYDB 1TYGB 4G0NB 1I4XA 2AX5A 3SEBA 4A8XC 3FILA 4GXBA 3KUZA 1WGKA 3FKYA 1T0SC 4N9F4 2V9HA 3OAWA 1YN5A 3QARA 1KM7A 4YSYB 1L4ZB 4FJVB 1NVID 2MA9B 3ONSA 4NAWB 1N5XA 3A4RA 4YL8A 2I38A 4IWPA 3QIJA 2MRPA 1WYGA 4BAXA 3BVGA 2LI5A 2PVOD 4IW0A 2KDIA 3A1QA 2ZJDA 1K8RB 4EZJA 3OLMD 2PE9A 1D6EC 4WWOA 2NPTB 4JIOU 1FRRA 1XLPA 2W9NA 3AECB 1NDDA 2NTTA 4IM3A 5D2MB 2INDC 1QKZA 5EE3A 4C56C 1GPXA 1D5XC 2ZZPB 3MJ5A 2Z0EB 4W9DA 3UQBA 3R66C 3L0WB 4FJZA 3FILB 1XCQL 2AEHA 2WNMA 3DBHB 2KJRA 5EE0A 3B2GA 3H6NA 3DHHC 1N5WA 3ZJVA 4DK5A 2KX3A 4YTMB 3AEGB 1M4VA 2K8HA 1I4HA 3O13A 2M4NA 2AL6A 2R2OA 2K25A 5AEKB 2FCQA 3NVZA 1V97A 4MSQB 3CMMB 4PK1A 1SF0A 1MG8A 1LQBA 4A90A 1L7YA 1FFUA 2LVOA 3I3TB 1XLQA 3VUWA 3CWIA 2SAKA 2KDFB 2KHWB 1IPGA 3URYA 1V9JA 4FJYA 2CU1A 4EZKA 4WAFA 2W82A 2D3BA 3RNAC 2LHDA 3B1LX 4G11A 1RFKA 4IWQA 2DX5B 3TEWA 3EECA 4KGTA 1FEHA 1H4RA 2BQQA 4BKTA 2WXIA 3NZ3A 3M62B 4XDCA 1V5OA 2DLBA 2IZVB 2K9XA 4ZHOA 4WQMA 3Q69A 1QOAA 2KDBA 2K6DB 2N7EA 1E9MA 2C5LC 1SE9A 4GN1A 1WX9A 4XWTA 2G1EA 2V3NA 2VRRB 1BMLC 3TJPA 4Q2JA 3BK2A 3JW0X 2G9HD 2ZW1A 3RCZA 2FBWB 2N0SB 3QCAA 5FK9C 1WFYA 3T9LA 1WXSA 1KTKA 4HCNB 3HRDD 1DYQA 3TBLD 3UIOB 2NVUI 1YIWA 5LLIA 3DVGX 2FIDA 2K1FA 3L10B 3AULA 2L05A 2IBIB 3ZNID 4AUQC 3VR8B 1TY2A 1TJEA 3TSSA 4CO7A 2IPKD 4M8MA 3LB8C 3BK1A 3LJ3A 1WH3A 3PZ7A 2C9WB 2E6XA 2V3SA 4I6NB 3Q8FA 4OW0A 1C4PA 3I5JC 2BYTA 2Y3AA 1B1ZA 1P7FA 3SR6A 4PT5A 2Q5WD 1FIQA 4RMAA 1D4BA 2XNAC 1TS4A 1YMHE 2LMCA 2OEDA 4P1BC 1UF0A 1OFFA 4XYCA 3DVGY 5AUKA 1XLOA 2HJ1A 2L76A 2JWZA 1WI0A 3K9PB 2A5UA 4MH0E 4MELA 2LGDA 5TSSA 2G45B 2QHOA 3IAS1 2XBBC 3WAOA 1HXYD 4GLSC 2KN5A 3PPAA 3PTFC 1WJ4A 1QT9A 1RWSA 3AN1A 1R4NB 2FUHB 4IKGA 2WXGA 2C60A 2FIFA 1KLUD 2BWFA 3L08A 1ZXHA 3PLVA 2D3AA 3A9JA 1P98A 4W9LA 2LWPA 2L00B 2N9PC 3PSEB 3BVZA 3RT3B 3VHTC 4IOIE 2LFIA 3Q3JA 3APCA 4GOCA 1P7EA 4GIVA 3L54A 4IM2A 2BB6A 2KDEB 1WRDB
chains in the Genus database with same CATH topology
2C7HA 3VTVA 3ZW3A 4DBGA 1XQQA 2GBJA 1BT0A 1UELA 2IY1B 4DHJD 3HK0A 4HJKA 1GC7A 3HIZA 2KQSA 4WWPA 3V61A 4MGZE 2AYOB 4K7SA 1V80A 1V86A 4BBNF 4LDTB 4HXDA 5KHOA 1Y8RC 3JSVB 1S3SG 4HDQA 1J19A 4CYEA 2KFKA 4IG7B 4J6IA 2IO1B 5D6JB 3EHVA 3GZNI 3SU8X 2K8BA 3RZFA 2GBNA 2CHXA 1IP9A 2MBHA 1E8WA 4DHJB 4TQ0A 3A9KA 1KJTA 3L13A 4MEMA 3VVWB 2KNBA 2MSED 3NS8A 1Q5WB 2KFJA 3PRZA 2LGXA 3U8ZA 1ZKHA 2N9EB 4II3B 3U30A 1OTRB 3ZDMC 2FAZA 1WY8A 2DYOA 3KVFB 2WWZA 2O2VA 4WJQA 2DZMA 3NHEB 2AL3A 1GUAB 2L7RA 4BFRA 1E8XA 4MM3A 3GOEA 3ZO5B 1YJ1A 2LD9A 2KVRA 3DVNU 3DQVA 1RFAA 1WR6E 4GDKA 1EO6A 2Z0DB 4IC7B 1VD2A 4AJYB 2GMIC 4GMVA 1KOTA 4W9HA 3A9JB 4XZ4A 2KWUB 4AP4C 3O65B 1V81A 2LVQA 2DYMA 3BY4B 3PHXB 4DXAB 3M95A 3HM6X 1WGHA 4E3CA 4WJNA 4I6PA 4MJSB 4BKSA 1D3ZA 1WGDA 3W1SA 1RAXA 1WE7A 5DPRA 3PV1A 2K39A 2BGFA 3V60A 4MGIE 2MCNB 4HVBA 2OJRA 1AARA 2EMSA 5E6PA 3WANA 3VDZA 3KH0A 2G4SA 1WM2A 2MBOA 3DBHI 3R7QA 1J8CA 2ZNVC 4AJWA 4PS3A 3WA0A 2KC2A 2KQ7A 2ZPNA 1WF9A 2O6VA 2YLMA 3PVLA 2J7QB 2KTFA 3ZIMA 4MGYE 3DOWA 3DDCB 2M8SA 2KANA 2A4ZA 2KFKB 4EEWA 3H7PA 2DENB 4PYZA 3TCAA 2C7MB 4K81A 2MP2A 4TUUA 2PJHA 2M17A 3JYUA 2D10A 4WWNA 3A9KB 3W1SC 4NY0A 2JVCA 2M0XA 3ZUNA 4EFOA 2O2VB 2WX0A 3PRMB 3ZDTA 3IVFA 2N4FA 4K1RB 3ZNGC 5E6NA 2JZ3B 5D94A 2IO3B 2ZNVB 4KZCA 2KMCA 3ZRCA 5L83A 2MW5A 2PE6B 1LXDA 1WYWB 3DBRI 3KYDD 2BKFA 4GDKB 4EZLA 1TBEA 2NCNA 2V4LA 3OJ4B 4KIKA 2JRIB 2MBQA 4FHJA 4DHZE 2BYFA 1WXVA 4ZRKA 3A1QB 3SD5A 2KK8A 3T8MA 1V2YA 1YX5B 3VAWA 2ZVOA 4W9FA 5DPTA 1VCBA 2OOBB 4W9CA 4II2B 4W9GA 3CSTA 4ZRIA 2RPQA 1NBFC 2LXAA 2GBKA 2EKEC 3MJWA 4XX5A 1EF1A 4PYUA 2KZRA 2BYVE 2MLBA 2M1MA 2HJ8A 5C1ZA 3UINB 4FA6A 5LXHA 4W9JA 3ZTCA 2GBMA 1GG3A 1C3TA 1P0RA 2Z59B 2I1JA 3EC8A 3APDA 4EUTA 1WXAA 2WX1A 4FN2A 1YX6B 4HPLB 1WM3A 2D07B 4A3PA 2RR9A 5JH5C 4DWFA 2LZ6A 1V5TA 2NPTA 3H7PB 4ANWA 1G6JA 3BINA 2DZIA 3AXCA 2FCMA 3S2AA 4TV3A 2CHWA 3OJ3A 5J17A 2RSUA 3TMPB 4NQKE 5HKHA 3SHQA 2IYDB 2N7DA 4G0NB 3TIXA 1WGYA 3B08A 4MGKE 4G3XB 3M63B 3NY5A 4GXBA 3KUZA 2J0JA 3QWZB 4B6WA 3Q3FA 5G55A 2MBEA 2G3QB 1C1YB 4HCPB 1ISNA 4N9F4 1QZEA 3OAWA 4KIKB 4E71A 3QARA 4B95A 4A20A 2CHZA 5J2RA 2JUOA 1KM7A 2J0MA 2KKCA 2LRUA 4OVUA 1WJUA 4FJVB 3K9OB 1HE8A 4LJOB 1E7UA 2MA9B 2NR2A 5IA7A 3ONSA 1L2NA 4NAWB 3A4RA 1UGMA 4YL8A 3IBEA 3ZLZA 4IWPA 4CHKA 2BWES 3QIJA 2MRPA 3QA8A 5BO4B 2DAFA 2UYZB 4NJ6A 1WR1A 4PS8A 3X0WA 2LI5A 3ZVVA 3VTUA 4IW0A 4MDKE 2KDIA 5AZHA 4E74A 3A1QA 2ZJDA 3H1UA 1K8RB 2DZKA 4IUMB 4EZJA 2CS4A 3OLMD 4K7WA 2HD5B 2KWCA 2RGFA 4M0WB 2PE9A 4WWOA 3VFKA 3NZSA 1RRBA 2NPTB 3QHTA 4JIOU 4EOYA 2EMTA 2XK5A 4I6LB 1U4AA 4ANXA 2W9NA 1NDDA 4FLHA 4IM3A 5D2MB 3VH4B 1F9JA 2N9XA 5AZFA 3VTWA 2G4DB 4ASWC 2LGYA 1P1AA 2ZZPB 2Z0EB 4NNJB 4W9DA 4BVUC 5JHAA 4FADA 3UQBA 3R66C 3L0WB 4FJZA 3ZNHB 4WAAA 4W9KA 2AEHA 2JRHA 3H7SA 3QAQA 3DPDA 4GGQA 2KJRA 2RD0A 3X23A 3UGBB 3IHPC 1CMXB 3KYCD 4P7IA 3H6NA 4ANUA 3PZDA 5E6OA 1V6EA 4K7UA 2KOXA 3ZRFA 3ENEA 4DK5A 2KX3A 2GOWA 3EFUA 1E5WA 2D3GA 2D2QA 4F1SA 2FCNA 3ECIA 4DDGD 2BYEA 2K8HA 2M4NA 2R2QA 3L17A 5DPWA 5CX3A 3V6CB 3V62A 3HHMA 4RM8A 2AL6A 2R2OA 2K25A 2L8JA 3ML8A 3WAPA 2JPHA 5AEKB 2FCQA 4ANVA 1E7VA 4MSQB 1S1QB 2DZJA 2ZVNA 2LJ5A 3CMMB 2WDTB 4KSKC 1MG8A 4GDLA 1LQBA 3SDLC 3ALBA 2NBUA 3V6EB 2Y5BB 3RYTA 1WX7A 1WE6A 2IO2B 4BOSC 1L7YA 3VUXA 3PHWB 2LVOA 2XK5B 3I3TB 3RUIB 1XD3B 