3DR6A

Structure of ynca, a putative acetyltransferase from salmonella typhimurium
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
172
Chain Sequence
AMTIRFADKADCAAITEIYNHAVLHTAAIWNDRTVDTDNRLAWYEARQLLGYPVLVSEENGVVTGYASFGDWRSFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVMVAGIESQNAASIRLHHSLGFTVTAQMPQVGVKFGRWLDLTFMQLQLDEHAAPDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Funded by the national institute of allergy and infectious diseases of nih (contract number hhsn272200700058c).
rcsb
molecule keywords yncA
molecule tags Transferase
source organism Salmonella typhimurium
total genus 51
structure length 172
sequence length 172
chains with identical sequence B, C
ec nomenclature ec 2.3.1.-:
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3dr6A00
1QSNA 4FD6A 2BEIA 3GY9A 4KUBA 1N71A 4R3KA 2JLMA 2K5TA 1FY7A 3LODA 1S3ZA 1K4JA 3F0AA 4KLVA 3T90A 3PGPA 3D2MA 4QBJA 2VEZA 2B4BA 3SXNA 4E2AA 3S6HA 3TOBA 3FBUA 1S7FA 4CRYB 3CXQA 4X5KA 5FVJA 3G8WA 4UBRA 2X7BA 3WR7A 1BOBA 3MGDA 2Q0YA 4BMHA 1KUXA 4QC6A 1S60A 1KUYA 2Q4YA 1XMTA 3BJ8A 4JWPA 4KUAA 2ZW4A 4QB9A 2GANA 4H6ZA 4AG7A 3GKRA 4E8OA 4XPLA 2EUIA 3TFYA 2B5GA 4M3SA 4UA3A 1P0HA 1XE4A 4AVAA 1M44A 2PSWA 4R87A 2R7HA 1Y9KA 4FD5A 2ZW6A 1Z4RA 2VZYA 2NMTA 1NSLA 1NE9A 1CM0A 3ZZIA 1YGHA 4HNXB 2Q44A 2JDDA 3W6SA 1I1DA 5IV0A 3DSBA 1OZPA 1Q2DA 2PR8A 4KOTA 3KKWA 2OZGA 4FD7A 1VHSA 2D4OA 3RYOA 2FCKA 5IB0A 1Y7RA 1QSMA 4K30A 2VXKA 3G3SA 2RC4A 2FS5A 2H5MA 2BSWA 4MI4A 4AB7A 5DWMA 1RXTA 2J8NA 4PK3A 3DR8A 5KTCA 3FNCA 1M4GA 2P0WA 1MJBA 1I12A 2PR1A 4KOSA 3R9GA 1SQHA 3TCVA 1IIDA 4KOVA 4JXQA 5F49A 4KOYA 3V8IA 2CNMA 2REEA 4CS0B 4Y49C 5JPHA 5C82A 1Y9WA 2Q4VA 1KZFA 4JJXA 1NMTA 2ARHA 3VWDA 4NF1A 3P2FA 4XPDC 4CAXA 1TIQA 2ATRA 3GYAA 2O28A 3UY5A 2WPWA 1UFHA 4PV6A 5ISVA 3BLNA 3FRMA 4KVXA 3W6XA 5H86A 3TO6A 1MJAA 1QSRA 1Z4EA 4JLYA 4M85A 2BL1A 2J8MA 3F5BA 4KOUA 2WPXA 5J8FA 2IL4A 4R57A 4RI1A 2HUZA 2FT0A 2HV2A 4NSQA 5C88A 4H6UA 4CAVA 2JDCA 1S7LA 4XNHB 2B58A 4YRHA 1XIXA 2QMLA 3BJ7A 1YVKA 4GS4A 4H89A 5IX3A 4II9A 3SXOA 5J8CA 3D8PA 2FIAA 3QB8A 4AG9A 4OLLA 4PSWA 1QSOA 2P6GA 2R98A 4L89A 4MHDA 3ZJ0A 2EVNA 4U9ZA 3S6FA 1RO5A 2B3VA 4KVME 4B5OA 4KLWA 3S6GA 2GE3A 5JQ4A 4MBUA 2Z10A 3EO4A 3NE7A 3TT2A 3QAHA 3OWCA 2OU2A 4R9MA 4QVTA 3E0KA 5GCNA 4HKFA 4AVCA 3DDDA 3EY5A 2G3TA 3EC4A 1IB1E 1MJ9A 5H84A 1M1DA 4ZBGA 2ZPAA 1Q2YA 3W91A 5E96A 4QUSA 3TOAA 4ONUA 2FSRA 4U5YA 1VKCA 2G3AA 2KCWA 4KOXA 4L8AA 3PZJA 3N7ZA 5F48A 1U6MA 3TO7A 3T9YA 4OADA 3DNSA 1Z9UA 2OZUA 4YGOA 1PUAA 3H4QA 4B5PB 2JEVA 2Q7BA 3CXPA 4ORFA 4F0YA 1CJWA 4MJ8A 5EBVA 3R1KA 4I49A 4KORA 2VBQA 4JXRA 1S7NA 3EXNA 1QSTA 3F8KA 2ZW7A 5CNPA 3PP9A 1ON0A 1B87A 1V0CA 2R8VA 2A4NA 2PDOA 2VZZA 4FD4A 1Q2CA 4AVBA 2HQYA 1B6BA 1YX0A 1J4JA 4JD6A 3D3SA 1I21A 2FIWA 1YK3A 3C26A 2PRBA 3R9FA 2FE7A 4UWJA 3TTHA 3IGRA 2PC1A 5HMNA 2PQ8A 2OZHA 4KZTA 3I9SA 3K9UA 2CNSA 1MK4A 4NXYA 4YFJA 2I00A 4Y49B 1IYKA 1XF8A 1LRZA 2C27A 4RS2A 3CXSA 1WWZA 4B5PA 4NEXA 2BUEA 2VI7A 4NCZA 2ZW5A 5F46A 1YREA 2G0BA 3EFAA 4XPDB 1IYLA 2B4DB 5F47A 2ZXVA 5I0CA 1L0CA 1YLEA 2QIRA 1S5KA 3FIXA 3I3GA 5DWNA 1YVOA 5EC4A 2VQYA 2P6EA 3DR6A 4R3LA 4F6AA 1KUVA 2B3UA 2AE6A 2FL4A 3S6KA 2J8RA 3TO9A 2Z0ZA 2CNTA 4XPKA 4CAWA 4HNYB 3VWEA 4MY3A 5KTDA 4OAEA 1M4DA 2R1IA 2D4PA 2OB0A 2Y0MA 2CY2A 1IICA 4LX9A 3JVNA 3IWGA 4UWIA 1R57A 1XEBA 4U9YA 4IUSA 1P4NA 2Z11A 2Q04A 3FYNA 5HH1A 1S7KA 4LUAA 2REFA 3R96A 3FB3A 4KOWA 3SHPA 4HNWB 3R95A 3B8GA 4J3GA 3LD2A 5KTAA 1PU9A 1WK4A 1YR0A 4PK2A 4E0AA 3JUWA 2GIVA 2I79A 4IF5A 4CRZB 2DXQA 2B4DA 2AJ6A 3D2PA 3FXTA 2OH1A 4DNCA 2QECA 2P6FA 1GHEA 2B5GB 4XNHC 3R9EA 4EVYA 1BO4A 1M4IA 4MY0A 2F5IA 4KVOE 4PSXA 3TE4A 3P2HA 2FXFA
chains in the Genus database with same CATH superfamily
