3DQVA

Structural insights into nedd8 activation of cullin-ring ligases: conformational control of conjugation
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
78
structure length
78
Chain Sequence
b'GSMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKIMGGSVLHLVLALRGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NEDD8
publication title Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 19
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3dqvA00
1ZKHA 4NNJB 1UH6A 1E90A 4JL9A 3ECIA 1P9DU 5KHQA 3MTNB 4DDID 4NJ7A 2R2QA 2WWZA 4W9CA 1WE6A 4FADA 4GIVA 4GGQA 2O6VB 2C7NB 5DPRA 3TCAA 2KD0A 2MA9B 2MRPA 2LZ6A 3KUDB 4GOCA 4KIKB 2KJ6A 3H7SA 2ZPYA 4BBNC 4DDGD 2M1MA 3DVGY 2KQSA 1WZ0A 4FA6A 1HE8A 4URKA 2JY6A 1GC7A 1E8ZA 3PPAA 1T0YA 2FCNA 1WE7A 2MX2A 2L3ZA 3QIJA 4IM2A 2BPSA 3CSTA 3UGBB 4GU2A 3VH4B 3AI5A 4ANXA 1RRBA 4ICUA 4WJNA 3UIOB 3ML8A 2DZJA 1WX9A 4ZRJA 4CYEA 4GXBA 3RZFA 4F1SA 4LJOB 4NPNA 4WWPA 2GMIC 3ZNHB 5CX3A 3A1QA 3PHWB 2NBVB 3ZTCA 1V9JA 3L54A 4M8NA 2KC2A 4NJ6A 4EEWA 1V81A 1WH3A 4ICVA 4J6IA 3JSVB 4K7UA 2KTRB 2IO1B 3VVWB 2BYFA 4EFOA 2HE7A 4IM3A 3C0RB 2QHOA 3IBEA 2FAZA 2KX0A 2D11A 2HJ8A 2CHZA 3AU4A 3ZW3A 1EF1A 3QX1A 1KM7A 3CSFA 1UZXB 4EZLA 3TIXA 2IY1B 5J2RA 1YX5B 2KTFA 2BYEA 3NOBA 2RR9A 2O2VA 4LJPB 1U4AA 4B6WA 1LFDA 2M0XA 2K25A 3A4SC 4E74A 1G6JA 3L16A 2DYBA 4ZRIA 3OLMD 5JHBA 2YLMA 1YIWA 2KFKA 2MSED 3HK0A 4W9IA 2DZKA 2FCMA 2ZZPB 3NS8A 5GMVA 3PGEA 5AZFA 1GJZA 4K1RB 1UELA 4IG7B 1C1YB 1JRUA 2XK5A 5E6NA 5L95C 3H7PA 2Z0EB 3W1SA 2L0FA 3B0AA 2GBRA 4GMVA 5LXHA 1WMHA 4KSLC 5HKHA 3ZNGC 3UF8A 3M63B 3NY5A 1J19A 2LUEA 2MW5A 4BBNF 1A5RA 1J8CA 2I1JA 2GBJA 1D3ZA 4RM8A 2C60A 4BOZB 2KANA 4ANUA 5DCNA 5AEKB 2ZJDA 3R3MA 1BT0A 3ML9A 3EHVA 1L7YA 2KC1A 2LRWA 1WGDA 4BKTA 2RSUA 2NS5A 3RCZA 2GBKA 2IYDB 4WQOB 2K8CA 1WM2A 2D3GA 5CTRC 2L05A 2KLGA 2Z0DB 1WXVA 3WANA 3ZTDA 2FUHB 3R7QA 4IWPA 2DENB 2DYMA 5CHVC 2G3QB 3SDLC 5AZHA 1WJUA 3PV1A 3VH3B 4BOSC 4G0NB 2BWFA 2KDEB 2NPTB 1NBFC 4GDKA 3B08A 2FCSA 4HDQA 3MJWA 1OQYA 1EF5A 4A20A 1OEYA 2G45B 1TGZB 3KYDD 2B3AA 3KUZA 2R2OA 3L17A 1F9JA 4F7ZA 1WGGA 1SIFA 3QA8A 2VRRB 1V86A 3QHTA 5E6OA 3ALBA 4MJSA 2N9EB 4I6PA 2GOWA 2J0KA 2D10A 1WY8A 1Z2MA 2XK5B 2K39A 3VTWA 3N30A 3H7PB 4FULA 1WIAA 1E5WA 2KN5A 3PT2B 1YX6B 4WWOA 2CHXA 4PYZA 4KVGB 3HM6X 4E71A 1RFAA 5G55A 3V6EB 1V5TA 4EZJA 1I42A 1WXAA 1GNUA 5D6JB 2ZPNA 2RGFA 3PS6A 2LGXA 2NVUI 4W9LA 4W9KA 3ONSA 2JZ3B 2IZVB 2DZMA 3JVZX 2MLBA 3DVGX 1WJNA 4XZ4A 2LXCA 2L7RA 3ZNZB 2CKHB 1P3QU 4GDLA 5TR5A 2Y5BB 1S1QB 3PREA 3RULA 2BKFA 5AZGA 2MWSB 4W9FA 5D7GA 4IWOA 3S2AA 4B9KA 2ZVOA 3DVNV 1NI2A 4JLCA 3HHMA 4KZCA 3D32A 2PE9A 3I3TB 5BO4B 1I35A 3QJZA 4MM3A 3A9JB 1KLVA 3RUIB 2ZNVB 2K8HA 1WGRA 2JT4B 2GBMA 3H9DA 4HWIB 2KVRA 3UINB 1P1AA 3ZRCA 2KNBA 4JGHB 3TJPA 2NBUA 3PRPB 4GDKB 2KHWB 1XQQA 5EDSA 1KJTA 3U8ZA 2WDTB 2KK8A 1ZW7A 3HM3A 1R4MI 2DAFA 2ZNVC 3Q3JA 4HXDA 2WYQA 4MGKE 2C7HA 2N7DA 4G3XB 4EOYA 1GUAB 2C9WB 4FHKA 4DHJB 4MGZE 3IVFA 3VQIA 3QCAA 2EMSA 1V5OA 2LD9A 4AUQC 2NBWB 2ZCCA 3DBHI 3GZNI 2DYOA 4X57B 3VUXA 4TV3A 3VTUA 1GG3A 4EZKA 3HIZA 1UBIA 2K6QA 3DQVA 2HD5B 2KWUB 3SHQA 3WIMA 2D07B 4N9F4 2L76A 2PPHA 1KOTA 3EECA 1OEYJ 1VCBA 4NY0A 3UQAA 2J7QB 2V4LA 3V60A 3QAQA 2DHZA 2G4SA 3NZSA 3KW5B 1UGMA 4WAAA 5C1ZA 2L0TA 2BWES 4MGIE 4TQ0A 3IG3A 3KYCD 3GOEA 3QC8B 5LLIA 3ZRFA 2N1WA 1PQSA 3DPDA 4IWQA 5D94A 2KMCA 3RT3B 4I6NB 1IYFA 3ZUNA 3JYUA 3TBLD 4WWNA 3PLUA 2I1KA 1OGWA 4MSMB 4A3PA 2HTHA 5JZEB 1RLFA 2MBHA 3PSEB 3PZDA 1WF9A 4LDTD 2K1FA 2JRHA 4JIOU 1Z5SB 3A1QB 3ZDMC 3IHPC 4IM0A 3RD2A 1UBQA 4WJPA 2KZRA 2ASQA 2G4DB 1V80A 2AEHA 1M94A 1XD3B 3L08A 1Y8RC 2KKCA 2ZEQA 3MHSD 3VXWA 3U7DA 1UD7A 3WAPA 2A5UA 3DBRI 4ZDVA 1S3SG 3OAWA 4HCPB 1SGHA 3IFWB 2AL3A 4EUTA 2IO3B 3M95A 4IW0A 3V6CB 1WYWB 3BINA 4PS3A 4RMAA 2KDFB 1Q5WB 3PLVA 2RD0A 2UWQA 2NR2A 1X1MA 4ANVA 2MP2A 3A33B 2N4FA 2XBBC 3PHXB 1P98A 3RYTA 3CF6E 4OVVA 2O2VB 4HK2A 3VAWA 2OJRA 3DDCB 2RPQA 4MSQB 4M8MA 1CMXB 1WR6E 4DK5A 2KFKB 2A4ZA 4W9DA 3AULA 4EKUA 1WJ6A 4GB9A 4B95A 2ZCBA 1WX8A 2O6VD 4P7IA 1EO6A 3JW0X 3ENEA 3W1YA 2K6DB 4HPLB 3ZNID 2PEAA 2XEWA 3WA0A 2KJHB 3DCGA 4KIKA 3M3JA 4KZ0A 4FJZA 2V1YA 4MEMA 1WMHB 4TKNA 4FN2A 1Q1OA 1WRDB 4ANWA 1K8RB 3WAOA 5DPTA 4G50A 5CHWA 1E8WA 3VFKA 3X23A 1E8YA 1LXDA 1YJ1A 2KLCA 3LJ3A 1WXSA 3W1SC 1NDDA 2KWVB 2BF8B 5IAAC 2KO3A 4HPMB 1LQBA 2EMTA 4KSKC 4W9HA 1V2YA 3ZDTA 2FCQA 2UYZB 2PJHA 3A9KA 3KUCB 1YQBA 4RM9A 2J0JA 4AJWA 2CHWA 4OVUA 2LXAA 4KDLB 3JSVA 3UQBA 2N1VA 1C3TA 3M62B 1Q0WB 4WJOA 2FIDA 3ZKJC 3RZWC 4CO7A 2IY0B 2V3SA 3VUYA 2DX5B 5LXIB 2KOXA 2JWZA 2YVCA 5C23A 5J18A 4HJKA 2LASA 1WZ3A 2LI5A 4PS8A 2ZVNA 3QK0A 1VD2A 1AARA 4FJVB 4K7SA 2KDIA 5CHFA 5KHOA 3DBSA 2KQ7A 4FHJA 3VDZA 2L8JA 2JF5A 2EKEC 3DVNU 1E7VA 4G11A 4MJSB 1OTRB 2M4NA 3SU8X 2CR5A 2IO0B 3NZUA 2J0MA 2KX3A 5JH5C 4BKGA 3ZO5B 2WX1A 4BKSD 3AU5A 1EUVB 5FR6A 4BKSA 4GSWA 3WAMA 2JZZA 3L13A 3CMMB 2C5LC 1WJ4A 2M17A 2MBOA 4HCNB 2C7MB 2BYVE 3B1LX 2K8BA 3K9OB 4IUMB 2AYOB 4TQ1A 4W9GA 2KXJA 2LRUA 3SD5A 3T8MA 2L00B 3V62A 4GDLB 4HDOA 4DHZB 3P2BA 4MELA 1IPGA 4NQKE 3WALA 2GBNA 2LGYA 3A9KB 3R66C 3K9PB 2AL6A 2KWCA 2CS4A 1WFYA 2LVPA 1IP9A 5JHAA 1RAXA 3UIPB 4K7WA 1XT9B 2JPHA 4AOFA 2IBIB 1FXTB 3VUWA 4A3OA 1V6EA 3APFA 3APDA 2KJRA 1WXMA 4BFRA 3APCA 4YL8A 4TUUA 4XC2A 3EC8A 3TL5A 4LCDE 4AWJA 3ZIMA 1R4NI 2MCNB 1WGYA 2M8SA 2AWTA 2D2QA 3BY4B 3N32A 2N9XA 3H6NA 2KFJA 2JVCA 3V61A 3VHTC 2W9NA 2NPTA 3AXCA 2JRIB 2LGDA 3ZLZA 4E3CA 1ISNA 2LVQA 2CU1A 1QZEA 2MBBB 3LDZE 4DWFA 1H4RA 2LVOA 2LJ5A 4WJQA 2JUOA 3VTVA 3X0WA 1SE9A 4AJYB 2WX0A 5D2MB 4F8CB 3PVLA 3L0WB 2JXXA 4FJYA 4NAWA 1TBEA 3N3KB 3QQ8B 4XX5A 2IO2B 4MDKE 1J0GA 4FLHA 1TZ1A 4GN1A 1E8XA 2KMAA 3QWZB 3R7RA 1L2NA 3DBLI 2OOBB 2KDBA 4ASWC 1WI0A 4IC7B 1WR1A 3NHEB 2MBEA 4FBJB 1WX7A 4I6LB 5DPWA 4PYUA 3PTFC 2Z59B 3OJ3A 1WGHA 2PE6B 2O6VA 3OJ4B 4ZYNA 3TMPB 2REXA 1GC6A 3A9JA 3PRMB 4HLEA 3Q3FA 4MH0E 4NQLB 2MQJA 4II3B 2BGFA 3T9LA 3O65B 3KVFB 1ZGUB 4K81A 4W9EA 4CHKA 4LDTB 1H8CA 4DXAB 2FIFA 4M0WB 2N9PC 4W9JA 3ZVVA 2LWPA 3QARA 2DAJA 1MG8A 5DPSA 5IA7A 1YD8U 3DOWA 2NCNA 5G2NA 1V49A 1TTNA 4II2B 5E6PA 4ZRKA 2MBQA 5J17A 2FNJB 1E7UA 3KH0A 4HVBA 1P0RA 4DHJD 4MGYE 2N7EA 5L83A 4BVUC 3PRZA 4PS7A 3A4RA 3EFUA 4NAWB 4DBGA 3L10B 3U30A 4JQWC 2DZIA 2KTRA 3H1UA 1LM8B 4KDIC 2MP2B 4KV2A 4AP4C 2BKRB 1WM3A 4DHZE
chains in the Genus database with same CATH superfamily
