3DR6A

Structure of ynca, a putative acetyltransferase from salmonella typhimurium
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
172
structure length
172
Chain Sequence
AMTIRFADKADCAAITEIYNHAVLHTAAIWNDRTVDTDNRLAWYEARQLLGYPVLVSEENGVVTGYASFGDWRSFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVMVAGIESQNAASIRLHHSLGFTVTAQMPQVGVKFGRWLDLTFMQLQLDEHAAPDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Funded by the national institute of allergy and infectious diseases of nih (contract number hhsn272200700058c).
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords yncA
total genus 51
structure length 172
sequence length 172
chains with identical sequence B, C
ec nomenclature ec 2.3.1.-:
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3dr6A00
3FYNA 2H5MA 2PSWA 1S7KA 2F5IA 4R87A 4PSXA 2R8VA 1B87A 4H6ZA 4UWJA 1M4DA 1IICA 2JLMA 1BOBA 3TT2A 2ARHA 4R9MA 4MJ8A 2G3TA 3DSBA 1XF8A 3FRMA 4Y49C 1S3ZA 3S6FA 3F8KA 2CNMA 2Z0ZA 4M85A 3TE4A 1I21A 4XPLA 4GS4A 3GY9A 3H4QA 4QBJA 1YGHA 4L8AA 3TO6A 1TIQA 3TOBA 1IYKA 5H84A 2PR8A 4RI1A 4R3KA 4NEXA 1NSLA 2Q44A 4NSQA 4EVYA 3S6GA 4FD6A 2Q04A 1FY7A 2QIRA 2VZZA 4U5YA 5EC4A 1R57A 2ATRA 3D3SA 2OZGA 3R1KA 3CXPA 1PU9A 3BLNA 4KLWA 2HV2A 3S6HA 3LODA 2Z11A 1NMTA 2K5TA 5F48A 4CAXA 5KTDA 3K9UA 1Q2CA 2FIWA 3MGDA 4XPDB 2VQYA 1Q2DA 2OB0A 2R98A 4Y49B 2O28A 2P0WA 1YVKA 4II9A 5C82A 1XIXA 3S6KA 1QSRA 4QUSA 4I49A 3TFYA 1N71A 4M3SA 2B5GA 3EFAA 1I12A 4FD7A 4NCZA 5EBVA 1QSOA 1Z9UA 4KUBA 5JQ4A 4YRHA 4FD4A 4J3GA 2RC4A 3JVNA 4AVAA 4R3LA 2FIAA 4LX9A 2FL4A 3R9FA 5F47A 2CY2A 1QSTA 1MJAA 1RO5A 2OH1A 3QAHA 4YFJA 2ZXVA 1KUYA 2J8MA 2ZW7A 1WWZA 4X5KA 2OZHA 1M44A 3SHPA 3FNCA 3W6XA 3FB3A 4UWIA 4XPDC 4OAEA 2FE7A 1M4IA 4PK3A 2QECA 4JLYA 4KOTA 4NXYA 4IUSA 5KTAA 1Z4RA 3DR8A 2REFA 3W6SA 1B6BA 1XE4A 1YVOA 4AG9A 1OZPA 1U6MA 4HNWB 4OADA 3IGRA 4CRZB 2VZYA 3IWGA 4MBUA 4KOVA 2G0BA 4JXRA 4BMHA 2R1IA 1MK4A 4HNYB 2VBQA 5J8FA 2AE6A 1QSMA 2Q7BA 3FBUA 1S7NA 4B5OA 5CNPA 3TTHA 3PZJA 3SXNA 3WR7A 2P6FA 3G8WA 4B5PA 4JXQA 2B3UA 2C27A 3LD2A 4R57A 1GHEA 1RXTA 2PQ8A 5HH1A 4E8OA 3N7ZA 3JUWA 5C88A 2Q0YA 1J4JA 1S7LA 1BO4A 4UA3A 4IF5A 4KUAA 3DNSA 1SQHA 2PC1A 1P0HA 5F46A 4XNHB 3D2PA 1NE9A 4KVOE 3R95A 2PDOA 4CAVA 1Q2YA 5J8CA 3SXOA 2JDDA 4ZBGA 5JPHA 3CXQA 4B5PB 3I9SA 2CNTA 3EC4A 3VWEA 4K30A 5E96A 4UBRA 4KORA 2D4PA 4ONUA 3F0AA 4KOSA 2GIVA 2FXFA 4KOUA 4KLVA 1I1DA 2FS5A 4OLLA 2Z10A 1V0CA 4FD5A 2NMTA 1KZFA 3W91A 4LUAA 3OWCA 2HQYA 2ZW6A 2J8NA 4ORFA 3KKWA 4JJXA 2BUEA 2REEA 2BEIA 2GE3A 2GANA 1YK3A 2VI7A 2B58A 2B3VA 1ON0A 2VXKA 3CXSA 3R96A 1M1DA 3UY5A 4KVXA 4CRYB 3RYOA 1YREA 4AVBA 2ZW5A 5F49A 5GCNA 3GKRA 2QMLA 1MJ9A 2DXQA 2PR1A 3EO4A 3P2FA 3QB8A 5DWMA 2A4NA 5ISVA 5IV0A 1VKCA 3F5BA 4E0AA 5DWNA 4AB7A 1WK4A 3DDDA 3V8IA 2OU2A 4MY3A 2Q4VA 3PGPA 2WPXA 1LRZA 2FSRA 4DNCA 3ZZIA 3TO9A 4HKFA 3I3GA 4AVCA 1XMTA 2BSWA 2R7HA 4PK2A 4U9YA 2FT0A 1M4GA 3FXTA 4JD6A 3G3SA 1CM0A 4MHDA 5IX3A 3DR6A 3D8PA 3C26A 5KTCA 3T9YA 1YR0A 3BJ8A 1IIDA 1K4JA 4XPKA 2Q4YA 4KVME 3E0KA 3PP9A 3EY5A 2JDCA 4QVTA 1S7FA 1Y9WA 1YLEA 