1QSNA 4FD6A 2XEIA 2BEIA 3GY9A 4KUBA 1N71A 4R3KA 1ZG7A 2HB6A 2JLMA 2K5TA 1FY7A 3WC7A 3LODA 1S3ZA 1K4JA 2NSMA 3F0AA 3PB6X 4KLVA 1YQEA 3T90A 1BAVA 3PGPA 3D2MA 2PRQA 4QBJA 2VEZA 3FF3A 2B4BA 2EK9A 3SI1A 1Y0YA 4PXDA 3JRUA 3SXNA 1FT7A 3S6HA 2CTBA 3FBUA 3PBEA 4MHPA 3TOBA 4E2AA 2V8GA 2V77A 1S7FA 4CRYB 4IHMA 3CXQA 3LMSA 4X5KA 3ISZA 5FVJA 4OC1A 3G8WA 3SI2A 4UBRA 4MXUA 2X7BA 3NA6A 3WR7A 1BOBA 3MGDA 3V38A 4KS9A 2NYQA 1ZG9A 4BINA 4MFQA 2Q0YA 4PPZA 4BMHA 1KUXA 3CPXA 3TX8A 4QC6A 1S60A 1KUYA 2Q4YA 3D67A 3ISXA 4YU9A 2ZOGA 3GLJA 3FMCA 1XMTA 3BJ8A 4JWPA 4KSIA 4GM5A 3PFEA 4CYQA 4KUAA 2ZW4A 5EMIA 4PXEA 4UFVA 5G21A 4QB9A 1TKFA 2GANA 3KZWA 3S9LA 1PYTB 4H6ZA 4AG7A 3NFZA 2ZENA 1ZG8A 2BO9A 5CBMA 4B10A 3GKRA 4E8OA 2EK8A 4JZ0A 4XPLA 4UEZA 2ZEDA 2EUIA 4X3RA 4UEEA 3T8WA 1R3NA 3TFYA 2B5GA 4B14A 4M3SA 4NGPA 4UA3A 1XOVA 1Z8WA 4A95A 1P0HA 2PJ6A 1TF9A 1VHEA 4LQ6A 1XE4A 3NE8A 4AVAA 1M44A 2PSWA 4R87A 4C7IA 2PE3A 2R7HA 2XEJA 1Y9KA 5K8NA 1RTQA 4FD5A 2POKA 2ZW6A 3PB9X 3B3VA 2C6PA 2FVGA 1GYTA 4R7MA 1Z4RA 2VZYA 4NGSA 2NMTA 1NSLA 1NE9A 1CM0A 4NGRA 3ZZIA 2PIZA 3D7DA 1YGHA 4HNXB 4WWVA 4NGNA 2PJBA 2Q44A 4CYPA 1CG2A 2ZELA 2JDDA 3W6SA 2Q7SA 1I1DA 2ZEPA 3SI0A 4NGMA 3DSBA 3SJFA 4CGPA 1OZPA 4FAIA 5IV0A 1Q2DA 2AFMA 2ZEHA 3CDXA 2O53A 2PR8A 5A27A 3B3SA 3NH5A 1HDQA 4KOTA 5HVFA 1CP6A 3KKWA 2OZGA 4FD7A 4UIAA 4ZX8A 1VHSA 4R8FA 2AFZA 3MRUA 2D4OA 3VH9A 3RYOA 5HVGA 2FCKA 5IB0A 5AG6A 2DF5A 4P4BA 1Y7RA 2AFXA 1R43A 1QSMA 4K30A 2VXKA 1IY7A 3G3SA 1PCAA 2RC4A 3D68A 2BCOA 4P10A 4R76A 2FS5A 3PB7X 2H5MA 4LQGA 4CYNA 1XJOA 2BSWA 2XEGA 3KHXA 2ZEEA 4MI4A 4AB7A 2JEWA 3H8FA 5JGFA 5LRGA 3WC6A 5DWMA 3B7IA 4MMOA 3H8GA 1RXTA 4C2YA 2J8NA 4O23A 4PK3A 2ZOFA 1HDUA 4P4JA 4UCMA 3K9TA 4OC2A 3DR8A 3KGQA 2XEFA 5THWA 5KTCA 5HXDA 2F7VA 3PFOA 1Z8XA 3FNCA 4C68A 1F2OA 4NJQA 3S9NA 4A94A 4JYWA 1QQ9A 1ARMA 1M4GA 2P0WA 1FNOA 1MJBA 4PXCA 4F0XA 1ELLP 1I12A 2PR1A 3D4UA 4KOSA 2PJ2A 1SQHA 1ZLIA 3R9GA 3TCVA 1IIDA 3B3TA 5AG7A 4CAFA 2ANPA 4JXQA 3KR5A 4KOVA 2YNCC 5F49A 4HPSA 4KOYA 4RUHA 5LYLA 5DS0A 4A33A 3V8IA 4A38A 2CNMA 2REEA 4CS0B 3NH8A 3B3WA 4Y49C 5JPHA 1H8LA 5C82A 1Y9WA 2PJ9A 4P4FA 2EWBA 3RBUA 2Q4VA 3CZXA 3PB4X 3WT4A 1XRYA 5D29A 2PVVA 1KZFA 4JJXA 1NMTA 1Y7EA 2ARHA 1LFWA 4NF1A 3VWDA 4WJBA 3P2FA 1LAMA 4XPDC 4P45A 2QYVA 4CAXA 1TIQA 2ATRA 3GYAA 2O28A 3UY5A 5HVHA 2WPWA 1UFHA 3IIBA 4PV6A 5ISVA 4UF4A 3BLNA 3FRMA 4KVXA 3W6XA 4CGLA 4UEFA 4ZY0A 2GU2A 5K8MA 5H86A 3TO6A 2YNDA 4FUUA 1MJAA 2IJZA 1BPMA 1QSRA 3H5ZA 3FJUA 1Z4EA 4JLYA 4M85A 2BL1A 2J8MA 3F5BA 4KOUA 4ZX9A 2WPXA 2AFUA 2IL4A 4A39A 5AG4A 3QAYA 4OIWA 5J8FA 3VARA 4R57A 4RI1A 4UIBA 2HUZA 2FT0A 3KR4A 3N5FA 3D7FA 4OC3A 2WZNA 5LYIA 3FH4A 2HV2A 2JBKA 4MFJA 4NSQA 4H6UA 4CAVA 2JDCA 1S7LA 5C88A 1BPNA 2C6GA 3KHZA 1KWMA 4XNHB 2IQ6A 4CPAA 2PJ3A 2B58A 2JBJA 2Z3OA 3IWEA 1XIXA 2QMLA 2QVPA 4YRHA 3IEHA 3BJ7A 1YVKA 1ZLHA 1Z2LA 2O4HA 2ZEOA 4GS4A 4H89A 4P4IA 4B11A 5IX3A 4MHNA 4II9A 3IU2A 3SXOA 1CP7A 5J8CA 4DUKA 3D8PA 1IOFA 2FIAA 3QB8A 5JH9A 5CPAA 2Z3LA 2ZEMA 3K2KA 3A9LA 4AG9A 2AFOA 4CYOA 4OLLA 2CIJA 4PSWA 1Q7LA 3SJXA 1QSOA 2V8HA 2P6GA 4CGMA 2R98A 4L89A 2WYRA 3CPAA 1YLOA 4MHDA 3ZJ0A 2EVNA 4U9ZA 4MCQA 1CBXA 3QNVA 3S6FA 1RO5A 4M6IA 2GFQA 2B3VA 4KVME 4B5OA 4KLWA 3S6GA 2RB7A 2RFHA 1TF8A 3KI9A 4OP4A 2GE3A 2V8DA 5JQ4A 4M6GA 4NFRA 4MBUA 3RZAA 3LACA 2Z10A 3EO4A 3NE7A 4YWYA 1OBRA 2PJ1A 3TT2A 4C2XA 2ZEFA 3QAHA 4PXBA 3WC5A 1F2PA 1TKHA 1X12A 3V7ZA 5JM6A 2CTCA 3OWCA 2I3CA 2OU2A 4QVTA 3E0KA 4R9MA 5GCNA 5A28A 4HKFA 4AVCA 5K8PA 3DDDA 3EY5A 3IFEA 2G3TA 2ODFA 1IB1E 3EC4A 2GLFA 4ZGYB 2EBJA 3PEIA 1MJ9A 2PJ0A 1Y0RA 5H84A 5F09A 1M1DA 1ELMP 4ZBGA 2ZPAA 1Q2YA 4X8IA 4B12A 3B2YA 3W91A 1JWQA 1IU8A 3BXMA 5E96A 2CXAA 3PRTA 2HC9A 1DE4C 3D7HA 5G22A 4QUSA 3B35A 2GREA 1AMPA 3TOAA 4ONUA 2FSRA 4EWTA 4U5YA 1TKJA 1VKCA 2G3AA 2KCWA 4KOXA 2Q51A 4L8AA 3PZJA 1AUGA 3N7ZA 2DPSA 3FEDA 5F48A 4CAEA 1U6MA 5I4MA 1YSJA 3T9YA 3TO7A 2YNCA 3DGVA 4OADA 2J9AA 3GIUA 7CPAA 3D7GA 3DNSA 3H8EA 2Z3MA 4R6TA 3GB0A 1Z9UA 3FVLA 2OOTA 2OZUA 4ZY1A 4YGOA 2AFWA 1PUAA 3H4QA 4B5PB 5J1QA 1NSAA 2JEVA 3SJGA 4CGOA 2Q7BA 3CXPA 3KQXA 4C2ZA 4ORFA 4F0YA 1EE3P 1CJWA 3KASA 4MJ8A 2Z3PA 2IMOA 5EBVA 3R1KA 4I49A 4KORA 4Q36A 4OIDA 2VBQA 1UWYA 4DYOA 4JXRA 5AGEA 2PJ4A 4B6ZA 1CPSA 1IOIA 2YNEA 3PB8X 1S7NA 3EXNA 5G1ZA 1QSTA 4OMEA 3F8KA 3BHXA 2ZW7A 3RNZA 5CNPA 3TC8A 4F8ZA 3PP9A 4P44A 4ONWA 4MFLA 2G9DA 4IK2A 1ON0A 1B87A 4Q38A 5LYDA 4FBEA 1V0CA 2R8VA 2A4NA 2Z3NA 2PDOA 2VZZA 3MN8A 4FD4A 1Q2CA 2C1CA 4NGTA 5ELYA 4G1PA 