2B3AA 2REXA 4NAWA 3U7DA 2MWSB 3VUWA 5DPSA 2KC1A 2PPHA 2PEAA 2MQJA 5LXIB 2DAJA 5J18A 2KDFB 2KHWB 1IPGA 1LFDA 3APFA 1ZGUB 1V9JA 3DCGA 2CU1A 3IG3A 4FJYA 3QJZA 5CTRC 3M3JA 2GBRA 1XT9B 1EF5A 4EZKA 2BPSA 2J0KA 1WGGA 2KO3A 1GJZA 4URKA 4JQWC 1WMHA 4HPMB 1WXMA 1WJNA 1YQBA 1Q1OA 3B1LX 4G11A 4DHZB 3WAMA 1R4MI 2FCSA 1R4NI 2IO0B 4IWQA 2C7NB 4F7ZA 2DX5B 3A4SC 1Z5SB 3KUCB 3ZNZB 3EECA 1LM8B 4NQLB 3UQAA 1WIAA 2YVCA 1X1MA 3A33B 4BOZB 4WJPA 4XC2A 4HDOA 2MBBB 4WJOA 1H4RA 3N30A 4FULA 2NBWB 1WX8A 1E8ZA 2K8CA 2KLCA 4BKTA 5IAAC 3M62B 4ICVA 1E90A 5C23A 3DVNV 1V5OA 2IZVB 2N1WA 3B0AA 2JZZA 3PLUA 2KDBA 2K6DB 1E8YA 2N7EA 4GDLB 4G50A 5G2NA 3CSFA 1P9DU 2C5LC 3WIMA 1SE9A 4IM0A 4HLEA 4GN1A 1NI2A 1UBIA 1WX9A 2D11A 1RLFA 1OEYJ 2VRRB 1OGWA 1IYFA 2KTRA 4HK2A 2AWTA 2LASA 4LJPB 3TJPA 4GU2A 4M8NA 4MSMB 1WZ0A 3JW0X 3RZWC 5JHBA 3NOBA 2KJ6A 4KDLB 3RCZA 3W1YA 3QCAA 1J0GA 1WFYA 3T9LA 1WXSA 2ASQA 3MTNB 3UF8A 4HCNB 1WMHB 2L0FA 3TBLD 4EKUA 2HTHA 3UIOB 1V49A 2NVUI 1YIWA 3PREA 4ZRJA 5LLIA 4TQ1A 3DVGX 1H8CA 1I42A 3AU4A 1JRUA 1SIFA 2FIDA 1GNUA 5JZEB 2K6QA 2K1FA 3DBLI 3L10B 3AULA 4AWJA 3IFWB 1EUVB 4JLCA 2LRWA 2L05A 3VUYA 3ZTDA 2N1VA 2WYQA 3PT2B 3QC8B 1WJ6A 2I1KA 2IBIB 3ZNID 4AUQC 2KMAA 2LVPA 4NPNA 1UZXB 1P3QU 4BBNC 4CO7A 1GC6A 4FBJB 3LDZE 4KDIC 2CR5A 3C0RB 5FR6A 3ZKJC 3RULA 4B9KA 1PQSA 3KUDB 1WZ3A 4M8MA 3N3KB 3LJ3A 3QX1A 2ZPYA 1WH3A 3UIPB 2C9WB 3PS6A 2LXCA 3PRPB 2CKHB 4KSLC 3RD2A 5TR5A 1TGZB 2V3SA 3PGEA 4LCDE 5CHWA 3AI5A 4I6NB 5CHVC 5EDSA 1KLVA 4WQOB 2L0TA 2LUEA 2NBVB 2KD0A 2ZEQA 3QK0A 3DBSA 5D7GA 2KTRB 4AOFA 4OVVA 4ZYNA 4DDID 3MHSD 4HWIB 4RMAA 3KW5B 2FNJB 3NZUA 2IY0B 1Q0WB 2NS5A 3DVGY 1Z2MA 2L76A 3VXWA 3R7RA 4PS7A 2JWZA 3R3MA 2DYBA 2V1YA 1WI0A 1M94A 1UD7A 2HE7A 4JL9A 5DCNA 2KWVB 4TKNA 3K9PB 2A5UA 4MH0E 4MELA 3VQIA 4W9IA 2LGDA 2G45B 2QHOA 2UWQA 2L3ZA 2XBBC 3WAOA 4BKSD 5CHFA 3JVZX 3JSVA 5L95C 2ZCBA 3TL5A 2KN5A 1I35A 2BKRB 4GB9A 2KXJA 3AU5A 4W9EA 2JXXA 2KJHB 1TTNA 3PPAA 4F8CB 3PTFC 1TZ1A 4NJ7A 4JGHB 1WJ4A 5KHQA 2JY6A 4ZDVA 2O6VD 2XEWA 4IWOA 4A3OA 3N32A 4KV2A 2JF5A 2FUHB 2KX0A 3H9DA 3WALA 1WGRA 2C60A 4BKGA 4ICUA 2DHZA 3VH3B 2FIFA 4KVGB 2BWFA 1YD8U 3L08A 1OQYA 4RM9A 3PLVA 1A5RA 1ZW7A 3CF6E 5GMVA 3A9JA 1P98A 5AZGA 1T0YA 1UBQA 2ZCCA 3HM3A 4KZ0A 2O6VB 2LWPA 4W9LA 1SGHA 2L00B 3P2BA 4FHKA 2N9PC 3PSEB 2JT4B 3RT3B 3ML9A 2KLGA 3VHTC 4MJSA 3QQ8B 4X57B 4LDTD 3L16A 3Q3JA 3APCA 2MP2B 4GOCA 4GSWA 1UH6A 4GIVA 1OEYA 3L54A 1FXTB 2MX2A 3D32A 4IM2A 2KDEB 1WRDB 2BF8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C7H A;  3VTV A;  3ZW3 A;  4DBG A;  1XQQ A;  2GBJ A;  1BT0 A;  1UEL A;  2IY1 B;  4DHJ D;  3HK0 A;  4HJK A;  1GC7 A;  3HIZ A;  2KQS A;  4WWP A;  3V61 A;  4MGZ E;  2AYO B;  4K7S A;  1V80 A;  1V86 A;  4BBN F;  4LDT B;  4HXD A;  5KHO A;  1Y8R C;  3JSV B;  1S3S G;  4HDQ A;  1J19 A;  4CYE A;  2KFK A;  4IG7 B;  4J6I A;  2IO1 B;  5D6J B;  3EHV A;  3GZN I;  3SU8 X;  2K8B A;  3RZF A;  2GBN A;  2CHX A;  1IP9 A;  2MBH A;  1E8W A;  4DHJ B;  4TQ0 A;  3A9K A;  1KJT A;  3L13 A;  4MEM A;  3VVW B;  2KNB A;  2MSE D;  3NS8 A;  1Q5W B;  2KFJ A;  3PRZ A;  2LGX A;  3U8Z A;  1ZKH A;  2N9E B;  4II3 B;  3U30 A;  1OTR B;  3ZDM C;  2FAZ A;  1WY8 A;  2DYO A;  3KVF B;  2WWZ A;  2O2V A;  4WJQ A;  2DZM A;  3NHE B;  2AL3 A;  1GUA B;  2L7R A;  4BFR A;  1E8X A;  4MM3 A;  3GOE A;  3ZO5 B;  1YJ1 A;  2LD9 A;  2KVR A;  3DVN U;  3DQV A;  1RFA A;  1WR6 E;  4GDK A;  1EO6 A;  2Z0D B;  4IC7 B;  1VD2 A;  4AJY B;  2GMI C;  4GMV A;  1KOT A;  4W9H A;  3A9J B;  4XZ4 A;  2KWU B;  4AP4 C;  3O65 B;  1V81 A;  2LVQ A;  2DYM A;  3BY4 B;  3PHX B;  4DXA B;  3M95 A;  3HM6 X;  1WGH A;  4E3C A;  4WJN A;  4I6P A;  4MJS B;  4BKS A;  1D3Z A;  1WGD A;  3W1S A;  1RAX A;  1WE7 A;  5DPR A;  3PV1 A;  2K39 A;  2BGF A;  3V60 A;  4MGI E;  2MCN B;  4HVB A;  2OJR A;  1AAR A;  2EMS A;  5E6P A;  3WAN A;  3VDZ A;  3KH0 A;  2G4S A;  1WM2 A;  2MBO A;  3DBH I;  3R7Q A;  1J8C A;  2ZNV C;  4AJW A;  4PS3 A;  3WA0 A;  2KC2 A;  2KQ7 A;  2ZPN A;  1WF9 A;  2O6V A;  2YLM A;  3PVL A;  2J7Q B;  2KTF A;  3ZIM A;  4MGY E;  3DOW A;  3DDC B;  2M8S A;  2KAN A;  2A4Z A;  2KFK B;  4EEW A;  3H7P A;  2DEN B;  4PYZ A;  3TCA A;  2C7M B;  4K81 A;  2MP2 A;  4TUU A;  2PJH A;  2M17 A;  3JYU A;  2D10 A;  4WWN A;  3A9K B;  3W1S C;  4NY0 A;  2JVC A;  2M0X A;  3ZUN A;  4EFO A;  2O2V B;  2WX0 A;  3PRM B;  3ZDT A;  3IVF A;  2N4F A;  4K1R B;  3ZNG C;  5E6N A;  2JZ3 B;  5D94 A;  2IO3 B;  2ZNV B;  4KZC A;  2KMC A;  3ZRC A;  5L83 A;  2MW5 A;  2PE6 B;  1LXD A;  1WYW B;  3DBR I;  3KYD D;  2BKF A;  4GDK B;  4EZL A;  1TBE A;  2NCN A;  2V4L A;  3OJ4 B;  4KIK A;  2JRI B;  2MBQ A;  4FHJ A;  4DHZ E;  2BYF A;  1WXV A;  4ZRK A;  3A1Q B;  3SD5 A;  2KK8 A;  3T8M A;  1V2Y A;  1YX5 B;  3VAW A;  2ZVO A;  4W9F A;  5DPT A;  1VCB A;  2OOB B;  4W9C A;  4II2 B;  4W9G A;  3CST A;  4ZRI A;  2RPQ A;  1NBF C;  2LXA A;  2GBK A;  2EKE C;  3MJW A;  4XX5 A;  1EF1 A;  4PYU A;  2KZR A;  2BYV E;  2MLB A;  2M1M A;  2HJ8 A;  5C1Z A;  3UIN B;  4FA6 A;  5LXH A;  4W9J A;  3ZTC A;  2GBM A;  1GG3 A;  1C3T A;  1P0R A;  2Z59 B;  2I1J A;  3EC8 A;  3APD A;  4EUT A;  1WXA A;  2WX1 A;  4FN2 A;  1YX6 B;  4HPL B;  1WM3 A;  2D07 B;  4A3P A;  2RR9 A;  5JH5 C;  4DWF A;  2LZ6 A;  1V5T A;  