4KOXA 1P4NA 3BJ7A 3FIXA 2Y0MA 1IB1E 3NE7A 1Z4EA 4U9ZA 2P6GA 4KOWA 4L89A 2ZPAA 3ZJ0A 4AG7A 1UFHA 3EXNA 3D2MA 2P6EA 1Y9KA 3R9EA 1IYLA 4H6UA 3T90A 5IB0A 2WPWA 1XEBA 4XNHC 2G3AA 2KCWA 2D4OA 1KUXA 2B4DB 2PRBA 1MJBA 4MY0A 4KZTA 2B4DA 4MI4A 1QSNA 2B5GB 2AJ6A 2J8RA 3R9GA 4F6AA 3B8GA 4PSWA 1S5KA 4KOYA 4RS2A 3P2HA 3TOAA 1KUVA 1L0CA 1CJWA 2IL4A 3TCVA 2I79A 2X7BA 4HNXB 4NF1A 1YX0A 2HUZA 2OZUA 2BL1A 1VHSA 3GYAA 5H86A 4YGOA 4QC6A 1PUAA 2JEVA 2VEZA 4QB9A 2B4BA 4PV6A 2FCKA 2EVNA 2I00A 2CNSA 4H89A 1Y7RA 4JWPA 4CS0B 5HMNA 4E2AA 4F0YA 5FVJA 4CAWA 1S60A 2EUIA 2ZW4A 3VWDA 5I0CA 3TO7A
chains in the Genus database with same CATH superfamily
3FYNA 2H5MA 2PSWA 3KZWA 1S7KA 4UEEA 4F6AA 2F5IA 4R87A 3D68A 4RUHA 4PSXA 2R8VA 4F9UA 4NGMA 3L2NA 3KL9A 3FX6A 1B87A 4H6ZA 2DF5A 4UWJA 1M4DA 1IICA 2JLMA 1BOBA 3TT2A 2ARHA 3LMSA 3CDXA 4CYNA 4R9MA 4P4IA 4MJ8A 4M6GA 4PPZA 2DPTA 4R76A 2G3TA 3DSBA 2CTBA 1XF8A 3FRMA 3KI9A 4Y49C 1S3ZA 2ZELA 3IO1A 4OC4A 5LYIA 3S6FA 3B7IA 1YSJA 2C1CA 3F8KA 4P4BA 4B11A 4UFVA 2CNMA 2Z0ZA 3D66A 4M85A 3TE4A 1I21A 1LFWA 1HDUA 2IQ6A 4XPLA 4MFZA 3KR4A 4GS4A 4B6ZA 3CT9A 3GY9A 3H4QA 4QBJA 1YGHA 4L8AA 1YW4A 4WWVA 3TO6A 1TIQA 2GLJA 4NGNA 1IYKA 3TOBA 3WT4A 5CPAA 4ZY2A 5H84A 2PR8A 4RI1A 4R3KA 2AFZA 4NEXA 5JM6A 4OP4A 1NSLA 3TC8A 2Q44A 4MRIA 4NSQA 1XRYA 5AG6A 4EVYA 5K8OA 1XFOA 3S6GA 5CBMA 3IJ3A 3JRUA 1Z8WA 1DE4C 3LWUA 2ZEFA 2BO9A 3PFOA 1VGYA 4O23A 1BAVA 3H8GA 4FD6A 4OIDA 3FMCA 2Z3OA 1A2ZA 4UCPA 4MMOA 2PE3A 4A39A 2Q04A 1FY7A 2QIRA 1QMUA 2VZZA 4MXUA 4U5YA 5EC4A 1R57A 5HVFA 4A30A 2ATRA 1NSAA 2OZGA 3D3SA 3H8EA 3R1KA 3WC5A 3ISZA 3CXPA 4NJRA 1PU9A 1CPXA 4A94A 4DJLA 2F8HA 3BLNA 4NGSA 3KGQA 3I1UA 4KLWA 1AMPA 4MFKA 2HV2A 3S6HA 1YLOA 2PJ5A 2Z11A 2O4HA 3LODA 4JYWA 4X8IA 2PJAA 1NMTA 2C6GA 1XBUA 2K5TA 5F48A 2HC9A 4CAXA 5KTDA 3K9UA 5LYLA 2XEJA 4P4DA 1Q2CA 2FIWA 2PJ9A 3MGDA 4PXEA 4XPDB 4A31A 2VQYA 1Q2DA 2OB0A 2PIZA 2R98A 4Y49B 4CAEA 2O28A 1Z8TA 2P0WA 5HXDA 4WJBA 1YVKA 2AFOA 1F57A 4FWUA 4LQ6A 6CPAA 4II9A 5C82A 5J1QA 1XIXA 4K3NA 3S6KA 1Z2LA 1QSRA 4QUSA 4I49A 1F2OA 4M6HA 1TKJA 2PJ6A 3IIBA 3TFYA 1BPMA 1N71A 1XMBA 4M3SA 2GREA 3D7FA 3GUXA 2B5GA 3EFAA 2PJ8A 1I12A 1CP6A 4FD7A 2WUUA 1YW6A 4NCZA 5AG4A 5EBVA 2JEWA 1QSOA 1M4LA 1LAMA 1RTQA 1Z9UA 4B13A 4CGLA 4P6YA 5I4MA 4KUBA 5JQ4A 4YRHA 5K8NA 4FD4A 3ISXA 1Q7LA 4J3GA 4ZY1A 1YQEA 3RNZA 1FT7A 2RC4A 3JVNA 4A33A 2C6CA 4AVAA 4MFPA 4P10A 4PXDA 1KWMA 2FIAA 4LX9A 2FL4A 4R3LA 5F47A 2CY2A 3R9FA 4CGNA 1QSTA 1Y0YA 2JBJA 3IC1A 1MJAA 4BBHA 1RO5A 2OH1A 3FECA 3QAHA 3PEIA 2V8VA 1ELLP 4ZX8A 4OC3A 4Q38A 2PCUA 4UEFA 4YFJA 1Z8LA 2CF4A 3BXMA 4B12A 4A38A 2ZXVA 1KUYA 2J8MA 1CG2A 2ZW7A 1CP7A 3KHZA 1WWZA 1Z8XA 4UCMA 2FVGA 4X5KA 3SJEA 3PBEA 4AXVA 2OZHA 1M44A 4OKOA 4JZ0A 5LRKA 3SHPA 3FNCA 1FNOA 3FB3A 4UWIA 4XPDC 3W6XA 4OAEA 1IOFA 2FE7A 3HUVA 4OMEA 1M4IA 4PK3A 1PCAA 2QECA 4JLYA 4KOTA 4NXYA 4IUSA 3S9MA 1Z4RA 5KTAA 3DR8A 1ARLA 2REFA 3W6SA 1B6BA 1XE4A 3D67A 4MHNA 4HPSA 4UEZA 4UF4A 2DEAA 5D29A 2AFWA 1YVOA 4ZI6A 4AG9A 4EMEA 1OZPA 1U6MA 3FF3A 2ABZA 2IJZA 3CPXA 4HNWB 2V8HA 4M6IA 3IGRA 4MHYA 4OADA 4CRZB 