3VATA 4AVBA 3IJ3A 2HQYA 3FECA 1B6BA 1YX0A 4F9UA 4EMEA 1J4JA 4JD6A 3D3SA 1I21A 2FIWA 5LYFA 1YK3A 3C26A 2PRBA 4NGQA 4X2TA 4CGNA 4TNUA 1YMEA 3R9FA 1LCPA 4A30A 4IAVA 2YGWA 2F8HA 4OKOA 2PJ5A 3BI0A 2FE7A 2PCUA 4A2ZA 4BD9A 4UWJA 3TTHA 1AYEA 5D8NA 3IGRA 4Z65A 2PC1A 4A32A 5HMNA 4ZY2A 5LRJA 1CX8A 1Z5RA 2PQ8A 6CPAA 2OZHA 2V8VA 4KZTA 3I9SA 4ZYQA 3K9UA 2CNSA 1MK4A 4NXYA 4YFJA 1TXRA 1Z8LA 4AXVA 2I00A 4Y49B 1IYKA 1XF8A 3GUXA 4P4DA 4A37A 4MCRA 8CPAA 1LRZA 1YW4A 3BI1A 2C27A 1ARLA 2C6CA 1JQGA 3CXSA 1WWZA 2CF4A 1F57A 3JTKA 4M6HA 4RS2A 4NEXA 3RO0A 3SJEA 2BUEA 4B5PA 2VI7A 4NCZA 1M4LA 3HLPA 2WUUA 2PJCA 1X10A 2ZW5A 5F46A 1YREA 2ABZA 2G0BA 4ZI6A 3EFAA 4XPDB 1IYLA 4OC4A 3PBBA 1LANA 1VGYA 2B4DB 4PQAA 5F47A 2PJ8A 4H2KA 2OR4A 4C7HA 2ZXVA 3FEEA 4W9YA 4MCPA 5I0CA 1L0CA 2BOAA 4Q7AA 5BWAB 1YLEA 3HUVA 2QIRA 1S5KA 3FIXA 3IU1A 2Q4ZA 3I1UA 3I3GA 1QMUA 1VIXA 1LAPA 4MFKA 3LWUA 2Q43A 5DWNA 1YVOA 1XMBA 4P4EA 2VL1A 2EO8A 1YW6A 1BLLE 2P6EA 2VQYA 3DR6A 5EC4A 4R3LA 4F6AA 1KUVA 2B3UA 4F9VA 2AE6A 1A2ZA 2FL4A 3S6KA 2J8RA 2PJAA 2GLJA 3TO9A 2Z0ZA 2CNTA 4XPKA 4CAWA 3S9MA 4EFDA 4HNYB 3VWEA 3B3CA 4MY3A 1CPXA 4K3NA 5KTDA 2WSAA 4OAEA 2QJ8A 1M4DA 2R1IA 2D4PA 4P6YA 2OB0A 2Y0MA 4MHZA 2CY2A 3IWWA 1IICA 3WABA 4LX9A 3JVNA 4UCNA 3IWGA 3D66A 4UWIA 1R57A 1XEBA 4FWUA 4MFZA 2AFSA 4IUSA 1XBUA 1P4NA 2PVWA 4U9YA 4MCSA 2Z11A 2Q04A 3FYNA 5HH1A 2ZEGA 1S7KA 2DEAA 3RAMA 5IB9A 4LUAA 3CT9A 2PIYA 2REFA 2Z3KA 3KL9A 3R96A 1VHOA 3FB3A 1ZO0A 3IO1A 4KOWA 4RN7A 3SHPA 4HNWB 3R95A 1XFOA 4A31A 3B8GA 4J3GA 3LD2A 5KTAA 4UFWA 4B13A 3DLJA 3IC1A 1PU9A 1WK4A 3NH4A 4MRIA 3KQZA 1YR0A 4PK2A 1Z8TA 4E0AA 3JUWA 4DJLA 4TWEA 2GIVA 5AG5A 4OC5A 2I79A 4IF5A 4NJRA 5K8OA 2DPTA 3FX6A 4CRZB 2DXQA 2B4DA 2AJ6A 1IGBA 3D2PA 2OH1A 3FXTA 2QECA 4KSFA 4DNCA 5LRKA 2P6FA 1GHEA 4BBHA 4GXHA 2B5GB 4MHYA 1DTDA 4XNHC 3R9EA 1LOKA 4EVYA 2PJ7A 1BO4A 1M4IA 4MY0A 2F5IA 4KVOE 3L2NA 5G20A 4KSAA 1HEEA 4MFPA 4OC0A 4PSXA 4UFXA 3P2HA 3TE4A 2FXFA 4UCPA
chains in the Genus database with same CATH topology
1QSNA 4FD6A 2BEIA 3GY9A 4KUBA 1N71A 4R3KA 2JLMA 2K5TA 1FY7A 3LODA 1S3ZA 1K4JA 3F0AA 4KLVA 3T90A 3PGPA 3D2MA 4QBJA 2VEZA 2B4BA 3SXNA 4E2AA 3S6HA 3TOBA 3FBUA 1S7FA 4CRYB 3CXQA 4X5KA 5FVJA 3G8WA 4UBRA 2X7BA 3WR7A 1BOBA 3MGDA 4KS9A 4MFQA 2Q0YA 4BMHA 1KUXA 4QC6A 1S60A 1KUYA 2Q4YA 1XMTA 3BJ8A 4JWPA 4CYQA 4KUAA 2ZW4A 4UFVA 5G21A 4QB9A 2GANA 4H6ZA 4AG7A 4B10A 3GKRA 4E8OA 4XPLA 2EUIA 3TFYA 2B5GA 4B14A 4M3SA 4UA3A 4A95A 1P0HA 1XE4A 4AVAA 1M44A 2PSWA 4R87A 4C7IA 2R7HA 1Y9KA 4FD5A 2ZW6A 1Z4RA 2VZYA 2NMTA 1NSLA 1NE9A 1CM0A 3ZZIA 1YGHA 4HNXB 2Q44A 4CYPA 2JDDA 3W6SA 4CGPA 1I1DA 5IV0A 3DSBA 1OZPA 1Q2DA 5A27A 2PR8A 4KOTA 3KKWA 2OZGA 4FD7A 1VHSA 2D4OA 3RYOA 2FCKA 5IB0A 5AG6A 1Y7RA 1QSMA 4K30A 2VXKA 3G3SA 2RC4A 2FS5A 2H5MA 4CYNA 2BSWA 4MI4A 4AB7A 5DWMA 1RXTA 4C2YA 2J8NA 4PK3A 4UCMA 3DR8A 5KTCA 3FNCA 4C68A 1M4GA 2P0WA 1MJBA 4F0XA 1I12A 2PR1A 4KOSA 3R9GA 1SQHA 4CAFA 3TCVA 1IIDA 5AG7A 4KOVA 4JXQA 2YNCC 5F49A 4KOYA 4A33A 3V8IA 2CNMA 2REEA 4CS0B 4Y49C 5JPHA 5C82A 1Y9WA 2Q4VA 1KZFA 4JJXA 1NMTA 2ARHA 3VWDA 4NF1A 3P2FA 4XPDC 4CAXA 1TIQA 2ATRA 3GYAA 2O28A 3UY5A 2WPWA 1UFHA 4PV6A 5ISVA 3BLNA 3FRMA 4KVXA 3W6XA 4CGLA 5H86A 3TO6A 2YNDA 1MJAA 1QSRA 3H5ZA 1Z4EA 4JLYA 4M85A 2BL1A 2J8MA 3F5BA 4KOUA 5AG4A 2WPXA 5J8FA 2IL4A 4R57A 4RI1A 2HUZA 2FT0A 2HV2A 4MFJA 4NSQA 5C88A 4H6UA 4CAVA 2JDCA 1S7LA 4XNHB 2B58A 2Z3OA 3IWEA 1XIXA 2QMLA 4YRHA 3BJ7A 1YVKA 4GS4A 4H89A 4B11A 5IX3A 4II9A 3IU2A 3SXOA 5J8CA 3D8PA 2FIAA 3QB8A 2Z3LA 3A9LA 4AG9A 4CYOA 4OLLA 4PSWA 1QSOA 2P6GA 4CGMA 2R98A 4L89A 4MHDA 3ZJ0A 2EVNA 4U9ZA 3S6FA 1RO5A 2B3VA 4KVME 4B5OA 4KLWA 3S6GA 2GE3A 5JQ4A 4MBUA 2Z10A 3EO4A 3NE7A 3TT2A 4C2XA 3QAHA 3OWCA 2OU2A 4R9MA 4QVTA 3E0KA 5GCNA 5A28A 4HKFA 4AVCA 3DDDA 3EY5A 2G3TA 3EC4A 1IB1E 4ZGYB 1MJ9A 5H84A 1M1DA 4ZBGA 2ZPAA 1Q2YA 4B12A 3W91A 5E96A 2CXAA 5G22A 4QUSA 3TOAA 4ONUA 2FSRA 4U5YA 1VKCA 2G3AA 2KCWA 4KOXA 4L8AA 3PZJA 3N7ZA 2DPSA 5F48A 4CAEA 1U6MA 3TO7A 3T9YA 2YNCA 4OADA 3DNSA 2Z3MA 1Z9UA 2OZUA 4YGOA 1PUAA 3H4QA 4B5PB 2JEVA 4CGOA 2Q7BA 3CXPA 4C2ZA 4ORFA 4F0YA 1CJWA 4MJ8A 2Z3PA 5EBVA 3R1KA 