2NPT A;  3H7P B;  4ANW A;  1G6J A;  3BIN A;  2DZI A;  3AXC A;  2FCM A;  3S2A A;  4TV3 A;  2CHW A;  3OJ3 A;  5J17 A;  2RSU A;  3TMP B;  4NQK E;  5HKH A;  3SHQ A;  2IYD B;  2N7D A;  4G0N B;  3TIX A;  1WGY A;  3B08 A;  4MGK E;  4G3X B;  3M63 B;  3NY5 A;  4GXB A;  3KUZ A;  2J0J A;  3QWZ B;  4B6W A;  3Q3F A;  5G55 A;  2MBE A;  2G3Q B;  1C1Y B;  4HCP B;  1ISN A;  4N9F 4;  1QZE A;  3OAW A;  4KIK B;  4E71 A;  3QAR A;  4B95 A;  4A20 A;  2CHZ A;  5J2R A;  2JUO A;  1KM7 A;  2J0M A;  2KKC A;  2LRU A;  4OVU A;  1WJU A;  4FJV B;  3K9O B;  1HE8 A;  4LJO B;  1E7U A;  2MA9 B;  2NR2 A;  5IA7 A;  3ONS A;  1L2N A;  4NAW B;  3A4R A;  1UGM A;  4YL8 A;  3IBE A;  3ZLZ A;  4IWP A;  4CHK A;  2BWE S;  3QIJ A;  2MRP A;  3QA8 A;  5BO4 B;  2DAF A;  2UYZ B;  4NJ6 A;  1WR1 A;  4PS8 A;  3X0W A;  2LI5 A;  3ZVV A;  3VTU A;  4IW0 A;  4MDK E;  2KDI A;  5AZH A;  4E74 A;  3A1Q A;  2ZJD A;  3H1U A;  1K8R B;  2DZK A;  4IUM B;  4EZJ A;  2CS4 A;  3OLM D;  4K7W A;  2HD5 B;  2KWC A;  2RGF A;  4M0W B;  2PE9 A;  4WWO A;  3VFK A;  3NZS A;  1RRB A;  2NPT B;  3QHT A;  4JIO U;  4EOY A;  2EMT A;  2XK5 A;  4I6L B;  1U4A A;  4ANX A;  2W9N A;  1NDD A;  4FLH A;  4IM3 A;  5D2M B;  3VH4 B;  1F9J A;  2N9X A;  5AZF A;  3VTW A;  2G4D B;  4ASW C;  2LGY A;  1P1A A;  2ZZP B;  2Z0E B;  4NNJ B;  4W9D A;  4BVU C;  5JHA A;  4FAD A;  3UQB A;  3R66 C;  3L0W B;  4FJZ A;  3ZNH B;  4WAA A;  4W9K A;  2AEH A;  2JRH A;  3H7S A;  3QAQ A;  3DPD A;  4GGQ A;  2KJR A;  2RD0 A;  3X23 A;  3UGB B;  3IHP C;  1CMX B;  3KYC D;  4P7I A;  3H6N A;  4ANU A;  3PZD A;  5E6O A;  1V6E A;  4K7U A;  2KOX A;  3ZRF A;  3ENE A;  4DK5 A;  2KX3 A;  2GOW A;  3EFU A;  1E5W A;  2D3G A;  2D2Q A;  4F1S A;  2FCN A;  3ECI A;  4DDG D;  2BYE A;  2K8H A;  2M4N A;  2R2Q A;  3L17 A;  5DPW A;  5CX3 A;  3V6C B;  3V62 A;  3HHM A;  4RM8 A;  2AL6 A;  2R2O A;  2K25 A;  2L8J A;  3ML8 A;  3WAP A;  2JPH A;  5AEK B;  2FCQ A;  4ANV A;  1E7V A;  4MSQ B;  1S1Q B;  2DZJ A;  2ZVN A;  2LJ5 A;  3CMM B;  2WDT B;  4KSK C;  1MG8 A;  4GDL A;  1LQB A;  3SDL C;  3ALB A;  2NBU A;  3V6E B;  2Y5B B;  3RYT A;  1WX7 A;  1WE6 A;  2IO2 B;  4BOS C;  1L7Y A;  3VUX A;  3PHW B;  2LVO A;  2XK5 B;  3I3T B;  3RUI B;  1XD3 B;  2B3A A;  2REX A;  4NAW A;  3U7D A;  2MWS B;  3VUW A;  5DPS A;  2KC1 A;  2PPH A;  2PEA A;  2MQJ A;  5LXI B;  2DAJ A;  5J18 A;  2KDF B;  2KHW B;  1IPG A;  1LFD A;  3APF A;  1ZGU B;  1V9J A;  3DCG A;  2CU1 A;  3IG3 A;  4FJY A;  3QJZ A;  5CTR C;  3M3J A;  2GBR A;  1XT9 B;  1EF5 A;  4EZK A;  2BPS A;  2J0K A;  1WGG A;  2KO3 A;  1GJZ A;  4URK A;  4JQW C;  1WMH A;  4HPM B;  1WXM A;  1WJN A;  1YQB A;  1Q1O A;  3B1L X;  4G11 A;  4DHZ B;  3WAM A;  1R4M I;  2FCS A;  1R4N I;  2IO0 B;  4IWQ A;  2C7N B;  4F7Z A;  2DX5 B;  3A4S C;  1Z5S B;  3KUC B;  3ZNZ B;  3EEC A;  1LM8 B;  4NQL B;  3UQA A;  1WIA A;  2YVC A;  1X1M A;  3A33 B;  4BOZ B;  4WJP A;  4XC2 A;  4HDO A;  2MBB B;  4WJO A;  1H4R A;  3N30 A;  4FUL A;  2NBW B;  1WX8 A;  1E8Z A;  2K8C A;  2KLC A;  4BKT A;  5IAA C;  3M62 B;  4ICV A;  1E90 A;  5C23 A;  3DVN V;  1V5O A;  2IZV B;  2N1W A;  3B0A A;  2JZZ A;  3PLU A;  2KDB A;  2K6D B;  1E8Y A;  2N7E A;  4GDL B;  4G50 A;  5G2N A;  3CSF A;  1P9D U;  2C5L C;  3WIM A;  1SE9 A;  4IM0 A;  4HLE A;  4GN1 A;  1NI2 A;  1UBI A;  1WX9 A;  2D11 A;  1RLF A;  1OEY J;  2VRR B;  1OGW A;  1IYF A;  2KTR A;  4HK2 A;  2AWT A;  2LAS A;  4LJP B;  3TJP A;  4GU2 A;  4M8N A;  4MSM B;  1WZ0 A;  3JW0 X;  3RZW C;  5JHB A;  3NOB A;  2KJ6 A;  4KDL B;  3RCZ A;  3W1Y A;  3QCA A;  1J0G A;  1WFY A;  3T9L A;  1WXS A;  2ASQ A;  3MTN B;  3UF8 A;  4HCN B;  1WMH B;  2L0F A;  3TBL D;  4EKU A;  2HTH A;  3UIO B;  1V49 A;  2NVU I;  1YIW A;  3PRE A;  4ZRJ A;  5LLI A;  4TQ1 A;  3DVG X;  1H8C A;  1I42 A;  3AU4 A;  1JRU A;  1SIF A;  2FID A;  1GNU A;  5JZE B;  2K6Q A;  2K1F A;  3DBL I;  3L10 B;  3AUL A;  4AWJ A;  3IFW B;  1EUV B;  4JLC A;  2LRW A;  2L05 A;  3VUY A;  3ZTD A;  2N1V A;  2WYQ A;  3PT2 B;  3QC8 B;  1WJ6 A;  2I1K A;  2IBI B;  3ZNI D;  4AUQ C;  2KMA A;  2LVP A;  4NPN A;  1UZX B;  1P3Q U;  4BBN C;  4CO7 A;  1GC6 A;  4FBJ B;  3LDZ E;  4KDI C;  2CR5 A;  3C0R B;  5FR6 A;  3ZKJ C;  3RUL A;  4B9K A;  1PQS A;  3KUD B;  1WZ3 A;  4M8M A;  3N3K B;  3LJ3 A;  3QX1 A;  2ZPY A;  1WH3 A;  3UIP B;  2C9W B;  3PS6 A;  2LXC A;  3PRP B;  2CKH B;  4KSL C;  3RD2 A;  5TR5 A;  1TGZ B;  2V3S A;  3PGE A;  4LCD E;  5CHW A;  3AI5 A;  4I6N B;  5CHV C;  5EDS A;  1KLV A;  4WQO B;  2L0T A;  2LUE A;  2NBV B;  2KD0 A;  2ZEQ A;  3QK0 A;  3DBS A;  5D7G A;  2KTR B;  4AOF A;  4OVV A;  4ZYN A;  4DDI D;  3MHS D;  4HWI B;  4RMA A;  3KW5 B;  2FNJ B;  3NZU A;  2IY0 B;  1Q0W B;  2NS5 A;  3DVG Y;  1Z2M A;  2L76 A;  3VXW A;  3R7R A;  4PS7 A;  2JWZ A;  3R3M A;  2DYB A;  2V1Y A;  1WI0 A;  1M94 A;  1UD7 A;  2HE7 A;  4JL9 A;  5DCN A;  2KWV B;  4TKN A;  3K9P B;  2A5U A;  4MH0 E;  4MEL A;  3VQI A;  4W9I A;  2LGD A;  2G45 B;  2QHO A;  2UWQ A;  2L3Z A;  2XBB C;  3WAO A;  4BKS D;  5CHF A;  3JVZ X;  3JSV A;  5L95 C;  2ZCB A;  3TL5 A;  2KN5 A;  1I35 A;  2BKR B;  4GB9 A;  2KXJ A;  3AU5 A;  4W9E A;  2JXX A;  2KJH B;  1TTN A;  3PPA A;  4F8C B;  3PTF C;  1TZ1 A;  4NJ7 A;  4JGH B;  1WJ4 A;  5KHQ A;  2JY6 A;  4ZDV A;  2O6V D;  2XEW A;  4IWO A;  4A3O A;  3N32 A;  4KV2 A;  2JF5 A;  2FUH B;  2KX0 A;  3H9D A;  3WAL A;  1WGR A;  2C60 A;  4BKG A;  4ICU A;  2DHZ A;  3VH3 B;  2FIF A;  4KVG B;  2BWF A;  1YD8 U;  3L08 A;  1OQY A;  4RM9 A;  3PLV A;  1A5R A;  1ZW7 A;  3CF6 E;  5GMV A;  3A9J A;  1P98 A;  5AZG A;  1T0Y A;  1UBQ A;  2ZCC A;  3HM3 A;  4KZ0 A;  2O6V B;  2LWP A;  4W9L A;  1SGH A;  2L00 B;  3P2B A;  4FHK A;  2N9P C;  3PSE B;  2JT4 B;  3RT3 B;  3ML9 A;  2KLG A;  3VHT C;  4MJS A;  3QQ8 B;  4X57 B;  4LDT D;  3L16 A;  3Q3J A;  3APC A;  2MP2 B;  4GOC A;  4GSW A;  1UH6 A;  4GIV A;  1OEY A;  3L54 A;  1FXT B;  2MX2 A;  3D32 A;  4IM2 A;  2KDE B;  1WRD B;  2BF8 B; 