2BB6A 1D5MC 3GP7A 1UH6A 3AECB 4JL9A 3W5UB 1P9DU 5KHQA 2R2QA 2I2YA 4M01A 2JXTA 1PFDA 2WXHA 2IGHA 3CWIA 3TEYA 2M1MA 1WZ0A 1HE8A 4URKA 5EE1A 3TEZA 3QIJA 2BPSA 4GU2A 3AI5A 1RRBA 4ICUA 3ML8A 2FUG1 1FD6A 2DZJA 1WX9A 4GXBA 4JX1C 4LJOB 4A90A 2PKOA 3IAS1 1V9JA 3L54A 2KC2A 1VZ8A 1T5XD 2V0GA 2WXMA 3C0RB 3IBEA 3Q2AC 2KX0A 4RGMA 3U7ZA 2CHZA 3ZW3A 1EF1A 3QX1A 4RF0A 2KTFA 4LJPB 2WP9B 5JHBA 3OLMD 3GZNB 4C4VB 1D6EC 2KFKA 3ZJTA 3HK0A 3P1MA 2DZKA 2ZZPB 3PGEA 3GE8C 1YN5A 1JRUA 1FRDA 2Z0EB 1ZPSA 2L0FA 4GMVA 5LXHA 3NY5A 1EWYC 1FFUA 2C60A 4ANUA 5DCNA 1D4BA 4D2KA 5C3JB 3PZ8A 1N5WA 2KC1A 4BKTA 1WGDA 1VRAB 2RSUA 2NS5A 2IYDB 1R4NB 2K8CA 1WM2A 5CTRC 1TS3A 2KLGA 1YNTE 1EU3A 2FUHB 1ET9A 3RNBC 2I38A 4IWPA 5CHVC 4BOSC 2BWFA 2NPTB 1HXYD 1JWSD 1MHHE 2INDC 3MC8A 3KUZA 1TZOA 2D10A 2K39A 3VTWA 1L6UA 3H7PB 1WIAA 3PT2B 2CHXA 3HM6X 1PUTA 2UU7A 2RGFA 2WXJA 3ONSA 1XF5L 3O13A 3JVZX 5IP4D 2W55A 2BKFA 5AZGA 4IWOA 3ZJVA 1I4PA 2W54A 1NI2A 2PW9A 4KZCA 1M4VA 5BO4B 2LGSA 1WGRA 2JT4B 3UINB 1ROEA 2KNBA 2PTLA 3TJPA 1F1HA 2KYWA 1J7CA 2IGGA 3P4SB 3V05A 1GUAB 3FC4A 2X38A 4DHJB 3W5VB 1V5OA 1WSPA 3HVDA 1CZPA 3DBHI 1XCTL 2DYOA 3I63C 4X57B 4TSSA 4DXGA 2HD5B 1L4ZB 3WIMA 1I4QA 2L76A 3EECA 2J7QB 3V60A 4IDIA 4M00A 2DHZA 4MGIE 3ZRFA 2N1WA 1PQSA 4PK1A 3NVWA 4P16A 2AX5A 2KMCA 4LNFA 2WXPA 1IYFA 5G5HA 2AQ3B 3ZUNA 1TS2A 1I4HA 2I1KA 2K5PA 1OGWA 2HTHA 2RPVA 3PZDA 4LDTD 2JRHA 5HHDG 1NYRA 1Z5SB 2BQQA 3A1QB 3RD2A 3RN9C 5I4DA 1EU4A 1UBQA 4N58A 2ASQA 2AEHA 2KKCA 3MHSD 2LGIA 2A5UA 3WAPA 1HEZE 4HCPB 1SGHA 3RMKC 4EUTA 3V6CB 2MJ3A 4RMAA 2KDFB 2RD0A 2UWQA 1P7FA 1X1MA 2MP2A 4J3OD 3A33B 3PHXB 1P98A 1XLPA 5D3IB 2EELA 4ARIA 1V1PA 2RPQA 2WXKA 4M8MA 1CMXB 4DK5A 3NS1A 4PT5A 3AULA 4Q2JA 1WJ6A 4GB9A 2D3BA 2BYTA 3JW0X 3ENEA 3Q69A 3W1YA 2YEPF 3ZNID 5BMGA 1DOIA 4M02A 5FKAC 3BIID 1E6EB 4G50A 1KTKA 4ZRPA 1NDDA 2KO3A 3ZDTA 3KUCB 1WGKA 4RM9A 1NI3A 1C3TA 4A8XC 2FIDA 2V3SA 3VUYA 2JWZA 2QIEB 4AS1A 4PS8A 2ZVNA 2SAKA 4K7SA 1AARA 2KQ7A 2L8JA 2IJ0A 3SU8X 3P42A 3NZUA 5JH5C 1SBBB 3ZO5B 1EUVB 4GSWA 3WAMA 3L13A 3W2DA 4ACFA 3RNFC 3NUHB 2MBOA 3B1LX 1C78A 2K8BA 1FMAD 4TQ1A 3NVVA 4HDOA 4HKZE 4DHZB 3NVYA 1CK1A 3Q8EA 3R66C 1WFYA 2LVPA 5JHAA 3VR9B 4MM3B 1XT9B 3AEDB 4BFRA 2XN9C 4XC2A 3EC8A 3ZIMA 4AWJA 1WGYA 3H6NA 1WRIA 3T3OA 2CU1A 1QZEA 4US8A 2MBBB 3LDZE 4DWFA 1H4RA 2LVOA 2KWDA 1SE9A 4F8CB 2JYEA 4L1BA 1L4DB 2QMTA 2RDGA 3BYTB 4XX5A 2IO2B 1TZ1A 4GN1A 1E8XA 3R7RA 5EE0A 2OEDA 1ZP0B 3NHEB 3W9CB 4FBJB 1MJDA 1WX7A 4I6LB 3OJ3A 1WGHA 2O6VA 3OJ4B 2G9HD 3AEAB 3PRMB 1ZXHA 3MC9A 3T9LA 3O65B 3KVFB 4W9EA 4K81A 1H8CA 2OJWA 4DXAB 4M0WB 4W9JA 3ZVVA 5IA7A 3FILB 1CJEA 3DOWA 2NCNA 1JWBD 1FXAA 4A9AA 1P0RA 4DHJD 2N7EA 1NYQA 3A4RA 3EFUA 4NAWB 2ZW0A 2KTRA 2SEBD 4KDIC 4KV2A 3AEFB 2BKRB 1ZKHA 1E90A 3ECIA 3RI7C 4NJ7A 2WWZA 1KH0A 1VLBA 3RFZB 2LJIA 4ZHPA 4GIVA 4GGQA 3TCAA 2BT6A 5BMHA 1TYGB 1VR9A 1V97A 2KJ6A 1ET6A 1YMHE 2JX5A 3BWUD 2JY6A 3PPAA 3SHQA 1T0YA 1IGDA 1K52A 4ANXA 3RNAC 2M0AA 4HKQA 4HRSA 4ZRJA 3RZFA 4F1SA 4NPNA 2GMIC 3I9V1 2WXLA 3ZNHB 3E56A 2NBVB 4NJ6A 1KLGD 1WH3A 4K7UA 4YTNB 1WXQA 1AW7A 1Y56A 2LMCA 4RGOS 2BYFA 1QT9A 4EFOA 3OG5A 3I5JC 1TKEA 3EA6A 3MC0B 2JYTA 3CSFA 4EZLA 2IY1B 2BYEA 1JROA 2O2VA 5JXVA 5MPOA 2M0XA 2K25A 2LHDA 1G6JA 4WURA 1MVKA 3MJ5A 2YLMA 2MSED 4AQ7A 4W9IA 1GJZA 1FM0D 4L2YA 3VRBB 2BBCA 2XK5A 2OHFA 3B0AA 1WMHA 4KSLC 4HROA 3ZNGC 3M63B 4BBNF 2V9HA 4RM8A 4BOZB 2ZJDA 3R3MA 2NMQA 1JWAD 2DNFA 3RCZA 1HZ5A 4WQOB 1I4GA 2Z0DB 4LK0M 3R7QA 4B0MA 2DYMA 4O1NA 3SDLC 5AZHA 3VH3B 4G0NB 1NBFC 4GDKA 1XO3A 4YT0B 3B08A 4HDQA 3MJWA 4A20A 2B3AA 3L17A 2R2OA 1F9JA 1B9RA 1WGGA 1SIFA 2WU2B 2J53A 2N9EB 2E3TA 3ZJUA 1QOFA 4WIPA 3N30A 2IPKD 2MJEA 1MG4A 1YX6B 4PYZA 1RFAA 3DBLB 5G55A 4EZJA 1YQ4B 3PS6A 3U2SC 3BK2A 2MLBA 3ZNZB 2CKHB 4GDLA 5TR5A 3PREA 3HVZA 2MWSB 1JWUD 5D7GA 2B76B 4FXCA 2HDEA 1DOXA 2JZPA 4JLCA 2DWQA 3QJZA 3A9JB 1KLVA 1YN3A 3RUIB 1NENB 4HWIB 3J9CA 1FNUA 1P1AA 4NZLB 1KF6B 3PRPB 1XQQA 1PYWD 1KJTA 3Q3JA 1C4PA 4MGKE 2N7DA 4G3XB 1SJED 2FBWB 2W3SA 3N1XC 4R3DA 3TEXA 4GLSC 3QCAA 2EMSA 4NAMA 2MEKA 4AUQC 2LFIA 2BS2B 3GZNI 1ACCA 2W82A 1YQ3B 3VUXA 4EZKA 2K6QA 1L5PA 2KWUB 4YXDB 1QOAA 3QAQA 1BXTA 5H8YE 5BYRA 3KW5B 4WAAA 2L0TA 2BWES 3GS2A 4XE0A 3IG3A 3KYCD 3Q14C 3GOEA 5IO9A 4OHJA 1RFKA 2KAJA 4I6NB 4LLGM 3RT3B 3KWVA 3PLUA 1IBXB 4A3PA 5JZEB 1RLFA 2MBHA 2V3PA 1ZUD2 1L0YB 3V3XA 3H8HA 3R2IA 4P1CC 2G4DB 3EUB2 1V80A 3L08A 1Y8RC 2H88B 3U7DA 4XDDA 1MFWA 1STEA 1J7AA 2K22A 4RCOA 2AL3A 4IW0A 3BINA 4PS3A 4A55A 2NR2A 3CF6E 4HK2A 4C80A 3VAWA 3DDCB 1RM6C 2QC8A 1WR6E 2A4ZA 2X8XX 1OQRA 4P7IA 2KACA 1CQVA 2PEAA 3NRZA 1GB4A 2KN4A 3DCGA 4KZ0A 4FJZA 4C7ZA 4TKNA 1Q1OA 1WRDB 1K8RB 1E8WA 1MI0A 1XCQL 1LXDA 1PGAA 1YJ1A 3Q3OC 4BAXA 1SIJA 5IAAC 2LUMA 4KSKC 2EKIA 4KX6B 2NTSA 1YQBA 4ZHOA 1N62A 4OVUA 2LXAA 3UQBA 2N1VA 1QLBB 1QKZA 1Q0WB 4WJOA 3ZKJC 4C56C 2IY0B 3BVGA 4US9A 2N0SB 1DGJA 4HJKA 1WZ3A 2HTME 1VD2A 4FJVB 2KDIA 3P63A 3VDZA 2EKEC 4YTMB 1E7VA 4MJSB 2M4NA 2CR5A 2IO0B 1KLUD 3C8YA 4C4VA 1ZDVA 1Q10A 4BKSD 1GAQB 1LO5D 1SE4A 3CMMB 1WJ4A 2C5LC 4HPPA 2N9KA 1ZXIA 3T3NA 5C2TB 2AYOB 2LRUA 4NQKE 3ZYYX 3WALA 2LGYA 1TT5B 1IP9A 3UIPB 2CJNA 4K7WA 4AOFA 4P6VF 1N5XA 1FXTB 4A3OA 4JWUC 5H92C 3VR8B 3APCA 4TUUA 4KKIA 5AUKA 1V8CA 4B0EA 2WU5B 2M8SA 2AWTA 3BY4B 2N9XA 1JCKB 3R2TA 3ZXRA 3V61A 3VHTC 1ENFA 2MJDA 2NPTA 3AXCA 4E3CA 4LNOA 3DBHB 4NJCA 3TEWA 4WJQA 4AJYB 4ZYSA 3L0WB 4FJYA 4YWGG 3BYYB 3N3KB 1FNWA 3QQ8B 2KMAA 4CQNA 1L2NA 2OOBB 2Y3AA 1AN8A 1SE3A 1V1OA 3PZ7A 3DHHC 2PE6B 4ZYNA 1FRRA 1SSNA 4NQLB 4II3B 1L6VA 3PO0A 3TSSA 3C19A 2N9PC 1AWDA 3OWEB 3QARA 2KVZA 4RF1A 5EE3A 1FCCC 1TTNA 2Y5CA 1B1ZA 4MGYE 3PRZA 2PMVA 3U30A 4JQWC 2DZIA 2M56B 4RGNA 4AP4C 4ARCA 4UDUC 1FPYA 3TMPB 4DHZE 2PVOD 1RYJA 3NZ3A 3MTNB 2GRIA 3GB1A 1WE6A 4FADA 2ONQA 4QAYA 2O6VB 5DPRA 2MRPA 2LZ6A 2V3NA 4GOCA 3N1ZC 4KIKB 3MP9A 3Q8AA 1JMLA 3H7SA 4DDGD 2KQSA 4FA6A 2FCNA 3UGBB 3VH4B 4K3BA 4WJNA 4CYEA 1SF0A 5HG2A 3RNGC 3GE3C 4WWPA 3A1QA 3PHWB 4XWWA 2HJ1A 2WDRB 4J6IA 3JSVB 1SB3C 1IGCA 2KTRB 3AB5A 2KT7A 2WS3B 1E9MA 2V4IB 2WXGA 3IT4B 2HE7A 1R4MB 2HJ8A 1HTOA 1K53A 3I57A 3AEBB 3UI3A 1YX5B 3ZXVA 3NOBA 2BVCA 1U4AA 4B6WA 1LFDA 3ABVB 2DYBA 4ZRIA 1XLOA 4JWSC 5GMVA 1R7SA 4K1RB 1UELA 1GPXA 5E6NA 5L95C 4S0RA 4DQOC 3E9SA 3MFGA 1F0ZA 5HKHA 3P4RB 3URYA 1A5RA 1J8CA 2I1JA 2GBJA 1E10A 3AE2B 4YSZB 5IKCM 5AEKB 2WNMA 1BT0A 2LRWA 1JRPA 1XLQA 1UUPA 2D3GA 4MT5A 4BZAA 3WANA 3P4QB 2E6XA 3ZTDA 5LNK1 2DENB 2G3QB 1WJUA 1EM7A 2BTEA 2LHEA 1NEKB 3DBRB 5HI1A 1OQYA 1EF5A 1OEYA 2G45B 1TGZB 3RNEC 4F7ZA 3QA8A 2VRRB 2Y5PA 1V86A 3QHTA 5E6OA 4C00A 4I6PA 1T6BX 2GOWA 2J0KA 1WY8A 1Z2MA 2XK5B 1HTQA 1F2RC 1E5WA 1N60A 2KN5A 1TS4A 2CJOA 2JQRB 4LTUA 2WQYB 3BVMA 1GNUA 2L83A 5D6JB 2LGXA 2NVUI 2XNAC 4W9KA 2IZVB 1GOZA 4XZ4A 2L7RA 1P3QU 2QCZA 2VH2A 4W9FA 4B9KA 5FR3A 2ZVOA 3Q3NC 3D32A 2PE9A 3I3TB 1I35A 4MM3A 2ZNVB 2K8HA 1QOGA 3H9DA 2Z8LA 4ZRQA 4GDKB 5AUIA 3U8ZA 2KK8A 3HM3A 4RNAA 3MHZA 2BS3B 2WYQA 2J52A 4EOYA 4FHKA 4HEA1 3VQIA 2LD9A 4EE2A 2NBWB 2ZCCA 3AEEB 4TV3A 3VTUA 2D07B 2PPHA 3UQAA 2V4LA 1T0SC 1UGMA 5C1ZA 2WXFA 4MACA 3QC8B 5LLIA 1SJHD 3R8BA 4IWQA 1J7BA 1PDXA 1C9FA 2L52A 3JYUA 3TBLD 1FFVA 5BMIA 3PSEB 1YJIA 3ZDMC 3IHPC 4IM0A 2KZRA 5GXGB 3Q8CA 2ZEQA 3FILA 1UD7A 1F2RI 4ZDVA 3OAWA 3IFWB 2ICIA 2IO3B 3U52E 1TKGA 1ZDXA 3HUIA 1XEEA 5T8IA 2PIAA 2INPE 2N4FA 2KQ4X 3P4PB 1I4XA 2OJRA 4MSQB 3EGRA 3AE8B 1L0XB 2WXNA 2KFKB 1ZOYB 4B95A 2O6VD 1HQRD 1EO6A 3ETRA 2K6DB 4HPLB 2XEWA 2KJHB 3M3JA 1I4RA 1OQQA 2V1YA 4FN2A 2WXQA 5DPTA 4YSXB 1YOVB 3X23A 1N6ZA 5IOIA 3FAHA 3LJ3A 3W1SC 2KWVB 2BF8B 4HPMB 3Q8BA 4W9HA 2PJHA 3A9KA 2J0JA 4N59A 2CHWA 2WXOA 4KDLB 4XDCA 3RZWC 2DX5B 5LXIB 2KOXA 5C23A 2YVCA 4WH4A 2LASA 3Q6BA 5CHFA 3DBSA 3AEGB 1E7PB 3SR6A 1HA5A 4G11A 1SE2A 2J0MA 1UNSA 3KQ4A 4BKGA 2WX1A 2WLBA 1GB1A 2BS4B 4BKSA 2YEPB 2JZZA 3BZDB 1A70A 1L0VB 4HCNB 2C7MB 3WCQA 1C4AA 4W9GA 2KXJA 3SD5A 2JU6X 4USAA 4MELA 2L1AA 1HZ6A 3K9PB 1FXIA 2CS4A 1RAXA 2JPHA 2IBIB 3VUWA 1K51A 3AE9B 3TL5A 1R4NI 2MCNB 2D2QA 3N32A 4WAFA 2JVCA 1D5XC 2DLBA 5E6JA 2JRIB 3ZLZA 1ISNA 1VZ6A 4ITKA 2LJ5A 1T0QC 2AQ1B 2JUOA 3X0WA 3N20C 1TBEA 4L23A 3DWGC 