4I49A 4KORA 4Q36A 2VBQA 4JXRA 5AGEA 2YNEA 1S7NA 3EXNA 5G1ZA 1QSTA 3F8KA 2ZW7A 5CNPA 3PP9A 4MFLA 1ON0A 1B87A 4Q38A 1V0CA 2R8VA 2A4NA 2Z3NA 2PDOA 2VZZA 4FD4A 1Q2CA 4AVBA 2HQYA 1B6BA 1YX0A 1J4JA 4JD6A 3D3SA 1I21A 2FIWA 1YK3A 3C26A 2PRBA 4CGNA 3R9FA 4A30A 2YGWA 2FE7A 4A2ZA 4UWJA 3TTHA 3IGRA 2PC1A 4A32A 5HMNA 2PQ8A 2OZHA 4KZTA 3I9SA 3K9UA 2CNSA 1MK4A 4NXYA 4YFJA 2I00A 4Y49B 1IYKA 1XF8A 1LRZA 2C27A 4RS2A 3CXSA 1WWZA 4B5PA 3JTKA 4NEXA 2BUEA 2VI7A 4NCZA 2WUUA 2ZW5A 5F46A 1YREA 2G0BA 3EFAA 4XPDB 1IYLA 2B4DB 5F47A 4C7HA 2ZXVA 5I0CA 1L0CA 5BWAB 1YLEA 2QIRA 1S5KA 3FIXA 3IU1A 3I3GA 4MFKA 5DWNA 1YVOA 5G20A 5EC4A 2VQYA 2P6EA 3DR6A 4R3LA 4F6AA 1KUVA 2B3UA 2AE6A 2FL4A 3S6KA 2J8RA 3TO9A 2Z0ZA 2CNTA 4XPKA 4CAWA 4HNYB 3VWEA 4MY3A 5KTDA 2WSAA 4OAEA 1M4DA 2R1IA 2D4PA 2OB0A 2Y0MA 2CY2A 1IICA 4LX9A 3JVNA 4UCNA 3IWGA 4UWIA 1R57A 1XEBA 4MFZA 4U9YA 4IUSA 1P4NA 2Z11A 2Q04A 3FYNA 5HH1A 1S7KA 4LUAA 2REFA 2Z3KA 3R96A 3FB3A 1ZO0A 4KOWA 3SHPA 4HNWB 3R95A 4A31A 3B8GA 4J3GA 3LD2A 5KTAA 4UFWA 4B13A 1PU9A 1WK4A 1YR0A 4PK2A 4E0AA 3JUWA 2GIVA 5AG5A 2I79A 4IF5A 2DPTA 4CRZB 2DXQA 2B4DA 2AJ6A 3D2PA 3FXTA 2OH1A 4DNCA 2QECA 4KSFA 2P6FA 1GHEA 4BBHA 2B5GB 4XNHC 3R9EA 4EVYA 1BO4A 1M4IA 4MY0A 2F5IA 4KVOE 4KSAA 4MFPA 4PSXA 4UFXA 3TE4A 3P2HA 2FXFA 4UCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QSN A;  4FD6 A;  2BEI A;  3GY9 A;  4KUB A;  1N71 A;  4R3K A;  2JLM A;  2K5T A;  1FY7 A;  3LOD A;  1S3Z A;  1K4J A;  3F0A A;  4KLV A;  3T90 A;  3PGP A;  3D2M A;  4QBJ A;  2VEZ A;  2B4B A;  3SXN A;  4E2A A;  3S6H A;  3TOB A;  3FBU A;  1S7F A;  4CRY B;  3CXQ A;  4X5K A;  5FVJ A;  3G8W A;  4UBR A;  2X7B A;  3WR7 A;  1BOB A;  3MGD A;  2Q0Y A;  4BMH A;  1KUX A;  4QC6 A;  1S60 A;  1KUY A;  2Q4Y A;  1XMT A;  3BJ8 A;  4JWP A;  4KUA A;  2ZW4 A;  4QB9 A;  2GAN A;  4H6Z A;  4AG7 A;  3GKR A;  4E8O A;  4XPL A;  2EUI A;  3TFY A;  2B5G A;  4M3S A;  4UA3 A;  1P0H A;  1XE4 A;  4AVA A;  1M44 A;  2PSW A;  4R87 A;  2R7H A;  1Y9K A;  4FD5 A;  2ZW6 A;  1Z4R A;  2VZY A;  2NMT A;  1NSL A;  1NE9 A;  1CM0 A;  3ZZI A;  1YGH A;  4HNX B;  2Q44 A;  2JDD A;  3W6S A;  1I1D A;  5IV0 A;  3DSB A;  1OZP A;  1Q2D A;  2PR8 A;  4KOT A;  3KKW A;  2OZG A;  4FD7 A;  1VHS A;  2D4O A;  3RYO A;  2FCK A;  5IB0 A;  1Y7R A;  1QSM A;  4K30 A;  2VXK A;  3G3S A;  2RC4 A;  2FS5 A;  2H5M A;  2BSW A;  4MI4 A;  4AB7 A;  5DWM A;  1RXT A;  2J8N A;  4PK3 A;  3DR8 A;  5KTC A;  3FNC A;  1M4G A;  2P0W A;  1MJB A;  1I12 A;  2PR1 A;  4KOS A;  3R9G A;  1SQH A;  3TCV A;  1IID A;  4KOV A;  4JXQ A;  5F49 A;  4KOY A;  3V8I A;  2CNM A;  2REE A;  4CS0 B;  4Y49 C;  5JPH A;  5C82 A;  1Y9W A;  2Q4V A;  1KZF A;  4JJX A;  1NMT A;  2ARH A;  3VWD A;  4NF1 A;  3P2F A;  4XPD C;  4CAX A;  1TIQ A;  2ATR A;  3GYA A;  2O28 A;  3UY5 A;  2WPW A;  1UFH A;  4PV6 A;  5ISV A;  3BLN A;  3FRM A;  4KVX A;  3W6X A;  5H86 A;  3TO6 A;  1MJA A;  1QSR A;  1Z4E A;  4JLY A;  4M85 A;  2BL1 A;  2J8M A;  3F5B A;  4KOU A;  2WPX A;  5J8F A;  2IL4 A;  4R57 A;  4RI1 A;  2HUZ A;  2FT0 A;  2HV2 A;  4NSQ A;  5C88 A;  4H6U A;  4CAV A;  2JDC A;  1S7L A;  4XNH B;  2B58 A;  4YRH A;  1XIX A;  2QML A;  3BJ7 A;  1YVK A;  4GS4 A;  4H89 A;  5IX3 A;  4II9 A;  3SXO A;  5J8C A;  3D8P A;  2FIA A;  3QB8 A;  4AG9 A;  4OLL A;  4PSW A;  1QSO A;  2P6G A;  2R98 A;  4L89 A;  4MHD A;  3ZJ0 A;  2EVN A;  4U9Z A;  3S6F A;  1RO5 A;  2B3V A;  4KVM E;  4B5O A;  4KLW A;  3S6G A;  2GE3 A;  5JQ4 A;  4MBU A;  2Z10 A;  3EO4 A;  3NE7 A;  3TT2 A;  3QAH A;  3OWC A;  2OU2 A;  4R9M A;  4QVT A;  3E0K A;  5GCN A;  4HKF A;  4AVC A;  3DDD A;  3EY5 A;  2G3T A;  3EC4 A;  1IB1 E;  1MJ9 A;  5H84 A;  1M1D A;  4ZBG A;  2ZPA A;  1Q2Y A;  3W91 A;  5E96 A;  4QUS A;  3TOA A;  4ONU A;  2FSR A;  4U5Y A;  1VKC A;  2G3A A;  2KCW A;  4KOX A;  4L8A A;  3PZJ A;  3N7Z A;  5F48 A;  1U6M A;  3TO7 A;  3T9Y A;  4OAD A;  3DNS A;  1Z9U A;  2OZU A;  4YGO A;  1PUA A;  3H4Q A;  4B5P B;  2JEV A;  2Q7B A;  3CXP A;  4ORF A;  4F0Y A;  1CJW A;  4MJ8 A;  5EBV A;  3R1K A;  4I49 A;  4KOR A;  2VBQ A;  4JXR A;  1S7N A;  3EXN A;  1QST A;  3F8K A;  