#chains in the Genus database with same CATH topology
 1XQQ A;  1C76 A;  1XEE A;  1V80 A;  1V86 A;  4HXD A;  3ABV B;  1Y8R C;  4HDQ A;  2RDH A;  2QEJ C;  5D6J B;  2BW2 A;  3EHV A;  2K8B A;  2CHX A;  1E8W A;  3VVW B;  2KNB A;  2MSE D;  1Q5W B;  1AN8 A;  3PRZ A;  1ZKH A;  2N9E B;  3Q8E A;  2O2V A;  2NTS A;  1E8X A;  2WLB A;  4MM3 A;  5HHD G;  4BZA A;  2KVR A;  1F2R C;  1VD2 A;  4GMV A;  4W9H A;  3Q8C A;  3A9J B;  1MJD A;  2LVQ A;  2R61 A;  4I6P A;  1VZ8 A;  5BMH A;  4BKS A;  1D3Z A;  1WGD A;  5H92 C;  1QOF A;  1TZO A;  2K39 A;  4MGI E;  1AAR A;  3GP7 A;  2EMS A;  2CJN A;  1F2R I;  3EUB 2;  2MBO A;  4PS3 A;  2KQ7 A;  3AE6 B;  3ZIM A;  3DOW A;  3AEE B;  3DDC B;  3P4R B;  2KAN A;  4RCO A;  3P1M A;  3TCA A;  4K81 A;  2N9K A;  2M17 A;  1JRP A;  3AE1 B;  1ESF A;  1WXQ A;  1SIJ A;  1N63 A;  3ZUN A;  3I57 A;  4WWM A;  2O2V B;  4MM3 B;  5E6N A;  1GAQ B;  1ZUD 2;  4S17 A;  2L1A A;  5AUI A;  4FHJ A;  4DHZ E;  1WXV A;  2KK8 A;  1V2Y A;  1K51 A;  4IDI A;  4W9F A;  4WIP A;  1MI0 A;  2M1M A;  5C1Z A;  4UDU C;  4FA6 A;  1C3T A;  1EM7 A;  1B9R A;  3V3X A;  1YX6 B;  2CJO A;  3TUO A;  5JH5 C;  4DWF A;  2QC8 A;  2WXH A;  3BIN A;  4TV3 A;  3OJ3 A;  1AW7 A;  3TIX A;  3NY5 A;  2K22 A;  1YN3 A;  5IN7 A;  2PLP A;  5HFY A;  2QIE B;  2CHZ A;  4A20 A;  5J2R A;  1C4A A;  1F77 A;  1VRA B;  1J7B A;  2J0M A;  3K9O B;  3R2T A;  1HE8 A;  4LJO B;  1E7U A;  1CK1 A;  1FFV A;  1UGM A;  3IBE A;  3U52 E;  4CHK A;  2BWE S;  3ZXV A;  2DAF A;  4NJ6 A;  3X0W A;  3ZVV A;  3VTU A;  4MDK E;  2K5P A;  2BBC A;  4K7W A;  2RGF A;  1KRH A;  4M01 A;  2PMV A;  2V0G A;  1JRO A;  3VFK A;  3NZS A;  1RRB A;  3QHT A;  1QF6 A;  4A9A A;  5G5H A;  4I6L B;  2XK5 A;  1J7A A;  3VH4 B;  2WXQ A;  2INN E;  1NEN B;  1DGJ A;  3DWG C;  1F9J A;  4ASW C;  3HVZ A;  4C4V B;  2LGY A;  2ICI A;  3E56 A;  1SB3 C;  5JHA A;  4YT0 B;  4NZL B;  3ZNH B;  1FXI A;  4WAA A;  1XXG A;  3QAQ A;  3EA6 A;  1L0X B;  3UGB B;  1CMX B;  2ONQ A;  3PZD A;  2L32 A;  5E6O A;  2GI9 A;  4K7U A;  2KOX A;  3N1Z C;  4MT5 A;  3ENE A;  5D3I B;  1ET6 A;  4RH6 A;  2GOW A;  3EFU A;  1E5W A;  3WCQ A;  3ECI A;  1K53 A;  4R3D A;  5DPW A;  4RM8 A;  2KT7 A;  3EFC A;  4ANV A;  3NUH B;  1S1Q B;  2ZVN A;  5T8I A;  3SDL C;  4N58 A;  2Y5B B;  4RF1 A;  4BOS C;  4OHJ A;  1CJE A;  1C4C A;  3VUX A;  2XK5 B;  1GOZ A;  3RUI B;  4NAW A;  3RNG C;  2KC1 A;  2PEA A;  2MQJ A;  5LXI B;  2DAJ A;  3APF A;  3DCG A;  5CTR C;  1XT9 B;  2KO3 A;  2D3C A;  4URK A;  4JQW C;  4HPM B;  2QMT A;  4B0M A;  1WJN A;  1YQB A;  1UNS A;  4DHZ B;  1R4M I;  2FCS A;  2PIA A;  1TS3 A;  2IO0 B;  3CIR B;  3AE7 B;  2C7N B;  1HTQ A;  1HTO A;  1LM8 B;  2L83 A;  4NQL B;  4C7Y A;  1JCK B;  1DOX A;  1WX8 A;  1E8Z A;  2K8C A;  5IAA C;  2V3P A;  4KGS A;  1KFY B;  2BS3 B;  3B0A A;  2N9L A;  1L6U A;  1AWD A;  5G2N A;  3CSF A;  3WIM A;  1RLF A;  1OEY J;  1OGW A;  2KTR A;  4LTU A;  2D5G A;  2LUM A;  1SJE D;  2WDV B;  2KJ6 A;  4KDL B;  1PUT A;  2L52 A;  3NG0 A;  2ASQ A;  2JX5 A;  4EKU A;  4ZRJ A;  5BMI A;  4TQ1 A;  5D3D A;  4DQO C;  3EGR A;  2WU2 B;  5JZE B;  3DBL I;  2IGH A;  3MC9 A;  1EUV B;  4JLC A;  3VUY A;  2N1V A;  2WYQ A;  2RPV A;  1WJ6 A;  5IOI A;  2KMA A;  1TKE A;  2WHI A;  1E0Z A;  4FBJ B;  3LDZ E;  4B9K A;  2CR5 A;  3C0R B;  3RUL A;  1PQS A;  4A6Q A;  4ITK A;  5E6J A;  1TKG A;  3UIP B;  5TR5 A;  4LCD E;  2LHE A;  3AI5 A;  5EDS A;  2JZP A;  2LUE A;  2NBV B;  1LO5 D;  2ZEQ A;  2KTR B;  3N20 C;  3AMZ A;  4AOF A;  1FRD A;  1YN4 A;  4ZYN A;  3MHS D;  4HWI B;  3KW5 B;  2K0P A;  3NZU A;  2WDR B;  3LXF A;  1FXA A;  1Z2M A;  3VXW A;  3R7R A;  4PS7 A;  1M94 A;  2HE7 A;  4JL9 A;  5DCN A;  2KWV B;  5FKA C;  4HRO A;  3VQI A;  1JW9 D;  4OZA A;  2Z8L A;  5CHF A;  4LNK A;  3GE3 C;  1D5Z C;  5I4D A;  5L95 C;  1E7P B;  1F1H A;  3TL5 A;  4ACF A;  3U2S C;  2KXJ A;  3AU5 A;  4W9E A;  2JXX A;  1EWY C;  1JWM D;  2WXN A;  4WH4 A;  4NJ7 A;  2W54 A;  4JGH B;  2JY6 A;  4ZDV A;  2O6V D;  2PW9 A;  4A3O A;  1SBB B;  3H9D A;  1PGA A;  1UGJ A;  2DHZ A;  4RGT A;  3ZQ4 A;  1MHH E;  3OWE B;  1V1O A;  2HDE A;  1T0R C;  1KF6 B;  1ZW7 A;  3CF6 E;  5GMV A;  1A5R A;  5AZG A;  2ZCC A;  2O6V B;  2IDY A;  3B2F A;  3P2B A;  3AM9 A;  3RFZ B;  2W55 A;  3RNC C;  1RM6 C;  3ML9 A;  3R8B A;  4X57 B;  3AEF B;  4LDT D;  3L16 A;  4OZC A;  3RN9 C;  3H8H A;  1UH6 A;  3D32 A;  1PYW D;  3IT4 B;  2BS2 B;  3ZW3 A;  2GBJ A;  4P6V F;  2IY1 B;  4DHJ D;  4ARC A;  3HK0 A;  4YWG G;  2KQS A;  2MJE A;  4DXG A;  4LDT B;  1N60 A;  1J19 A;  2KFK A;  