3DR6A

Structure of ynca, a putative acetyltransferase from salmonella typhimurium
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
172
Chain Sequence
AMTIRFADKADCAAITEIYNHAVLHTAAIWNDRTVDTDNRLAWYEARQLLGYPVLVSEENGVVTGYASFGDWRSFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVMVAGIESQNAASIRLHHSLGFTVTAQMPQVGVKFGRWLDLTFMQLQLDEHAAPDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords yncA
publication title Funded by the national institute of allergy and infectious diseases of nih (contract number hhsn272200700058c).
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 51
structure length 172
sequence length 172
chains with identical sequence B, C
ec nomenclature ec 2.3.1.-:
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3dr6A00
2G3TA 4E8OA 3SHPA 5IB0A 3R95A 4ONUA 3PP9A 1M44A 4KLVA 4XPLA 2FIWA 4B5PB 4BMHA 4CAVA 2Q4YA 2EUIA 2I00A 4KOTA 2IL4A 3DSBA 2OZUA 2P0WA 2VBQA 2JDDA 3DR6A 2ZPAA 3QAHA 2AJ6A 1IIDA 5F46A 2ZW6A 4PK3A 3BJ8A 5H84A 1XIXA 1LRZA 3I9SA 2NMTA 4CAXA 4KOVA 4II9A 1NSLA 5EBVA 3EFAA 4KOUA 3S6GA 4CRYB 4XPDB 1Z4RA 1Z9UA 3SXNA 3KKWA 4AG9A 2VEZA 4R87A 2FT0A 4F6AA 2ATRA 4KLWA 5F48A 4B5PA 3TT2A 3JVNA 3VWEA 4JJXA 4YGOA 1B6BA 4UBRA 1GHEA 3R96A 2P6GA 4LUAA 5DWMA 2J8MA 4JLYA 2Q4VA 2PSWA 2C27A 3ZZIA 1VKCA 5KTDA 3FNCA 1BO4A 4JXQA 3S6FA 2PC1A 4PSXA 2D4PA 4B5OA 4HNYB 2ZW7A 3IWGA 1MJBA 2Q0YA 1FY7A 5J8CA 4HNXB 2B5GB 4FD5A 2GE3A 3D3SA 5IX3A 2VI7A 2R7HA 3T9YA 3K9UA 5KTCA 3EY5A 2KCWA 4FD7A 2BEIA 2FL4A 3F0AA 2X7BA 5KTAA 2BUEA 4AG7A 4KOXA 1V0CA 4M85A 4FD4A 4DNCA 1KUXA 1MJAA 3RYOA 3MGDA 2QECA 3P2HA 1PUAA 1IICA 1M4GA 2JEVA 3TO6A 4QBJA 2OU2A 2B5GA 3B8GA 2B4BA 4HNWB 2G0BA 1Q2DA 3G3SA 3NE7A 1XEBA 4U9YA 5C82A 1Y7RA 5IV0A 2AE6A 1IB1E 2G3AA 1VHSA 4U9ZA 3GYAA 4XNHB 4YRHA 4NCZA 3CXPA 4M3SA 3LODA 5F49A 3F5BA 4JWPA 5EC4A 4CRZB 4RI1A 4PV6A 1I1DA 4QC6A 4KZTA 4UA3A 1YGHA 3EO4A 4MBUA 3DNSA 1S3ZA 3G8WA 2H5MA 2GANA 2F5IA 2P6EA 2PDOA 1S5KA 3E0KA 1YX0A 2P6FA 4L8AA 4XNHC 5E96A 3TO7A 1YVKA 1CJWA 1Q2CA 1KZFA 4H89A 4CS0B 1I12A 1N71A 4KOSA 2VZYA 2R1IA 4HKFA 1XF8A 4R9MA 1QSOA 1RXTA 2BL1A 2JLMA 3TO9A 3I3GA 4E0AA 3P2FA 4XPDC 3FB3A 4RS2A 1M4DA 2B4DB 3F8KA 3EC4A 2ZW4A 1S7KA 2K5TA 4KUBA 2PR1A 2PR8A 4QUSA 5F47A 1S60A 4MJ8A 4JD6A 4PK2A 2PRBA 3LD2A 2QIRA 3D8PA 3R9FA 1U6MA 1TIQA 3V8IA 2J8RA 3TCVA 5GCNA 3TOAA 2REEA 3DDDA 1M4IA 1Q2YA 4KORA 1Y9WA 1BOBA 2CNMA 5HH1A 4R3LA 2Q44A 3GY9A 5H86A 2B4DA 3R9GA 1YVOA 2GIVA 4CAWA 1XE4A 3W6XA 1NE9A 1NMTA 4AVCA 2Z10A 1KUYA 4I49A 4QVTA 2B58A 2R98A 5DWNA 4IF5A 1K4JA 1QSTA 1SQHA 4XPKA 3W91A 2WPXA 1P0HA 4YFJA 3VWDA 4OADA 1QSRA 4KOWA 4QB9A 1WWZA 3D2MA 3PGPA 1XMTA 2PQ8A 2FIAA 2BSWA 3FBUA 2EVNA 2CY2A 3R1KA 2REFA 1M1DA 3H4QA 2O28A 4AB7A 4MY3A 1I21A 2FSRA 3R9EA 4MI4A 1MJ9A 2OH1A 5FVJA 4NXYA 1B87A 4OAEA 2HQYA 3FRMA 5JPHA 4NEXA 4F0YA 2Z11A 4NF1A 2VZZA 2DXQA 4ORFA 2ZXVA 1QSNA 2HUZA 4EVYA 4X5KA 1KUVA 4Y49B 3C26A 5CNPA 2HV2A 3ZJ0A 4JXRA 1QSMA 2OB0A 2CNSA 4KVOE 2Y0MA 4NSQA 1WK4A 1L0CA 1PU9A 1OZPA 4H6ZA 1IYKA 3CXQA 4GS4A 5I0CA 2FS5A 2B3VA 3SXOA 2I79A 1IYLA 5HMNA 1YR0A 3W6SA 1J4JA 3IGRA 3FYNA 3GKRA 1P4NA 3T90A 3QB8A 4MY0A 4Y49C 2Z0ZA 2A4NA 3TTHA 3PZJA 2RC4A 2FE7A 3CXSA 4R57A 4KVME 5JQ4A 1MK4A 3TE4A 4E2AA 4H6UA 4PSWA 2JDCA 3DR8A 2Q04A 3FXTA 4U5YA 4ZBGA 4KOYA 3WR7A 1YK3A 2B3UA 4R3KA 3S6HA 2OZGA 4L89A 5C88A 1S7FA 4UWJA 3EXNA 1CM0A 2J8NA 4LX9A 4FD6A 2FCKA 3BJ7A 1RO5A 3N7ZA 2D4OA 4KUAA 2R8VA 1R57A 3OWCA 1S7NA 4AVBA 2QMLA 4KVXA 2VXKA 1Z4EA 3BLNA 1YLEA 1Y9KA 4MHDA 2VQYA 4K30A 5ISVA 1S7LA 3UY5A 3JUWA 2ZW5A 3TOBA 1UFHA 2Q7BA 1YREA 3TFYA 3FIXA 2OZHA 3D2PA 3S6KA 2FXFA 4UWIA 2CNTA 2WPWA 4OLLA 4IUSA 4J3GA 5J8FA 1ON0A 4AVAA 2ARHA
chains in the Genus database with same CATH superfamily