2VZYA 2I3CA 3WC6A 1BLLE 3IWGA 4MBUA 4KOVA 2G0BA 3KHXA 5EMIA 5A27A 1VHOA 4JXRA 4BMHA 3S9LA 2PVVA 2R1IA 1MK4A 2ZEHA 4MCRA 4HNYB 2V77A 2GLFA 1EE3P 2VBQA 3QAYA 5J8FA 2AE6A 1QSMA 2Q7BA 2F7VA 3FBUA 3D4UA 3MN8A 4ONWA 1JQGA 1S7NA 4B5OA 5CNPA 5K8PA 3D7DA 3TTHA 3PZJA 3SXNA 3WR7A 4C7HA 1YMEA 2Z3NA 3FEEA 2P6FA 3BI0A 5A28A 3G8WA 4B5PA 4JXQA 4C2XA 2EBJA 3H5ZA 4MHPA 4ZX9A 2B3UA 2C27A 3LD2A 1LOKA 2ZOGA 4R57A 1GHEA 3D7HA 1RXTA 2PQ8A 3NE8A 3QNVA 5HH1A 4E8OA 3N7ZA 3JUWA 2HB6A 5C88A 2Q0YA 1J4JA 1S7LA 2Z3MA 1BO4A 3CZXA 3D7GA 4UA3A 4IF5A 2RB7A 1ZG7A 2G9DA 4KUAA 3DNSA 1CBXA 1SQHA 2PC1A 1IU8A 2PJ4A 3N5FA 4KSFA 3CPAA 4R8FA 4ZY0A 1P0HA 4KS9A 1IGBA 2Z3KA 4XNHB 3RO0A 5F46A 3PB7X 4RN7A 4Z65A 5LRJA 2YNCA 3PBBA 1TF8A 3D2PA 4IHMA 1NE9A 3PRTA 3FVLA 2QVPA 3MRUA 1ELMP 4KVOE 2YNCC 3R95A 1CX8A 2CIJA 2PDOA 4CAVA 1Q2YA 5J8CA 3SXOA 2JDDA 3HLPA 4NGRA 3RAMA 4A32A 4ZBGA 2POKA 5JPHA 4DYOA 3CXQA 3A9LA 4B5PB 4P4JA 4C2ZA 3I9SA 4IAVA 2CNTA 5LRGA 2AFSA 1QQ9A 2AFMA 3KR5A 3EC4A 4OIWA 3VWEA 3B3WA 4FUUA 4K30A 5E96A 3IWEA 4UBRA 3B3SA 4KORA 1XOVA 2D4PA 4R6TA 4Q36A 4CYQA 4PQAA 1VHEA 4ONUA 2Q7SA 1IOIA 3F0AA 3T8WA 4EWTA 4KOSA 2GIVA 2FXFA 4KOUA 4BINA 4KLVA 1I1DA 2FS5A 4OLLA 4YU9A 3KQXA 1X10A 2Z10A 3RZAA 1V0CA 4DUKA 4Q7AA 4FD5A 2ZOFA 2NMTA 3NH8A 1KZFA 3W91A 2WYRA 3IEHA 4LUAA 3OWCA 3SI2A 2PRQA 2HQYA 5D8NA 2ZW6A 1AYEA 1HDQA 2EK9A 4GM5A 2DPSA 2J8NA 4ORFA 4OC5A 1GYTA 1TF9A 4CGOA 3KKWA 5K8MA 3SJFA 4JJXA 3B3VA 2BUEA 1LCPA 5G20A 2REEA 3FH4A 2BEIA 2GE3A 2GANA 2EO8A 2GU2A 4X2TA 4MFJA 1YK3A 2VI7A 2B58A 4CAFA 8CPAA 5G21A 5HVGA 4TNUA 4F9VA 2V8DA 4B14A 2Z3PA 1F2PA 5LYDA 2B3VA 4P45A 1ON0A 3S9NA 4G1PA 2VXKA 2XEGA 3CXSA 2PJ3A 3R96A 4CGMA 1M1DA 3UY5A 4FAIA 1AUGA 4KVXA 4BD9A 4CRYB 1DTDA 4TWEA 3RYOA 1YREA 4AVBA 2PJ0A 2ZW5A 1IY7A 2NSMA 5F49A 4FBEA 3SJGA 5GCNA 3GKRA 2QMLA 1MJ9A 7CPAA 2DXQA 3WABA 2PR1A 2YNEA 3EO4A 3P2FA 2JBKA 3QB8A 5JGFA 5DWMA 3SI0A 2A4NA 4CPAA 5ISVA 2PJ1A 4MCPA 5IV0A 2ZEOA 3IU2A 1VKCA 1XJOA 4OC2A 2ZEPA 3F5BA 4W9YA 4E0AA 1VIXA 4NGQA 5DWNA 3KASA 4AB7A 4P4FA 3NFZA 2OOTA 1WK4A 3DDDA 4OC1A 2OU2A 3V8IA 3NH5A 4MY3A 2EWBA 5JH9A 1ZO0A 2Q4VA 3PGPA 2VL1A 2J9AA 2WPXA 4NJQA 4P4EA 1Z5RA 5F09A 2GFQA 3VH9A 4A95A 4C7IA 1LRZA 1PYTB 2FSRA 3PB9X 4DNCA 3DLJA 3ZZIA 3TO9A 4CYOA 4HKFA 4A2ZA 1Y0RA 2O53A 3IWWA 3I3GA 4AVCA 1XMTA 2PJ2A 2ZEMA 2BSWA 4UFXA 2R7HA 4PK2A 4U9YA 2FT0A 1M4GA 3FXTA 4JD6A 4CYPA 5BWAB 2XEFA 3G3SA 4MCSA 1CM0A 4MHDA 5IX3A 3DR6A 3D8PA 3C26A 3PB8X 4F8ZA 5KTCA 1LAPA 2Z3LA 1YR0A 3T9YA 5AG5A 3BJ8A 1IIDA 1K4JA 3GIUA 3NH4A 2Q4YA 4XPKA 4KVME 3E0KA 4P44A 3FJUA 4C2YA 3PP9A 2PJBA 3EY5A 4PXBA 1Y7EA 2JDCA 4QVTA 1S7FA 1Y9WA 1YLEA 3BI1A 2IMOA 3PFEA 4KOXA 1P4NA 1ZG8A 2ANPA 3BJ7A 2ZENA 4MFLA 5LYFA 5I0CA 1BPNA 2YNDA 2CTCA 2ZEEA 3FIXA 5IB9A 3K2KA 3PB6X 4F0XA 2Y0MA 1IB1E 3NE7A 1ZLHA 1Z4EA 4U9ZA 2P6GA 2RFHA 2ZEDA 4KOWA 3IU1A 4MHZA 4L89A 3LACA 2ZPAA 3ZJ0A 2QYVA 3H8FA 1ZLIA 3SJXA 4AG7A 1UFHA 3EXNA 3D2MA 3TX8A 2NYQA 5THWA 3B3TA 2P6EA 1Y9KA 3R9EA 1IYLA 5G22A 3GB0A 4H6UA 4R7MA 3BHXA 2PJ7A 5ELYA 3T90A 5IB0A 2WPWA 1XEBA 2ZEGA 4XNHC 1TKHA 2G3AA 1CPSA 