4LK0 M;  1T6B X;  2IO1 B;  1IP9 A;  2MBH A;  4DHJ B;  3L13 A;  4MEM A;  5GXG B;  4MAC A;  3ZDM C;  3U30 A;  5BMG A;  3KVF B;  2DZM A;  2SEB D;  3NHE B;  4DXF A;  4BFR A;  4ZHP A;  5C2T B;  1YJ1 A;  3LYY A;  2OHF A;  3DQV A;  1QOB A;  4GDK A;  1EO6 A;  2Z0D B;  1I4Q A;  2M19 A;  2KYW A;  2KWU B;  1V81 A;  2DYM A;  3BY4 B;  3PHX B;  3M95 A;  3HM6 X;  4WJN A;  1OQQ A;  1T5X D;  5DPR A;  3PV1 A;  2MCN B;  4HVB A;  2OJR A;  3TEY A;  3VDZ A;  1WWT A;  4AS1 A;  2G4S A;  2PKO A;  1J8C A;  1BXT A;  5G5G A;  3W5U B;  2WXJ A;  1WF9 A;  2J7Q B;  1N62 A;  4LNF A;  2KFK B;  2DEN B;  5EE1 A;  2C7M B;  3V05 A;  1ACC A;  1I4R A;  3JYU A;  2D10 A;  4WWN A;  3BYY B;  4NY0 A;  2JVC A;  3AED B;  3IT6 B;  2M0X A;  1CZP A;  4EFO A;  2RMM A;  3PRM B;  3IVF A;  2N4F A;  4K1R B;  3Q8A A;  1SEB D;  2AQ2 B;  2JZ3 B;  3ZRC A;  4KZC A;  2KMC A;  4HRS A;  3DBR I;  2WXF A;  4GDK B;  2NCN A;  2V4L A;  1FCC C;  3DBR B;  1EU3 A;  2BYF A;  3SD5 A;  1YX5 B;  3BII D;  3TEZ A;  4W9C A;  4W9G A;  3CST A;  3HVD A;  4XX5 A;  2KZR A;  2BYV E;  3MHZ A;  1MPE A;  2MLB A;  4KKI A;  3VRB B;  3HUI A;  3UIN B;  1XLN A;  5LXH A;  2GBM A;  1SE4 A;  1P0R A;  3EC8 A;  3APD A;  1PFD A;  1L5P A;  2WU5 B;  4HPL B;  3T3N A;  4A3P A;  2H89 B;  3N9Y C;  2DZI A;  3S2A A;  5J17 A;  1SE2 A;  3SHQ A;  2N7D A;  2RDG A;  1WGY A;  3B08 A;  3NVW A;  4EE2 A;  4MGK E;  1F0Z A;  3B9J A;  3MFG A;  4B6W A;  3Q3F A;  1UWX A;  1ENF A;  5G55 A;  1FO4 A;  1ISN A;  1IBX A;  1ZOY B;  4O1N A;  1YJI A;  2JUO A;  1NYQ A;  3IXS A;  2LRU A;  4OVU A;  1WJU A;  4ZOH C;  4YSX B;  1SE3 A;  2NR2 A;  4JPS A;  3QA8 A;  5BO4 B;  2UYZ B;  1WR1 A;  4PS8 A;  2MJD A;  3U4E G;  1QLB B;  3AB5 A;  3H1U A;  2CS4 A;  2KWC A;  2PTL A;  1T3Q A;  1QOG A;  1U4A A;  4ANX A;  2MH7 A;  2N9X A;  3VTW A;  1HZ5 A;  1P1A A;  2YEP F;  3Q6B A;  3DHI C;  4NNJ B;  2KMM A;  4FAD A;  1JWU D;  4W9K A;  3H7S A;  3DPD A;  4GGQ A;  2JYT A;  1HZ6 A;  3X23 A;  4ANU A;  4P7I A;  1IBX B;  1TT5 B;  1YNT E;  4RFB A;  3FAH A;  3ZRF A;  4YSZ B;  1PGX A;  2EKI A;  2BTE A;  2D3G A;  2D2Q A;  4F1S A;  1V1P A;  2FCN A;  2MEK A;  2BYE A;  3DHG C;  2WS3 B;  2R2Q A;  3L17 A;  3HHM A;  3WAP A;  2JPH A;  1E7V A;  2DZJ A;  2LGI A;  2DNF A;  2WXM A;  2WDT B;  4GDL A;  3RPF C;  3ALB A;  2NBU A;  3RYT A;  1WE6 A;  4LNN A;  2I2Y A;  1I4P A;  4XE0 A;  4HPP A;  1XD3 B;  2B3A A;  2JXT A;  1VZ6 A;  2REX A;  3J9C A;  2FUG 1;  1ZDX A;  1CQV A;  5J18 A;  1K52 A;  4JX1 C;  1LFD A;  3GS2 A;  2X38 A;  2GBR A;  3ETR A;  3BYT B;  2M0A A;  1K50 A;  1HQR D;  1WXM A;  1WSP A;  1Q1O A;  2Y5C A;  3WAM A;  1ZP0 B;  3A4S C;  3ZNZ B;  3ZXR A;  1Q10 A;  3UQA A;  4C4V A;  3RMK C;  1X1M A;  4BOZ B;  4WJP A;  4XC2 A;  2MBB B;  3N30 A;  3AE8 B;  1V1P B;  1TKY A;  2EEL A;  4ICV A;  5C23 A;  1L0Y B;  2IGD A;  2N1W A;  2TSS A;  3OG5 A;  2JZZ A;  1E8Y A;  4L1B A;  4GDL B;  4G50 A;  1P9D U;  3Q3O C;  4WUR A;  1NI2 A;  1UBI A;  1IYF A;  1ZPS A;  2ON8 A;  2AWT A;  2LAS A;  4LJP B;  5JHB A;  3NOB A;  3AEB B;  2GLS A;  3W1Y A;  1KLG D;  3IAM 1;  2L0F A;  5C3J B;  1V49 A;  3GE8 C;  3PRE A;  1I42 A;  2WXP A;  3AU4 A;  1SIF A;  4YTN B;  2K6Q A;  4KX6 B;  3IFW B;  2LRW A;  4YXD B;  3QC8 B;  2I1K A;  3VRA B;  1BUI C;  3KWV A;  1GC6 A;  3UI3 A;  3BWU D;  4KDI C;  5FR6 A;  3ZKJ C;  1N61 A;  2JU6 X;  3PS6 A;  2LXC A;  3PRP B;  2CKH B;  3E9S A;  3L4P A;  3RD2 A;  1TGZ B;  5CHW A;  5CHV C;  1L6V A;  1KLV A;  4WQO B;  1OQR A;  3DBS A;  5D7G A;  4OVV A;  4FXC A;  4DDI D;  3N1X C;  1ROE A;  2FNJ B;  2IY0 B;  4US8 A;  1Q0W B;  1E10 A;  4D2K A;  2HTM E;  3T3O A;  3BZD B;  2V1Y A;  1UD7 A;  3P63 A;  2L3Z A;  4RGN A;  2DWQ A;  1TS2 A;  2KDM A;  3JVZ X;  3JSV A;  2ZCB A;  3P4P B;  4GB9 A;  2AQ1 B;  3AE4 B;  4F8C B;  5JXV A;  3AH7 A;  4J3O D;  5KHQ A;  1TIF A;  5BYQ A;  2XEW A;  4IWO A;  1R4M B;  4KV2 A;  2JF5 A;  2W3S A;  1WGR A;  4KVG B;  1YD8 U;  4OZB A;  4RM9 A;  1YQ3 B;  1T0Y A;  1UBQ A;  3HM3 A;  4FHK A;  1JAL A;  2KLG A;  2MP2 B;  1OEY A;  2BF8 B;  3VTV A;  1UEL A;  1XF5 L;  1IGC A;  5IKC M;  1IUE A;  4HJK A;  1GC7 A;  2MHJ A;  4HKZ E;  3V61 A;  4MGZ E;  4BBN F;  3JSV B;  4LLG M;  4TSS A;  3SU8 X;  3NVV A;  2GBN A;  3P4S B;  2PVG C;  3W9C B;  1KJT A;  4C00 A;  2QDF A;  2LGX A;  3U8Z A;  4II3 B;  1OTR B;  2FAZ A;  1WY8 A;  4WJQ A;  2WWZ A;  3NS1 A;  3AE9 B;  2AL3 A;  1GUA B;  1FPY A;  3ZO5 B;  3DBL B;  4US9 A;  1RFA A;  2OJW A;  4QAY A;  2GMI C;  1KOT A;  4XZ4 A;  2WGS A;  3I63 C;  4AP4 C;  3O65 B;  4C7Z A;  4DXA B;  2J4X A;  4B0E A;  3KWL A;  4E3C A;  1NYR A;  4LNO A;  3W1S A;  3MP9 A;  1MVK A;  1RYJ A;  4JWU C;  5IO9 A;  3DBH I;  1WM2 A;  2ZNV C;  4AJW A;  1ET9 A;  2KC2 A;  2V4I B;  2O6V A;  2YLM A;  3PVL A;  2CU3 A;  3Q14 C;  4MGY E;  2A4Z A;  3H7P A;  4PYZ A;  4TUU A;  1JWS D;  3RI7 C;  4H2A A;  2JYE A;  3W1S C;  2VH2 A;  3ZGZ A;  4L2Y A;  2BVC A;  2WX0 A;  3ZDT A;  2QSD A;  3ZNG C;  3RNF C;  4AQ7 A;  2IO3 B;  2ZNV B;  1UWM A;  5BYR A;  1WYW B;  3KYD D;  1HEZ E;  4KIK A;  2MBQ A;  3A1Q B;  1IGD A;  3T8M A;  3VAW A;  2ZVO A;  4II2 B;  2LXA A;  2GBK A;  2EKE C;  1EF1 A;  4PYU A;  1JQ4 A;  1EU4 A;  2HJ8 A;  4W9J A;  1GG3 A;  2B76 B;  2YEP B;  4REZ A;  