1XOVA 2WSAA 5A28A 2G3TA 2ZOFA 3SHPA 4E8OA 4C7IA 5IB0A 3R95A 4ONUA 3PP9A 2CIJA 4EFDA 1M44A 4KLVA 2Q51A 4XPLA 4JYWA 2FIWA 2YNCC 5LYIA 1ZG7A 4R8FA 4B5PB 2VL1A 3PFEA 2FVGA 4Q38A 2YNCA 4BMHA 3B35A 3KHXA 2Q4YA 4FUUA 2RB7A 2EUIA 2I00A 3CPXA 4KOTA 3RO0A 1RTQA 2PIZA 1H8LA 2IL4A 3DSBA 2OZUA 2P0WA 2VBQA 2JDDA 3DR6A 4PXBA 3B2YA 4B14A 5AGEA 2PJ8A 2ZPAA 2GFQA 3QAHA 4OC3A 3FEDA 2PJ7A 3WABA 1ZLHA 2BO9A 2AJ6A 2PJAA 4NJRA 4ONWA 1IIDA 5F46A 2ZW6A 2PJCA 3GB0A 4PK3A 3KASA 3BJ8A 2Z3OA 5H84A 1XIXA 1LRZA 3I9SA 1IGBA 2NMTA 4PPZA 4KOVA 3VARA 4CAXA 2O53A 1NSLA 4NGRA 1XRYA 5EBVA 3EFAA 2DF5A 3SJFA 1KWMA 2V8DA 3FECA 1JQGA 1LANA 4KOUA 3S6GA 4B13A 4CRYB 3B7IA 4XPDB 2IQ6A 5LRJA 4B10A 1Z4RA 2PCUA 4ZX8A 1Z9UA 3SXNA 3KKWA 4R76A 4AG9A 2VEZA 1AMPA 4R87A 2OOTA 2FT0A 4OC5A 4F6AA 2ATRA 2XEFA 4DJLA 3N5FA 3CPAA 4KLWA 5J1QA 3NH5A 4GM5A 3IO1A 3ISZA 3BI1A 5F48A 1OBRA 4B5PA 3T8WA 3TT2A 4C2ZA 1TKHA 2DPTA 3D7HA 3JVNA 4W9YA 3VWEA 2PVVA 4JJXA 1DTDA 1B6BA 2EO8A 4YGOA 2OR4A 4UBRA 3PBBA 1GHEA 4MXUA 4A33A 3R96A 2P6GA 3CDXA 4LUAA 5DWMA 1TF8A 2J8MA 4MCRA 4JLYA 2Q4VA 5HVGA 2PSWA 5CBMA 4P4IA 2ZENA 2C27A 4PXCA 3ZZIA 3PRTA 1VKCA 2Z3KA 4F8ZA 5KTDA 3FNCA 3NH8A 1BO4A 4JXQA 1XJOA 3S6FA 2PC1A 4PSXA 4MFLA 3PEIA 2D4PA 4UEEA 1R43A 2V8HA 2XEGA 3KR5A 4MFZA 4NGMA 1XBUA 4B5OA 4HNYB 1XFOA 1CP6A 5THWA 2ZW7A 1GYTA 4Q36A 4MFPA 3FX6A 3IWGA 1MJBA 3PFOA 3IIBA 2I3CA 2Q0YA 1JWQA 1FY7A 5J8CA 1VIXA 5JGFA 4HNXB 4OC4A 2B5GB 4WJBA 4UCMA 4CAEA 4A30A 2CXAA 4FD5A 2GE3A 4MCSA 5A27A 3D3SA 3V38A 4B11A 5IX3A 2Z3NA 2ZEPA 3D7DA 3IWWA 4X8IA 2VI7A 2R7HA 3T9YA 2PJBA 3K9UA 5EMIA 1TF9A 5KTCA 3PB9X 3EY5A 2KCWA 4FD7A 2BEIA 2PJ2A 2FL4A 4CGPA 3F0AA 3LACA 4BINA 2X7BA 4Q7AA 5KTAA 4A37A 2BUEA 4AG7A 4KOXA 2EWBA 4UEFA 4A39A 2HC9A 2QVPA 3L2NA 1V0CA 4M85A 5G1ZA 4FD4A 5AG6A 4DNCA 4ZX9A 3K2KA 1KUXA 1MJAA 1Z8XA 4PXDA 3RYOA 3VATA 4RUHA 1HDUA 3MGDA 1F57A 1IOFA 2QECA 3P2HA 5K8OA 1PUAA 1IICA 5D8NA 1M4GA 2JEVA 3NFZA 3TO6A 4QBJA 4H2KA 4OKOA 3GLJA 1Z2LA 2OU2A 7CPAA 2B5GA 3B8GA 4ZY0A 5G21A 3MN8A 2JEWA 2B4BA 4HNWB 4FAIA 4UF4A 2AFUA 4NFRA 2G0BA 3VH9A 3A9LA 1Q2DA 3G3SA 1Z8TA 1XEBA 2IMOA 1Y7EA 3NE7A 4U9YA 5C82A 1IY7A 3IU1A 1Y7RA 4IHMA 5IV0A 2AE6A 2Q4ZA 1IB1E 2PJ4A 2G3AA 2PJ3A 1Y0RA 1VHSA 4U9ZA 4P44A 2NSMA 3GYAA 4KSAA 4XNHB 1YMEA 4YRHA 2WYRA 4NCZA 3CXPA 4M3SA 3SJXA 5K8PA 4MCPA 3LODA 5F49A 3F5BA 2CF4A 2AFWA 1F2OA 1YW4A 2QYVA 4C2XA 4JWPA 4KSIA 5EC4A 4CRZB 4RI1A 4PV6A 1TKFA 5AG4A 3SI0A 1I1DA 2BOAA 1HDQA 3FMCA 3GUXA 1BPMA 4KZTA 4QC6A 4UA3A 4UCNA 4CGMA 1YGHA 2AFZA 3EO4A 4MBUA 5HVFA 3DNSA 4P4FA 3BI0A 1FT7A 5JM6A 1S3ZA 4M6HA 3G8WA 2H5MA 4MRIA 2GLFA 2BCOA 4A94A 3KGQA 3PB7X 1HEEA 2GANA 3D4UA 4UEZA 1IU8A 2F5IA 5LYLA 2P6EA 4CGLA 2PDOA 4BBHA 4KS9A 4MCQA 1S5KA 2PJ6A 3E0KA 3NE8A 1YX0A 3BXMA 1LCPA 2P6FA 4L8AA 1ZLIA 4XNHC 3WC7A 5E96A 1UWYA 1ARLA 4EMEA 3SI2A 3TO7A 4NGTA 1YVKA 2Q43A 6CPAA 1CJWA 1ZO0A 1Q2CA 1TKJA 4UFXA 3KR4A 1LAMA 1KZFA 4OC1A 4H89A 2ZEHA 4CS0B 4EWTA 1I12A 1N71A 3ISXA 2AFMA 2VZYA 4KOSA 2ZEMA 2QJ8A 3WC5A 3DLJA 4HPSA 2R1IA 4P6YA 4HKFA 3D7GA 3JTKA 4NGSA 1XF8A 4R9MA 1QSOA 1RXTA 2BL1A 2JLMA 3BHXA 3TO9A 3I3GA 4E0AA 1F2PA 4F0XA 4X2TA 3P2FA 4XPDC 4CYQA 3FB3A 3QNVA 4R6TA 3IFEA 4RS2A 3TC8A 4PQAA 1ZG9A 2GLJA 3GIUA 3KL9A 3PB8X 2EK8A 4C7HA 4MFQA 1M4DA 4DYOA 2B4DB 2PJ1A 3F8KA 3EC4A 5IB9A 4K3NA 2ZW4A 3IEHA 2IJZA 1S7KA 2K5TA 2F7VA 2WUUA 4FBEA 3PB4X 4NGPA 4KUBA 2PR1A 2PR8A 4QUSA 5F47A 1S60A 4P45A 4ZI6A 5K8MA 1VHOA 4BD9A 2AFSA 4MJ8A 4JD6A 1Z8LA 1BPNA 4OIDA 2J9AA 3FJUA 4UFVA 4PK2A 2F8HA 2PRBA 3LD2A 4ZY1A 3KQZA 2QIRA 3D8PA 3R9FA 3D66A 1U6MA 1Y0YA 1TIQA 3V8IA 2J8RA 3TCVA 3D67A 4FWUA 4MFKA 4MHYA 5GCNA 2PJ5A 1NSAA 3TOAA 3JRUA 8CPAA 2REEA 3KQXA 4CAFA 4Z65A 2V77A 1YSJA 3DDDA 4P10A 1M4IA 1Q2YA 4KORA 5I4MA 1Y9WA 1BOBA 2CNMA 3PB6X 5HH1A 3IWEA 4R3LA 4AXVA 2Q44A 3GY9A 3IU2A 5H86A 1LOKA 2B4DA 3R9GA 1YVOA 2GIVA 4CYNA 1AUGA 4A95A 4CYPA 4CAWA 2RFHA 2PIYA 1X10A 5DS0A 1ELMP 4P4DA 5G20A 1CP7A 2YGWA 4R7MA 1XE4A 4YWYA 4IK2A 3W6XA 1NE9A 1EE3P 3KHZA 3S9LA 1NMTA 4AVCA 4MHPA 2Z10A 2Q7SA 1KUYA 1YW6A 1A2ZA 5HXDA 2POKA 4I49A 2ZEEA 2EBJA 4IAVA 4KSFA 4QVTA 2WZNA 5LYDA 4X3RA 2ABZA 1ZG8A 2B58A 2R98A 5DWNA 4IF5A 1LAPA 1K4JA 1QSTA 1SQHA 4XPKA 2C6GA 3W91A 2XEJA 2WPXA 1PCAA 1R3NA 1P0HA 4CYOA 4YFJA 1X12A 1Q7LA 3VWDA 4OADA 1QSRA 4KOWA 3WC6A 1BLLE 3FVLA 4QB9A 1WWZA 3D2MA 4A32A 4JZ0A 3PGPA 4WWVA 1XMTA 2CTCA 2C6PA 4OP4A 2PQ8A 1CBXA 2FIAA 2BSWA 3I1UA 3FBUA 2EVNA 2CY2A 1ARMA 2JBKA 3R1KA 3H8GA 2REFA 1M1DA 4UFWA 3H4QA 3HUVA 1DE4C 2O28A 4AB7A 4ZYQA 3B3WA 