1J0GA 2IDYA 4P1BC 1UWMA 1WI0A 4IC7B 1WR1A 2PVGC 2WDQB 4XGAB 2MBEA 3AH7A 3AM9A 4PYUA 3PTFC 2Z59B 3SFDB 1YJJA 1AYFA 3B2FA 2REXA 1GC6A 2INCC 3A9JA 3NVZA 3Q3FA 4MH0E 1I7HA 2FIFA 5TSSA 3CIRB 2DAJA 4OVZA 4II2B 2GB1A 5E6PA 5J17A 2FNJB 2H89B 5L83A 4BVUC 4YSYB 4DBGA 3BK1A 2MHJA 1QILA 2BW2A 3H1UA 2RDBC 2MP2B 4MH8A 3DHIC 2GLSA 1BMLC 1VZ7A 4NNJB 2WXRA 5IN7A 2L32A 1V1PB 4DDID 4W9CA 1T3QA 2K3UA 4ZOHC 2C7NB 2KD0A 2MA9B 2R61A 3KUDB 1FCLA 4BBNC 2ZPYA 3DVGY 1GC7A 1E8ZA 1WE7A 1P7EA 2L3ZA 2MX2A 4IM2A 3CSTA 3AMZA 1EWCA 3UIOB 1IBXA 5CX3A 3ZTCA 4M8NA 4A6QA 4EEWA 1V81A 4ICVA 3TUOA 4XWTA 2IO1B 3VVWB 1K50A 4IM3A 2QHOA 5FK9C 2FAZA 2D11A 3HRDD 5BYQA 3AU4A 1KM7A 1UZXB 1FNVA 3SFEB 3TIXA 5J2RA 2RR9A 4E74A 3A4SC 3DHGC 3L16A 1YIWA 4KGTA 1ESFA 1TJEA 5AZFA 2FCMA 3NS8A 2D3CA 1C4CA 4IOIE 4IG7B 1C1YB 2IGDA 2K9XA 2M19A 4JPSA 4RH6A 3H7PA 3W1SA 2GBRA 2RDHA 2VZKB 3UF8A 2MH7A 2RMMA 1J19A 2LUEA 2MW5A 3NG0A 5HFYA 1D3ZA 2ACZB 4C7YA 2KANA 2AQ2B 3ML9A 3EHVA 1L7YA 3AE7B 3SEBA 2BB5A 2GBKA 4OZBA 2INNE 2K0PA 4YTPB 2L05A 1WXVA 3PV1A 3KWLA 2KDEB 1RWSA 1TS5A 2FCSA 3KYDD 3AE1B 3LB8C 3IT6B 3L4PA 3ALBA 4MJSA 2QSDA 4DXFA 1YN4A 4FULA 3N1YC 1VDVA 4WWOA 1D5ZC 4KVGB 2QDFA 4E71A 3V6EB 1I42A 1V5TA 1WXAA 1JW9D 3IXSA 2ZPNA 2D3AA 2PLPA 4LNIA 4W9LA 2JZ3B 1XXGA 2DZMA 3DVGX 1WJNA 2LXCA 3RULA 2Y5BB 1S1QB 3S2AA 3DVNV 3RPFC 3HHMA 4HJGE 2GBMA 2KVRA 3ZRCA 2VH1A 2GI9A 3VRAB 1TKYA 4JGHB 3FKYA 1XLNA 1UF0A 2NBUA 3DWMA 2KHWB 5EDSA 2KMMA 2WDTB 1ZW7A 1R4MI 2DAFA 2ZNVC 4HXDA 1FEHA 1TY2A 2C7HA 4OZCA 2C9WB 4MGZE 3IVFA 2WHIA 1QF6A 3ZGZA 2DBYA 2W3RA 1NVID 1ZE3D 1LGRA 3BVZA 1TIFA 1GG3A 1SXTA 1OFFA 1SEBD 1UBIA 3HIZA 4OW0A 2NTTA 1JWMD 3DQVA 3U4EG 4N9F4 1KOTA 1OEYJ 1VCBA 4NY0A 4OZAA 2G4SA 3NZSA 2JSVX 4TQ0A 3DPDA 4TMAB 5D94A 3ZQ4A 1F52A 4WWNA 1PGBA 4MSMB 1WF9A 2K1FA 2ON8A 3B2GA 4JIOU 4WQMA 4S17A 1FIQA 4WJPA 1WWTA 1M94A 1XD3B 3VXWA 2QJLA 1QOBA 3DBRI 1S3SG 3M95A 1WYWB 1Q5WB 3PLVA 2J42A 1FO4A 4ANVA 2XBBC 3RYTA 4OVVA 1C76A 2O2VB 1N61A 2N7JA 1C79A 2D5GA 3Q8FA 4W9DA 1PGXA 3LXFA 4EKUA 2ZCBA 1WX8A 5G5GA 3WA0A 4KIKA 4MEMA 4LNKA 1WMHB 4ANWA 3WAOA 1DOYA 3AE4B 1MHXA 4LNNA 5CHWA 3VFKA 1E8YA 2TSSA 4KGRA 2KLCA 1WXSA 1LQBA 2EMTA 3IAM1 1V2YA 2FCQA 2UYZB 3AE5B 3AN1A 2G1EA 5EE9A 4AJWA 3JSVA 3RNCC 3M62B 2CU3A 1F77A 4N6EB 4CO7A 2ZW1A 5J18A 2WDVB 2LI5A 5BYSA 3QK0A 5KHOA 4FHJA 1TY0A 2JF5A 3DVNU 3AV8A 3Q3MC 1OTRB 2WGSA 3B9JA 2KX3A 3LYYA 4KKJA 3AU5A 2WXIA 1KRHA 5FR6A 4REZA 2M17A 3EFCA 2BYVE 4IUMB 3K9OB 2VZKD 5D3DA 3T8MA 2L00B 3V62A 4GDLB 3P2BA 1IPGA 2GBNA 3A9KB 3N9YC 2AL6A 2KWCA 1QQRA 4JE3B 1T0RC 1V6EA 3APFA 3APDA 2KJRA 1WXMA 4YL8A 4H2AA 3AE3B 2JWUA 4LCDE 4KGSA 2KFJA 3KLSX 4IKGA 2W9NA 2LGDA 4M0WA 2LVQA 1VJKA 1BUIC 1WYGA 3VTVA 2WX0A 5D2MB 3PVLA 1N63A 2JXXA 4NAWA 4RFBA 1JQ4A 2FE8A 2QILA 4MDKE 1JALA 4FLHA 1DYQA 2KDMA 3QWZB 3DBLI 1UWXA 2KDBA 2Q5WD 4ASWC 2N9LA 4XYCA 5DPWA 2J4XA 1KFYB 4WWMA 1E0ZA 1C77A 4HLEA 2MQJA 2BGFA 4K3CA 1ZGUB 4CHKA 4LDTB 4RGTA 2LWPA 1UGJA 1MG8A 3NJTA 5DPSA 1YD8U 5G2NA 1V49A 4ZRKA 2MBQA 4HVBA 1E7UA 3KH0A 1IUEA 4PS7A 2LEKA 3L10B 1MPEA 3AE6B 1LM8B 2QEJC 1WM3A
chains in the Genus database with same CATH topology
1ZKHA 4NNJB 1UH6A 1E90A 4JL9A 3ECIA 1P9DU 5KHQA 3MTNB 4DDID 4NJ7A 2R2QA 2WWZA 4W9CA 1WE6A 4FADA 4GIVA 4GGQA 2O6VB 2C7NB 5DPRA 3TCAA 2KD0A 2MA9B 2MRPA 2LZ6A 3KUDB 4GOCA 4KIKB 2KJ6A 3H7SA 2ZPYA 4BBNC 4DDGD 2M1MA 3DVGY 2KQSA 1WZ0A 4FA6A 1HE8A 4URKA 2JY6A 1GC7A 1E8ZA 3PPAA 1T0YA 2FCNA 1WE7A 2MX2A 2L3ZA 3QIJA 4IM2A 2BPSA 3CSTA 3UGBB 4GU2A 3VH4B 3AI5A 4ANXA 1RRBA 4ICUA 4WJNA 3UIOB 3ML8A 2DZJA 1WX9A 4ZRJA 4CYEA 4GXBA 3RZFA 4F1SA 4LJOB 4NPNA 4WWPA 2GMIC 3ZNHB 5CX3A 3A1QA 3PHWB 2NBVB 3ZTCA 1V9JA 3L54A 4M8NA 2KC2A 4NJ6A 4EEWA 1V81A 1WH3A 4ICVA 4J6IA 3JSVB 4K7UA 2KTRB 2IO1B 3VVWB 2BYFA 4EFOA 2HE7A 4IM3A 3C0RB 2QHOA 3IBEA 2FAZA 2KX0A 2D11A 2HJ8A 2CHZA 3AU4A 3ZW3A 1EF1A 3QX1A 1KM7A 3CSFA 1UZXB 4EZLA 3TIXA 2IY1B 5J2RA 1YX5B 2KTFA 2BYEA 3NOBA 2RR9A 2O2VA 4LJPB 1U4AA 4B6WA 1LFDA 2M0XA 2K25A 3A4SC 4E74A 1G6JA 3L16A 2DYBA 4ZRIA 3OLMD 5JHBA 2YLMA 1YIWA 2KFKA 2MSED 3HK0A 4W9IA 2DZKA 2FCMA 2ZZPB 3NS8A 5GMVA 3PGEA 5AZFA 1GJZA 4K1RB 1UELA 4IG7B 1C1YB 1JRUA 2XK5A 5E6NA 5L95C 3H7PA 2Z0EB 3W1SA 2L0FA 3B0AA 2GBRA 4GMVA 5LXHA 1WMHA 4KSLC 5HKHA 3ZNGC 3UF8A 3M63B 3NY5A 1J19A 2LUEA 2MW5A 4BBNF 1A5RA 1J8CA 2I1JA 2GBJA 1D3ZA 4RM8A 2C60A 4BOZB 2KANA 4ANUA 5DCNA 5AEKB 2ZJDA 3R3MA 1BT0A 3ML9A 3EHVA 1L7YA 2KC1A 2LRWA 1WGDA 4BKTA 2RSUA 2NS5A 3RCZA 2GBKA 2IYDB 4WQOB 2K8CA 1WM2A 2D3GA 5CTRC 2L05A 2KLGA 2Z0DB 1WXVA 3WANA 3ZTDA 2FUHB 3R7QA 4IWPA 2DENB 2DYMA 5CHVC 2G3QB 3SDLC 5AZHA 1WJUA 3PV1A 3VH3B 4BOSC 4G0NB 2BWFA 2KDEB 2NPTB 1NBFC 4GDKA 3B08A 2FCSA 4HDQA 3MJWA 1OQYA 1EF5A 4A20A 1OEYA 2G45B 1TGZB 3KYDD 2B3AA 3KUZA 2R2OA 3L17A 1F9JA 4F7ZA 1WGGA 1SIFA 3QA8A 2VRRB 1V86A 3QHTA 5E6OA 3ALBA 4MJSA 2N9EB 4I6PA 2GOWA 2J0KA 2D10A 1WY8A 1Z2MA 2XK5B 2K39A 3VTWA 3N30A 3H7PB 4FULA 1WIAA 1E5WA 2KN5A 3PT2B 1YX6B 4WWOA 2CHXA 4PYZA 4KVGB 3HM6X 4E71A 1RFAA 5G55A 3V6EB 1V5TA 4EZJA 1I42A 1WXAA 1GNUA 5D6JB 2ZPNA 2RGFA 3PS6A 2LGXA 2NVUI 4W9LA 4W9KA 3ONSA 2JZ3B 2IZVB 2DZMA 3JVZX 2MLBA 3DVGX 1WJNA 4XZ4A 2LXCA 2L7RA 3ZNZB 2CKHB 1P3QU 4GDLA 5TR5A 2Y5BB 1S1QB 3PREA 3RULA 2BKFA 5AZGA 2MWSB 4W9FA 5D7GA 4IWOA 3S2AA 4B9KA 2ZVOA 3DVNV 1NI2A 4JLCA 3HHMA 4KZCA 3D32A 2PE9A 3I3TB 5BO4B 1I35A 3QJZA 4MM3A 3A9JB 1KLVA 3RUIB 2ZNVB 2K8HA 1WGRA 2JT4B 2GBMA 3H9DA 4HWIB 2KVRA 3UINB 1P1AA 3ZRCA 2KNBA 4JGHB 3TJPA 2NBUA 3PRPB 4GDKB 2KHWB 1XQQA 5EDSA 1KJTA 3U8ZA 2WDTB 2KK8A 1ZW7A 3HM3A 1R4MI 2DAFA 2ZNVC 3Q3JA 4HXDA 2WYQA 4MGKE 2C7HA 2N7DA 4G3XB 4EOYA 1GUAB 2C9WB 4FHKA 4DHJB 4MGZE 3IVFA 3VQIA 3QCAA 2EMSA 1V5OA 2LD9A 4AUQC 2NBWB 2ZCCA 3DBHI 3GZNI 2DYOA 4X57B 3VUXA 4TV3A 3VTUA 1GG3A 4EZKA 3HIZA 1UBIA 2K6QA 3DQVA 2HD5B 2KWUB 3SHQA 3WIMA 2D07B 4N9F4 2L76A 2PPHA 1KOTA 3EECA 1OEYJ 1VCBA 4NY0A 3UQAA 2J7QB 2V4LA 3V60A 3QAQA 2DHZA 2G4SA 3NZSA 3KW5B 1UGMA 4WAAA 5C1ZA 2L0TA 2BWES 4MGIE 4TQ0A 3IG3A 3KYCD 3GOEA 3QC8B 5LLIA 3ZRFA 2N1WA 1PQSA 3DPDA 4IWQA 5D94A 2KMCA 3RT3B 4I6NB 1IYFA 3ZUNA 3JYUA 3TBLD 4WWNA 3PLUA 2I1KA 1OGWA 4MSMB 4A3PA 2HTHA 5JZEB 1RLFA 2MBHA 3PSEB 3PZDA 1WF9A 4LDTD 2K1FA 2JRHA 4JIOU 1Z5SB 3A1QB 3ZDMC 3IHPC 4IM0A 3RD2A 1UBQA 4WJPA 2KZRA 2ASQA 2G4DB 1V80A 2AEHA 1M94A 1XD3B 3L08A 1Y8RC 2KKCA 2ZEQA 3MHSD 3VXWA 3U7DA 1UD7A 3WAPA 2A5UA 3DBRI 4ZDVA 1S3SG 3OAWA 4HCPB 1SGHA 3IFWB 2AL3A 4EUTA 2IO3B 3M95A 4IW0A 3V6CB 1WYWB 3BINA 4PS3A 4RMAA 2KDFB 1Q5WB 3PLVA 2RD0A 2UWQA 2NR2A 1X1MA 4ANVA 2MP2A 3A33B 2N4FA 2XBBC 3PHXB 1P98A 3RYTA 3CF6E 4OVVA 2O2VB 4HK2A 3VAWA 2OJRA 3DDCB 2RPQA 4MSQB 4M8MA 1CMXB 1WR6E 4DK5A 2KFKB 2A4ZA 4W9DA 3AULA 4EKUA 1WJ6A 4GB9A 4B95A 2ZCBA 1WX8A 2O6VD 4P7IA 1EO6A 3JW0X 3ENEA 3W1YA 2K6DB 4HPLB 3ZNID 2PEAA 2XEWA 3WA0A 2KJHB 3DCGA 4KIKA 3M3JA 4KZ0A 4FJZA 2V1YA 4MEMA 1WMHB 4TKNA 4FN2A 1Q1OA 1WRDB 4ANWA 1K8RB 3WAOA 5DPTA 4G50A 5CHWA 1E8WA 3VFKA 3X23A 1E8YA 1LXDA 1YJ1A 2KLCA 3LJ3A 1WXSA 3W1SC 1NDDA 2KWVB 2BF8B 5IAAC 2KO3A 4HPMB 1LQBA 2EMTA 4KSKC 4W9HA 1V2YA 3ZDTA 2FCQA 2UYZB 2PJHA 3A9KA 3KUCB 1YQBA 4RM9A 2J0JA 4AJWA 2CHWA 4OVUA 2LXAA 4KDLB 3JSVA 3UQBA 2N1VA 1C3TA 3M62B 1Q0WB 4WJOA 2FIDA 3ZKJC 3RZWC 4CO7A 2IY0B 2V3SA 3VUYA 2DX5B 5LXIB 2KOXA 2JWZA 