2ZW7 A;  5CNP A;  3PP9 A;  1ON0 A;  1B87 A;  1V0C A;  2R8V A;  2A4N A;  2PDO A;  2VZZ A;  4FD4 A;  1Q2C A;  4AVB A;  2HQY A;  1B6B A;  1YX0 A;  1J4J A;  4JD6 A;  3D3S A;  1I21 A;  2FIW A;  1YK3 A;  3C26 A;  2PRB A;  3R9F A;  2FE7 A;  4UWJ A;  3TTH A;  3IGR A;  2PC1 A;  5HMN A;  2PQ8 A;  2OZH A;  4KZT A;  3I9S A;  3K9U A;  2CNS A;  1MK4 A;  4NXY A;  4YFJ A;  2I00 A;  4Y49 B;  1IYK A;  1XF8 A;  1LRZ A;  2C27 A;  4RS2 A;  3CXS A;  1WWZ A;  4B5P A;  4NEX A;  2BUE A;  2VI7 A;  4NCZ A;  2ZW5 A;  5F46 A;  1YRE A;  2G0B A;  3EFA A;  4XPD B;  1IYL A;  2B4D B;  5F47 A;  2ZXV A;  5I0C A;  1L0C A;  1YLE A;  2QIR A;  1S5K A;  3FIX A;  3I3G A;  5DWN A;  1YVO A;  5EC4 A;  2VQY A;  2P6E A;  3DR6 A;  4R3L A;  4F6A A;  1KUV A;  2B3U A;  2AE6 A;  2FL4 A;  3S6K A;  2J8R A;  3TO9 A;  2Z0Z A;  2CNT A;  4XPK A;  4CAW A;  4HNY B;  3VWE A;  4MY3 A;  5KTD A;  4OAE A;  1M4D A;  2R1I A;  2D4P A;  2OB0 A;  2Y0M A;  2CY2 A;  1IIC A;  4LX9 A;  3JVN A;  3IWG A;  4UWI A;  1R57 A;  1XEB A;  4U9Y A;  4IUS A;  1P4N A;  2Z11 A;  2Q04 A;  3FYN A;  5HH1 A;  1S7K A;  4LUA A;  2REF A;  3R96 A;  3FB3 A;  4KOW A;  3SHP A;  4HNW B;  3R95 A;  3B8G A;  4J3G A;  3LD2 A;  5KTA A;  1PU9 A;  1WK4 A;  1YR0 A;  4PK2 A;  4E0A A;  3JUW A;  2GIV A;  2I79 A;  4IF5 A;  4CRZ B;  2DXQ A;  2B4D A;  2AJ6 A;  3D2P A;  3FXT A;  2OH1 A;  4DNC A;  2QEC A;  2P6F A;  1GHE A;  2B5G B;  4XNH C;  3R9E A;  4EVY A;  1BO4 A;  1M4I A;  4MY0 A;  2F5I A;  4KVO E;  4PSX A;  3TE4 A;  3P2H A;  2FXF A; 
#chains in the Genus database with same CATH topology
 1QSN A;  4FD6 A;  2XEI A;  2BEI A;  3GY9 A;  4KUB A;  1N71 A;  4R3K A;  1ZG7 A;  2HB6 A;  2JLM A;  2K5T A;  1FY7 A;  3WC7 A;  3LOD A;  1S3Z A;  1K4J A;  2NSM A;  3F0A A;  3PB6 X;  4KLV A;  1YQE A;  3T90 A;  1BAV A;  3PGP A;  3D2M A;  2PRQ A;  4QBJ A;  2VEZ A;  3FF3 A;  2B4B A;  2EK9 A;  3SI1 A;  1Y0Y A;  4PXD A;  3JRU A;  3SXN A;  1FT7 A;  3S6H A;  2CTB A;  3FBU A;  3PBE A;  4MHP A;  3TOB A;  4E2A A;  2V8G A;  2V77 A;  1S7F A;  4CRY B;  4IHM A;  3CXQ A;  3LMS A;  4X5K A;  3ISZ A;  5FVJ A;  4OC1 A;  3G8W A;  3SI2 A;  4UBR A;  4MXU A;  2X7B A;  3NA6 A;  3WR7 A;  1BOB A;  3MGD A;  3V38 A;  4KS9 A;  2NYQ A;  1ZG9 A;  4BIN A;  4MFQ A;  2Q0Y A;  4PPZ A;  4BMH A;  1KUX A;  3CPX A;  3TX8 A;  4QC6 A;  1S60 A;  1KUY A;  2Q4Y A;  3D67 A;  3ISX A;  4YU9 A;  2ZOG A;  3GLJ A;  3FMC A;  1XMT A;  3BJ8 A;  4JWP A;  4KSI A;  4GM5 A;  3PFE A;  4CYQ A;  4KUA A;  2ZW4 A;  5EMI A;  4PXE A;  4UFV A;  5G21 A;  4QB9 A;  1TKF A;  2GAN A;  3KZW A;  3S9L A;  1PYT B;  4H6Z A;  4AG7 A;  3NFZ A;  2ZEN A;  1ZG8 A;  2BO9 A;  5CBM A;  4B10 A;  3GKR A;  4E8O A;  2EK8 A;  4JZ0 A;  4XPL A;  4UEZ A;  2ZED A;  2EUI A;  4X3R A;  4UEE A;  3T8W A;  1R3N A;  3TFY A;  2B5G A;  4B14 A;  4M3S A;  4NGP A;  4UA3 A;  1XOV A;  1Z8W A;  4A95 A;  1P0H A;  2PJ6 A;  1TF9 A;  1VHE A;  4LQ6 A;  1XE4 A;  3NE8 A;  4AVA A;  1M44 A;  2PSW A;  4R87 A;  4C7I A;  2PE3 A;  2R7H A;  2XEJ A;  1Y9K A;  5K8N A;  1RTQ A;  4FD5 A;  2POK A;  2ZW6 A;  3PB9 X;  3B3V A;  2C6P A;  2FVG A;  1GYT A;  4R7M A;  1Z4R A;  2VZY A;  4NGS A;  2NMT A;  1NSL A;  1NE9 A;  1CM0 A;  4NGR A;  3ZZI A;  2PIZ A;  3D7D A;  1YGH A;  4HNX B;  4WWV A;  4NGN A;  2PJB A;  2Q44 A;  4CYP A;  1CG2 A;  2ZEL A;  2JDD A;  3W6S A;  2Q7S A;  1I1D A;  2ZEP A;  3SI0 A;  4NGM A;  3DSB A;  3SJF A;  4CGP A;  1OZP A;  4FAI A;  5IV0 A;  1Q2D A;  2AFM A;  2ZEH A;  3CDX A;  2O53 A;  2PR8 A;  5A27 A;  3B3S A;  3NH5 A;  1HDQ A;  4KOT A;  5HVF A;  1CP6 A;  3KKW A;  2OZG A;  4FD7 A;  4UIA A;  4ZX8 A;  1VHS A;  4R8F A;  2AFZ A;  3MRU A;  2D4O A;  3VH9 A;  3RYO A;  5HVG A;  2FCK A;  5IB0 A;  5AG6 A;  2DF5 A;  4P4B A;  1Y7R A;  2AFX A;  1R43 A;  1QSM A;  4K30 A;  2VXK A;  1IY7 A;  3G3S A;  1PCA A;  2RC4 A;  3D68 A;  2BCO A;  4P10 A;  4R76 A;  2FS5 A;  3PB7 X;  2H5M A;  4LQG A;  4CYN A;  1XJO A;  2BSW A;  2XEG A;  3KHX A;  2ZEE A;  4MI4 A;  4AB7 A;  2JEW A;  3H8F A;  5JGF A;  5LRG A;  3WC6 A;  5DWM A;  3B7I A;  4MMO A;  3H8G A;  1RXT A;  4C2Y A;  2J8N A;  