2I1J A;  1QQR A;  4EUT A;  4FN2 A;  3NVY A;  4RF0 A;  1WM3 A;  4M0W A;  2KQ4 X;  2RR9 A;  2H88 B;  3H7P B;  4ANW A;  1G6J A;  2CHW A;  2DBY A;  2WXO A;  4HJG E;  3TMP B;  4NQK E;  3FC4 A;  1FNW A;  2ZW0 A;  1F52 A;  4G3X B;  3M63 B;  2J0J A;  3QWZ B;  2MBE A;  4N6E B;  2G3Q B;  1C1Y B;  4HCP B;  3MC0 B;  1QZE A;  4KIK B;  4E71 A;  4USA A;  4B95 A;  4TMA B;  2LEK A;  3U7Z A;  2KKC A;  4A55 A;  2VH1 A;  5IA7 A;  1L2N A;  1TS5 A;  3ZLZ A;  3I9V 1;  1QIL A;  2GRI A;  1D5M C;  3ZYY X;  2AQ3 B;  3Q3N C;  5AZH A;  4E74 A;  2DZK A;  4IUM B;  2HD5 B;  4M0W B;  2MJ3 A;  2N7J A;  4EOY A;  2EMT A;  3ZJT A;  4FLH A;  2BT6 A;  5AZF A;  2G4D B;  1L0V B;  2J53 A;  4JE3 B;  1AYF A;  2JRH A;  1SXT A;  3PZ8 A;  2RD0 A;  4S0R A;  3IHP C;  3KYC D;  2M56 B;  1PGB A;  4XWW A;  1V6E A;  1ZDV A;  2RDB C;  3MC8 A;  1C79 A;  4DDG D;  1C9F A;  2J52 A;  5CX3 A;  3V6C B;  3V62 A;  1YJJ A;  3ML8 A;  2L8J A;  4KSK C;  2LJ5 A;  3R2I A;  3V6E B;  2LJI A;  1WX7 A;  2IO2 B;  1N6Z A;  3PHW B;  1NEK B;  4KKJ A;  3U7D A;  2MWS B;  5DPS A;  3DWM A;  2PPH A;  3P42 A;  5EE9 A;  1ZGU B;  3IG3 A;  3QJZ A;  3M3J A;  1EF5 A;  2BPS A;  2J0K A;  1WGG A;  2X8X X;  1GJZ A;  1FNU A;  1JWA D;  1WMH A;  4XGA B;  3BVM A;  2KVZ A;  1VZ7 A;  1R4N I;  4ZRP A;  1VJK A;  4F7Z A;  4CQN A;  1Z5S B;  3KUC B;  1DOI A;  2KAC A;  2QIL A;  1WIA A;  2YVC A;  3A33 B;  3PO0 A;  4HDO A;  4XDD A;  4WJO A;  4FUL A;  2NBW B;  2KLC A;  1LGR A;  5MPO A;  1E90 A;  3DVN V;  1WRI A;  4M00 A;  5BYS A;  2XN9 C;  3KQ4 A;  4RNA A;  3GB1 A;  4N59 A;  2J42 A;  3PLU A;  2KAJ A;  1T0Q C;  3AE3 B;  4ARI A;  4IM0 A;  4HLE A;  2D11 A;  3W5V B;  4ZYS A;  1STE A;  4HK2 A;  2UU7 A;  4GU2 A;  4M8N A;  4MSM B;  1WZ0 A;  2IJ0 A;  3RZW C;  3Q3M C;  2JWU A;  4L23 A;  4NJC A;  1ZE3 D;  1J0G A;  3MTN B;  3UF8 A;  1WMH B;  2HTH A;  1H8C A;  1JRU A;  1GNU A;  1ZXI A;  4AWJ A;  2FE8 A;  3ZTD A;  1UUP A;  3PT2 B;  4C80 A;  1R7S A;  1L4D B;  4NPN A;  2LVP A;  3NJT A;  4LNI A;  1UZX B;  1P3Q U;  4BBN C;  2INC C;  3TEX A;  3KUD B;  1WZ3 A;  3N3K B;  3QX1 A;  2ZPY A;  1FNV A;  2JSV X;  1GB4 A;  3AV8 A;  3N1Y C;  4KSL C;  1FD6 A;  3ZJU A;  3PGE A;  2BS4 B;  2L0T A;  2KD0 A;  2KN4 A;  3QK0 A;  1GB1 A;  1PDX A;  4HKQ A;  1XCT L;  1J7C A;  1Y56 A;  2KWD A;  2NS5 A;  4P1C C;  2LGS A;  3R3M A;  2DYB A;  4TKN A;  2JQR B;  4W9I A;  5FR3 A;  2UWQ A;  2NMQ A;  4BKS D;  3C8Y A;  1I35 A;  2BKR B;  4K3C A;  4P16 A;  2KJH B;  1TTN A;  1E6E B;  1NI3 A;  1TZ1 A;  1C77 A;  2WDQ B;  1TY0 A;  1FMA D;  3N32 A;  2KX0 A;  3WAL A;  4BKG A;  4ICU A;  3VH3 B;  2QCZ A;  1MFW A;  1OQY A;  1A70 A;  2Y5P A;  1XO3 A;  1EWC A;  3RNB C;  2IGG A;  4KZ0 A;  2E3T A;  1SGH A;  2JT4 B;  3RNE C;  4YTP B;  4MJS A;  3QQ8 B;  2K3U A;  1FM0 D;  3AE5 B;  4GSW A;  1FXT B;  2MX2 A;  4BVU C;  5IP4 D;  2C7H A;  4DBG A;  1MHX A;  1BT0 A;  1HA5 A;  3HIZ A;  1FCL A;  4WWP A;  2AYO B;  4K7S A;  5HG2 A;  3KLS X;  3SFD B;  1JML A;  5KHO A;  1S3S G;  4CYE A;  2GB1 A;  2INP E;  4IG7 B;  4J6I A;  3GZN I;  1V8C A;  3RZF A;  3Q8B A;  2WXL A;  3GZN B;  4TQ0 A;  3A9K A;  2WXK A;  3NS8 A;  2KFJ A;  5HI1 A;  2VZK D;  2DYO A;  2W3R A;  1I4G A;  2L7R A;  3GOE A;  2LD9 A;  3DVN U;  1WR6 E;  4IC7 B;  4AJY B;  1KH0 A;  4RGM A;  2WXR A;  1DOY A;  2VZK B;  1VDV A;  1WGH A;  4K3B A;  2QJL A;  4MJS B;  1RAX A;  1WE7 A;  3V60 A;  2BGF A;  5E6P A;  3WAN A;  1JWB D;  3KH0 A;  4OVZ A;  5LNK 1;  3R7Q A;  2WQY B;  3WA0 A;  2ZPN A;  4HEA 1;  4KGR A;  2KTF A;  2ACZ B;  1SJH D;  2M8S A;  4EEW A;  4JWS C;  3Q2A C;  3AE2 B;  2MP2 A;  2BB5 A;  2PJH A;  3A9K B;  4RGO S;  5D94 A;  5L83 A;  1YOV B;  2MW5 A;  2PE6 B;  1MG4 A;  1LXD A;  2BKF A;  4EZL A;  1TBE A;  1YQ4 B;  3OJ4 B;  2JRI B;  3W2D A;  2WP9 B;  4ZRK A;  4NAM A;  5DPT A;  1VCB A;  2OOB B;  4ZRI A;  2RPQ A;  1NBF C;  3MJW A;  1SSN A;  1I7H A;  5H8Y E;  3ZTC A;  1VR9 A;  4ZRQ A;  4M02 A;  2Z59 B;  3VR9 B;  3SFE B;  1WXA A;  3AEA B;  2WX1 A;  2D07 B;  1C78 A;  4MH8 A;  3NRZ A;  2LZ6 A;  3C19 A;  1V5T A;  2NPT A;  1VLB A;  3AXC A;  2FCM A;  3P4Q B;  2RSU A;  5HKH A;  2IYD B;  1TYG B;  4G0N B;  1I4X A;  2AX5 A;  3SEB A;  4A8X C;  3FIL A;  4GXB A;  3KUZ A;  1WGK A;  3FKY A;  1T0S C;  4N9F 4;  2V9H A;  3OAW A;  1YN5 A;  3QAR A;  1KM7 A;  4YSY B;  1L4Z B;  4FJV B;  1NVI D;  2MA9 B;  3ONS A;  4NAW B;  1N5X A;  3A4R A;  4YL8 A;  2I38 A;  4IWP A;  3QIJ A;  2MRP A;  1WYG A;  4BAX A;  3BVG A;  2LI5 A;  2PVO D;  4IW0 A;  2KDI A;  3A1Q A;  2ZJD A;  1K8R B;  4EZJ A;  3OLM D;  2PE9 A;  1D6E C;  4WWO A;  2NPT B;  4JIO U;  1FRR A;  1XLP A;  2W9N A;  3AEC B;  1NDD A;  2NTT A;  4IM3 A;  5D2M B;  2IND C;  1QKZ A;  5EE3 A;  4C56 C;  1GPX A;  1D5X C;  2ZZP B;  3MJ5 A;  2Z0E B;  4W9D A;  3UQB A;  3R66 C;  3L0W B;  4FJZ A;  3FIL B;  1XCQ L;  2AEH A;  2WNM A;  3DBH B;  2KJR A;  5EE0 A;  3B2G A;  3H6N A;  3DHH C;  1N5W A;  3ZJV A;  4DK5 A;  2KX3 A;  4YTM B;  3AEG B;  1M4V A;  2K8H A;  1I4H A;  3O13 A;  2M4N A;  2AL6 A;  2R2O A;  2K25 A;  5AEK B;  2FCQ A;  3NVZ A;  1V97 A;  4MSQ B;  3CMM B;  4PK1 A;  1SF0 A;  1MG8 A;  1LQB A;  4A90 A;  1L7Y A;  1FFU A;  2LVO A;  3I3T B;  1XLQ A;  3VUW A;  3CWI A;  2SAK A;  2KDF B;  2KHW B;  