4MY3A 1CX8A 1I21A 2FSRA 3R9EA 4MI4A 1BAVA 1MJ9A 2OH1A 5FVJA 3H8FA 1LFWA 3NA6A 4NXYA 5LRKA 1B87A 4OAEA 4CAVA 3B3SA 2HQYA 2PJ9A 3FRMA 4LQ6A 3RAMA 1AYEA 2PJ0A 4NEXA 5JPHA 2ANPA 2CTBA 4F0YA 2XEIA 2Z11A 4NF1A 3KZWA 2VZZA 1TXRA 3IJ3A 4MHNA 2DXQA 2V8GA 4ORFA 3CT9A 3RNZA 3NH4A 2DEAA 2ZXVA 4A38A 1QSNA 4P4JA 3B3VA 2HUZA 4UCPA 4P4BA 4EVYA 3SI1A 3WT4A 2DPSA 4X5KA 4F9UA 4OC0A 1KUVA 2AFXA 4Y49B 1QQ9A 2Z3MA 3B3TA 3MRUA 3C26A 4MMOA 5CNPA 4A2ZA 2ZEGA 2HV2A 3ZJ0A 3QAYA 2G9DA 4JXRA 2GREA 1QSMA 2OB0A 2CNSA 4KVOE 1Z5RA 2Y0MA 4UIAA 4NSQA 1WK4A 1PYTB 1L0CA 5G22A 1PU9A 1OZPA 4H6ZA 2ZEDA 4P4EA 4NJQA 1IYKA 2Z3LA 3CXQA 4GS4A 4MHZA 4LQGA 2C6CA 5I0CA 4M6IA 3DGVA 2FS5A 4DUKA 2B3VA 3CZXA 3SXOA 2I79A 1IYLA 2O4HA 5HMNA 1XMBA 1YR0A 4G1PA 3W6SA 5LRGA 1J4JA 3IGRA 5D29A 3FYNA 4ZGYB 3FF3A 3GKRA 1P4NA 3T90A 3H8EA 2PE3A 4F9VA 3QB8A 4MY0A 4A31A 2ZEOA 4Y49C 2Z0ZA 2A4NA 3TTHA 2ODFA 2ZEFA 2V8VA 3H5ZA 3PZJA 2RC4A 4CPAA 3B3CA 1CPXA 1CG2A 2FE7A 3CXSA 4R57A 1M4LA 4B12A 4KVME 4II9A 5JQ4A 1CPSA 5CPAA 1MK4A 2EK9A 4M6GA 3TX8A 4ZY2A 4E2AA 3TE4A 4H6UA 3RBUA 1FNOA 2JDCA 4PSWA 4TWEA 4PXEA 1YQEA 3DR8A 3LMSA 4GXHA 2Q04A 3FXTA 4OMEA 4U5YA 1Z8WA 4CGNA 4ZBGA 4KOYA 3WR7A 1YK3A 1ELLP 2B3UA 4NGQA 4NGNA 4R3KA 3S6HA 2OZGA 5BWAB 4L89A 2NYQA 5C88A 3RZAA 1S7FA 1VHEA 4UWJA 2YNEA 3S9NA 3EXNA 1CM0A 3SJGA 2J8NA 4LX9A 3SJEA 3FEEA 4FD6A 4B6ZA 2FCKA 2YNDA 2Z3PA 3BJ7A 1RO5A 3N7ZA 2C1CA 2GU2A 2D4OA 4KUAA 2R8VA 4TNUA 1R57A 5K8NA 3OWCA 4OIWA 1S7NA 5HVHA 4AVBA 2QMLA 3HLPA 4KVXA 2HB6A 3IC1A 2VXKA 3V7ZA 2ZELA 2ZOGA 2AFOA 1Z4EA 3BLNA 1QMUA 1YLEA 4C2YA 3KI9A 1Y9KA 5ELYA 4MHDA 2VQYA 4K30A 4UIBA 3D7FA 5ISVA 4OC2A 1S7LA 3UY5A 3JUWA 2JBJA 2ZW5A 3K9TA 3TOBA 4MFJA 2PRQA 1UFHA 2Q7BA 1YREA 5JH9A 3FIXA 3TFYA 2PVWA 3D68A 4YU9A 2OZHA 3D2PA 1IOIA 4C68A 4O23A 3S6KA 5F09A 4CGOA 2FXFA 4UWIA 2CNTA 2WPWA 4OLLA 4IUSA 4J3GA 4RN7A 1ON0A 5J8FA 3S9MA 5LYFA 5AG7A 1YLOA 3LWUA 4AVAA 3FH4A 2ARHA 5AG5A 1VGYA 3PBEA
chains in the Genus database with same CATH topology
2WSAA 5A28A 2G3TA 4E8OA 3SHPA 4C7IA 5IB0A 3R95A 4ONUA 3PP9A 1M44A 4KLVA 4XPLA 2FIWA 2YNCC 4B5PB 4Q38A 2YNCA 4BMHA 4CAVA 2Q4YA 2EUIA 2I00A 4KOTA 5G1ZA 2IL4A 3DSBA 2OZUA 2P0WA 2VBQA 2JDDA 3DR6A 4B14A 5AGEA 2ZPAA 3QAHA 2AJ6A 1IIDA 5F46A 2ZW6A 4PK3A 3BJ8A 2Z3OA 5H84A 1XIXA 1LRZA 3I9SA 2NMTA 4CAXA 4KOVA 4II9A 1NSLA 5EBVA 3EFAA 4KOUA 3S6GA 4B13A 4CRYB 4XPDB 4B10A 1Z4RA 1Z9UA 3SXNA 3KKWA 4AG9A 2VEZA 4R87A 2FT0A 4F6AA 2ATRA 4KLWA 5F48A 4B5PA 3TT2A 4C2ZA 2DPTA 3JVNA 3VWEA 4JJXA 4YGOA 1B6BA 4UBRA 1GHEA 4A33A 3R96A 2P6GA 4LUAA 5DWMA 2J8MA 4JLYA 2Q4VA 2PSWA 2C27A 3ZZIA 1VKCA 2Z3KA 5KTDA 3FNCA 1BO4A 4JXQA 3S6FA 2PC1A 4PSXA 4MFLA 2D4PA 4B5OA 4MFZA 4HNYB 2ZW7A 4Q36A 4MFPA 3IWGA 1MJBA 2Q0YA 1FY7A 5J8CA 4HNXB 2B5GB 4UCMA 4CAEA 4A30A 2CXAA 4FD5A 2GE3A 5A27A 3D3SA 4B11A 5IX3A 2Z3NA 2VI7A 2R7HA 3T9YA 3K9UA 5KTCA 3EY5A 2KCWA 4FD7A 2BEIA 2FL4A 4CGPA 3F0AA 2X7BA 5KTAA 2BUEA 4AG7A 4KOXA 1V0CA 4M85A 4FD4A 5AG6A 4DNCA 1KUXA 1MJAA 3RYOA 3MGDA 2QECA 3P2HA 1PUAA 1IICA 1M4GA 2JEVA 3TO6A 4QBJA 2OU2A 2B5GA 3B8GA 5G21A 2B4BA 4HNWB 2G0BA 3A9LA 1Q2DA 3G3SA 3NE7A 1XEBA 4U9YA 5C82A 3IU1A 1Y7RA 5IV0A 2AE6A 1IB1E 2G3AA 1VHSA 4U9ZA 3GYAA 4KSAA 4XNHB 4YRHA 4NCZA 3CXPA 4M3SA 3LODA 5F49A 3F5BA 4C2XA 4JWPA 5EC4A 4CRZB 4RI1A 4PV6A 5AG4A 1I1DA 4QC6A 4KZTA 4UA3A 4UCNA 4CGMA 1YGHA 3EO4A 4MBUA 3DNSA 1S3ZA 3G8WA 2H5MA 2GANA 2F5IA 2P6EA 4CGLA 2PDOA 4BBHA 4KS9A 1S5KA 3E0KA 1YX0A 2P6FA 4L8AA 4XNHC 5E96A 3TO7A 1YVKA 1CJWA 1ZO0A 1Q2CA 4UFXA 1KZFA 4H89A 4CS0B 1I12A 1N71A 4KOSA 2VZYA 2R1IA 4HKFA 3JTKA 1XF8A 4R9MA 1QSOA 1RXTA 2BL1A 2JLMA 3TO9A 3I3GA 4E0AA 4F0XA 3P2FA 4XPDC 4CYQA 3FB3A 4RS2A 4C7HA 4MFQA 1M4DA 2B4DB 3F8KA 3EC4A 2ZW4A 1S7KA 2K5TA 2WUUA 4KUBA 2PR1A 2PR8A 4QUSA 5F47A 1S60A 4MJ8A 4JD6A 4UFVA 4PK2A 2PRBA 3LD2A 2QIRA 3D8PA 3R9FA 1U6MA 1TIQA 3V8IA 2J8RA 3TCVA 4MFKA 5GCNA 3TOAA 2REEA 4CAFA 3DDDA 1M4IA 1Q2YA 4KORA 1Y9WA 1BOBA 2CNMA 5HH1A 3IWEA 4R3LA 2Q44A 3GY9A 3IU2A 5H86A 2B4DA 3R9GA 1YVOA 2GIVA 4CYNA 4A95A 4CYPA 4CAWA 5G20A 2YGWA 1XE4A 3W6XA 1NE9A 1NMTA 4AVCA 2Z10A 1KUYA 4I49A 4QVTA 4KSFA 2B58A 2R98A 5DWNA 