4O23 A;  4PK3 A;  2ZOF A;  1HDU A;  4P4J A;  4UCM A;  3K9T A;  4OC2 A;  3DR8 A;  3KGQ A;  2XEF A;  5THW A;  5KTC A;  5HXD A;  2F7V A;  3PFO A;  1Z8X A;  3FNC A;  4C68 A;  1F2O A;  4NJQ A;  3S9N A;  4A94 A;  4JYW A;  1QQ9 A;  1ARM A;  1M4G A;  2P0W A;  1FNO A;  1MJB A;  4PXC A;  4F0X A;  1ELL P;  1I12 A;  2PR1 A;  3D4U A;  4KOS A;  2PJ2 A;  1SQH A;  1ZLI A;  3R9G A;  3TCV A;  1IID A;  3B3T A;  5AG7 A;  4CAF A;  2ANP A;  4JXQ A;  3KR5 A;  4KOV A;  2YNC C;  5F49 A;  4HPS A;  4KOY A;  4RUH A;  5LYL A;  5DS0 A;  4A33 A;  3V8I A;  4A38 A;  2CNM A;  2REE A;  4CS0 B;  3NH8 A;  3B3W A;  4Y49 C;  5JPH A;  1H8L A;  5C82 A;  1Y9W A;  2PJ9 A;  4P4F A;  2EWB A;  3RBU A;  2Q4V A;  3CZX A;  3PB4 X;  3WT4 A;  1XRY A;  5D29 A;  2PVV A;  1KZF A;  4JJX A;  1NMT A;  1Y7E A;  2ARH A;  1LFW A;  4NF1 A;  3VWD A;  4WJB A;  3P2F A;  1LAM A;  4XPD C;  4P45 A;  2QYV A;  4CAX A;  1TIQ A;  2ATR A;  3GYA A;  2O28 A;  3UY5 A;  5HVH A;  2WPW A;  1UFH A;  3IIB A;  4PV6 A;  5ISV A;  4UF4 A;  3BLN A;  3FRM A;  4KVX A;  3W6X A;  4CGL A;  4UEF A;  4ZY0 A;  2GU2 A;  5K8M A;  5H86 A;  3TO6 A;  2YND A;  4FUU A;  1MJA A;  2IJZ A;  1BPM A;  1QSR A;  3H5Z A;  3FJU A;  1Z4E A;  4JLY A;  4M85 A;  2BL1 A;  2J8M A;  3F5B A;  4KOU A;  4ZX9 A;  2WPX A;  2AFU A;  2IL4 A;  4A39 A;  5AG4 A;  3QAY A;  4OIW A;  5J8F A;  3VAR A;  4R57 A;  4RI1 A;  4UIB A;  2HUZ A;  2FT0 A;  3KR4 A;  3N5F A;  3D7F A;  4OC3 A;  2WZN A;  5LYI A;  3FH4 A;  2HV2 A;  2JBK A;  4MFJ A;  4NSQ A;  4H6U A;  4CAV A;  2JDC A;  1S7L A;  5C88 A;  1BPN A;  2C6G A;  3KHZ A;  1KWM A;  4XNH B;  2IQ6 A;  4CPA A;  2PJ3 A;  2B58 A;  2JBJ A;  2Z3O A;  3IWE A;  1XIX A;  2QML A;  2QVP A;  4YRH A;  3IEH A;  3BJ7 A;  1YVK A;  1ZLH A;  1Z2L A;  2O4H A;  2ZEO A;  4GS4 A;  4H89 A;  4P4I A;  4B11 A;  5IX3 A;  4MHN A;  4II9 A;  3IU2 A;  3SXO A;  1CP7 A;  5J8C A;  4DUK A;  3D8P A;  1IOF A;  2FIA A;  3QB8 A;  5JH9 A;  5CPA A;  2Z3L A;  2ZEM A;  3K2K A;  3A9L A;  4AG9 A;  2AFO A;  4CYO A;  4OLL A;  2CIJ A;  4PSW A;  1Q7L A;  3SJX A;  1QSO A;  2V8H A;  2P6G A;  4CGM A;  2R98 A;  4L89 A;  2WYR A;  3CPA A;  1YLO A;  4MHD A;  3ZJ0 A;  2EVN A;  4U9Z A;  4MCQ A;  1CBX A;  3QNV A;  3S6F A;  1RO5 A;  4M6I A;  2GFQ A;  2B3V A;  4KVM E;  4B5O A;  4KLW A;  3S6G A;  2RB7 A;  2RFH A;  1TF8 A;  3KI9 A;  4OP4 A;  2GE3 A;  2V8D A;  5JQ4 A;  4M6G A;  4NFR A;  4MBU A;  3RZA A;  3LAC A;  2Z10 A;  3EO4 A;  3NE7 A;  4YWY A;  1OBR A;  2PJ1 A;  3TT2 A;  4C2X A;  2ZEF A;  3QAH A;  4PXB A;  3WC5 A;  1F2P A;  1TKH A;  1X12 A;  3V7Z A;  5JM6 A;  2CTC A;  3OWC A;  2I3C A;  2OU2 A;  4QVT A;  3E0K A;  4R9M A;  5GCN A;  5A28 A;  4HKF A;  4AVC A;  5K8P A;  3DDD A;  3EY5 A;  3IFE A;  2G3T A;  2ODF A;  1IB1 E;  3EC4 A;  2GLF A;  4ZGY B;  2EBJ A;  3PEI A;  1MJ9 A;  2PJ0 A;  1Y0R A;  5H84 A;  5F09 A;  1M1D A;  1ELM P;  4ZBG A;  2ZPA A;  1Q2Y A;  4X8I A;  4B12 A;  3B2Y A;  3W91 A;  1JWQ A;  1IU8 A;  3BXM A;  5E96 A;  2CXA A;  3PRT A;  2HC9 A;  1DE4 C;  3D7H A;  5G22 A;  4QUS A;  3B35 A;  2GRE A;  1AMP A;  3TOA A;  4ONU A;  2FSR A;  4EWT A;  4U5Y A;  1TKJ A;  1VKC A;  2G3A A;  2KCW A;  4KOX A;  2Q51 A;  4L8A A;  3PZJ A;  1AUG A;  3N7Z A;  2DPS A;  3FED A;  5F48 A;  4CAE A;  1U6M A;  5I4M A;  1YSJ A;  3T9Y A;  3TO7 A;  2YNC A;  3DGV A;  4OAD A;  2J9A A;  3GIU A;  7CPA A;  3D7G A;  3DNS A;  3H8E A;  2Z3M A;  4R6T A;  3GB0 A;  1Z9U A;  3FVL A;  2OOT A;  2OZU A;  4ZY1 A;  4YGO A;  2AFW A;  1PUA A;  3H4Q A;  4B5P B;  5J1Q A;  1NSA A;  2JEV A;  3SJG A;  4CGO A;  2Q7B A;  3CXP A;  3KQX A;  4C2Z A;  4ORF A;  4F0Y A;  1EE3 P;  1CJW A;  3KAS A;  4MJ8 A;  2Z3P A;  2IMO A;  5EBV A;  3R1K A;  4I49 A;  4KOR A;  4Q36 A;  4OID A;  2VBQ A;  1UWY A;  4DYO A;  4JXR A;  5AGE A;  2PJ4 A;  4B6Z A;  1CPS A;  1IOI A;  2YNE A;  3PB8 X;  1S7N A;  3EXN A;  5G1Z A;  1QST A;  4OME A;  3F8K A;  3BHX A;  2ZW7 A;  3RNZ A;  5CNP A;  3TC8 A;  4F8Z A;  3PP9 A;  4P44 A;  4ONW A;  4MFL A;  2G9D A;  4IK2 A;  1ON0 A;  1B87 A;  4Q38 A;  5LYD A;  4FBE A;  1V0C A;  2R8V A;  2A4N A;  2Z3N A;  2PDO