4CGPA 4NGTA 2KCWA 4KSIA 2D4OA 2C6PA 2PIYA 3RBUA 4NFRA 4B10A 2AFXA 1JWQA 4UIAA 1KUXA 2V8GA 2B4DB 2PRBA 4OC0A 4X3RA 4A37A 1MJBA 4MY0A 4KZTA 2B4DA 1R3NA 2Q51A 2XEIA 4MI4A 1ARMA 3VATA 4ZGYB 5AGEA 1QSNA 3SI1A 4IK2A 2B5GB 2AJ6A 1R43A 2J8RA 2OR4A 4H2KA 3R9GA 2BCOA 4MFQA 1OBRA 3B35A 3B8GA 1TXRA 3PB4X 3V7ZA 1TKFA 4MCQA 2WSAA 3V38A 1H8LA 4PSWA 3GLJA 1S5KA 4KOYA 4RS2A 3P2HA 3TOAA 4LQGA 3NA6A 1HEEA 1KUVA 1X12A 2BOAA 2QJ8A 1LANA 3B2YA 1L0CA 3K9TA 1CJWA 1ZG9A 2AFUA 2IL4A 2Q4ZA 4UFWA 4UIBA 5HVHA 3TCVA 2I79A 2X7BA 4HNXB 4NF1A 1UWYA 1YX0A 2HUZA 2OZUA 2YGWA 2BL1A 3KQZA 3JTKA 1VHSA 2CXAA 3GYAA 5AG7A 5G1ZA 5H86A 4NGPA 3FEDA 4YGOA 2WZNA 1PUAA 2JEVA 3B3CA 4QC6A 2VEZA 4EFDA 4QB9A 2B4BA 4PV6A 4ZYQA 2FCKA 2EVNA 2PJCA 2I00A 2CNSA 4YWYA 4H89A 1Y7RA 3DGVA 3WC7A 4JWPA 4CS0B 5HMNA 2ODFA 4E2AA 2PVWA 4GXHA 4F0YA 3VARA 5FVJA 4CAWA 1S60A 4UCNA 5DS0A 4KSAA 2EUIA 2ZW4A 2EK8A 4PXCA 3IFEA 4C68A 3VWDA 2Q43A 3TO7A
chains in the Genus database with same CATH topology
3FYNA 2H5MA 2PSWA 1S7KA 2F5IA 4R87A 4PSXA 2R8VA 1B87A 4H6ZA 4UWJA 1M4DA 1IICA 2JLMA 1BOBA 3TT2A 2ARHA 4CYNA 4R9MA 4MJ8A 2DPTA 2G3TA 3DSBA 1XF8A 3FRMA 4Y49C 1S3ZA 3S6FA 3F8KA 4B11A 4UFVA 2CNMA 2Z0ZA 4M85A 3TE4A 1I21A 4XPLA 4MFZA 4GS4A 3GY9A 3H4QA 4QBJA 1YGHA 4L8AA 3TO6A 1TIQA 3TOBA 1IYKA 5H84A 2PR8A 4RI1A 4R3KA 4NEXA 1NSLA 2Q44A 4NSQA 5AG6A 4EVYA 3S6GA 4C7IA 4FD6A 4UCPA 2Z3OA 2Q04A 1FY7A 2QIRA 2VZZA 4U5YA 5EC4A 1R57A 4A30A 2ATRA 3D3SA 2OZGA 3R1KA 3CXPA 1PU9A 3BLNA 4KLWA 4MFKA 2HV2A 3S6HA 3LODA 2Z11A 1NMTA 2K5TA 5F48A 4CAXA 5KTDA 3K9UA 1Q2CA 2FIWA 3MGDA 4XPDB 4A31A 2VQYA 1Q2DA 2OB0A 2R98A 4Y49B 4CAEA 2O28A 2P0WA 1YVKA 4II9A 5C82A 1XIXA 3S6KA 1QSRA 4QUSA 4I49A 3TFYA 1N71A 4M3SA 2B5GA 3EFAA 1I12A 4FD7A 2WUUA 4NCZA 5AG4A 5EBVA 1QSOA 1Z9UA 4B13A 4CGLA 4KUBA 5JQ4A 4YRHA 4FD4A 4J3GA 2RC4A 3JVNA 4A33A 4AVAA 4MFPA 4CGOA 4R3LA 2FIAA 4LX9A 2FL4A 3R9FA 5F47A 2CY2A 4CGNA 1QSTA 4BBHA 1MJAA 1RO5A 2OH1A 3QAHA 4Q38A 4YFJA 4B12A 2ZXVA 1KUYA 2J8MA 2ZW7A 1WWZA 4UCMA 4X5KA 2OZHA 1M44A 3SHPA 3FNCA 3W6XA 3FB3A 4UWIA 4XPDC 4OAEA 2FE7A 1M4IA 4PK3A 2QECA 4JLYA 4KOTA 4NXYA 4IUSA 5KTAA 1Z4RA 3DR8A 2REFA 3W6SA 1B6BA 1XE4A 1YVOA 4AG9A 1OZPA 1U6MA 4HNWB 4OADA 3IGRA 4CRZB 2VZYA 3IWGA 4MBUA 4KOVA 2G0BA 5A27A 4JXRA 4BMHA 2R1IA 1MK4A 4HNYB 2VBQA 5J8FA 2AE6A 1QSMA 2Q7BA 3FBUA 1S7NA 4B5OA 5CNPA 3TTHA 3PZJA 3SXNA 3WR7A 4C7HA 2Z3NA 5A28A 2P6FA 3G8WA 4B5PA 4JXQA 4C2XA 3H5ZA 2B3UA 2C27A 3LD2A 4R57A 1GHEA 1RXTA 2PQ8A 5HH1A 4E8OA 3N7ZA 3JUWA 5C88A 2Q0YA 1J4JA 1S7LA 2Z3MA 1BO4A 4UA3A 4IF5A 4KUAA 3DNSA 1SQHA 2PC1A 4KSFA 1P0HA 4KS9A 5F46A 2Z3KA 4XNHB 2YNCA 3D2PA 1NE9A 4KVOE 3R95A 2YNCC 2PDOA 4CAVA 1Q2YA 5J8CA 3SXOA 2JDDA 4A32A 4ZBGA 5JPHA 3CXQA 3A9LA 4B5PB 4C2ZA 3I9SA 2CNTA 3EC4A 3VWEA 4K30A 5E96A 3IWEA 4UBRA 4KORA 2D4PA 4Q36A 4CYQA 4ONUA 3F0AA 4KOSA 2GIVA 2FXFA 4KOUA 4KLVA 1I1DA 2FS5A 4OLLA 2Z10A 1V0CA 4FD5A 2NMTA 1KZFA 3W91A 4LUAA 3OWCA 2HQYA 2ZW6A 2DPSA 2J8NA 4ORFA 3KKWA 4JJXA 2BUEA 5G20A 2REEA 2BEIA 2GE3A 2GANA 4MFJA 1YK3A 2VI7A 2B58A 4CAFA 5G21A 4B14A 2Z3PA 2B3VA 1ON0A 2VXKA 