2YVCA 5C23A 5J18A 4HJKA 2LASA 1WZ3A 2LI5A 4PS8A 2ZVNA 3QK0A 1VD2A 1AARA 4FJVB 4K7SA 2KDIA 5CHFA 5KHOA 3DBSA 2KQ7A 4FHJA 3VDZA 2L8JA 2JF5A 2EKEC 3DVNU 1E7VA 4G11A 4MJSB 1OTRB 2M4NA 3SU8X 2CR5A 2IO0B 3NZUA 2J0MA 2KX3A 5JH5C 4BKGA 3ZO5B 2WX1A 4BKSD 3AU5A 1EUVB 5FR6A 4BKSA 4GSWA 3WAMA 2JZZA 3L13A 3CMMB 2C5LC 1WJ4A 2M17A 2MBOA 4HCNB 2C7MB 2BYVE 3B1LX 2K8BA 3K9OB 4IUMB 2AYOB 4TQ1A 4W9GA 2KXJA 2LRUA 3SD5A 3T8MA 2L00B 3V62A 4GDLB 4HDOA 4DHZB 3P2BA 4MELA 1IPGA 4NQKE 3WALA 2GBNA 2LGYA 3A9KB 3R66C 3K9PB 2AL6A 2KWCA 2CS4A 1WFYA 2LVPA 1IP9A 5JHAA 1RAXA 3UIPB 4K7WA 1XT9B 2JPHA 4AOFA 2IBIB 1FXTB 3VUWA 4A3OA 1V6EA 3APFA 3APDA 2KJRA 1WXMA 4BFRA 3APCA 4YL8A 4TUUA 4XC2A 3EC8A 3TL5A 4LCDE 4AWJA 3ZIMA 1R4NI 2MCNB 1WGYA 2M8SA 2AWTA 2D2QA 3BY4B 3N32A 2N9XA 3H6NA 2KFJA 2JVCA 3V61A 3VHTC 2W9NA 2NPTA 3AXCA 2JRIB 2LGDA 3ZLZA 4E3CA 1ISNA 2LVQA 2CU1A 1QZEA 2MBBB 3LDZE 4DWFA 1H4RA 2LVOA 2LJ5A 4WJQA 2JUOA 3VTVA 3X0WA 1SE9A 4AJYB 2WX0A 5D2MB 4F8CB 3PVLA 3L0WB 2JXXA 4FJYA 4NAWA 1TBEA 3N3KB 3QQ8B 4XX5A 2IO2B 4MDKE 1J0GA 4FLHA 1TZ1A 4GN1A 1E8XA 2KMAA 3QWZB 3R7RA 1L2NA 3DBLI 2OOBB 2KDBA 4ASWC 1WI0A 4IC7B 1WR1A 3NHEB 2MBEA 4FBJB 1WX7A 4I6LB 5DPWA 4PYUA 3PTFC 2Z59B 3OJ3A 1WGHA 2PE6B 2O6VA 3OJ4B 4ZYNA 3TMPB 2REXA 1GC6A 3A9JA 3PRMB 4HLEA 3Q3FA 4MH0E 4NQLB 2MQJA 4II3B 2BGFA 3T9LA 3O65B 3KVFB 1ZGUB 4K81A 4W9EA 4CHKA 4LDTB 1H8CA 4DXAB 2FIFA 4M0WB 2N9PC 4W9JA 3ZVVA 2LWPA 3QARA 2DAJA 1MG8A 5DPSA 5IA7A 1YD8U 3DOWA 2NCNA 5G2NA 1V49A 1TTNA 4II2B 5E6PA 4ZRKA 2MBQA 5J17A 2FNJB 1E7UA 3KH0A 4HVBA 1P0RA 4DHJD 4MGYE 2N7EA 5L83A 4BVUC 3PRZA 4PS7A 3A4RA 3EFUA 4NAWB 4DBGA 3L10B 3U30A 4JQWC 2DZIA 2KTRA 3H1UA 1LM8B 4KDIC 2MP2B 4KV2A 4AP4C 2BKRB 1WM3A 4DHZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKH A;  4NNJ B;  1UH6 A;  1E90 A;  4JL9 A;  3ECI A;  1P9D U;  5KHQ A;  3MTN B;  4DDI D;  4NJ7 A;  2R2Q A;  2WWZ A;  4W9C A;  1WE6 A;  4FAD A;  4GIV A;  4GGQ A;  2O6V B;  2C7N B;  5DPR A;  3TCA A;  2KD0 A;  2MA9 B;  2MRP A;  2LZ6 A;  3KUD B;  4GOC A;  4KIK B;  2KJ6 A;  3H7S A;  2ZPY A;  4BBN C;  4DDG D;  2M1M A;  3DVG Y;  2KQS A;  1WZ0 A;  4FA6 A;  1HE8 A;  4URK A;  2JY6 A;  1GC7 A;  1E8Z A;  3PPA A;  1T0Y A;  2FCN A;  1WE7 A;  2MX2 A;  2L3Z A;  3QIJ A;  4IM2 A;  2BPS A;  3CST A;  3UGB B;  4GU2 A;  3VH4 B;  3AI5 A;  4ANX A;  1RRB A;  4ICU A;  4WJN A;  3UIO B;  3ML8 A;  2DZJ A;  1WX9 A;  4ZRJ A;  4CYE A;  4GXB A;  3RZF A;  4F1S A;  4LJO B;  4NPN A;  4WWP A;  2GMI C;  3ZNH B;  5CX3 A;  3A1Q A;  3PHW B;  2NBV B;  3ZTC A;  1V9J A;  3L54 A;  4M8N A;  2KC2 A;  4NJ6 A;  4EEW A;  1V81 A;  1WH3 A;  4ICV A;  4J6I A;  3JSV B;  4K7U A;  2KTR B;  2IO1 B;  3VVW B;  2BYF A;  4EFO A;  2HE7 A;  4IM3 A;  3C0R B;  2QHO A;  3IBE A;  2FAZ A;  2KX0 A;  2D11 A;  2HJ8 A;  2CHZ A;  3AU4 A;  3ZW3 A;  1EF1 A;  3QX1 A;  1KM7 A;  3CSF A;  1UZX B;  4EZL A;  3TIX A;  2IY1 B;  5J2R A;  1YX5 B;  2KTF A;  2BYE A;  3NOB A;  2RR9 A;  2O2V A;  4LJP B;  1U4A A;  4B6W A;  1LFD A;  2M0X A;  2K25 A;  3A4S C;  4E74 A;  1G6J A;  3L16 A;  2DYB A;  4ZRI A;  3OLM D;  5JHB A;  2YLM A;  1YIW A;  2KFK A;  2MSE D;  3HK0 A;  4W9I A;  2DZK A;  2FCM A;  2ZZP B;  3NS8 A;  5GMV A;  3PGE A;  5AZF A;  1GJZ A;  4K1R B;  1UEL A;  4IG7 B;  1C1Y B;  1JRU A;  2XK5 A;  5E6N A;  5L95 C;  3H7P A;  2Z0E B;  3W1S A;  2L0F A;  3B0A A;  2GBR A;  4GMV A;  5LXH A;  1WMH A;  4KSL C;  5HKH A;  3ZNG C;  3UF8 A;  3M63 B;  3NY5 A;  1J19 A;  2LUE A;  2MW5 A;  4BBN F;  1A5R A;  1J8C A;  2I1J A;  2GBJ A;  1D3Z A;  4RM8 A;  2C60 A;  4BOZ B;  2KAN A;  4ANU A;  5DCN A;  5AEK B;  2ZJD A;  3R3M A;  1BT0 A;  3ML9 A;  3EHV A;  1L7Y A;  2KC1 A;  2LRW A;  1WGD A;  4BKT A;  2RSU A;  2NS5 A;  3RCZ A;  2GBK A;  2IYD B;  4WQO B;  2K8C A;  1WM2 A;  2D3G A;  5CTR C;  2L05 A;  2KLG A;  2Z0D B;  1WXV A;  3WAN A;  3ZTD A;  2FUH B;  3R7Q A;  4IWP A;  2DEN B;  2DYM A;  5CHV C;  2G3Q B;  3SDL C;  5AZH A;  1WJU A;  3PV1 A;  3VH3 B;  4BOS C;  4G0N B;  2BWF A;  2KDE B;  2NPT B;  1NBF C;  4GDK A;  3B08 A;  2FCS A;  4HDQ A;  3MJW A;  1OQY A;  1EF5 A;  4A20 A;  1OEY A;  2G45 B;  1TGZ B;  3KYD D;  2B3A A;  3KUZ A;  2R2O A;  3L17 A;  1F9J A;  4F7Z A;  1WGG A;  1SIF A;  3QA8 A;  2VRR B;  1V86 A;  3QHT A;  5E6O A;  3ALB A;  4MJS A;  2N9E B;  4I6P A;  2GOW A;  2J0K A;  2D10 A;  1WY8 A;  1Z2M A;  2XK5 B;  2K39 A;  3VTW A;  3N30 A;  3H7P B;  4FUL A;  1WIA A;  1E5W A;  2KN5 A;  3PT2 B;  1YX6 B;  4WWO A;  2CHX A;  4PYZ A;  4KVG B;  3HM6 X;  4E71 A;  1RFA A;  5G55 A;  3V6E B;  1V5T A;  4EZJ A;  1I42 A;  1WXA A;  1GNU A;  5D6J B;  2ZPN A;  2RGF A;  3PS6 A;  2LGX A;  2NVU I;  4W9L A;  4W9K A;  3ONS A;  2JZ3 B;  2IZV B;  2DZM A;  3JVZ X;  2MLB A;  3DVG X;  1WJN A;  4XZ4 A;  2LXC A;  2L7R A;  3ZNZ B;  2CKH B;  1P3Q U;  4GDL A;  5TR5 A;  2Y5B B;  1S1Q B;  3PRE A;  3RUL A;  2BKF A;  5AZG A;  2MWS B;  4W9F A;  5D7G A;  4IWO A;  3S2A A;  4B9K A;  2ZVO A;  3DVN V;  1NI2 A;  4JLC A;  3HHM A;  4KZC A;  3D32 A;  2PE9 A;  3I3T B;  5BO4 B;  1I35 A;  3QJZ A;  4MM3 A;  3A9J B;  1KLV A;  3RUI B;  2ZNV B;  2K8H A;  1WGR A;  2JT4 B;  2GBM A;  3H9D A;  4HWI B;  2KVR A;  3UIN B;  1P1A A;  3ZRC A;  2KNB A;  4JGH B;  3TJP A;  2NBU A;  3PRP B;  4GDK B;  2KHW B;  1XQQ A;  5EDS A;  1KJT A;  3U8Z A;  2WDT B;  2KK8 A;  1ZW7 A;  3HM3 A;  1R4M I;  2DAF A;  2ZNV C;  3Q3J A;  4HXD A;  2WYQ A;  4MGK E;  2C7H A;  2N7D A;  4G3X B;  4EOY A;  1GUA B;  2C9W B;  4FHK A;  4DHJ B;  4MGZ E;  3IVF A;  3VQI A;  3QCA A;  2EMS A;  1V5O A;  2LD9 A;  4AUQ C;  2NBW B;  2ZCC A;  3DBH I;  3GZN I;  2DYO A;  4X57 B;  3VUX A;  4TV3 A;  3VTU A;  1GG3 A;  4EZK A;  3HIZ A;  1UBI A;  2K6Q A;  3DQV A;  2HD5 B;  2KWU B;  3SHQ A;  3WIM A;  2D07 B;  4N9F 4;  2L76 A;  2PPH A;  1KOT A;  3EEC A;  1OEY J;  1VCB A;  4NY0 A;  3UQA A;  2J7Q B;  2V4L A;  3V60 A;  3QAQ A;  2DHZ A;  2G4S A;  3NZS A;  3KW5 B;  1UGM A;  4WAA A;  5C1Z A;  2L0T A;  2BWE S;  4MGI E;  4TQ0 A;  3IG3 A;  3KYC D;  3GOE A;  3QC8 B;  5LLI A;  3ZRF A;  2N1W A;  1PQS A;  3DPD A;  4IWQ A;  5D94 A;  2KMC A;  3RT3 B;  4I6N B;  1IYF A;  3ZUN A;  3JYU A;  3TBL D;  4WWN A;  3PLU A;  2I1K A;  1OGW A;  4MSM B;  4A3P A;  2HTH A;  5JZE B;  1RLF A;  2MBH A;  3PSE B;  3PZD A;  1WF9 A;  4LDT D;  2K1F A;  2JRH A;  4JIO U;  1Z5S B;  3A1Q B;  3ZDM C;  3IHP C;  4IM0 A;  3RD2 A;  1UBQ A;  4WJP A;  2KZR A;  2ASQ A;  2G4D B;  1V80 A;  2AEH A;  1M94 A;  1XD3 B;  3L08 A;  1Y8R C;  2KKC A;  2ZEQ A;  3MHS D;  3VXW A;  3U7D A;  1UD7 A;  3WAP A;  2A5U A;  3DBR I;  4ZDV A;  1S3S G;  3OAW A;  4HCP B;  1SGH A;  3IFW B;  2AL3 A;  4EUT A;  2IO3 B;  3M95 A;  4IW0 A;  3V6C B;  1WYW B;  3BIN A;  4PS3 A;  4RMA A;  2KDF B;  1Q5W B;  3PLV A;  2RD0 A;  2UWQ A;  2NR2 A;  1X1M A;  4ANV A;  2MP2 A;  3A33 B;  2N4F A;  2XBB C;  3PHX B;  1P98 A;  3RYT A;  3CF6 E;  4OVV A;  2O2V B;  4HK2 A;  3VAW A;  2OJR A;  3DDC B;  2RPQ A;  4MSQ B;  4M8M A;  1CMX B;  1WR6 E;  4DK5 A;  2KFK B;  2A4Z A;  4W9D A;  3AUL A;  4EKU A;  1WJ6 A;  4GB9 A;  4B95 A;  2ZCB A;  1WX8 A;  2O6V D;  4P7I A;  1EO6 A;  3JW0 X;  3ENE A;  3W1Y A;  2K6D B;  4HPL B;  3ZNI D;  2PEA A;  2XEW A;  3WA0 A;  2KJH B;  3DCG A;  4KIK