A;  2VZZ A;  3MN8 A;  4FD4 A;  1Q2C A;  2C1C A;  4NGT A;  5ELY A;  4G1P A;  3VAT A;  4AVB A;  3IJ3 A;  2HQY A;  3FEC A;  1B6B A;  1YX0 A;  4F9U A;  4EME A;  1J4J A;  4JD6 A;  3D3S A;  1I21 A;  2FIW A;  5LYF A;  1YK3 A;  3C26 A;  2PRB A;  4NGQ A;  4X2T A;  4CGN A;  4TNU A;  1YME A;  3R9F A;  1LCP A;  4A30 A;  4IAV A;  2YGW A;  2F8H A;  4OKO A;  2PJ5 A;  3BI0 A;  2FE7 A;  2PCU A;  4A2Z A;  4BD9 A;  4UWJ A;  3TTH A;  1AYE A;  5D8N A;  3IGR A;  4Z65 A;  2PC1 A;  4A32 A;  5HMN A;  4ZY2 A;  5LRJ A;  1CX8 A;  1Z5R A;  2PQ8 A;  6CPA A;  2OZH A;  2V8V A;  4KZT A;  3I9S A;  4ZYQ A;  3K9U A;  2CNS A;  1MK4 A;  4NXY A;  4YFJ A;  1TXR A;  1Z8L A;  4AXV A;  2I00 A;  4Y49 B;  1IYK A;  1XF8 A;  3GUX A;  4P4D A;  4A37 A;  4MCR A;  8CPA A;  1LRZ A;  1YW4 A;  3BI1 A;  2C27 A;  1ARL A;  2C6C A;  1JQG A;  3CXS A;  1WWZ A;  2CF4 A;  1F57 A;  3JTK A;  4M6H A;  4RS2 A;  4NEX A;  3RO0 A;  3SJE A;  2BUE A;  4B5P A;  2VI7 A;  4NCZ A;  1M4L A;  3HLP A;  2WUU A;  2PJC A;  1X10 A;  2ZW5 A;  5F46 A;  1YRE A;  2ABZ A;  2G0B A;  4ZI6 A;  3EFA A;  4XPD B;  1IYL A;  4OC4 A;  3PBB A;  1LAN A;  1VGY A;  2B4D B;  4PQA A;  5F47 A;  2PJ8 A;  4H2K A;  2OR4 A;  4C7H A;  2ZXV A;  3FEE A;  4W9Y A;  4MCP A;  5I0C A;  1L0C A;  2BOA A;  4Q7A A;  5BWA B;  1YLE A;  3HUV A;  2QIR A;  1S5K A;  3FIX A;  3IU1 A;  2Q4Z A;  3I1U A;  3I3G A;  1QMU A;  1VIX A;  1LAP A;  4MFK A;  3LWU A;  2Q43 A;  5DWN A;  1YVO A;  1XMB A;  4P4E A;  2VL1 A;  2EO8 A;  1YW6 A;  1BLL E;  2P6E A;  2VQY A;  3DR6 A;  5EC4 A;  4R3L A;  4F6A A;  1KUV A;  2B3U A;  4F9V A;  2AE6 A;  1A2Z A;  2FL4 A;  3S6K A;  2J8R A;  2PJA A;  2GLJ A;  3TO9 A;  2Z0Z A;  2CNT A;  4XPK A;  4CAW A;  3S9M A;  4EFD A;  4HNY B;  3VWE A;  3B3C A;  4MY3 A;  1CPX A;  4K3N A;  5KTD A;  2WSA A;  4OAE A;  2QJ8 A;  1M4D A;  2R1I A;  2D4P A;  4P6Y A;  2OB0 A;  2Y0M A;  4MHZ A;  2CY2 A;  3IWW A;  1IIC A;  3WAB A;  4LX9 A;  3JVN A;  4UCN A;  3IWG A;  3D66 A;  4UWI A;  1R57 A;  1XEB A;  4FWU A;  4MFZ A;  2AFS A;  4IUS A;  1XBU A;  1P4N A;  2PVW A;  4U9Y A;  4MCS A;  2Z11 A;  2Q04 A;  3FYN A;  5HH1 A;  2ZEG A;  1S7K A;  2DEA A;  3RAM A;  5IB9 A;  4LUA A;  3CT9 A;  2PIY A;  2REF A;  2Z3K A;  3KL9 A;  3R96 A;  1VHO A;  3FB3 A;  1ZO0 A;  3IO1 A;  4KOW A;  4RN7 A;  3SHP A;  4HNW B;  3R95 A;  1XFO A;  4A31 A;  3B8G A;  4J3G A;  3LD2 A;  5KTA A;  4UFW A;  4B13 A;  3DLJ A;  3IC1 A;  1PU9 A;  1WK4 A;  3NH4 A;  4MRI A;  3KQZ A;  1YR0 A;  4PK2 A;  1Z8T A;  4E0A A;  3JUW A;  4DJL A;  4TWE A;  2GIV A;  5AG5 A;  4OC5 A;  2I79 A;  4IF5 A;  4NJR A;  5K8O A;  2DPT A;  3FX6 A;  4CRZ B;  2DXQ A;  2B4D A;  2AJ6 A;  1IGB A;  3D2P A;  2OH1 A;  3FXT A;  2QEC A;  4KSF A;  4DNC A;  5LRK A;  2P6F A;  1GHE A;  4BBH A;  4GXH A;  2B5G B;  4MHY A;  1DTD A;  4XNH C;  3R9E A;  1LOK A;  4EVY A;  2PJ7 A;  1BO4 A;  1M4I A;  4MY0 A;  2F5I A;  4KVO E;  3L2N A;  5G20 A;  4KSA A;  1HEE A;  4MFP A;  4OC0 A;  4PSX A;  4UFX A;  3P2H A;  3TE4 A;  2FXF A;  4UCP A; 
#chains in the Genus database with same CATH homology
 1QSN A;  4FD6 A;  2BEI A;  3GY9 A;  4KUB A;  1N71 A;  4R3K A;  2JLM A;  2K5T A;  1FY7 A;  3LOD A;  1S3Z A;  1K4J A;  3F0A A;  4KLV A;  3T90 A;  3PGP A;  3D2M A;  4QBJ A;  2VEZ A;  2B4B A;  3SXN A;  4E2A A;  3S6H A;  3TOB A;  3FBU A;  1S7F A;  4CRY B;  3CXQ A;  4X5K A;  5FVJ A;  3G8W A;  4UBR A;  2X7B A;  3WR7 A;  1BOB A;  3MGD A;  4KS9 A;  4MFQ A;  2Q0Y A;  4BMH A;  1KUX A;  4QC6 A;  1S60 A;  1KUY A;  2Q4Y A;  1XMT A;  3BJ8 A;  4JWP A;  4CYQ A;  4KUA A;  2ZW4 A;  4UFV A;  5G21 A;  4QB9 A;  2GAN A;  4H6Z A;  4AG7 A;  4B10 A;  3GKR A;  4E8O A;  4XPL A;  2EUI A;  3TFY A;  2B5G A;  4B14 A;  4M3S A;  4UA3 A;  4A95 A;  1P0H A;  1XE4 A;  4AVA A;  1M44 A;  2PSW A;  4R87 A;  4C7I A;  2R7H A;  1Y9K A;  4FD5 A;  2ZW6 A;  1Z4R A;  2VZY A;  2NMT A;  1NSL A;  1NE9 A;  1CM0 A;  3ZZI A;  1YGH A;  4HNX B;  2Q44 A;  4CYP A;  2JDD A;  3W6S A;  4CGP A;  1I1D A;  5IV0 A;  3DSB A;  1OZP A;  1Q2D A;  5A27 A;  2PR8 A;  4KOT A;  3KKW A;  2OZG A;  4FD7 A;  1VHS A;  2D4O A;  3RYO A;  