4IF5A 1K4JA 1QSTA 1SQHA 4XPKA 3W91A 2WPXA 1P0HA 4CYOA 4YFJA 3VWDA 4OADA 1QSRA 4KOWA 4QB9A 4A32A 1WWZA 3D2MA 3PGPA 1XMTA 2PQ8A 2FIAA 2BSWA 3FBUA 2EVNA 2CY2A 3R1KA 2REFA 1M1DA 4UFWA 3H4QA 2O28A 4AB7A 4MY3A 1I21A 2FSRA 3R9EA 4MI4A 1MJ9A 2OH1A 5FVJA 4NXYA 1B87A 4OAEA 2HQYA 3FRMA 5JPHA 4NEXA 4F0YA 2Z11A 4NF1A 2VZZA 2DXQA 4ORFA 2ZXVA 1QSNA 2HUZA 4UCPA 4EVYA 2DPSA 4X5KA 1KUVA 4Y49B 4A2ZA 2Z3MA 3C26A 5CNPA 2HV2A 3ZJ0A 4JXRA 1QSMA 2OB0A 2CNSA 4KVOE 2Y0MA 4NSQA 1WK4A 1L0CA 5G22A 1PU9A 1OZPA 4H6ZA 1IYKA 2Z3LA 3CXQA 4GS4A 5I0CA 2FS5A 2B3VA 3SXOA 2I79A 1IYLA 5HMNA 1YR0A 3W6SA 1J4JA 3IGRA 3FYNA 4ZGYB 3GKRA 1P4NA 3T90A 3QB8A 4MY0A 4A31A 4Y49C 2Z0ZA 2A4NA 3TTHA 3H5ZA 3PZJA 2RC4A 2FE7A 3CXSA 4R57A 4B12A 4KVME 5JQ4A 1MK4A 3TE4A 4E2AA 4H6UA 4PSWA 2JDCA 3DR8A 2Q04A 3FXTA 4U5YA 4CGNA 4ZBGA 4KOYA 3WR7A 1YK3A 2B3UA 4R3KA 3S6HA 2OZGA 5BWAB 4L89A 5C88A 1S7FA 4UWJA 2YNEA 3EXNA 1CM0A 2J8NA 4LX9A 4FD6A 2FCKA 2YNDA 2Z3PA 3BJ7A 1RO5A 3N7ZA 2D4OA 4KUAA 2R8VA 1R57A 3OWCA 1S7NA 4AVBA 2QMLA 4KVXA 2VXKA 1Z4EA 3BLNA 1YLEA 4C2YA 1Y9KA 4MHDA 2VQYA 4K30A 5ISVA 1S7LA 3UY5A 3JUWA 2ZW5A 3TOBA 4MFJA 1UFHA 2Q7BA 1YREA 3TFYA 3FIXA 4C68A 2OZHA 3D2PA 3S6KA 4CGOA 2FXFA 4UWIA 2CNTA 2WPWA 4OLLA 4IUSA 4J3GA 5J8FA 1ON0A 5AG7A 4AVAA 5AG5A 2ARHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3T A;  4E8O A;  3SHP A;  5IB0 A;  3R95 A;  4ONU A;  3PP9 A;  1M44 A;  4KLV A;  4XPL A;  2FIW A;  4B5P B;  4BMH A;  4CAV A;  2Q4Y A;  2EUI A;  2I00 A;  4KOT A;  2IL4 A;  3DSB A;  2OZU A;  2P0W A;  2VBQ A;  2JDD A;  3DR6 A;  2ZPA A;  3QAH A;  2AJ6 A;  1IID A;  5F46 A;  2ZW6 A;  4PK3 A;  3BJ8 A;  5H84 A;  1XIX A;  1LRZ A;  3I9S A;  2NMT A;  4CAX A;  4KOV A;  4II9 A;  1NSL A;  5EBV A;  3EFA A;  4KOU A;  3S6G A;  4CRY B;  4XPD B;  1Z4R A;  1Z9U A;  3SXN A;  3KKW A;  4AG9 A;  2VEZ A;  4R87 A;  2FT0 A;  4F6A A;  2ATR A;  4KLW A;  5F48 A;  4B5P A;  3TT2 A;  3JVN A;  3VWE A;  4JJX A;  4YGO A;  1B6B A;  4UBR A;  1GHE A;  3R96 A;  2P6G A;  4LUA A;  5DWM A;  2J8M A;  4JLY A;  2Q4V A;  2PSW A;  2C27 A;  3ZZI A;  1VKC A;  5KTD A;  3FNC A;  1BO4 A;  4JXQ A;  3S6F A;  2PC1 A;  4PSX A;  2D4P A;  4B5O A;  4HNY B;  2ZW7 A;  3IWG A;  1MJB A;  2Q0Y A;  1FY7 A;  5J8C A;  4HNX B;  2B5G B;  4FD5 A;  2GE3 A;  3D3S A;  5IX3 A;  2VI7 A;  2R7H A;  3T9Y A;  3K9U A;  5KTC A;  3EY5 A;  2KCW A;  4FD7 A;  2BEI A;  2FL4 A;  3F0A A;  2X7B A;  5KTA A;  2BUE A;  4AG7 A;  4KOX A;  1V0C A;  4M85 A;  4FD4 A;  4DNC A;  1KUX A;  1MJA A;  3RYO A;  3MGD A;  2QEC A;  3P2H A;  1PUA A;  1IIC A;  1M4G A;  2JEV A;  3TO6 A;  4QBJ A;  2OU2 A;  2B5G A;  3B8G A;  2B4B A;  4HNW B;  2G0B A;  1Q2D A;  3G3S A;  3NE7 A;  1XEB A;  4U9Y A;  5C82 A;  1Y7R A;  5IV0 A;  2AE6 A;  1IB1 E;  2G3A A;  1VHS A;  4U9Z A;  3GYA A;  4XNH B;  4YRH A;  4NCZ A;  3CXP A;  4M3S A;  3LOD A;  5F49 A;  3F5B A;  4JWP A;  5EC4 A;  4CRZ B;  4RI1 A;  4PV6 A;  1I1D A;  4QC6 A;  4KZT A;  4UA3 A;  1YGH A;  3EO4 A;  4MBU A;  3DNS A;  1S3Z A;  3G8W A;  2H5M A;  2GAN A;  2F5I A;  2P6E A;  2PDO A;  1S5K A;  3E0K A;  1YX0 A;  2P6F A;  4L8A A;  4XNH C;  5E96 A;  3TO7 A;  1YVK A;  1CJW A;  1Q2C A;  1KZF A;  4H89 A;  4CS0 B;  1I12 A;  1N71 A;  4KOS A;  2VZY A;  2R1I A;  4HKF A;  1XF8 A;  4R9M A;  1QSO A;  1RXT A;  2BL1 A;  2JLM A;  3TO9 A;  3I3G A;  4E0A A;  3P2F A;  4XPD C;  3FB3 A;  4RS2 A;  1M4D A;  2B4D B;  3F8K A;  3EC4 A;  2ZW4 A;  1S7K A;  2K5T A;  4KUB A;  2PR1 A;  2PR8 A;  4QUS A;  5F47 A;  1S60 A;  4MJ8 A;  4JD6 A;  4PK2 A;  2PRB A;  3LD2 A;  2QIR A;  3D8P A;  3R9F A;  1U6M A;  1TIQ A;  3V8I A;  2J8R A;  3TCV A;  5GCN A;  3TOA A;  2REE A;  3DDD A;  1M4I A;  1Q2Y A;  4KOR A;  1Y9W A;  1BOB A;  2CNM A;  5HH1 A;  4R3L A;  2Q44 A;  3GY9 A;  5H86 A;  2B4D A;  3R9G A;  1YVO A;  2GIV A;  4CAW A;  1XE4 A;  3W6X A;  1NE9 A;  1NMT A;  4AVC A;  2Z10 A;  1KUY A;  4I49 A;  4QVT A;  2B58 A;  2R98 A;  5DWN A;  4IF5 A;  1K4J A;  1QST A;  1SQH A;  4XPK A;  3W91 A;  2WPX A;  1P0H A;  4YFJ A;  3VWD A;  4OAD A;  1QSR A;  4KOW A;  4QB9 A;  1WWZ A;  3D2M A;  3PGP A;  1XMT A;  