1IPG A;  3URY A;  1V9J A;  4FJY A;  2CU1 A;  4EZK A;  4WAF A;  2W82 A;  2D3B A;  3RNA C;  2LHD A;  3B1L X;  4G11 A;  1RFK A;  4IWQ A;  2DX5 B;  3TEW A;  3EEC A;  4KGT A;  1FEH A;  1H4R A;  2BQQ A;  4BKT A;  2WXI A;  3NZ3 A;  3M62 B;  4XDC A;  1V5O A;  2DLB A;  2IZV B;  2K9X A;  4ZHO A;  4WQM A;  3Q69 A;  1QOA A;  2KDB A;  2K6D B;  2N7E A;  1E9M A;  2C5L C;  1SE9 A;  4GN1 A;  1WX9 A;  4XWT A;  2G1E A;  2V3N A;  2VRR B;  1BML C;  3TJP A;  4Q2J A;  3BK2 A;  3JW0 X;  2G9H D;  2ZW1 A;  3RCZ A;  2FBW B;  2N0S B;  3QCA A;  5FK9 C;  1WFY A;  3T9L A;  1WXS A;  1KTK A;  4HCN B;  3HRD D;  1DYQ A;  3TBL D;  3UIO B;  2NVU I;  1YIW A;  5LLI A;  3DVG X;  2FID A;  2K1F A;  3L10 B;  3AUL A;  2L05 A;  2IBI B;  3ZNI D;  4AUQ C;  3VR8 B;  1TY2 A;  1TJE A;  3TSS A;  4CO7 A;  2IPK D;  4M8M A;  3LB8 C;  3BK1 A;  3LJ3 A;  1WH3 A;  3PZ7 A;  2C9W B;  2E6X A;  2V3S A;  4I6N B;  3Q8F A;  4OW0 A;  1C4P A;  3I5J C;  2BYT A;  2Y3A A;  1B1Z A;  1P7F A;  3SR6 A;  4PT5 A;  2Q5W D;  1FIQ A;  4RMA A;  1D4B A;  2XNA C;  1TS4 A;  1YMH E;  2LMC A;  2OED A;  4P1B C;  1UF0 A;  1OFF A;  4XYC A;  3DVG Y;  5AUK A;  1XLO A;  2HJ1 A;  2L76 A;  2JWZ A;  1WI0 A;  3K9P B;  2A5U A;  4MH0 E;  4MEL A;  2LGD A;  5TSS A;  2G45 B;  2QHO A;  3IAS 1;  2XBB C;  3WAO A;  1HXY D;  4GLS C;  2KN5 A;  3PPA A;  3PTF C;  1WJ4 A;  1QT9 A;  1RWS A;  3AN1 A;  1R4N B;  2FUH B;  4IKG A;  2WXG A;  2C60 A;  2FIF A;  1KLU D;  2BWF A;  3L08 A;  1ZXH A;  3PLV A;  2D3A A;  3A9J A;  1P98 A;  4W9L A;  2LWP A;  2L00 B;  2N9P C;  3PSE B;  3BVZ A;  3RT3 B;  3VHT C;  4IOI E;  2LFI A;  3Q3J A;  3APC A;  4GOC A;  1P7E A;  4GIV A;  3L54 A;  4IM2 A;  2BB6 A;  2KDE B;  1WRD B; 
#chains in the Genus database with same CATH homology
 2C7H A;  3VTV A;  3ZW3 A;  4DBG A;  1XQQ A;  2GBJ A;  1BT0 A;  1UEL A;  2IY1 B;  4DHJ D;  3HK0 A;  4HJK A;  1GC7 A;  3HIZ A;  2KQS A;  4WWP A;  3V61 A;  4MGZ E;  2AYO B;  4K7S A;  1V80 A;  1V86 A;  4BBN F;  4LDT B;  4HXD A;  5KHO A;  1Y8R C;  3JSV B;  1S3S G;  4HDQ A;  1J19 A;  4CYE A;  2KFK A;  4IG7 B;  4J6I A;  2IO1 B;  5D6J B;  3EHV A;  3GZN I;  3SU8 X;  2K8B A;  3RZF A;  2GBN A;  2CHX A;  1IP9 A;  2MBH A;  1E8W A;  4DHJ B;  4TQ0 A;  3A9K A;  1KJT A;  3L13 A;  4MEM A;  3VVW B;  2KNB A;  2MSE D;  3NS8 A;  1Q5W B;  2KFJ A;  3PRZ A;  2LGX A;  3U8Z A;  1ZKH A;  2N9E B;  4II3 B;  3U30 A;  1OTR B;  3ZDM C;  2FAZ A;  1WY8 A;  2DYO A;  3KVF B;  2WWZ A;  2O2V A;  4WJQ A;  2DZM A;  3NHE B;  2AL3 A;  1GUA B;  2L7R A;  4BFR A;  1E8X A;  4MM3 A;  3GOE A;  3ZO5 B;  1YJ1 A;  2LD9 A;  2KVR A;  3DVN U;  3DQV A;  1RFA A;  1WR6 E;  4GDK A;  1EO6 A;  2Z0D B;  4IC7 B;  1VD2 A;  4AJY B;  2GMI C;  4GMV A;  1KOT A;  4W9H A;  3A9J B;  4XZ4 A;  2KWU B;  4AP4 C;  3O65 B;  1V81 A;  2LVQ A;  2DYM A;  3BY4 B;  3PHX B;  4DXA B;  3M95 A;  3HM6 X;  1WGH A;  4E3C A;  4WJN A;  4I6P A;  4MJS B;  4BKS A;  1D3Z A;  1WGD A;  3W1S A;  1RAX A;  1WE7 A;  5DPR A;  3PV1 A;  2K39 A;  2BGF A;  3V60 A;  4MGI E;  2MCN B;  4HVB A;  2OJR A;  1AAR A;  2EMS A;  5E6P A;  3WAN A;  3VDZ A;  3KH0 A;  2G4S A;  1WM2 A;  2MBO A;  3DBH I;  3R7Q A;  1J8C A;  2ZNV C;  4AJW A;  4PS3 A;  3WA0 A;  2KC2 A;  2KQ7 A;  2ZPN A;  1WF9 A;  2O6V A;  2YLM A;  3PVL A;  2J7Q B;  2KTF A;  3ZIM A;  4MGY E;  3DOW A;  3DDC B;  2M8S A;  2KAN A;  2A4Z A;  2KFK B;  4EEW A;  3H7P A;  2DEN B;  4PYZ A;  3TCA A;  2C7M B;  4K81 A;  2MP2 A;  4TUU A;  2PJH A;  2M17 A;  3JYU A;  2D10 A;  4WWN A;  3A9K B;  3W1S C;  4NY0 A;  2JVC A;  2M0X A;  3ZUN A;  4EFO A;  2O2V B;  2WX0 A;  3PRM B;  3ZDT A;  3IVF A;  2N4F A;  4K1R B;  3ZNG C;  5E6N A;  2JZ3 B;  5D94 A;  2IO3 B;  2ZNV B;  4KZC A;  2KMC A;  3ZRC A;  5L83 A;  2MW5 A;  2PE6 B;  1LXD A;  1WYW B;  3DBR I;  3KYD D;  2BKF A;  4GDK B;  4EZL A;  1TBE A;  2NCN A;  2V4L A;  3OJ4 B;  4KIK A;  2JRI B;  2MBQ A;  4FHJ A;  4DHZ E;  2BYF A;  1WXV A;  4ZRK A;  3A1Q B;  3SD5 A;  2KK8 A;  3T8M A;  1V2Y A;  1YX5 B;  3VAW A;  2ZVO A;  4W9F A;  5DPT A;  1VCB A;  2OOB B;  4W9C A;  4II2 B;  4W9G A;  3CST A;  4ZRI A;  2RPQ A;  1NBF C;  2LXA A;  2GBK A;  2EKE C;  3MJW A;  4XX5 A;  1EF1 A;  4PYU A;  2KZR A;  2BYV E;  2MLB A;  2M1M A;  2HJ8 A;  5C1Z A;  3UIN B;  4FA6 A;  5LXH A;  4W9J A;  3ZTC A;  2GBM A;  1GG3 A;  1C3T A;  1P0R A;  2Z59 B;  2I1J A;  3EC8 A;  3APD A;  4EUT A;  1WXA A;  2WX1 A;  4FN2 A;  1YX6 B;  4HPL B;  1WM3 A;  2D07 B;  4A3P A;  2RR9 A;  5JH5 C;  4DWF A;  2LZ6 A;  1V5T A;  2NPT A;  3H7P B;  4ANW A;  1G6J A;  3BIN A;  2DZI A;  3AXC A;  2FCM A;  3S2A A;  4TV3 A;  2CHW A;  3OJ3 A;  5J17 A;  2RSU A;  3TMP B;  4NQK E;  5HKH A;  3SHQ A;  2IYD B;  2N7D A;  4G0N B;  3TIX A;  1WGY A;  3B08 A;  4MGK E;  4G3X B;  3M63 B;  3NY5 A;  4GXB A;  3KUZ A;  2J0J A;  3QWZ B;  4B6W A;  3Q3F A;  5G55 A;  2MBE A;  2G3Q B;  1C1Y B;  4HCP B;  1ISN A;  4N9F 4;  1QZE A;  3OAW A;  4KIK B;  4E71 A;  3QAR A;  4B95 A;  4A20 A;  2CHZ A;  5J2R A;  2JUO A;  1KM7 A;  2J0M A;  2KKC A;  2LRU A;  4OVU A;  1WJU A;  4FJV B;  3K9O B;  1HE8 A;  4LJO B;  1E7U A;  2MA9 B;  2NR2 A;  5IA7 A;  3ONS A;  1L2N A;  4NAW B;  3A4R A;  1UGM A;  4YL8 A;  3IBE A;  3ZLZ A;  4IWP A;  4CHK A;  2BWE S;  3QIJ A;  2MRP A;  3QA8 