3CXSA 3R96A 4CGMA 1M1DA 3UY5A 4KVXA 4CRYB 3RYOA 1YREA 4AVBA 2ZW5A 5F49A 5GCNA 3GKRA 2QMLA 1MJ9A 2DXQA 2PR1A 2YNEA 3EO4A 3P2FA 3QB8A 5DWMA 2A4NA 5ISVA 5IV0A 3IU2A 1VKCA 3F5BA 4E0AA 5DWNA 4AB7A 1WK4A 3DDDA 3V8IA 2OU2A 4MY3A 1ZO0A 2Q4VA 3PGPA 2WPXA 4A95A 1LRZA 2FSRA 4DNCA 3ZZIA 3TO9A 4CYOA 4HKFA 4A2ZA 3I3GA 4AVCA 1XMTA 2BSWA 4UFXA 2R7HA 4PK2A 4U9YA 2FT0A 4JD6A 1M4GA 3FXTA 4CYPA 5BWAB 3G3SA 1CM0A 4MHDA 5IX3A 3DR6A 3D8PA 3C26A 5KTCA 3T9YA 2Z3LA 1YR0A 5AG5A 3BJ8A 1IIDA 1K4JA 4XPKA 2Q4YA 4KVME 3E0KA 4C2YA 3PP9A 3EY5A 2JDCA 4QVTA 1S7FA 1Y9WA 1YLEA 4KOXA 1P4NA 3BJ7A 4MFLA 2YNDA 3FIXA 4F0XA 2Y0MA 1IB1E 3NE7A 1Z4EA 4U9ZA 2P6GA 4KOWA 3IU1A 4L89A 2ZPAA 3ZJ0A 4AG7A 1UFHA 3EXNA 3D2MA 2P6EA 1Y9KA 3R9EA 1IYLA 5G22A 4H6UA 3T90A 5IB0A 2WPWA 1XEBA 4XNHC 2G3AA 4CGPA 2KCWA 2D4OA 4B10A 1KUXA 2B4DB 2PRBA 1MJBA 4MY0A 4KZTA 2B4DA 4MI4A 4ZGYB 5AGEA 1QSNA 2B5GB 2AJ6A 2J8RA 3R9GA 4MFQA 4F6AA 3B8GA 2WSAA 4PSWA 1S5KA 4KOYA 4RS2A 3P2HA 3TOAA 1KUVA 1L0CA 1CJWA 2IL4A 4UFWA 3TCVA 2I79A 2X7BA 4HNXB 4NF1A 1YX0A 2HUZA 2OZUA 2YGWA 2BL1A 3JTKA 1VHSA 2CXAA 3GYAA 5AG7A 5G1ZA 5H86A 4YGOA 4QC6A 1PUAA 2JEVA 2VEZA 4QB9A 2B4BA 4PV6A 2FCKA 2EVNA 2I00A 2CNSA 4H89A 1Y7RA 4JWPA 4CS0B 5HMNA 4E2AA 4F0YA 5FVJA 4CAWA 1S60A 4UCNA 4KSAA 2EUIA 2ZW4A 4C68A 3VWDA 5I0CA 3TO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FYN A;  2H5M A;  2PSW A;  1S7K A;  2F5I A;  4R87 A;  4PSX A;  2R8V A;  1B87 A;  4H6Z A;  4UWJ A;  1M4D A;  1IIC A;  2JLM A;  1BOB A;  3TT2 A;  2ARH A;  4R9M A;  4MJ8 A;  2G3T A;  3DSB A;  1XF8 A;  3FRM A;  4Y49 C;  1S3Z A;  3S6F A;  3F8K A;  2CNM A;  2Z0Z A;  4M85 A;  3TE4 A;  1I21 A;  4XPL A;  4GS4 A;  3GY9 A;  3H4Q A;  4QBJ A;  1YGH A;  4L8A A;  3TO6 A;  1TIQ A;  3TOB A;  1IYK A;  5H84 A;  2PR8 A;  4RI1 A;  4R3K A;  4NEX A;  1NSL A;  2Q44 A;  4NSQ A;  4EVY A;  3S6G A;  4FD6 A;  2Q04 A;  1FY7 A;  2QIR A;  2VZZ A;  4U5Y A;  5EC4 A;  1R57 A;  2ATR A;  3D3S A;  2OZG A;  3R1K A;  3CXP A;  1PU9 A;  3BLN A;  4KLW A;  2HV2 A;  3S6H A;  3LOD A;  2Z11 A;  1NMT A;  2K5T A;  5F48 A;  4CAX A;  5KTD A;  3K9U A;  1Q2C A;  2FIW A;  3MGD A;  4XPD B;  2VQY A;  1Q2D A;  2OB0 A;  2R98 A;  4Y49 B;  2O28 A;  2P0W A;  1YVK A;  4II9 A;  5C82 A;  1XIX A;  3S6K A;  1QSR A;  4QUS A;  4I49 A;  3TFY A;  1N71 A;  4M3S A;  2B5G A;  3EFA A;  1I12 A;  4FD7 A;  4NCZ A;  5EBV A;  1QSO A;  1Z9U A;  4KUB A;  5JQ4 A;  4YRH A;  4FD4 A;  4J3G A;  2RC4 A;  3JVN A;  4AVA A;  4R3L A;  2FIA A;  4LX9 A;  2FL4 A;  3R9F A;  5F47 A;  2CY2 A;  1QST A;  1MJA A;  1RO5 A;  2OH1 A;  3QAH A;  4YFJ A;  2ZXV A;  1KUY A;  2J8M A;  2ZW7 A;  1WWZ A;  4X5K A;  2OZH A;  1M44 A;  3SHP A;  3FNC A;  3W6X A;  3FB3 A;  4UWI A;  4XPD C;  4OAE A;  2FE7 A;  1M4I A;  4PK3 A;  2QEC A;  4JLY A;  4KOT A;  4NXY A;  4IUS A;  5KTA A;  1Z4R A;  3DR8 A;  2REF A;  3W6S A;  1B6B A;  1XE4 A;  1YVO A;  4AG9 A;  1OZP A;  1U6M A;  4HNW B;  4OAD A;  3IGR A;  4CRZ B;  2VZY A;  3IWG A;  4MBU A;  4KOV A;  2G0B A;  4JXR A;  4BMH A;  2R1I A;  1MK4 A;  4HNY B;  2VBQ A;  5J8F A;  