2PQ8 A;  2FIA A;  2BSW A;  3FBU A;  2EVN A;  2CY2 A;  3R1K A;  2REF A;  1M1D A;  3H4Q A;  2O28 A;  4AB7 A;  4MY3 A;  1I21 A;  2FSR A;  3R9E A;  4MI4 A;  1MJ9 A;  2OH1 A;  5FVJ A;  4NXY A;  1B87 A;  4OAE A;  2HQY A;  3FRM A;  5JPH A;  4NEX A;  4F0Y A;  2Z11 A;  4NF1 A;  2VZZ A;  2DXQ A;  4ORF A;  2ZXV A;  1QSN A;  2HUZ A;  4EVY A;  4X5K A;  1KUV A;  4Y49 B;  3C26 A;  5CNP A;  2HV2 A;  3ZJ0 A;  4JXR A;  1QSM A;  2OB0 A;  2CNS A;  4KVO E;  2Y0M A;  4NSQ A;  1WK4 A;  1L0C A;  1PU9 A;  1OZP A;  4H6Z A;  1IYK A;  3CXQ A;  4GS4 A;  5I0C A;  2FS5 A;  2B3V A;  3SXO A;  2I79 A;  1IYL A;  5HMN A;  1YR0 A;  3W6S A;  1J4J A;  3IGR A;  3FYN A;  3GKR A;  1P4N A;  3T90 A;  3QB8 A;  4MY0 A;  4Y49 C;  2Z0Z A;  2A4N A;  3TTH A;  3PZJ A;  2RC4 A;  2FE7 A;  3CXS A;  4R57 A;  4KVM E;  5JQ4 A;  1MK4 A;  3TE4 A;  4E2A A;  4H6U A;  4PSW A;  2JDC A;  3DR8 A;  2Q04 A;  3FXT A;  4U5Y A;  4ZBG A;  4KOY A;  3WR7 A;  1YK3 A;  2B3U A;  4R3K A;  3S6H A;  2OZG A;  4L89 A;  5C88 A;  1S7F A;  4UWJ A;  3EXN A;  1CM0 A;  2J8N A;  4LX9 A;  4FD6 A;  2FCK A;  3BJ7 A;  1RO5 A;  3N7Z A;  2D4O A;  4KUA A;  2R8V A;  1R57 A;  3OWC A;  1S7N A;  4AVB A;  2QML A;  4KVX A;  2VXK A;  1Z4E A;  3BLN A;  1YLE A;  1Y9K A;  4MHD A;  2VQY A;  4K30 A;  5ISV A;  1S7L A;  3UY5 A;  3JUW A;  2ZW5 A;  3TOB A;  1UFH A;  2Q7B A;  1YRE A;  3TFY A;  3FIX A;  2OZH A;  3D2P A;  3S6K A;  2FXF A;  4UWI A;  2CNT A;  2WPW A;  4OLL A;  4IUS A;  4J3G A;  5J8F A;  1ON0 A;  4AVA A;  2ARH A; 
#chains in the Genus database with same CATH topology
 1XOV A;  2WSA A;  5A28 A;  2G3T A;  2ZOF A;  3SHP A;  4E8O A;  4C7I A;  5IB0 A;  3R95 A;  4ONU A;  3PP9 A;  2CIJ A;  4EFD A;  1M44 A;  4KLV A;  2Q51 A;  4XPL A;  4JYW A;  2FIW A;  2YNC C;  5LYI A;  1ZG7 A;  4R8F A;  4B5P B;  2VL1 A;  3PFE A;  2FVG A;  4Q38 A;  2YNC A;  4BMH A;  3B35 A;  3KHX A;  2Q4Y A;  4FUU A;  2RB7 A;  2EUI A;  2I00 A;  3CPX A;  4KOT A;  3RO0 A;  1RTQ A;  2PIZ A;  1H8L A;  2IL4 A;  3DSB A;  2OZU A;  2P0W A;  2VBQ A;  2JDD A;  3DR6 A;  4PXB A;  3B2Y A;  4B14 A;  5AGE A;  2PJ8 A;  2ZPA A;  2GFQ A;  3QAH A;  4OC3 A;  3FED A;  2PJ7 A;  3WAB A;  1ZLH A;  2BO9 A;  2AJ6 A;  2PJA A;  4NJR A;  4ONW A;  1IID A;  5F46 A;  2ZW6 A;  2PJC A;  3GB0 A;  4PK3 A;  3KAS A;  3BJ8 A;  2Z3O A;  5H84 A;  1XIX A;  1LRZ A;  3I9S A;  1IGB A;  2NMT A;  4PPZ A;  4KOV A;  3VAR A;  4CAX A;  2O53 A;  1NSL A;  4NGR A;  1XRY A;  5EBV A;  3EFA A;  2DF5 A;  3SJF A;  1KWM A;  2V8D A;  3FEC A;  1JQG A;  1LAN A;  4KOU A;  3S6G A;  4B13 A;  4CRY B;  3B7I A;  4XPD B;  2IQ6 A;  5LRJ A;  4B10 A;  1Z4R A;  2PCU A;  4ZX8 A;  1Z9U A;  3SXN A;  3KKW A;  4R76 A;  4AG9 A;  2VEZ A;  1AMP A;  4R87 A;  2OOT A;  2FT0 A;  4OC5 A;  4F6A A;  2ATR A;  2XEF A;  4DJL A;  3N5F A;  3CPA A;  4KLW A;  5J1Q A;  3NH5 A;  4GM5 A;  3IO1 A;  3ISZ A;  3BI1 A;  5F48 A;  1OBR A;  4B5P A;  3T8W A;  3TT2 A;  4C2Z A;  1TKH A;  2DPT A;  3D7H A;  3JVN A;  4W9Y A;  3VWE A;  2PVV A;  4JJX A;  1DTD A;  1B6B A;  2EO8 A;  4YGO A;  2OR4 A;  4UBR A;  3PBB A;  1GHE A;  4MXU A;  4A33 A;  3R96 A;  2P6G A;  3CDX A;  4LUA A;  5DWM A;  1TF8 A;  2J8M A;  4MCR A;  4JLY A;  2Q4V A;  5HVG A;  2PSW A;  5CBM A;  4P4I A;  2ZEN A;  2C27 A;  4PXC A;  3ZZI A;  3PRT A;  1VKC A;  2Z3K A;  4F8Z A;  5KTD A;  3FNC A;  3NH8 A;  1BO4 A;  4JXQ A;  1XJO A;  3S6F A;  2PC1 A;  4PSX A;  4MFL A;  3PEI A;  2D4P A;  4UEE A;  1R43 A;  2V8H A;  2XEG A;  3KR5 A;  4MFZ A;  4NGM A;  1XBU A;  4B5O A;  4HNY B;  1XFO A;  1CP6 A;  5THW A;  2ZW7 A;  1GYT A;  4Q36 A;  4MFP A;  3FX6 A;  3IWG A;  1MJB A;  3PFO A;  3IIB A;  2I3C A;  2Q0Y A;  1JWQ A;  1FY7 A;  5J8C A;  1VIX A;  5JGF A;  4HNX B;  4OC4 A;  2B5G B;  4WJB A;  4UCM A;  4CAE A;  4A30 A;  2CXA A;  4FD5 A;  2GE3 A;  4MCS A;  5A27 A;  3D3S A;  3V38 A;  4B11 A;  5IX3 A;  2Z3N A;  2ZEP A;  3D7D A;  3IWW A;  4X8I A;  2VI7 A;  2R7H A;  3T9Y A;  2PJB A;  3K9U A;  5EMI A;  1TF9 A;  5KTC A;  3PB9 X;  3EY5 A;  2KCW A;  4FD7 A;  2BEI A;  2PJ2 A;  2FL4 A;  4CGP A;  3F0A A;  3LAC A;  4BIN A;  2X7B A;  