A;  3M3J A;  4KZ0 A;  4FJZ A;  2V1Y A;  4MEM A;  1WMH B;  4TKN A;  4FN2 A;  1Q1O A;  1WRD B;  4ANW A;  1K8R B;  3WAO A;  5DPT A;  4G50 A;  5CHW A;  1E8W A;  3VFK A;  3X23 A;  1E8Y A;  1LXD A;  1YJ1 A;  2KLC A;  3LJ3 A;  1WXS A;  3W1S C;  1NDD A;  2KWV B;  2BF8 B;  5IAA C;  2KO3 A;  4HPM B;  1LQB A;  2EMT A;  4KSK C;  4W9H A;  1V2Y A;  3ZDT A;  2FCQ A;  2UYZ B;  2PJH A;  3A9K A;  3KUC B;  1YQB A;  4RM9 A;  2J0J A;  4AJW A;  2CHW A;  4OVU A;  2LXA A;  4KDL B;  3JSV A;  3UQB A;  2N1V A;  1C3T A;  3M62 B;  1Q0W B;  4WJO A;  2FID A;  3ZKJ C;  3RZW C;  4CO7 A;  2IY0 B;  2V3S A;  3VUY A;  2DX5 B;  5LXI B;  2KOX A;  2JWZ A;  2YVC A;  5C23 A;  5J18 A;  4HJK A;  2LAS A;  1WZ3 A;  2LI5 A;  4PS8 A;  2ZVN A;  3QK0 A;  1VD2 A;  1AAR A;  4FJV B;  4K7S A;  2KDI A;  5CHF A;  5KHO A;  3DBS A;  2KQ7 A;  4FHJ A;  3VDZ A;  2L8J A;  2JF5 A;  2EKE C;  3DVN U;  1E7V A;  4G11 A;  4MJS B;  1OTR B;  2M4N A;  3SU8 X;  2CR5 A;  2IO0 B;  3NZU A;  2J0M A;  2KX3 A;  5JH5 C;  4BKG A;  3ZO5 B;  2WX1 A;  4BKS D;  3AU5 A;  1EUV B;  5FR6 A;  4BKS A;  4GSW A;  3WAM A;  2JZZ A;  3L13 A;  3CMM B;  2C5L C;  1WJ4 A;  2M17 A;  2MBO A;  4HCN B;  2C7M B;  2BYV E;  3B1L X;  2K8B A;  3K9O B;  4IUM B;  2AYO B;  4TQ1 A;  4W9G A;  2KXJ A;  2LRU A;  3SD5 A;  3T8M A;  2L00 B;  3V62 A;  4GDL B;  4HDO A;  4DHZ B;  3P2B A;  4MEL A;  1IPG A;  4NQK E;  3WAL A;  2GBN A;  2LGY A;  3A9K B;  3R66 C;  3K9P B;  2AL6 A;  2KWC A;  2CS4 A;  1WFY A;  2LVP A;  1IP9 A;  5JHA A;  1RAX A;  3UIP B;  4K7W A;  1XT9 B;  2JPH A;  4AOF A;  2IBI B;  1FXT B;  3VUW A;  4A3O A;  1V6E A;  3APF A;  3APD A;  2KJR A;  1WXM A;  4BFR A;  3APC A;  4YL8 A;  4TUU A;  4XC2 A;  3EC8 A;  3TL5 A;  4LCD E;  4AWJ A;  3ZIM A;  1R4N I;  2MCN B;  1WGY A;  2M8S A;  2AWT A;  2D2Q A;  3BY4 B;  3N32 A;  2N9X A;  3H6N A;  2KFJ A;  2JVC A;  3V61 A;  3VHT C;  2W9N A;  2NPT A;  3AXC A;  2JRI B;  2LGD A;  3ZLZ A;  4E3C A;  1ISN A;  2LVQ A;  2CU1 A;  1QZE A;  2MBB B;  3LDZ E;  4DWF A;  1H4R A;  2LVO A;  2LJ5 A;  4WJQ A;  2JUO A;  3VTV A;  3X0W A;  1SE9 A;  4AJY B;  2WX0 A;  5D2M B;  4F8C B;  3PVL A;  3L0W B;  2JXX A;  4FJY A;  4NAW A;  1TBE A;  3N3K B;  3QQ8 B;  4XX5 A;  2IO2 B;  4MDK E;  1J0G A;  4FLH A;  1TZ1 A;  4GN1 A;  1E8X A;  2KMA A;  3QWZ B;  3R7R A;  1L2N A;  3DBL I;  2OOB B;  2KDB A;  4ASW C;  1WI0 A;  4IC7 B;  1WR1 A;  3NHE B;  2MBE A;  4FBJ B;  1WX7 A;  4I6L B;  5DPW A;  4PYU A;  3PTF C;  2Z59 B;  3OJ3 A;  1WGH A;  2PE6 B;  2O6V A;  3OJ4 B;  4ZYN A;  3TMP B;  2REX A;  1GC6 A;  3A9J A;  3PRM B;  4HLE A;  3Q3F A;  4MH0 E;  4NQL B;  2MQJ A;  4II3 B;  2BGF A;  3T9L A;  3O65 B;  3KVF B;  1ZGU B;  4K81 A;  4W9E A;  4CHK A;  4LDT B;  1H8C A;  4DXA B;  2FIF A;  4M0W B;  2N9P C;  4W9J A;  3ZVV A;  2LWP A;  3QAR A;  2DAJ A;  1MG8 A;  5DPS A;  5IA7 A;  1YD8 U;  3DOW A;  2NCN A;  5G2N A;  1V49 A;  1TTN A;  4II2 B;  5E6P A;  4ZRK A;  2MBQ A;  5J17 A;  2FNJ B;  1E7U A;  3KH0 A;  4HVB A;  1P0R A;  4DHJ D;  4MGY E;  2N7E A;  5L83 A;  4BVU C;  3PRZ A;  4PS7 A;  3A4R A;  3EFU A;  4NAW B;  4DBG A;  3L10 B;  3U30 A;  4JQW C;  2DZI A;  2KTR A;  3H1U A;  1LM8 B;  4KDI C;  2MP2 B;  4KV2 A;  4AP4 C;  2BKR B;  1WM3 A;  4DHZ E; 
#chains in the Genus database with same CATH topology
 2BB6 A;  1D5M C;  3GP7 A;  1UH6 A;  3AEC B;  4JL9 A;  3W5U B;  1P9D U;  5KHQ A;  2R2Q A;  2I2Y A;  4M01 A;  2JXT A;  1PFD A;  2WXH A;  2IGH A;  3CWI A;  3TEY A;  2M1M A;  1WZ0 A;  1HE8 A;  4URK A;  5EE1 A;  3TEZ A;  3QIJ A;  2BPS A;  4GU2 A;  3AI5 A;  1RRB A;  4ICU A;  3ML8 A;  2FUG 1;  1FD6 A;  2DZJ A;  1WX9 A;  4GXB A;  4JX1 C;  4LJO B;  4A90 A;  2PKO A;  3IAS 1;  1V9J A;  3L54 A;  2KC2 A;  1VZ8 A;  1T5X D;  2V0G A;  2WXM A;  3C0R B;  3IBE A;  3Q2A C;  2KX0 A;  4RGM A;  3U7Z A;  2CHZ A;  3ZW3 A;  1EF1 A;  3QX1 A;  4RF0 A;  2KTF A;  4LJP B;  2WP9 B;  5JHB A;  3OLM D;  3GZN B;  4C4V B;  1D6E C;  2KFK A;  3ZJT A;  3HK0 A;  3P1M A;  2DZK A;  2ZZP B;  3PGE A;  3GE8 C;  1YN5 A;  1JRU A;  1FRD A;  2Z0E B;  1ZPS A;  2L0F A;  4GMV A;  5LXH A;  3NY5 A;  1EWY C;  1FFU A;  2C60 A;  4ANU A;  5DCN A;  1D4B A;  4D2K A;  5C3J B;  3PZ8 A;  1N5W A;  2KC1 A;  4BKT A;  1WGD A;  1VRA B;  2RSU A;  2NS5 A;  2IYD B;  1R4N B;  2K8C A;  1WM2 A;  5CTR C;  1TS3 A;  2KLG A;  1YNT E;  1EU3 A;  2FUH B;  1ET9 A;  3RNB C;  2I38 A;  4IWP A;  5CHV C;  4BOS C;  2BWF A;  2NPT B;  1HXY D;  1JWS D;  1MHH E;  2IND C;  3MC8 A;  3KUZ A;  1TZO A;  2D10 A;  2K39 A;  3VTW A;  1L6U A;  3H7P B;  1WIA A;  3PT2 B;  2CHX A;  3HM6 X;  1PUT A;  2UU7 A;  2RGF A;  2WXJ A;  3ONS A;  1XF5 L;  3O13 A;  3JVZ X;  5IP4 D;  2W55 A;  2BKF A;  5AZG A;  4IWO A;  3ZJV A;  1I4P A;  2W54 A;  1NI2 A;  2PW9 A;  4KZC A;  1M4V A;  5BO4 B;  2LGS A;  1WGR A;  2JT4 B;  3UIN B;  1ROE A;  2KNB A;  2PTL A;  3TJP A;  1F1H A;  2KYW A;  1J7C A;  2IGG A;  3P4S B;  3V05 A;  1GUA B;  3FC4 A;  2X38 A;  4DHJ B;  3W5V B;  1V5O A;  1WSP A;  3HVD A;  1CZP A;  3DBH I;  1XCT L;  2DYO A;  3I63 C;  4X57 B;  4TSS A;  4DXG A;  2HD5 B;  1L4Z B;  3WIM A;  1I4Q A;  2L76 A;  3EEC A;  2J7Q B;  3V60 A;  4IDI A;  4M00 A;  2DHZ A;  4MGI E;  3ZRF A;  2N1W A;  1PQS A;  4PK1 A;  3NVW A;  4P16 A;  2AX5 A;  2KMC A;  4LNF A;  2WXP A;  1IYF A;  5G5H A;  2AQ3 B;  3ZUN A;  1TS2 A;  1I4H A;  2I1K A;  2K5P A;  1OGW A;  2HTH A;  2RPV A;  3PZD A;  4LDT D;  2JRH A;  5HHD G;  1NYR A;  1Z5S B;  2BQQ A;  3A1Q B;  3RD2 A;  3RN9 C;  5I4D A;  1EU4 A;  1UBQ A;  4N58 A;  2ASQ A;  2AEH A;  2KKC A;  3MHS D;  2LGI A;  2A5U A;  3WAP A;  1HEZ E;  4HCP B;  1SGH A;  3RMK C;  4EUT A;  3V6C B;  2MJ3 A;  4RMA A;  2KDF B;  2RD0 A;  2UWQ A;  1P7F A;  1X1M A;  2MP2 A;  4J3O D;  3A33 B;  3PHX B;  1P98 A;  1XLP A;  5D3I B;  2EEL A;  4ARI A;  1V1P A;  2RPQ A;  2WXK A;  4M8M A;  1CMX B;  4DK5 A;  3NS1 A;  4PT5 A;  3AUL A;  4Q2J A;  1WJ6 A;  4GB9 A;  2D3B A;  2BYT A;  3JW0 X;  3ENE A;  3Q69 A;  3W1Y A;  2YEP F;  3ZNI D;  5BMG A;  1DOI A;  4M02 A;  5FKA C;  3BII D;  1E6E B;  4G50 A;  1KTK A;  4ZRP A;  1NDD A;  2KO3 A;  3ZDT A;  3KUC B;  1WGK A;  4RM9 A;  1NI3 A;  1C3T A;  4A8X C;  2FID A;  2V3S A;  3VUY A;  2JWZ A;  2QIE B;  4AS1 A;  4PS8 A;  2ZVN A;  2SAK A;  4K7S A;  1AAR A;  2KQ7 A;  2L8J A;  2IJ0 A;  3SU8 X;  3P42 A;  3NZU A;  5JH5 C;  1SBB B;  3ZO5 B;  1EUV B;  4GSW A;  3WAM A;  3L13 A;  3W2D A;  4ACF A;  3RNF C;  3NUH B;  2MBO A;  3B1L X;  1C78 A;  2K8B A;  1FMA D;  4TQ1 A;  3NVV A;  4HDO A;  4HKZ E;  4DHZ B;  3NVY A;  1CK1 A;  3Q8E A;  3R66 C;  1WFY A;  2LVP A;  5JHA A;  3VR9 B;  4MM3 B;  1XT9 B;  3AED B;  4BFR A;  2XN9 C;  4XC2 A;  3EC8 A;  3ZIM A;  4AWJ A;  1WGY A;  3H6N A;  1WRI A;  3T3O A;  2CU1 A;  1QZE A;  4US8 A;  2MBB B;  3LDZ E;  4DWF A;  1H4R A;  2LVO A;  2KWD A;  1SE9 A;  4F8C B;  2JYE A;  4L1B A;  1L4D B;  2QMT A;  2RDG A;  3BYT B;  4XX5 A;  2IO2 B;  1TZ1 A;  4GN1 A;  1E8X A;  3R7R A;  5EE0 A;  2OED A;  1ZP0 B;  3NHE B;  3W9C B;  4FBJ B;  1MJD A;  1WX7 A;  4I6L B;  3OJ3 A;  1WGH A;  2O6V A;  3OJ4 B;  2G9H D;  3AEA B;  3PRM B;  1ZXH A;  3MC9 A;  3T9L A;  3O65 B;  3KVF B;  4W9E A;  4K81 A;  1H8C A;  2OJW A;  4DXA B;  4M0W B;  4W9J A;  