2AE6 A;  1QSM A;  2Q7B A;  3FBU A;  1S7N A;  4B5O A;  5CNP A;  3TTH A;  3PZJ A;  3SXN A;  3WR7 A;  2P6F A;  3G8W A;  4B5P A;  4JXQ A;  2B3U A;  2C27 A;  3LD2 A;  4R57 A;  1GHE A;  1RXT A;  2PQ8 A;  5HH1 A;  4E8O A;  3N7Z A;  3JUW A;  5C88 A;  2Q0Y A;  1J4J A;  1S7L A;  1BO4 A;  4UA3 A;  4IF5 A;  4KUA A;  3DNS A;  1SQH A;  2PC1 A;  1P0H A;  5F46 A;  4XNH B;  3D2P A;  1NE9 A;  4KVO E;  3R95 A;  2PDO A;  4CAV A;  1Q2Y A;  5J8C A;  3SXO A;  2JDD A;  4ZBG A;  5JPH A;  3CXQ A;  4B5P B;  3I9S A;  2CNT A;  3EC4 A;  3VWE A;  4K30 A;  5E96 A;  4UBR A;  4KOR A;  2D4P A;  4ONU A;  3F0A A;  4KOS A;  2GIV A;  2FXF A;  4KOU A;  4KLV A;  1I1D A;  2FS5 A;  4OLL A;  2Z10 A;  1V0C A;  4FD5 A;  2NMT A;  1KZF A;  3W91 A;  4LUA A;  3OWC A;  2HQY A;  2ZW6 A;  2J8N A;  4ORF A;  3KKW A;  4JJX A;  2BUE A;  2REE A;  2BEI A;  2GE3 A;  2GAN A;  1YK3 A;  2VI7 A;  2B58 A;  2B3V A;  1ON0 A;  2VXK A;  3CXS A;  3R96 A;  1M1D A;  3UY5 A;  4KVX A;  4CRY B;  3RYO A;  1YRE A;  4AVB A;  2ZW5 A;  5F49 A;  5GCN A;  3GKR A;  2QML A;  1MJ9 A;  2DXQ A;  2PR1 A;  3EO4 A;  3P2F A;  3QB8 A;  5DWM A;  2A4N A;  5ISV A;  5IV0 A;  1VKC A;  3F5B A;  4E0A A;  5DWN A;  4AB7 A;  1WK4 A;  3DDD A;  3V8I A;  2OU2 A;  4MY3 A;  2Q4V A;  3PGP A;  2WPX A;  1LRZ A;  2FSR A;  4DNC A;  3ZZI A;  3TO9 A;  4HKF A;  3I3G A;  4AVC A;  1XMT A;  2BSW A;  2R7H A;  4PK2 A;  4U9Y A;  2FT0 A;  1M4G A;  3FXT A;  4JD6 A;  3G3S A;  1CM0 A;  4MHD A;  5IX3 A;  3DR6 A;  3D8P A;  3C26 A;  5KTC A;  3T9Y A;  1YR0 A;  3BJ8 A;  1IID A;  1K4J A;  4XPK A;  2Q4Y A;  4KVM E;  3E0K A;  3PP9 A;  3EY5 A;  2JDC A;  4QVT A;  1S7F A;  1Y9W A;  1YLE A;  4KOX A;  1P4N A;  3BJ7 A;  3FIX A;  2Y0M A;  1IB1 E;  3NE7 A;  1Z4E A;  4U9Z A;  2P6G A;  4KOW A;  4L89 A;  2ZPA A;  3ZJ0 A;  4AG7 A;  1UFH A;  3EXN A;  3D2M A;  2P6E A;  1Y9K A;  3R9E A;  1IYL A;  4H6U A;  3T90 A;  5IB0 A;  2WPW A;  1XEB A;  4XNH C;  2G3A A;  2KCW A;  2D4O A;  1KUX A;  2B4D B;  2PRB A;  1MJB A;  4MY0 A;  4KZT A;  2B4D A;  4MI4 A;  1QSN A;  2B5G B;  2AJ6 A;  2J8R A;  3R9G A;  4F6A A;  3B8G A;  4PSW A;  1S5K A;  4KOY A;  4RS2 A;  3P2H A;  3TOA A;  1KUV A;  1L0C A;  1CJW A;  2IL4 A;  3TCV A;  2I79 A;  2X7B A;  4HNX B;  4NF1 A;  1YX0 A;  2HUZ A;  2OZU A;  2BL1 A;  1VHS A;  3GYA A;  5H86 A;  4YGO A;  4QC6 A;  1PUA A;  2JEV A;  2VEZ A;  4QB9 A;  2B4B A;  4PV6 A;  2FCK A;  2EVN A;  2I00 A;  2CNS A;  4H89 A;  1Y7R A;  4JWP A;  4CS0 B;  5HMN A;  4E2A A;  4F0Y A;  5FVJ A;  4CAW A;  1S60 A;  2EUI A;  2ZW4 A;  3VWD A;  5I0C A;  3TO7 A; 
#chains in the Genus database with same CATH topology