4Q7A A;  5KTA A;  4A37 A;  2BUE A;  4AG7 A;  4KOX A;  2EWB A;  4UEF A;  4A39 A;  2HC9 A;  2QVP A;  3L2N A;  1V0C A;  4M85 A;  5G1Z A;  4FD4 A;  5AG6 A;  4DNC A;  4ZX9 A;  3K2K A;  1KUX A;  1MJA A;  1Z8X A;  4PXD A;  3RYO A;  3VAT A;  4RUH A;  1HDU A;  3MGD A;  1F57 A;  1IOF A;  2QEC A;  3P2H A;  5K8O A;  1PUA A;  1IIC A;  5D8N A;  1M4G A;  2JEV A;  3NFZ A;  3TO6 A;  4QBJ A;  4H2K A;  4OKO A;  3GLJ A;  1Z2L A;  2OU2 A;  7CPA A;  2B5G A;  3B8G A;  4ZY0 A;  5G21 A;  3MN8 A;  2JEW A;  2B4B A;  4HNW B;  4FAI A;  4UF4 A;  2AFU A;  4NFR A;  2G0B A;  3VH9 A;  3A9L A;  1Q2D A;  3G3S A;  1Z8T A;  1XEB A;  2IMO A;  1Y7E A;  3NE7 A;  4U9Y A;  5C82 A;  1IY7 A;  3IU1 A;  1Y7R A;  4IHM A;  5IV0 A;  2AE6 A;  2Q4Z A;  1IB1 E;  2PJ4 A;  2G3A A;  2PJ3 A;  1Y0R A;  1VHS A;  4U9Z A;  4P44 A;  2NSM A;  3GYA A;  4KSA A;  4XNH B;  1YME A;  4YRH A;  2WYR A;  4NCZ A;  3CXP A;  4M3S A;  3SJX A;  5K8P A;  4MCP A;  3LOD A;  5F49 A;  3F5B A;  2CF4 A;  2AFW A;  1F2O A;  1YW4 A;  2QYV A;  4C2X A;  4JWP A;  4KSI A;  5EC4 A;  4CRZ B;  4RI1 A;  4PV6 A;  1TKF A;  5AG4 A;  3SI0 A;  1I1D A;  2BOA A;  1HDQ A;  3FMC A;  3GUX A;  1BPM A;  4KZT A;  4QC6 A;  4UA3 A;  4UCN A;  4CGM A;  1YGH A;  2AFZ A;  3EO4 A;  4MBU A;  5HVF A;  3DNS A;  4P4F A;  3BI0 A;  1FT7 A;  5JM6 A;  1S3Z A;  4M6H A;  3G8W A;  2H5M A;  4MRI A;  2GLF A;  2BCO A;  4A94 A;  3KGQ A;  3PB7 X;  1HEE A;  2GAN A;  3D4U A;  4UEZ A;  1IU8 A;  2F5I A;  5LYL A;  2P6E A;  4CGL A;  2PDO A;  4BBH A;  4KS9 A;  4MCQ A;  1S5K A;  2PJ6 A;  3E0K A;  3NE8 A;  1YX0 A;  3BXM A;  1LCP A;  2P6F A;  4L8A A;  1ZLI A;  4XNH C;  3WC7 A;  5E96 A;  1UWY A;  1ARL A;  4EME A;  3SI2 A;  3TO7 A;  4NGT A;  1YVK A;  2Q43 A;  6CPA A;  1CJW A;  1ZO0 A;  1Q2C A;  1TKJ A;  4UFX A;  3KR4 A;  1LAM A;  1KZF A;  4OC1 A;  4H89 A;  2ZEH A;  4CS0 B;  4EWT A;  1I12 A;  1N71 A;  3ISX A;  2AFM A;  2VZY A;  4KOS A;  2ZEM A;  2QJ8 A;  3WC5 A;  3DLJ A;  4HPS A;  2R1I A;  4P6Y A;  4HKF A;  3D7G A;  3JTK A;  4NGS A;  1XF8 A;  4R9M A;  1QSO A;  1RXT A;  2BL1 A;  2JLM A;  3BHX A;  3TO9 A;  3I3G A;  4E0A A;  1F2P A;  4F0X A;  4X2T A;  3P2F A;  4XPD C;  4CYQ A;  3FB3 A;  3QNV A;  4R6T A;  3IFE A;  4RS2 A;  3TC8 A;  4PQA A;  1ZG9 A;  2GLJ A;  3GIU A;  3KL9 A;  3PB8 X;  2EK8 A;  4C7H A;  4MFQ A;  1M4D A;  4DYO A;  2B4D B;  2PJ1 A;  3F8K A;  3EC4 A;  5IB9 A;  4K3N A;  2ZW4 A;  3IEH A;  2IJZ A;  1S7K A;  2K5T A;  2F7V A;  2WUU A;  4FBE A;  3PB4 X;  4NGP A;  4KUB A;  2PR1 A;  2PR8 A;  4QUS A;  5F47 A;  1S60 A;  4P45 A;  4ZI6 A;  5K8M A;  1VHO A;  4BD9 A;  2AFS A;  4MJ8 A;  4JD6 A;  1Z8L A;  1BPN A;  4OID A;  2J9A A;  3FJU A;  4UFV A;  4PK2 A;  2F8H A;  2PRB A;  3LD2 A;  4ZY1 A;  3KQZ A;  2QIR A;  3D8P A;  3R9F A;  3D66 A;  1U6M A;  1Y0Y A;  1TIQ A;  3V8I A;  2J8R A;  3TCV A;  3D67 A;  4FWU A;  4MFK A;  4MHY A;  5GCN A;  2PJ5 A;  1NSA A;  3TOA A;  3JRU A;  8CPA A;  2REE A;  3KQX A;  4CAF A;  4Z65 A;  2V77 A;  1YSJ A;  3DDD A;  4P10 A;  1M4I A;  1Q2Y A;  4KOR A;  5I4M A;  1Y9W A;  1BOB A;  2CNM A;  3PB6 X;  5HH1 A;  3IWE A;  4R3L A;  4AXV A;  2Q44 A;  3GY9 A;  3IU2 A;  5H86 A;  1LOK A;  2B4D A;  3R9G A;  1YVO A;  2GIV A;  4CYN A;  1AUG A;  4A95 A;  4CYP A;  4CAW A;  2RFH A;  2PIY A;  1X10 A;  5DS0 A;  1ELM P;  4P4D A;  5G20 A;  1CP7 A;  2YGW A;  4R7M A;  1XE4 A;  4YWY A;  4IK2 A;  3W6X A;  1NE9 A;  1EE3 P;  3KHZ A;  3S9L A;  1NMT A;  4AVC A;  4MHP A;  2Z10 A;  2Q7S A;  1KUY A;  1YW6 A;  1A2Z A;  5HXD A;  2POK A;  4I49 A;  2ZEE A;  2EBJ A;  4IAV A;  4KSF A;  4QVT A;  2WZN A;  5LYD A;  4X3R A;  2ABZ A;  1ZG8 A;  2B58 A;  2R98 A;  5DWN A;  4IF5 A;  1LAP A;  1K4J A;  1QST A;  1SQH A;  4XPK A;  2C6G A;  3W91 A;  2XEJ A;  2WPX A;  1PCA A;  1R3N A;  1P0H A;  4CYO A;  4YFJ A;  1X12 A;  1Q7L A;  3VWD A;  4OAD A;  1QSR A;  4KOW A;  3WC6 A;  1BLL E;  3FVL A;  4QB9 A;  1WWZ A;  3D2M A;  4A32 A;  4JZ0 A;  3PGP A;  4WWV A;  1XMT A;  2CTC A;  2C6P A;  4OP4 A;  2PQ8 A;  1CBX A;  2FIA A;  2BSW A;  3I1U A;  3FBU A;  2EVN A;  2CY2 A;  1ARM A;  2JBK A;  3R1K A;  3H8G