3ZVV A;  5IA7 A;  3FIL B;  1CJE A;  3DOW A;  2NCN A;  1JWB D;  1FXA A;  4A9A A;  1P0R A;  4DHJ D;  2N7E A;  1NYQ A;  3A4R A;  3EFU A;  4NAW B;  2ZW0 A;  2KTR A;  2SEB D;  4KDI C;  4KV2 A;  3AEF B;  2BKR B;  1ZKH A;  1E90 A;  3ECI A;  3RI7 C;  4NJ7 A;  2WWZ A;  1KH0 A;  1VLB A;  3RFZ B;  2LJI A;  4ZHP A;  4GIV A;  4GGQ A;  3TCA A;  2BT6 A;  5BMH A;  1TYG B;  1VR9 A;  1V97 A;  2KJ6 A;  1ET6 A;  1YMH E;  2JX5 A;  3BWU D;  2JY6 A;  3PPA A;  3SHQ A;  1T0Y A;  1IGD A;  1K52 A;  4ANX A;  3RNA C;  2M0A A;  4HKQ A;  4HRS A;  4ZRJ A;  3RZF A;  4F1S A;  4NPN A;  2GMI C;  3I9V 1;  2WXL A;  3ZNH B;  3E56 A;  2NBV B;  4NJ6 A;  1KLG D;  1WH3 A;  4K7U A;  4YTN B;  1WXQ A;  1AW7 A;  1Y56 A;  2LMC A;  4RGO S;  2BYF A;  1QT9 A;  4EFO A;  3OG5 A;  3I5J C;  1TKE A;  3EA6 A;  3MC0 B;  2JYT A;  3CSF A;  4EZL A;  2IY1 B;  2BYE A;  1JRO A;  2O2V A;  5JXV A;  5MPO A;  2M0X A;  2K25 A;  2LHD A;  1G6J A;  4WUR A;  1MVK A;  3MJ5 A;  2YLM A;  2MSE D;  4AQ7 A;  4W9I A;  1GJZ A;  1FM0 D;  4L2Y A;  3VRB B;  2BBC A;  2XK5 A;  2OHF A;  3B0A A;  1WMH A;  4KSL C;  4HRO A;  3ZNG C;  3M63 B;  4BBN F;  2V9H A;  4RM8 A;  4BOZ B;  2ZJD A;  3R3M A;  2NMQ A;  1JWA D;  2DNF A;  3RCZ A;  1HZ5 A;  4WQO B;  1I4G A;  2Z0D B;  4LK0 M;  3R7Q A;  4B0M A;  2DYM A;  4O1N A;  3SDL C;  5AZH A;  3VH3 B;  4G0N B;  1NBF C;  4GDK A;  1XO3 A;  4YT0 B;  3B08 A;  4HDQ A;  3MJW A;  4A20 A;  2B3A A;  3L17 A;  2R2O A;  1F9J A;  1B9R A;  1WGG A;  1SIF A;  2WU2 B;  2J53 A;  2N9E B;  2E3T A;  3ZJU A;  1QOF A;  4WIP A;  3N30 A;  2IPK D;  2MJE A;  1MG4 A;  1YX6 B;  4PYZ A;  1RFA A;  3DBL B;  5G55 A;  4EZJ A;  1YQ4 B;  3PS6 A;  3U2S C;  3BK2 A;  2MLB A;  3ZNZ B;  2CKH B;  4GDL A;  5TR5 A;  3PRE A;  3HVZ A;  2MWS B;  1JWU D;  5D7G A;  2B76 B;  4FXC A;  2HDE A;  1DOX A;  2JZP A;  4JLC A;  2DWQ A;  3QJZ A;  3A9J B;  1KLV A;  1YN3 A;  3RUI B;  1NEN B;  4HWI B;  3J9C A;  1FNU A;  1P1A A;  4NZL B;  1KF6 B;  3PRP B;  1XQQ A;  1PYW D;  1KJT A;  3Q3J A;  1C4P A;  4MGK E;  2N7D A;  4G3X B;  1SJE D;  2FBW B;  2W3S A;  3N1X C;  4R3D A;  3TEX A;  4GLS C;  3QCA A;  2EMS A;  4NAM A;  2MEK A;  4AUQ C;  2LFI A;  2BS2 B;  3GZN I;  1ACC A;  2W82 A;  1YQ3 B;  3VUX A;  4EZK A;  2K6Q A;  1L5P A;  2KWU B;  4YXD B;  1QOA A;  3QAQ A;  1BXT A;  5H8Y E;  5BYR A;  3KW5 B;  4WAA A;  2L0T A;  2BWE S;  3GS2 A;  4XE0 A;  3IG3 A;  3KYC D;  3Q14 C;  3GOE A;  5IO9 A;  4OHJ A;  1RFK A;  2KAJ A;  4I6N B;  4LLG M;  3RT3 B;  3KWV A;  3PLU A;  1IBX B;  4A3P A;  5JZE B;  1RLF A;  2MBH A;  2V3P A;  1ZUD 2;  1L0Y B;  3V3X A;  3H8H A;  3R2I A;  4P1C C;  2G4D B;  3EUB 2;  1V80 A;  3L08 A;  1Y8R C;  2H88 B;  3U7D A;  4XDD A;  1MFW A;  1STE A;  1J7A A;  2K22 A;  4RCO A;  2AL3 A;  4IW0 A;  3BIN A;  4PS3 A;  4A55 A;  2NR2 A;  3CF6 E;  4HK2 A;  4C80 A;  3VAW A;  3DDC B;  1RM6 C;  2QC8 A;  1WR6 E;  2A4Z A;  2X8X X;  1OQR A;  4P7I A;  2KAC A;  1CQV A;  2PEA A;  3NRZ A;  1GB4 A;  2KN4 A;  3DCG A;  4KZ0 A;  4FJZ A;  4C7Z A;  4TKN A;  1Q1O A;  1WRD B;  1K8R B;  1E8W A;  1MI0 A;  1XCQ L;  1LXD A;  1PGA A;  1YJ1 A;  3Q3O C;  4BAX A;  1SIJ A;  5IAA C;  2LUM A;  4KSK C;  2EKI A;  4KX6 B;  2NTS A;  1YQB A;  4ZHO A;  1N62 A;  4OVU A;  2LXA A;  3UQB A;  2N1V A;  1QLB B;  1QKZ A;  1Q0W B;  4WJO A;  3ZKJ C;  4C56 C;  2IY0 B;  3BVG A;  4US9 A;  2N0S B;  1DGJ A;  4HJK A;  1WZ3 A;  2HTM E;  1VD2 A;  4FJV B;  2KDI A;  3P63 A;  3VDZ A;  2EKE C;  4YTM B;  1E7V A;  4MJS B;  2M4N A;  2CR5 A;  2IO0 B;  1KLU D;  3C8Y A;  4C4V A;  1ZDV A;  1Q10 A;  4BKS D;  1GAQ B;  1LO5 D;  1SE4 A;  3CMM B;  1WJ4 A;  2C5L C;  4HPP A;  2N9K A;  1ZXI A;  3T3N A;  5C2T B;  2AYO B;  2LRU A;  4NQK E;  3ZYY X;  3WAL A;  2LGY A;  1TT5 B;  1IP9 A;  3UIP B;  2CJN A;  4K7W A;  4AOF A;  4P6V F;  1N5X A;  1FXT B;  4A3O A;  4JWU C;  5H92 C;  3VR8 B;  3APC A;  4TUU A;  4KKI A;  5AUK A;  1V8C A;  4B0E A;  2WU5 B;  2M8S A;  2AWT A;  3BY4 B;  2N9X A;  1JCK B;  3R2T A;  3ZXR A;  3V61 A;  3VHT C;  1ENF A;  2MJD A;  2NPT A;  3AXC A;  4E3C A;  4LNO A;  3DBH B;  4NJC A;  3TEW A;  4WJQ A;  4AJY B;  4ZYS A;  3L0W B;  4FJY A;  4YWG G;  3BYY B;  3N3K B;  1FNW A;  3QQ8 B;  2KMA A;  4CQN A;  1L2N A;  2OOB B;  2Y3A A;  1AN8 A;  1SE3 A;  1V1O A;  3PZ7 A;  3DHH C;  2PE6 B;  4ZYN A;  1FRR A;  1SSN A;  4NQL B;  4II3 B;  1L6V A;  3PO0 A;  3TSS A;  3C19 A;  2N9P C;  1AWD A;  3OWE B;  3QAR A;  2KVZ A;  4RF1 A;  5EE3 A;  1FCC C;  1TTN A;  2Y5C A;  1B1Z A;  4MGY E;  3PRZ A;  2PMV A;  3U30 A;  4JQW C;  2DZI A;  2M56 B;  4RGN A;  4AP4 C;  4ARC A;  4UDU C;  1FPY A;  3TMP B;  4DHZ E;  2PVO D;  1RYJ A;  3NZ3 A;  3MTN B;  2GRI A;  3GB1 A;  1WE6 A;  4FAD A;  2ONQ A;  4QAY A;  2O6V B;  5DPR A;  2MRP A;  2LZ6 A;  2V3N A;  4GOC A;  3N1Z C;  4KIK B;  3MP9 A;  3Q8A A;  1JML A;  3H7S A;  4DDG D;  2KQS A;  4FA6 A;  2FCN A;  3UGB B;  3VH4 B;  4K3B A;  4WJN A;  4CYE A;  1SF0 A;  5HG2 A;  3RNG C;  3GE3 C;  4WWP A;  3A1Q A;  3PHW B;  4XWW A;  2HJ1 A;  2WDR B;  4J6I A;  3JSV B;  1SB3 C;  1IGC A;  2KTR B;  3AB5 A;  2KT7 A;  2WS3 B;  1E9M A;  2V4I B;  2WXG A;  3IT4 B;  2HE7 A;  1R4M B;  2HJ8 A;  1HTO A;  1K53 A;  3I57 A;  3AEB B;  3UI3 A;  1YX5 B;  3ZXV A;  3NOB A;  2BVC A;  1U4A A;  4B6W A;  1LFD A;  3ABV B;  2DYB A;  4ZRI A;  1XLO A;  4JWS C;  5GMV A;  1R7S A;  4K1R B;  1UEL A;  1GPX A;  5E6N A;  5L95 C;  4S0R A;  4DQO C;  3E9S A;  3MFG A;  1F0Z A;  5HKH A;  3P4R B;  3URY A;  1A5R A;  1J8C A;  2I1J A;  2GBJ A;  1E10 A;  3AE2 B;  4YSZ B;  5IKC M;  5AEK B;  2WNM A;  1BT0 A;  2LRW A;  1JRP A;  1XLQ A;  1UUP A;  2D3G A;  4MT5 A;  4BZA A;  3WAN A;  3P4Q B;  2E6X A;  3ZTD A;  5LNK 1;  2DEN B;  2G3Q B;  1WJU A;  1EM7 A;  2BTE A;  2LHE A;  1NEK B;  3DBR B;  5HI1 A;  1OQY A;  1EF5 A;  1OEY A;  2G45 B;  1TGZ B;  3RNE C;  4F7Z A;  3QA8 A;  2VRR B;  2Y5P A;  1V86 A;  3QHT A;  5E6O A;  4C00 A;  4I6P A;  1T6B X;  2GOW A;  2J0K A;  1WY8 A;  1Z2M A;  2XK5 B;  1HTQ A;  1F2R C;  1E5W A;  1N60 A;  2KN5 A;  1TS4 A;  2CJO A;  2JQR B;  4LTU A;  2WQY B;  3BVM A;  1GNU A;  2L83 A;  5D6J B;  2LGX A;  2NVU I;  2XNA C;  4W9K A;  2IZV B;  1GOZ A;  4XZ4 A;  2L7R A;  1P3Q U;  2QCZ A;  2VH2 A;  4W9F A;  4B9K A;  5FR3 A;  2ZVO A;  3Q3N C;  3D32 A;  2PE9 A;  3I3T B;  1I35 A;  4MM3 A;  2ZNV B;  2K8H A;  1QOG A;  3H9D A;  2Z8L A;  4ZRQ A;  4GDK B;  5AUI A;  3U8Z A;  2KK8 A;  3HM3 A;  4RNA A;  3MHZ A;  2BS3 B;  2WYQ A;  2J52 A;  4EOY A;  4FHK A;  4HEA 1;  3VQI A;  2LD9 A;  4EE2 A;  2NBW B;  2ZCC A;  3AEE B;  4TV3 A;  3VTU A;  2D07 B;  2PPH A;  3UQA A;  2V4L A;  1T0S C;  1UGM A;  5C1Z A;  2WXF A;  4MAC A;  3QC8 B;  5LLI A;  1SJH D;  3R8B A;  4IWQ A;  1J7B A;  1PDX A;  1C9F A;  2L52 A;  3JYU A;  3TBL D;  1FFV A;  5BMI A;  3PSE B;  1YJI A;  3ZDM C;  3IHP C;  4IM0 A;  2KZR A;  5GXG B;  3Q8C A;  2ZEQ A;  3FIL A;  1UD7 A;  1F2R I;  4ZDV A;  3OAW A;  3IFW B;  2ICI A;  2IO3 B;  3U52 E;  1TKG A;  1ZDX A;  3HUI A;  1XEE A;  5T8I A;  2PIA A;  2INP E;  2N4F A;  2KQ4 X;  3P4P B;  1I4X A;  2OJR A;  4MSQ B;  3EGR A;  3AE8 B;  1L0X B;  2WXN A;  2KFK B;  1ZOY B;  4B95 A;  2O6V D;  1HQR D;  1EO6 A;  3ETR A;  2K6D B;  4HPL B;  2XEW A;  2KJH