2FCK A;  5IB0 A;  5AG6 A;  1Y7R A;  1QSM A;  4K30 A;  2VXK A;  3G3S A;  2RC4 A;  2FS5 A;  2H5M A;  4CYN A;  2BSW A;  4MI4 A;  4AB7 A;  5DWM A;  1RXT A;  4C2Y A;  2J8N A;  4PK3 A;  4UCM A;  3DR8 A;  5KTC A;  3FNC A;  4C68 A;  1M4G A;  2P0W A;  1MJB A;  4F0X A;  1I12 A;  2PR1 A;  4KOS A;  3R9G A;  1SQH A;  4CAF A;  3TCV A;  1IID A;  5AG7 A;  4KOV A;  4JXQ A;  2YNC C;  5F49 A;  4KOY A;  4A33 A;  3V8I A;  2CNM A;  2REE A;  4CS0 B;  4Y49 C;  5JPH A;  5C82 A;  1Y9W A;  2Q4V A;  1KZF A;  4JJX A;  1NMT A;  2ARH A;  3VWD A;  4NF1 A;  3P2F A;  4XPD C;  4CAX A;  1TIQ A;  2ATR A;  3GYA A;  2O28 A;  3UY5 A;  2WPW A;  1UFH A;  4PV6 A;  5ISV A;  3BLN A;  3FRM A;  4KVX A;  3W6X A;  4CGL A;  5H86 A;  3TO6 A;  2YND A;  1MJA A;  1QSR A;  3H5Z A;  1Z4E A;  4JLY A;  4M85 A;  2BL1 A;  2J8M A;  3F5B A;  4KOU A;  5AG4 A;  2WPX A;  5J8F A;  2IL4 A;  4R57 A;  4RI1 A;  2HUZ A;  2FT0 A;  2HV2 A;  4MFJ A;  4NSQ A;  5C88 A;  4H6U A;  4CAV A;  2JDC A;  1S7L A;  4XNH B;  2B58 A;  2Z3O A;  3IWE A;  1XIX A;  2QML A;  4YRH A;  3BJ7 A;  1YVK A;  4GS4 A;  4H89 A;  4B11 A;  5IX3 A;  4II9 A;  3IU2 A;  3SXO A;  5J8C A;  3D8P A;  2FIA A;  3QB8 A;  2Z3L A;  3A9L A;  4AG9 A;  4CYO A;  4OLL A;  4PSW A;  1QSO A;  2P6G A;  4CGM A;  2R98 A;  4L89 A;  4MHD A;  3ZJ0 A;  2EVN A;  4U9Z A;  3S6F A;  1RO5 A;  2B3V A;  4KVM E;  4B5O A;  4KLW A;  3S6G A;  2GE3 A;  5JQ4 A;  4MBU A;  2Z10 A;  3EO4 A;  3NE7 A;  3TT2 A;  4C2X A;  3QAH A;  3OWC A;  2OU2 A;  4R9M A;  4QVT A;  3E0K A;  5GCN A;  5A28 A;  4HKF A;  4AVC A;  3DDD A;  3EY5 A;  2G3T A;  3EC4 A;  1IB1 E;  4ZGY B;  1MJ9 A;  5H84 A;  1M1D A;  4ZBG A;  2ZPA A;  1Q2Y A;  4B12 A;  3W91 A;  5E96 A;  2CXA A;  5G22 A;  4QUS A;  3TOA A;  4ONU A;  2FSR A;  4U5Y A;  1VKC A;  2G3A A;  2KCW A;  4KOX A;  4L8A A;  3PZJ A;  3N7Z A;  2DPS A;  5F48 A;  4CAE A;  1U6M A;  3TO7 A;  3T9Y A;  2YNC A;  4OAD A;  3DNS A;  2Z3M A;  1Z9U A;  2OZU A;  4YGO A;  1PUA A;  3H4Q A;  4B5P B;  2JEV A;  4CGO A;  2Q7B A;  3CXP A;  4C2Z A;  4ORF A;  4F0Y A;  1CJW A;  4MJ8 A;  2Z3P A;  5EBV A;  3R1K A;  4I49 A;  4KOR A;  4Q36 A;  2VBQ A;  4JXR A;  5AGE A;  2YNE A;  1S7N A;  3EXN A;  5G1Z A;  1QST A;  3F8K A;  2ZW7 A;  5CNP A;  3PP9 A;  4MFL A;  1ON0 A;  1B87 A;  4Q38 A;  1V0C A;  2R8V A;  2A4N A;  2Z3N A;  2PDO A;  2VZZ A;  4FD4 A;  1Q2C A;  4AVB A;  2HQY A;  1B6B A;  1YX0 A;  1J4J A;  4JD6 A;  3D3S A;  1I21 A;  2FIW A;  1YK3 A;  3C26 A;  2PRB A;  4CGN A;  3R9F A;  4A30 A;  2YGW A;  2FE7 A;  4A2Z A;  4UWJ A;  3TTH A;  3IGR A;  2PC1 A;  4A32 A;  5HMN A;  2PQ8 A;  2OZH A;  4KZT A;  3I9S A;  3K9U A;  2CNS A;  1MK4 A;  4NXY A;  4YFJ A;  2I00 A;  4Y49 B;  1IYK A;  1XF8 A;  1LRZ A;  2C27 A;  4RS2 A;  3CXS A;  1WWZ A;  4B5P A;  3JTK A;  4NEX A;  2BUE A;  2VI7 A;  4NCZ A;  2WUU A;  2ZW5 A;  5F46 A;  1YRE A;  2G0B A;  3EFA A;  4XPD B;  1IYL A;  2B4D B;  5F47 A;  4C7H A;  2ZXV A;  5I0C A;  1L0C A;  5BWA B;  1YLE A;  2QIR A;  1S5K A;  3FIX A;  3IU1 A;  3I3G A;  4MFK A;  5DWN A;  1YVO A;  5G20 A;  5EC4 A;  2VQY A;  2P6E A;  3DR6 A;  4R3L A;  4F6A A;  1KUV A;  2B3U A;  2AE6 A;  2FL4 A;  3S6K A;  2J8R A;  3TO9 A;  2Z0Z A;  2CNT A;  4XPK A;  4CAW A;  4HNY B;  3VWE A;  4MY3 A;  5KTD A;  2WSA A;  4OAE A;  1M4D A;  2R1I A;  2D4P A;  2OB0 A;  2Y0M A;  2CY2 A;  1IIC A;  4LX9 A;  3JVN A;  4UCN A;  3IWG A;  4UWI A;  1R57 A;  1XEB A;  4MFZ A;  4U9Y A;  4IUS A;  1P4N A;  2Z11 A;  2Q04 A;  3FYN A;  5HH1 A;  1S7K A;  4LUA A;  2REF A;  2Z3K A;  3R96 A;  3FB3 A;  1ZO0 A;  4KOW A;  3SHP A;  4HNW B;  3R95 A;  4A31 A;  3B8G A;  4J3G A;  3LD2 A;  5KTA A;  4UFW A;  4B13 A;  1PU9 A;  1WK4 A;  1YR0 A;  4PK2 A;  4E0A A;  3JUW A;  2GIV A;  5AG5 A;  2I79 A;  4IF5 A;  2DPT A;  4CRZ B;  2DXQ A;  2B4D A;  2AJ6 A;  3D2P A;  3FXT A;  2OH1 A;  4DNC A;  2QEC A;  4KSF A;  2P6F A;  1GHE A;  4BBH A;  2B5G B;  4XNH C;  3R9E A;  4EVY A;  1BO4 A;  1M4I A;  4MY0 A;  2F5I A;  4KVO E;  4KSA A;  4MFP A;  4PSX A;  4UFX A;  3TE4 A;  3P2H A;  2FXF A;  4UCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...