A;  2REF A;  1M1D A;  4UFW A;  3H4Q A;  3HUV A;  1DE4 C;  2O28 A;  4AB7 A;  4ZYQ A;  3B3W A;  4MY3 A;  1CX8 A;  1I21 A;  2FSR A;  3R9E A;  4MI4 A;  1BAV A;  1MJ9 A;  2OH1 A;  5FVJ A;  3H8F A;  1LFW A;  3NA6 A;  4NXY A;  5LRK A;  1B87 A;  4OAE A;  4CAV A;  3B3S A;  2HQY A;  2PJ9 A;  3FRM A;  4LQ6 A;  3RAM A;  1AYE A;  2PJ0 A;  4NEX A;  5JPH A;  2ANP A;  2CTB A;  4F0Y A;  2XEI A;  2Z11 A;  4NF1 A;  3KZW A;  2VZZ A;  1TXR A;  3IJ3 A;  4MHN A;  2DXQ A;  2V8G A;  4ORF A;  3CT9 A;  3RNZ A;  3NH4 A;  2DEA A;  2ZXV A;  4A38 A;  1QSN A;  4P4J A;  3B3V A;  2HUZ A;  4UCP A;  4P4B A;  4EVY A;  3SI1 A;  3WT4 A;  2DPS A;  4X5K A;  4F9U A;  4OC0 A;  1KUV A;  2AFX A;  4Y49 B;  1QQ9 A;  2Z3M A;  3B3T A;  3MRU A;  3C26 A;  4MMO A;  5CNP A;  4A2Z A;  2ZEG A;  2HV2 A;  3ZJ0 A;  3QAY A;  2G9D A;  4JXR A;  2GRE A;  1QSM A;  2OB0 A;  2CNS A;  4KVO E;  1Z5R A;  2Y0M A;  4UIA A;  4NSQ A;  1WK4 A;  1PYT B;  1L0C A;  5G22 A;  1PU9 A;  1OZP A;  4H6Z A;  2ZED A;  4P4E A;  4NJQ A;  1IYK A;  2Z3L A;  3CXQ A;  4GS4 A;  4MHZ A;  4LQG A;  2C6C A;  5I0C A;  4M6I A;  3DGV A;  2FS5 A;  4DUK A;  2B3V A;  3CZX A;  3SXO A;  2I79 A;  1IYL A;  2O4H A;  5HMN A;  1XMB A;  1YR0 A;  4G1P A;  3W6S A;  5LRG A;  1J4J A;  3IGR A;  5D29 A;  3FYN A;  4ZGY B;  3FF3 A;  3GKR A;  1P4N A;  3T90 A;  3H8E A;  2PE3 A;  4F9V A;  3QB8 A;  4MY0 A;  4A31 A;  2ZEO A;  4Y49 C;  2Z0Z A;  2A4N A;  3TTH A;  2ODF A;  2ZEF A;  2V8V A;  3H5Z A;  3PZJ A;  2RC4 A;  4CPA A;  3B3C A;  1CPX A;  1CG2 A;  2FE7 A;  3CXS A;  4R57 A;  1M4L A;  4B12 A;  4KVM E;  4II9 A;  5JQ4 A;  1CPS A;  5CPA A;  1MK4 A;  2EK9 A;  4M6G A;  3TX8 A;  4ZY2 A;  4E2A A;  3TE4 A;  4H6U A;  3RBU A;  1FNO A;  2JDC A;  4PSW A;  4TWE A;  4PXE A;  1YQE A;  3DR8 A;  3LMS A;  4GXH A;  2Q04 A;  3FXT A;  4OME A;  4U5Y A;  1Z8W A;  4CGN A;  4ZBG A;  4KOY A;  3WR7 A;  1YK3 A;  1ELL P;  2B3U A;  4NGQ A;  4NGN A;  4R3K A;  3S6H A;  2OZG A;  5BWA B;  4L89 A;  2NYQ A;  5C88 A;  3RZA A;  1S7F A;  1VHE A;  4UWJ A;  2YNE A;  3S9N A;  3EXN A;  1CM0 A;  3SJG A;  2J8N A;  4LX9 A;  3SJE A;  3FEE A;  4FD6 A;  4B6Z A;  2FCK A;  2YND A;  2Z3P A;  3BJ7 A;  1RO5 A;  3N7Z A;  2C1C A;  2GU2 A;  2D4O A;  4KUA A;  2R8V A;  4TNU A;  1R57 A;  5K8N A;  3OWC A;  4OIW A;  1S7N A;  5HVH A;  4AVB A;  2QML A;  3HLP A;  4KVX A;  2HB6 A;  3IC1 A;  2VXK A;  3V7Z A;  2ZEL A;  2ZOG A;  2AFO A;  1Z4E A;  3BLN A;  1QMU A;  1YLE A;  4C2Y A;  3KI9 A;  1Y9K A;  5ELY A;  4MHD A;  2VQY A;  4K30 A;  4UIB A;  3D7F A;  5ISV A;  4OC2 A;  1S7L A;  3UY5 A;  3JUW A;  2JBJ A;  2ZW5 A;  3K9T A;  3TOB A;  4MFJ A;  2PRQ A;  1UFH A;  2Q7B A;  1YRE A;  5JH9 A;  3FIX A;  3TFY A;  2PVW A;  3D68 A;  4YU9 A;  2OZH A;  3D2P A;  1IOI A;  4C68 A;  4O23 A;  3S6K A;  5F09 A;  4CGO A;  2FXF A;  4UWI A;  2CNT A;  2WPW A;  4OLL A;  4IUS A;  4J3G A;  4RN7 A;  1ON0 A;  5J8F A;  3S9M A;  5LYF A;  5AG7 A;  1YLO A;  3LWU A;  4AVA A;  3FH4 A;  2ARH A;  5AG5 A;  1VGY A;  3PBE A; 
#chains in the Genus database with same CATH homology
 2WSA A;  5A28 A;  2G3T A;  4E8O A;  3SHP A;  4C7I A;  5IB0 A;  3R95 A;  4ONU A;  3PP9 A;  1M44 A;  4KLV A;  4XPL A;  2FIW A;  2YNC C;  4B5P B;  4Q38 A;  2YNC A;  4BMH A;  4CAV A;  2Q4Y A;  2EUI A;  2I00 A;  4KOT A;  5G1Z A;  2IL4 A;  3DSB A;  2OZU A;  2P0W A;  2VBQ A;  2JDD A;  3DR6 A;  4B14 A;  5AGE A;  2ZPA A;  3QAH A;  2AJ6 A;  1IID A;  5F46 A;  2ZW6 A;  4PK3 A;  3BJ8 A;  2Z3O A;  5H84 A;  1XIX A;  1LRZ A;  3I9S A;  2NMT A;  4CAX A;  4KOV A;  4II9 A;  1NSL A;  5EBV A;  3EFA A;  4KOU A;  3S6G A;  4B13 A;  4CRY B;  4XPD B;  4B10 A;  1Z4R A;  1Z9U A;  3SXN A;  3KKW A;  4AG9 A;  2VEZ A;  4R87 A;  2FT0 A;  4F6A A;  2ATR A;  4KLW A;  5F48 A;  4B5P A;  3TT2 A;  4C2Z A;  2DPT A;  3JVN A;  3VWE A;  4JJX A;  4YGO A;  1B6B A;  4UBR A;  1GHE A;  4A33 A;  3R96 A;  2P6G A;  4LUA A;  5DWM A;  2J8M A;  4JLY A;  2Q4V A;  2PSW A;  2C27 A;  3ZZI A;  1VKC A;  2Z3K A;  5KTD A;  3FNC A;  1BO4 A;  4JXQ A;  3S6F A;  2PC1 A;  4PSX A;  4MFL A;  2D4P A;  4B5O A;  4MFZ A;  4HNY B;  2ZW7 