B;  3M3J A;  1I4R A;  1OQQ A;  2V1Y A;  4FN2 A;  2WXQ A;  5DPT A;  4YSX B;  1YOV B;  3X23 A;  1N6Z A;  5IOI A;  3FAH A;  3LJ3 A;  3W1S C;  2KWV B;  2BF8 B;  4HPM B;  3Q8B A;  4W9H A;  2PJH A;  3A9K A;  2J0J A;  4N59 A;  2CHW A;  2WXO A;  4KDL B;  4XDC A;  3RZW C;  2DX5 B;  5LXI B;  2KOX A;  5C23 A;  2YVC A;  4WH4 A;  2LAS A;  3Q6B A;  5CHF A;  3DBS A;  3AEG B;  1E7P B;  3SR6 A;  1HA5 A;  4G11 A;  1SE2 A;  2J0M A;  1UNS A;  3KQ4 A;  4BKG A;  2WX1 A;  2WLB A;  1GB1 A;  2BS4 B;  4BKS A;  2YEP B;  2JZZ A;  3BZD B;  1A70 A;  1L0V B;  4HCN B;  2C7M B;  3WCQ A;  1C4A A;  4W9G A;  2KXJ A;  3SD5 A;  2JU6 X;  4USA A;  4MEL A;  2L1A A;  1HZ6 A;  3K9P B;  1FXI A;  2CS4 A;  1RAX A;  2JPH A;  2IBI B;  3VUW A;  1K51 A;  3AE9 B;  3TL5 A;  1R4N I;  2MCN B;  2D2Q A;  3N32 A;  4WAF A;  2JVC A;  1D5X C;  2DLB A;  5E6J A;  2JRI B;  3ZLZ A;  1ISN A;  1VZ6 A;  4ITK A;  2LJ5 A;  1T0Q C;  2AQ1 B;  2JUO A;  3X0W A;  3N20 C;  1TBE A;  4L23 A;  3DWG C;  1J0G A;  2IDY A;  4P1B C;  1UWM A;  1WI0 A;  4IC7 B;  1WR1 A;  2PVG C;  2WDQ B;  4XGA B;  2MBE A;  3AH7 A;  3AM9 A;  4PYU A;  3PTF C;  2Z59 B;  3SFD B;  1YJJ A;  1AYF A;  3B2F A;  2REX A;  1GC6 A;  2INC C;  3A9J A;  3NVZ A;  3Q3F A;  4MH0 E;  1I7H A;  2FIF A;  5TSS A;  3CIR B;  2DAJ A;  4OVZ A;  4II2 B;  2GB1 A;  5E6P A;  5J17 A;  2FNJ B;  2H89 B;  5L83 A;  4BVU C;  4YSY B;  4DBG A;  3BK1 A;  2MHJ A;  1QIL A;  2BW2 A;  3H1U A;  2RDB C;  2MP2 B;  4MH8 A;  3DHI C;  2GLS A;  1BML C;  1VZ7 A;  4NNJ B;  2WXR A;  5IN7 A;  2L32 A;  1V1P B;  4DDI D;  4W9C A;  1T3Q A;  2K3U A;  4ZOH C;  2C7N B;  2KD0 A;  2MA9 B;  2R61 A;  3KUD B;  1FCL A;  4BBN C;  2ZPY A;  3DVG Y;  1GC7 A;  1E8Z A;  1WE7 A;  1P7E A;  2L3Z A;  2MX2 A;  4IM2 A;  3CST A;  3AMZ A;  1EWC A;  3UIO B;  1IBX A;  5CX3 A;  3ZTC A;  4M8N A;  4A6Q A;  4EEW A;  1V81 A;  4ICV A;  3TUO A;  4XWT A;  2IO1 B;  3VVW B;  1K50 A;  4IM3 A;  2QHO A;  5FK9 C;  2FAZ A;  2D11 A;  3HRD D;  5BYQ A;  3AU4 A;  1KM7 A;  1UZX B;  1FNV A;  3SFE B;  3TIX A;  5J2R A;  2RR9 A;  4E74 A;  3A4S C;  3DHG C;  3L16 A;  1YIW A;  4KGT A;  1ESF A;  1TJE A;  5AZF A;  2FCM A;  3NS8 A;  2D3C A;  1C4C A;  4IOI E;  4IG7 B;  1C1Y B;  2IGD A;  2K9X A;  2M19 A;  4JPS A;  4RH6 A;  3H7P A;  3W1S A;  2GBR A;  2RDH A;  2VZK B;  3UF8 A;  2MH7 A;  2RMM A;  1J19 A;  2LUE A;  2MW5 A;  3NG0 A;  5HFY A;  1D3Z A;  2ACZ B;  4C7Y A;  2KAN A;  2AQ2 B;  3ML9 A;  3EHV A;  1L7Y A;  3AE7 B;  3SEB A;  2BB5 A;  2GBK A;  4OZB A;  2INN E;  2K0P A;  4YTP B;  2L05 A;  1WXV A;  3PV1 A;  3KWL A;  2KDE B;  1RWS A;  1TS5 A;  2FCS A;  3KYD D;  3AE1 B;  3LB8 C;  3IT6 B;  3L4P A;  3ALB A;  4MJS A;  2QSD A;  4DXF A;  1YN4 A;  4FUL A;  3N1Y C;  1VDV A;  4WWO A;  1D5Z C;  4KVG B;  2QDF A;  4E71 A;  3V6E B;  1I42 A;  1V5T A;  1WXA A;  1JW9 D;  3IXS A;  2ZPN A;  2D3A A;  2PLP A;  4LNI A;  4W9L A;  2JZ3 B;  1XXG A;  2DZM A;  3DVG X;  1WJN A;  2LXC A;  3RUL A;  2Y5B B;  1S1Q B;  3S2A A;  3DVN V;  3RPF C;  3HHM A;  4HJG E;  2GBM A;  2KVR A;  3ZRC A;  2VH1 A;  2GI9 A;  3VRA B;  1TKY A;  4JGH B;  3FKY A;  1XLN A;  1UF0 A;  2NBU A;  3DWM A;  2KHW B;  5EDS A;  2KMM A;  2WDT B;  1ZW7 A;  1R4M I;  2DAF A;  2ZNV C;  4HXD A;  1FEH A;  1TY2 A;  2C7H A;  4OZC A;  2C9W B;  4MGZ E;  3IVF A;  2WHI A;  1QF6 A;  3ZGZ A;  2DBY A;  2W3R A;  1NVI D;  1ZE3 D;  1LGR A;  3BVZ A;  1TIF A;  1GG3 A;  1SXT A;  1OFF A;  1SEB D;  1UBI A;  3HIZ A;  4OW0 A;  2NTT A;  1JWM D;  3DQV A;  3U4E G;  4N9F 4;  1KOT A;  1OEY J;  1VCB A;  4NY0 A;  4OZA A;  2G4S A;  3NZS A;  2JSV X;  4TQ0 A;  3DPD A;  4TMA B;  5D94 A;  3ZQ4 A;  1F52 A;  4WWN A;  1PGB A;  4MSM B;  1WF9 A;  2K1F A;  2ON8 A;  3B2G A;  4JIO U;  4WQM A;  4S17 A;  1FIQ A;  4WJP A;  1WWT A;  1M94 A;  1XD3 B;  3VXW A;  2QJL A;  1QOB A;  3DBR I;  1S3S G;  3M95 A;  1WYW B;  1Q5W B;  3PLV A;  2J42 A;  1FO4 A;  4ANV A;  2XBB C;  3RYT A;  4OVV A;  1C76 A;  2O2V B;  1N61 A;  2N7J A;  1C79 A;  2D5G A;  3Q8F A;  4W9D A;  1PGX A;  3LXF A;  4EKU A;  2ZCB A;  1WX8 A;  5G5G A;  3WA0 A;  4KIK A;  4MEM A;  4LNK A;  1WMH B;  4ANW A;  3WAO A;  1DOY A;  3AE4 B;  1MHX A;  4LNN A;  5CHW A;  3VFK A;  1E8Y A;  2TSS A;  4KGR A;  2KLC A;  1WXS A;  1LQB A;  2EMT A;  3IAM 1;  1V2Y A;  2FCQ A;  2UYZ B;  3AE5 B;  3AN1 A;  2G1E A;  5EE9 A;  4AJW A;  3JSV A;  3RNC C;  3M62 B;  2CU3 A;  1F77 A;  4N6E B;  4CO7 A;  2ZW1 A;  5J18 A;  2WDV B;  2LI5 A;  5BYS A;  3QK0 A;  5KHO A;  4FHJ A;  1TY0 A;  2JF5 A;  3DVN U;  3AV8 A;  3Q3M C;  1OTR B;  2WGS A;  3B9J A;  2KX3 A;  3LYY A;  4KKJ A;  3AU5 A;  2WXI A;  1KRH A;  5FR6 A;  4REZ A;  2M17 A;  3EFC A;  2BYV E;  4IUM B;  3K9O B;  2VZK D;  5D3D A;  3T8M A;  2L00 B;  3V62 A;  4GDL B;  3P2B A;  1IPG A;  2GBN A;  3A9K B;  3N9Y C;  2AL6 A;  2KWC A;  1QQR A;  4JE3 B;  1T0R C;  1V6E A;  3APF A;  3APD A;  2KJR A;  1WXM A;  4YL8 A;  4H2A A;  3AE3 B;  2JWU A;  4LCD E;  4KGS A;  2KFJ A;  3KLS X;  4IKG A;  2W9N A;  2LGD A;  4M0W A;  2LVQ A;  1VJK A;  1BUI C;  1WYG A;  3VTV A;  2WX0 A;  5D2M B;  3PVL A;  1N63 A;  2JXX A;  4NAW A;  4RFB A;  1JQ4 A;  2FE8 A;  2QIL A;  4MDK E;  1JAL A;  4FLH A;  1DYQ A;  2KDM A;  3QWZ B;  3DBL I;  1UWX A;  2KDB A;  2Q5W D;  4ASW C;  2N9L A;  4XYC A;  5DPW A;  2J4X A;  1KFY B;  4WWM A;  1E0Z A;  1C77 A;  4HLE A;  2MQJ A;  2BGF A;  4K3C A;  1ZGU B;  4CHK A;  4LDT B;  4RGT A;  2LWP A;  1UGJ A;  1MG8 A;  3NJT A;  5DPS A;  1YD8 U;  5G2N A;  1V49 A;  4ZRK A;  2MBQ A;  4HVB A;  1E7U A;  3KH0 A;  1IUE A;  4PS7 A;  2LEK A;  3L10 B;  1MPE A;  3AE6 B;  1LM8 B;  2QEJ C;  1WM3 A; 
#chains in the Genus database with same CATH homology
 1ZKH A;  4NNJ B;  1UH6 A;  1E90 A;  4JL9 A;  3ECI A;  1P9D U;  5KHQ A;  3MTN B;  4DDI D;  4NJ7 A;  2R2Q A;  2WWZ A;  4W9C A;  1WE6 A;  4FAD A;  4GIV A;  4GGQ A;  2O6V B;  2C7N B;  5DPR A;  3TCA A;  2KD0 A;  2MA9 B;  2MRP A;  2LZ6 A;  3KUD B;  4GOC A;  4KIK B;  2KJ6 A;  3H7S A;  2ZPY A;  4BBN C;  4DDG D;  2M1M A;  3DVG Y;  2KQS A;  1WZ0 A;  4FA6 A;  1HE8 A;  4URK A;  2JY6 A;  1GC7 A;  1E8Z A;  3PPA A;  1T0Y A;  2FCN A;  1WE7 A;  2MX2 A;  2L3Z A;  3QIJ A;  4IM2 A;  2BPS A;  3CST A;  3UGB B;  4GU2 A;  3VH4 B;  3AI5 A;  4ANX A;  1RRB A;  4ICU A;  4WJN A;  3UIO B;  3ML8 A;  2DZJ A;  1WX9 A;  4ZRJ A;  4CYE A;  4GXB A;  3RZF A;  4F1S A;  4LJO B;  4NPN A;  4WWP A;  2GMI C;  3ZNH B;  5CX3 A;  3A1Q A;  3PHW B;  2NBV B;  3ZTC A;  1V9J A;  3L54 A;  4M8N A;  2KC2 A;  4NJ6 A;  4EEW A;  1V81 A;  1WH3 A;  4ICV A;  4J6I A;  3JSV B;  4K7U A;  2KTR B;  2IO1 B;  3VVW B;  2BYF A;  4EFO A;  2HE7 A;  4IM3 A;  3C0R B;  2QHO A;  3IBE A;  2FAZ A;  2KX0 A;  2D11 A;  2HJ8 A;  2CHZ A;  3AU4 A;  3ZW3 A;  1EF1 A;  3QX1 A;  1KM7 A;  3CSF A;  1UZX B;  4EZL A;  3TIX A;  2IY1 B;  5J2R A;  1YX5 B;  2KTF A;  2BYE A;  3NOB A;  2RR9 A;  2O2V A;  4LJP B;  1U4A A;  4B6W A;  1LFD A;  2M0X A;  2K25 A;  3A4S C;  4E74 A;  1G6J A;  3L16 A;  2DYB A;  4ZRI A;  3OLM D;  5JHB A;  2YLM A;  1YIW A;  2KFK A;  2MSE D;  3HK0 A;  4W9I A;  2DZK A;  2FCM A;  2ZZP B;  3NS8 A;  5GMV A;  3PGE A;  5AZF A;  1GJZ A;  4K1R B;  1UEL A;  4IG7 B;  1C1Y B;  1JRU A;  2XK5 A;  5E6N A;  