 3FYN A;  2H5M A;  2PSW A;  3KZW A;  1S7K A;  4UEE A;  4F6A A;  2F5I A;  4R87 A;  3D68 A;  4RUH A;  4PSX A;  2R8V A;  4F9U A;  4NGM A;  3L2N A;  3KL9 A;  3FX6 A;  1B87 A;  4H6Z A;  2DF5 A;  4UWJ A;  1M4D A;  1IIC A;  2JLM A;  1BOB A;  3TT2 A;  2ARH A;  3LMS A;  3CDX A;  4CYN A;  4R9M A;  4P4I A;  4MJ8 A;  4M6G A;  4PPZ A;  2DPT A;  4R76 A;  2G3T A;  3DSB A;  2CTB A;  1XF8 A;  3FRM A;  3KI9 A;  4Y49 C;  1S3Z A;  2ZEL A;  3IO1 A;  4OC4 A;  5LYI A;  3S6F A;  3B7I A;  1YSJ A;  2C1C A;  3F8K A;  4P4B A;  4B11 A;  4UFV A;  2CNM A;  2Z0Z A;  3D66 A;  4M85 A;  3TE4 A;  1I21 A;  1LFW A;  1HDU A;  2IQ6 A;  4XPL A;  4MFZ A;  3KR4 A;  4GS4 A;  4B6Z A;  3CT9 A;  3GY9 A;  3H4Q A;  4QBJ A;  1YGH A;  4L8A A;  1YW4 A;  4WWV A;  3TO6 A;  1TIQ A;  2GLJ A;  4NGN A;  1IYK A;  3TOB A;  3WT4 A;  5CPA A;  4ZY2 A;  5H84 A;  2PR8 A;  4RI1 A;  4R3K A;  2AFZ A;  4NEX A;  5JM6 A;  4OP4 A;  1NSL A;  3TC8 A;  2Q44 A;  4MRI A;  4NSQ A;  1XRY A;  5AG6 A;  4EVY A;  5K8O A;  1XFO A;  3S6G A;  5CBM A;  3IJ3 A;  3JRU A;  1Z8W A;  1DE4 C;  3LWU A;  2ZEF A;  2BO9 A;  3PFO A;  1VGY A;  4O23 A;  1BAV A;  3H8G A;  4FD6 A;  4OID A;  3FMC A;  2Z3O A;  1A2Z A;  4UCP A;  4MMO A;  2PE3 A;  4A39 A;  2Q04 A;  1FY7 A;  2QIR A;  1QMU A;  2VZZ A;  4MXU A;  4U5Y A;  5EC4 A;  1R57 A;  5HVF A;  4A30 A;  2ATR A;  1NSA A;  2OZG A;  3D3S A;  3H8E A;  3R1K A;  3WC5 A;  3ISZ A;  3CXP A;  4NJR A;  1PU9 A;  1CPX A;  4A94 A;  4DJL A;  2F8H A;  3BLN A;  4NGS A;  3KGQ A;  3I1U A;  4KLW A;  1AMP A;  4MFK A;  2HV2 A;  3S6H A;  1YLO A;  2PJ5 A;  2Z11 A;  2O4H A;  3LOD A;  4JYW A;  4X8I A;  2PJA A;  1NMT A;  2C6G A;  1XBU A;  2K5T A;  5F48 A;  2HC9 A;  4CAX A;  5KTD A;  3K9U A;  5LYL A;  2XEJ A;  4P4D A;  1Q2C A;  2FIW A;  2PJ9 A;  3MGD A;  4PXE A;  4XPD B;  4A31 A;  2VQY A;  1Q2D A;  2OB0 A;  2PIZ A;  2R98 A;  4Y49 B;  4CAE A;  2O28 A;  1Z8T A;  2P0W A;  5HXD A;  4WJB A;  1YVK A;  2AFO A;  1F57 A;  4FWU A;  4LQ6 A;  6CPA A;  4II9 A;  5C82 A;  5J1Q A;  1XIX A;  4K3N A;  3S6K A;  1Z2L A;  1QSR A;  4QUS A;  4I49 A;  1F2O A;  4M6H A;  1TKJ A;  2PJ6 A;  3IIB A;  3TFY A;  1BPM A;  1N71 A;  1XMB A;  4M3S A;  2GRE A;  3D7F A;  3GUX A;  2B5G A;  3EFA A;  2PJ8 A;  1I12 A;  1CP6 A;  4FD7 A;  2WUU A;  1YW6 A;  4NCZ A;  5AG4 A;  5EBV A;  2JEW A;  1QSO A;  1M4L A;  1LAM A;  1RTQ A;  1Z9U A;  4B13 A;  4CGL A;  4P6Y A;  5I4M A;  4KUB A;  5JQ4 A;  4YRH A;  5K8N A;  4FD4 A;  3ISX A;  1Q7L A;  4J3G A;  4ZY1 A;  1YQE A;  3RNZ A;  1FT7 A;  2RC4 A;  3JVN A;  4A33 A;  2C6C A;  4AVA A;  4MFP A;  4P10 A;  4PXD A;  1KWM A;  2FIA A;  4LX9 A;  2FL4 A;  4R3L A;  5F47 A;  2CY2 A;  3R9F A;  4CGN A;  1QST A;  1Y0Y A;  2JBJ A;  3IC1 A;  1MJA A;  4BBH A;  1RO5 A;  2OH1 A;  3FEC A;  3QAH A;  3PEI A;  2V8V A;  1ELL P;  4ZX8 A;  4OC3 A;  4Q38 A;  2PCU A;  4UEF A;  4YFJ A;  1Z8L A;  2CF4 A;  3BXM A;  4B12 A;  4A38 A;  2ZXV A;  1KUY A;  2J8M A;  1CG2 A;  2ZW7 A;  1CP7 A;  3KHZ A;  1WWZ A;  1Z8X A;  4UCM A;  2FVG A;  4X5K A;  3SJE A;  3PBE A;  4AXV A;  2OZH A;  1M44 A;  4OKO A;  4JZ0 A;  5LRK A;  3SHP A;  3FNC A;  1FNO A;  3FB3 A;  4UWI A;  4XPD C;  3W6X A;  4OAE A;  1IOF A;  2FE7 A;  3HUV A;  4OME A;  1M4I A;  4PK3 A;  1PCA A;  2QEC A;  4JLY A;  4KOT A;  4NXY A;  4IUS A;  3S9M A;  1Z4R A;  5KTA A;  3DR8 A;  1ARL A;  2REF A;  3W6S A;  1B6B A;  1XE4 A;  3D67 A;  4MHN A;  4HPS A;  4UEZ A;  4UF4 A;  2DEA A;  5D29 A;  2AFW A;  1YVO A;  4ZI6 A;  4AG9 A;  4EME A;  1OZP A;  