A;  5BO4 B;  2DAF A;  2UYZ B;  4NJ6 A;  1WR1 A;  4PS8 A;  3X0W A;  2LI5 A;  3ZVV A;  3VTU A;  4IW0 A;  4MDK E;  2KDI A;  5AZH A;  4E74 A;  3A1Q A;  2ZJD A;  3H1U A;  1K8R B;  2DZK A;  4IUM B;  4EZJ A;  2CS4 A;  3OLM D;  4K7W A;  2HD5 B;  2KWC A;  2RGF A;  4M0W B;  2PE9 A;  4WWO A;  3VFK A;  3NZS A;  1RRB A;  2NPT B;  3QHT A;  4JIO U;  4EOY A;  2EMT A;  2XK5 A;  4I6L B;  1U4A A;  4ANX A;  2W9N A;  1NDD A;  4FLH A;  4IM3 A;  5D2M B;  3VH4 B;  1F9J A;  2N9X A;  5AZF A;  3VTW A;  2G4D B;  4ASW C;  2LGY A;  1P1A A;  2ZZP B;  2Z0E B;  4NNJ B;  4W9D A;  4BVU C;  5JHA A;  4FAD A;  3UQB A;  3R66 C;  3L0W B;  4FJZ A;  3ZNH B;  4WAA A;  4W9K A;  2AEH A;  2JRH A;  3H7S A;  3QAQ A;  3DPD A;  4GGQ A;  2KJR A;  2RD0 A;  3X23 A;  3UGB B;  3IHP C;  1CMX B;  3KYC D;  4P7I A;  3H6N A;  4ANU A;  3PZD A;  5E6O A;  1V6E A;  4K7U A;  2KOX A;  3ZRF A;  3ENE A;  4DK5 A;  2KX3 A;  2GOW A;  3EFU A;  1E5W A;  2D3G A;  2D2Q A;  4F1S A;  2FCN A;  3ECI A;  4DDG D;  2BYE A;  2K8H A;  2M4N A;  2R2Q A;  3L17 A;  5DPW A;  5CX3 A;  3V6C B;  3V62 A;  3HHM A;  4RM8 A;  2AL6 A;  2R2O A;  2K25 A;  2L8J A;  3ML8 A;  3WAP A;  2JPH A;  5AEK B;  2FCQ A;  4ANV A;  1E7V A;  4MSQ B;  1S1Q B;  2DZJ A;  2ZVN A;  2LJ5 A;  3CMM B;  2WDT B;  4KSK C;  1MG8 A;  4GDL A;  1LQB A;  3SDL C;  3ALB A;  2NBU A;  3V6E B;  2Y5B B;  3RYT A;  1WX7 A;  1WE6 A;  2IO2 B;  4BOS C;  1L7Y A;  3VUX A;  3PHW B;  2LVO A;  2XK5 B;  3I3T B;  3RUI B;  1XD3 B;  2B3A A;  2REX A;  4NAW A;  3U7D A;  2MWS B;  3VUW A;  5DPS A;  2KC1 A;  2PPH A;  2PEA A;  2MQJ A;  5LXI B;  2DAJ A;  5J18 A;  2KDF B;  2KHW B;  1IPG A;  1LFD A;  3APF A;  1ZGU B;  1V9J A;  3DCG A;  2CU1 A;  3IG3 A;  4FJY A;  3QJZ A;  5CTR C;  3M3J A;  2GBR A;  1XT9 B;  1EF5 A;  4EZK A;  2BPS A;  2J0K A;  1WGG A;  2KO3 A;  1GJZ A;  4URK A;  4JQW C;  1WMH A;  4HPM B;  1WXM A;  1WJN A;  1YQB A;  1Q1O A;  3B1L X;  4G11 A;  4DHZ B;  3WAM A;  1R4M I;  2FCS A;  1R4N I;  2IO0 B;  4IWQ A;  2C7N B;  4F7Z A;  2DX5 B;  3A4S C;  1Z5S B;  3KUC B;  3ZNZ B;  3EEC A;  1LM8 B;  4NQL B;  3UQA A;  1WIA A;  2YVC A;  1X1M A;  3A33 B;  4BOZ B;  4WJP A;  4XC2 A;  4HDO A;  2MBB B;  4WJO A;  1H4R A;  3N30 A;  4FUL A;  2NBW B;  1WX8 A;  1E8Z A;  2K8C A;  2KLC A;  4BKT A;  5IAA C;  3M62 B;  4ICV A;  1E90 A;  5C23 A;  3DVN V;  1V5O A;  2IZV B;  2N1W A;  3B0A A;  2JZZ A;  3PLU A;  2KDB A;  2K6D B;  1E8Y A;  2N7E A;  4GDL B;  4G50 A;  5G2N A;  3CSF A;  1P9D U;  2C5L C;  3WIM A;  1SE9 A;  4IM0 A;  4HLE A;  4GN1 A;  1NI2 A;  1UBI A;  1WX9 A;  2D11 A;  1RLF A;  1OEY J;  2VRR B;  1OGW A;  1IYF A;  2KTR A;  4HK2 A;  2AWT A;  2LAS A;  4LJP B;  3TJP A;  4GU2 A;  4M8N A;  4MSM B;  1WZ0 A;  3JW0 X;  3RZW C;  5JHB A;  3NOB A;  2KJ6 A;  4KDL B;  3RCZ A;  3W1Y A;  3QCA A;  1J0G A;  1WFY A;  3T9L A;  1WXS A;  2ASQ A;  3MTN B;  3UF8 A;  4HCN B;  1WMH B;  2L0F A;  3TBL D;  4EKU A;  2HTH A;  3UIO B;  1V49 A;  2NVU I;  1YIW A;  3PRE A;  4ZRJ A;  5LLI A;  4TQ1 A;  3DVG X;  1H8C A;  1I42 A;  3AU4 A;  1JRU A;  1SIF A;  2FID A;  1GNU A;  5JZE B;  2K6Q A;  2K1F A;  3DBL I;  3L10 B;  3AUL A;  4AWJ A;  3IFW B;  1EUV B;  4JLC A;  2LRW A;  2L05 A;  3VUY A;  3ZTD A;  2N1V A;  2WYQ A;  3PT2 B;  3QC8 B;  1WJ6 A;  2I1K A;  2IBI B;  3ZNI D;  4AUQ C;  2KMA A;  2LVP A;  4NPN A;  1UZX B;  1P3Q U;  4BBN C;  4CO7 A;  1GC6 A;  4FBJ B;  3LDZ E;  4KDI C;  2CR5 A;  3C0R B;  5FR6 A;  3ZKJ C;  3RUL A;  4B9K A;  1PQS A;  3KUD B;  1WZ3 A;  4M8M A;  3N3K B;  3LJ3 A;  3QX1 A;  2ZPY A;  1WH3 A;  3UIP B;  2C9W B;  3PS6 A;  2LXC A;  3PRP B;  2CKH B;  4KSL C;  3RD2 A;  5TR5 A;  1TGZ B;  2V3S A;  3PGE A;  4LCD E;  5CHW A;  3AI5 A;  4I6N B;  5CHV C;  5EDS A;  1KLV A;  4WQO B;  2L0T A;  2LUE A;  2NBV B;  2KD0 A;  2ZEQ A;  3QK0 A;  3DBS A;  5D7G A;  2KTR B;  4AOF A;  4OVV A;  4ZYN A;  4DDI D;  3MHS D;  4HWI B;  4RMA A;  3KW5 B;  2FNJ B;  3NZU A;  2IY0 B;  1Q0W B;  2NS5 A;  3DVG Y;  1Z2M A;  2L76 A;  3VXW A;  3R7R A;  4PS7 A;  2JWZ A;  3R3M A;  2DYB A;  2V1Y A;  1WI0 A;  1M94 A;  1UD7 A;  2HE7 A;  4JL9 A;  5DCN A;  2KWV B;  4TKN A;  3K9P B;  2A5U A;  4MH0 E;  4MEL A;  3VQI A;  4W9I A;  2LGD A;  2G45 B;  2QHO A;  2UWQ A;  2L3Z A;  2XBB C;  3WAO A;  4BKS D;  5CHF A;  3JVZ X;  3JSV A;  5L95 C;  2ZCB A;  3TL5 A;  2KN5 A;  1I35 A;  2BKR B;  4GB9 A;  2KXJ A;  3AU5 A;  4W9E A;  2JXX A;  2KJH B;  1TTN A;  3PPA A;  4F8C B;  3PTF C;  1TZ1 A;  4NJ7 A;  4JGH B;  1WJ4 A;  5KHQ A;  2JY6 A;  4ZDV A;  2O6V D;  2XEW A;  4IWO A;  4A3O A;  3N32 A;  4KV2 A;  2JF5 A;  2FUH B;  2KX0 A;  3H9D A;  3WAL A;  1WGR A;  2C60 A;  4BKG A;  4ICU A;  2DHZ A;  3VH3 B;  2FIF A;  4KVG B;  2BWF A;  1YD8 U;  3L08 A;  1OQY A;  4RM9 A;  3PLV A;  1A5R A;  1ZW7 A;  3CF6 E;  5GMV A;  3A9J A;  1P98 A;  5AZG A;  1T0Y A;  1UBQ A;  2ZCC A;  3HM3 A;  4KZ0 A;  2O6V B;  2LWP A;  4W9L A;  1SGH A;  2L00 B;  3P2B A;  4FHK A;  2N9P C;  3PSE B;  2JT4 B;  3RT3 B;  3ML9 A;  2KLG A;  3VHT C;  4MJS A;  3QQ8 B;  4X57 B;  4LDT D;  3L16 A;  3Q3J A;  3APC A;  2MP2 B;  4GOC A;  4GSW A;  1UH6 A;  4GIV A;  1OEY A;  3L54 A;  1FXT B;  2MX2 A;  3D32 A;  4IM2 A;  2KDE B;  1WRD B;  2BF8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...