5L95 C;  3H7P A;  2Z0E B;  3W1S A;  2L0F A;  3B0A A;  2GBR A;  4GMV A;  5LXH A;  1WMH A;  4KSL C;  5HKH A;  3ZNG C;  3UF8 A;  3M63 B;  3NY5 A;  1J19 A;  2LUE A;  2MW5 A;  4BBN F;  1A5R A;  1J8C A;  2I1J A;  2GBJ A;  1D3Z A;  4RM8 A;  2C60 A;  4BOZ B;  2KAN A;  4ANU A;  5DCN A;  5AEK B;  2ZJD A;  3R3M A;  1BT0 A;  3ML9 A;  3EHV A;  1L7Y A;  2KC1 A;  2LRW A;  1WGD A;  4BKT A;  2RSU A;  2NS5 A;  3RCZ A;  2GBK A;  2IYD B;  4WQO B;  2K8C A;  1WM2 A;  2D3G A;  5CTR C;  2L05 A;  2KLG A;  2Z0D B;  1WXV A;  3WAN A;  3ZTD A;  2FUH B;  3R7Q A;  4IWP A;  2DEN B;  2DYM A;  5CHV C;  2G3Q B;  3SDL C;  5AZH A;  1WJU A;  3PV1 A;  3VH3 B;  4BOS C;  4G0N B;  2BWF A;  2KDE B;  2NPT B;  1NBF C;  4GDK A;  3B08 A;  2FCS A;  4HDQ A;  3MJW A;  1OQY A;  1EF5 A;  4A20 A;  1OEY A;  2G45 B;  1TGZ B;  3KYD D;  2B3A A;  3KUZ A;  2R2O A;  3L17 A;  1F9J A;  4F7Z A;  1WGG A;  1SIF A;  3QA8 A;  2VRR B;  1V86 A;  3QHT A;  5E6O A;  3ALB A;  4MJS A;  2N9E B;  4I6P A;  2GOW A;  2J0K A;  2D10 A;  1WY8 A;  1Z2M A;  2XK5 B;  2K39 A;  3VTW A;  3N30 A;  3H7P B;  4FUL A;  1WIA A;  1E5W A;  2KN5 A;  3PT2 B;  1YX6 B;  4WWO A;  2CHX A;  4PYZ A;  4KVG B;  3HM6 X;  4E71 A;  1RFA A;  5G55 A;  3V6E B;  1V5T A;  4EZJ A;  1I42 A;  1WXA A;  1GNU A;  5D6J B;  2ZPN A;  2RGF A;  3PS6 A;  2LGX A;  2NVU I;  4W9L A;  4W9K A;  3ONS A;  2JZ3 B;  2IZV B;  2DZM A;  3JVZ X;  2MLB A;  3DVG X;  1WJN A;  4XZ4 A;  2LXC A;  2L7R A;  3ZNZ B;  2CKH B;  1P3Q U;  4GDL A;  5TR5 A;  2Y5B B;  1S1Q B;  3PRE A;  3RUL A;  2BKF A;  5AZG A;  2MWS B;  4W9F A;  5D7G A;  4IWO A;  3S2A A;  4B9K A;  2ZVO A;  3DVN V;  1NI2 A;  4JLC A;  3HHM A;  4KZC A;  3D32 A;  2PE9 A;  3I3T B;  5BO4 B;  1I35 A;  3QJZ A;  4MM3 A;  3A9J B;  1KLV A;  3RUI B;  2ZNV B;  2K8H A;  1WGR A;  2JT4 B;  2GBM A;  3H9D A;  4HWI B;  2KVR A;  3UIN B;  1P1A A;  3ZRC A;  2KNB A;  4JGH B;  3TJP A;  2NBU A;  3PRP B;  4GDK B;  2KHW B;  1XQQ A;  5EDS A;  1KJT A;  3U8Z A;  2WDT B;  2KK8 A;  1ZW7 A;  3HM3 A;  1R4M I;  2DAF A;  2ZNV C;  3Q3J A;  4HXD A;  2WYQ A;  4MGK E;  2C7H A;  2N7D A;  4G3X B;  4EOY A;  1GUA B;  2C9W B;  4FHK A;  4DHJ B;  4MGZ E;  3IVF A;  3VQI A;  3QCA A;  2EMS A;  1V5O A;  2LD9 A;  4AUQ C;  2NBW B;  2ZCC A;  3DBH I;  3GZN I;  2DYO A;  4X57 B;  3VUX A;  4TV3 A;  3VTU A;  1GG3 A;  4EZK A;  3HIZ A;  1UBI A;  2K6Q A;  3DQV A;  2HD5 B;  2KWU B;  3SHQ A;  3WIM A;  2D07 B;  4N9F 4;  2L76 A;  2PPH A;  1KOT A;  3EEC A;  1OEY J;  1VCB A;  4NY0 A;  3UQA A;  2J7Q B;  2V4L A;  3V60 A;  3QAQ A;  2DHZ A;  2G4S A;  3NZS A;  3KW5 B;  1UGM A;  4WAA A;  5C1Z A;  2L0T A;  2BWE S;  4MGI E;  4TQ0 A;  3IG3 A;  3KYC D;  3GOE A;  3QC8 B;  5LLI A;  3ZRF A;  2N1W A;  1PQS A;  3DPD A;  4IWQ A;  5D94 A;  2KMC A;  3RT3 B;  4I6N B;  1IYF A;  3ZUN A;  3JYU A;  3TBL D;  4WWN A;  3PLU A;  2I1K A;  1OGW A;  4MSM B;  4A3P A;  2HTH A;  5JZE B;  1RLF A;  2MBH A;  3PSE B;  3PZD A;  1WF9 A;  4LDT D;  2K1F A;  2JRH A;  4JIO U;  1Z5S B;  3A1Q B;  3ZDM C;  3IHP C;  4IM0 A;  3RD2 A;  1UBQ A;  4WJP A;  2KZR A;  2ASQ A;  2G4D B;  1V80 A;  2AEH A;  1M94 A;  1XD3 B;  3L08 A;  1Y8R C;  2KKC A;  2ZEQ A;  3MHS D;  3VXW A;  3U7D A;  1UD7 A;  3WAP A;  2A5U A;  3DBR I;  4ZDV A;  1S3S G;  3OAW A;  4HCP B;  1SGH A;  3IFW B;  2AL3 A;  4EUT A;  2IO3 B;  3M95 A;  4IW0 A;  3V6C B;  1WYW B;  3BIN A;  4PS3 A;  4RMA A;  2KDF B;  1Q5W B;  3PLV A;  2RD0 A;  2UWQ A;  2NR2 A;  1X1M A;  4ANV A;  2MP2 A;  3A33 B;  2N4F A;  2XBB C;  3PHX B;  1P98 A;  3RYT A;  3CF6 E;  4OVV A;  2O2V B;  4HK2 A;  3VAW A;  2OJR A;  3DDC B;  2RPQ A;  4MSQ B;  4M8M A;  1CMX B;  1WR6 E;  4DK5 A;  2KFK B;  2A4Z A;  4W9D A;  3AUL A;  4EKU A;  1WJ6 A;  4GB9 A;  4B95 A;  2ZCB A;  1WX8 A;  2O6V D;  4P7I A;  1EO6 A;  3JW0 X;  3ENE A;  3W1Y A;  2K6D B;  4HPL B;  3ZNI D;  2PEA A;  2XEW A;  3WA0 A;  2KJH B;  3DCG A;  4KIK A;  3M3J A;  4KZ0 A;  4FJZ A;  2V1Y A;  4MEM A;  1WMH B;  4TKN A;  4FN2 A;  1Q1O A;  1WRD B;  4ANW A;  1K8R B;  3WAO A;  5DPT A;  4G50 A;  5CHW A;  1E8W A;  3VFK A;  3X23 A;  1E8Y A;  1LXD A;  1YJ1 A;  2KLC A;  3LJ3 A;  1WXS A;  3W1S C;  1NDD A;  2KWV B;  2BF8 B;  5IAA C;  2KO3 A;  4HPM B;  1LQB A;  2EMT A;  4KSK C;  4W9H A;  1V2Y A;  3ZDT A;  2FCQ A;  2UYZ B;  2PJH A;  3A9K A;  3KUC B;  1YQB A;  4RM9 A;  2J0J A;  4AJW A;  2CHW A;  4OVU A;  2LXA A;  4KDL B;  3JSV A;  3UQB A;  2N1V A;  1C3T A;  3M62 B;  1Q0W B;  4WJO A;  2FID A;  3ZKJ C;  3RZW C;  4CO7 A;  2IY0 B;  2V3S A;  3VUY A;  2DX5 B;  5LXI B;  2KOX A;  2JWZ A;  2YVC A;  5C23 A;  5J18 A;  4HJK A;  2LAS A;  1WZ3 A;  2LI5 A;  4PS8 A;  2ZVN A;  3QK0 A;  1VD2 A;  1AAR A;  4FJV B;  4K7S A;  2KDI A;  5CHF A;  5KHO A;  3DBS A;  2KQ7 A;  4FHJ A;  3VDZ A;  2L8J A;  2JF5 A;  2EKE C;  3DVN U;  1E7V A;  4G11 A;  4MJS B;  1OTR B;  2M4N A;  3SU8 X;  2CR5 A;  2IO0 B;  3NZU A;  2J0M A;  2KX3 A;  5JH5 C;  4BKG A;  3ZO5 B;  2WX1 A;  4BKS D;  3AU5 A;  1EUV B;  5FR6 A;  4BKS A;  4GSW A;  3WAM A;  2JZZ A;  3L13 A;  3CMM B;  2C5L C;  1WJ4 A;  2M17 A;  2MBO A;  4HCN B;  2C7M B;  2BYV E;  3B1L X;  2K8B A;  3K9O B;  4IUM B;  2AYO B;  4TQ1 A;  4W9G A;  2KXJ A;  2LRU A;  3SD5 A;  3T8M A;  2L00 B;  3V62 A;  4GDL B;  4HDO A;  4DHZ B;  3P2B A;  4MEL A;  1IPG A;  4NQK E;  3WAL A;  2GBN A;  2LGY A;  3A9K B;  3R66 C;  3K9P B;  2AL6 A;  2KWC A;  2CS4 A;  1WFY A;  2LVP A;  1IP9 A;  5JHA A;  1RAX A;  3UIP B;  4K7W A;  1XT9 B;  2JPH A;  4AOF A;  2IBI B;  1FXT B;  3VUW A;  4A3O A;  1V6E A;  3APF A;  3APD A;  2KJR A;  1WXM A;  4BFR A;  3APC A;  4YL8 A;  4TUU A;  4XC2 A;  3EC8 A;  3TL5 A;  4LCD E;  4AWJ A;  3ZIM A;  1R4N I;  2MCN B;  1WGY A;  2M8S A;  2AWT A;  2D2Q A;  3BY4 B;  3N32 A;  2N9X A;  3H6N A;  2KFJ A;  2JVC A;  3V61 A;  3VHT C;  2W9N A;  2NPT A;  3AXC A;  2JRI B;  2LGD A;  3ZLZ A;  4E3C A;  1ISN A;  2LVQ A;  2CU1 A;  1QZE A;  2MBB B;  3LDZ E;  4DWF A;  1H4R A;  2LVO A;  2LJ5 A;  4WJQ A;  2JUO A;  3VTV A;  3X0W A;  1SE9 A;  4AJY B;  2WX0 A;  5D2M B;  4F8C B;  3PVL A;  3L0W B;  2JXX A;  4FJY A;  4NAW A;  1TBE A;  3N3K B;  3QQ8 B;  4XX5 A;  2IO2 B;  4MDK E;  1J0G A;  4FLH A;  1TZ1 A;  4GN1 A;  1E8X A;  2KMA A;  3QWZ B;  3R7R A;  1L2N A;  3DBL I;  2OOB B;  2KDB A;  4ASW C;  1WI0 A;  4IC7 B;  1WR1 A;  3NHE B;  2MBE A;  4FBJ B;  1WX7 A;  4I6L B;  5DPW A;  4PYU A;  3PTF C;  2Z59 B;  3OJ3 A;  1WGH A;  2PE6 B;  2O6V A;  3OJ4 B;  4ZYN A;  3TMP B;  2REX A;  1GC6 A;  3A9J A;  3PRM B;  4HLE A;  3Q3F A;  4MH0 E;  4NQL B;  2MQJ A;  4II3 B;  2BGF A;  3T9L A;  3O65 B;  3KVF B;  1ZGU B;  4K81 A;  4W9E A;  4CHK A;  4LDT B;  1H8C A;  4DXA B;  2FIF A;  4M0W B;  2N9P C;  4W9J A;  3ZVV A;  2LWP A;  3QAR A;  2DAJ A;  1MG8 A;  5DPS A;  5IA7 A;  1YD8 U;  3DOW A;  2NCN A;  5G2N A;  1V49 A;  1TTN A;  4II2 B;  5E6P A;  4ZRK A;  2MBQ A;  5J17 A;  2FNJ B;  1E7U A;  3KH0 A;  4HVB A;  1P0R A;  4DHJ D;  4MGY E;  2N7E A;  5L83 A;  4BVU C;  3PRZ A;  4PS7 A;  3A4R A;  3EFU A;  4NAW B;  4DBG A;  3L10 B;  3U30 A;  4JQW C;  2DZI A;  2KTR A;  3H1U A;  1LM8 B;  4KDI C;  2MP2 B;  4KV2 A;  4AP4 C;  2BKR B;  1WM3 A;  4DHZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...