A;  4Q36 A;  4MFP A;  3IWG A;  1MJB A;  2Q0Y A;  1FY7 A;  5J8C A;  4HNX B;  2B5G B;  4UCM A;  4CAE A;  4A30 A;  2CXA A;  4FD5 A;  2GE3 A;  5A27 A;  3D3S A;  4B11 A;  5IX3 A;  2Z3N A;  2VI7 A;  2R7H A;  3T9Y A;  3K9U A;  5KTC A;  3EY5 A;  2KCW A;  4FD7 A;  2BEI A;  2FL4 A;  4CGP A;  3F0A A;  2X7B A;  5KTA A;  2BUE A;  4AG7 A;  4KOX A;  1V0C A;  4M85 A;  4FD4 A;  5AG6 A;  4DNC A;  1KUX A;  1MJA A;  3RYO A;  3MGD A;  2QEC A;  3P2H A;  1PUA A;  1IIC A;  1M4G A;  2JEV A;  3TO6 A;  4QBJ A;  2OU2 A;  2B5G A;  3B8G A;  5G21 A;  2B4B A;  4HNW B;  2G0B A;  3A9L A;  1Q2D A;  3G3S A;  3NE7 A;  1XEB A;  4U9Y A;  5C82 A;  3IU1 A;  1Y7R A;  5IV0 A;  2AE6 A;  1IB1 E;  2G3A A;  1VHS A;  4U9Z A;  3GYA A;  4KSA A;  4XNH B;  4YRH A;  4NCZ A;  3CXP A;  4M3S A;  3LOD A;  5F49 A;  3F5B A;  4C2X A;  4JWP A;  5EC4 A;  4CRZ B;  4RI1 A;  4PV6 A;  5AG4 A;  1I1D A;  4QC6 A;  4KZT A;  4UA3 A;  4UCN A;  4CGM A;  1YGH A;  3EO4 A;  4MBU A;  3DNS A;  1S3Z A;  3G8W A;  2H5M A;  2GAN A;  2F5I A;  2P6E A;  4CGL A;  2PDO A;  4BBH A;  4KS9 A;  1S5K A;  3E0K A;  1YX0 A;  2P6F A;  4L8A A;  4XNH C;  5E96 A;  3TO7 A;  1YVK A;  1CJW A;  1ZO0 A;  1Q2C A;  4UFX A;  1KZF A;  4H89 A;  4CS0 B;  1I12 A;  1N71 A;  4KOS A;  2VZY A;  2R1I A;  4HKF A;  3JTK A;  1XF8 A;  4R9M A;  1QSO A;  1RXT A;  2BL1 A;  2JLM A;  3TO9 A;  3I3G A;  4E0A A;  4F0X A;  3P2F A;  4XPD C;  4CYQ A;  3FB3 A;  4RS2 A;  4C7H A;  4MFQ A;  1M4D A;  2B4D B;  3F8K A;  3EC4 A;  2ZW4 A;  1S7K A;  2K5T A;  2WUU A;  4KUB A;  2PR1 A;  2PR8 A;  4QUS A;  5F47 A;  1S60 A;  4MJ8 A;  4JD6 A;  4UFV A;  4PK2 A;  2PRB A;  3LD2 A;  2QIR A;  3D8P A;  3R9F A;  1U6M A;  1TIQ A;  3V8I A;  2J8R A;  3TCV A;  4MFK A;  5GCN A;  3TOA A;  2REE A;  4CAF A;  3DDD A;  1M4I A;  1Q2Y A;  4KOR A;  1Y9W A;  1BOB A;  2CNM A;  5HH1 A;  3IWE A;  4R3L A;  2Q44 A;  3GY9 A;  3IU2 A;  5H86 A;  2B4D A;  3R9G A;  1YVO A;  2GIV A;  4CYN A;  4A95 A;  4CYP A;  4CAW A;  5G20 A;  2YGW A;  1XE4 A;  3W6X A;  1NE9 A;  1NMT A;  4AVC A;  2Z10 A;  1KUY A;  4I49 A;  4QVT A;  4KSF A;  2B58 A;  2R98 A;  5DWN A;  4IF5 A;  1K4J A;  1QST A;  1SQH A;  4XPK A;  3W91 A;  2WPX A;  1P0H A;  4CYO A;  4YFJ A;  3VWD A;  4OAD A;  1QSR A;  4KOW A;  4QB9 A;  4A32 A;  1WWZ A;  3D2M A;  3PGP A;  1XMT A;  2PQ8 A;  2FIA A;  2BSW A;  3FBU A;  2EVN A;  2CY2 A;  3R1K A;  2REF A;  1M1D A;  4UFW A;  3H4Q A;  2O28 A;  4AB7 A;  4MY3 A;  1I21 A;  2FSR A;  3R9E A;  4MI4 A;  1MJ9 A;  2OH1 A;  5FVJ A;  4NXY A;  1B87 A;  4OAE A;  2HQY A;  3FRM A;  5JPH A;  4NEX A;  4F0Y A;  2Z11 A;  4NF1 A;  2VZZ A;  2DXQ A;  4ORF A;  2ZXV A;  1QSN A;  2HUZ A;  4UCP A;  4EVY A;  2DPS A;  4X5K A;  1KUV A;  4Y49 B;  4A2Z A;  2Z3M A;  3C26 A;  5CNP A;  2HV2 A;  3ZJ0 A;  4JXR A;  1QSM A;  2OB0 A;  2CNS A;  4KVO E;  2Y0M A;  4NSQ A;  1WK4 A;  1L0C A;  5G22 A;  1PU9 A;  1OZP A;  4H6Z A;  1IYK A;  2Z3L A;  3CXQ A;  4GS4 A;  5I0C A;  2FS5 A;  2B3V A;  3SXO A;  2I79 A;  1IYL A;  5HMN A;  1YR0 A;  3W6S A;  1J4J A;  3IGR A;  3FYN A;  4ZGY B;  3GKR A;  1P4N A;  3T90 A;  3QB8 A;  4MY0 A;  4A31 A;  4Y49 C;  2Z0Z A;  2A4N A;  3TTH A;  3H5Z A;  3PZJ A;  2RC4 A;  2FE7 A;  3CXS A;  4R57 A;  4B12 A;  4KVM E;  5JQ4 A;  1MK4 A;  3TE4 A;  4E2A A;  4H6U A;  4PSW A;  2JDC A;  3DR8 A;  2Q04 A;  3FXT A;  4U5Y A;  4CGN A;  4ZBG A;  4KOY A;  3WR7 A;  1YK3 A;  2B3U A;  4R3K A;  3S6H A;  2OZG A;  5BWA B;  4L89 A;  5C88 A;  1S7F A;  4UWJ A;  2YNE A;  3EXN A;  1CM0 A;  2J8N A;  4LX9 A;  4FD6 A;  2FCK A;  2YND A;  2Z3P A;  3BJ7 A;  1RO5 A;  3N7Z A;  2D4O A;  4KUA A;  2R8V A;  1R57 A;  3OWC A;  1S7N A;  4AVB A;  2QML A;  4KVX A;  2VXK A;  1Z4E A;  3BLN A;  1YLE A;  4C2Y A;  1Y9K A;  4MHD A;  2VQY A;  4K30 A;  5ISV A;  1S7L A;  3UY5 A;  3JUW A;  2ZW5 A;  3TOB A;  4MFJ A;  1UFH A;  2Q7B A;  1YRE A;  3TFY A;  3FIX A;  4C68 A;  2OZH A;  3D2P A;  3S6K A;  4CGO A;  2FXF A;  4UWI A;  2CNT A;  2WPW A;  4OLL A;  4IUS A;  4J3G A;  5J8F A;  1ON0 A;  5AG7 A;  4AVA A;  5AG5 A;  2ARH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...