1U6M A;  3FF3 A;  2ABZ A;  2IJZ A;  3CPX A;  4HNW B;  2V8H A;  4M6I A;  3IGR A;  4MHY A;  4OAD A;  4CRZ B;  2VZY A;  2I3C A;  3WC6 A;  1BLL E;  3IWG A;  4MBU A;  4KOV A;  2G0B A;  3KHX A;  5EMI A;  5A27 A;  1VHO A;  4JXR A;  4BMH A;  3S9L A;  2PVV A;  2R1I A;  1MK4 A;  2ZEH A;  4MCR A;  4HNY B;  2V77 A;  2GLF A;  1EE3 P;  2VBQ A;  3QAY A;  5J8F A;  2AE6 A;  1QSM A;  2Q7B A;  2F7V A;  3FBU A;  3D4U A;  3MN8 A;  4ONW A;  1JQG A;  1S7N A;  4B5O A;  5CNP A;  5K8P A;  3D7D A;  3TTH A;  3PZJ A;  3SXN A;  3WR7 A;  4C7H A;  1YME A;  2Z3N A;  3FEE A;  2P6F A;  3BI0 A;  5A28 A;  3G8W A;  4B5P A;  4JXQ A;  4C2X A;  2EBJ A;  3H5Z A;  4MHP A;  4ZX9 A;  2B3U A;  2C27 A;  3LD2 A;  1LOK A;  2ZOG A;  4R57 A;  1GHE A;  3D7H A;  1RXT A;  2PQ8 A;  3NE8 A;  3QNV A;  5HH1 A;  4E8O A;  3N7Z A;  3JUW A;  2HB6 A;  5C88 A;  2Q0Y A;  1J4J A;  1S7L A;  2Z3M A;  1BO4 A;  3CZX A;  3D7G A;  4UA3 A;  4IF5 A;  2RB7 A;  1ZG7 A;  2G9D A;  4KUA A;  3DNS A;  1CBX A;  1SQH A;  2PC1 A;  1IU8 A;  2PJ4 A;  3N5F A;  4KSF A;  3CPA A;  4R8F A;  4ZY0 A;  1P0H A;  4KS9 A;  1IGB A;  2Z3K A;  4XNH B;  3RO0 A;  5F46 A;  3PB7 X;  4RN7 A;  4Z65 A;  5LRJ A;  2YNC A;  3PBB A;  1TF8 A;  3D2P A;  4IHM A;  1NE9 A;  3PRT A;  3FVL A;  2QVP A;  3MRU A;  1ELM P;  4KVO E;  2YNC C;  3R95 A;  1CX8 A;  2CIJ A;  2PDO A;  4CAV A;  1Q2Y A;  5J8C A;  3SXO A;  2JDD A;  3HLP A;  4NGR A;  3RAM A;  4A32 A;  4ZBG A;  2POK A;  5JPH A;  4DYO A;  3CXQ A;  3A9L A;  4B5P B;  4P4J A;  4C2Z A;  3I9S A;  4IAV A;  2CNT A;  5LRG A;  2AFS A;  1QQ9 A;  2AFM A;  3KR5 A;  3EC4 A;  4OIW A;  3VWE A;  3B3W A;  4FUU A;  4K30 A;  5E96 A;  3IWE A;  4UBR A;  3B3S A;  4KOR A;  1XOV A;  2D4P A;  4R6T A;  4Q36 A;  4CYQ A;  4PQA A;  1VHE A;  4ONU A;  2Q7S A;  1IOI A;  3F0A A;  3T8W A;  4EWT A;  4KOS A;  2GIV A;  2FXF A;  4KOU A;  4BIN A;  4KLV A;  1I1D A;  2FS5 A;  4OLL A;  4YU9 A;  3KQX A;  1X10 A;  2Z10 A;  3RZA A;  1V0C A;  4DUK A;  4Q7A A;  4FD5 A;  2ZOF A;  2NMT A;  3NH8 A;  1KZF A;  3W91 A;  2WYR A;  3IEH A;  4LUA A;  3OWC A;  3SI2 A;  2PRQ A;  2HQY A;  5D8N A;  2ZW6 A;  1AYE A;  1HDQ A;  2EK9 A;  4GM5 A;  2DPS A;  2J8N A;  4ORF A;  4OC5 A;  1GYT A;  1TF9 A;  4CGO A;  3KKW A;  5K8M A;  3SJF A;  4JJX A;  3B3V A;  2BUE A;  1LCP A;  5G20 A;  2REE A;  3FH4 A;  2BEI A;  2GE3 A;  2GAN A;  2EO8 A;  2GU2 A;  4X2T A;  4MFJ A;  1YK3 A;  2VI7 A;  2B58 A;  4CAF A;  8CPA A;  5G21 A;  5HVG A;  4TNU A;  4F9V A;  2V8D A;  4B14 A;  2Z3P A;  1F2P A;  5LYD A;  2B3V A;  4P45 A;  1ON0 A;  3S9N A;  4G1P A;  2VXK A;  2XEG A;  3CXS A;  2PJ3 A;  3R96 A;  4CGM A;  1M1D A;  3UY5 A;  4FAI A;  1AUG A;  4KVX A;  4BD9 A;  4CRY B;  1DTD A;  4TWE A;  3RYO A;  1YRE A;  4AVB A;  2PJ0 A;  2ZW5 A;  1IY7 A;  2NSM A;  5F49 A;  4FBE A;  3SJG A;  5GCN A;  3GKR A;  2QML A;  1MJ9 A;  7CPA A;  2DXQ A;  3WAB A;  2PR1 A;  2YNE A;  3EO4 A;  3P2F A;  2JBK A;  3QB8 A;  5JGF A;  5DWM A;  3SI0 A;  2A4N A;  4CPA A;  5ISV A;  2PJ1 A;  4MCP A;  5IV0 A;  2ZEO A;  3IU2 A;  1VKC A;  1XJO A;  4OC2 A;  2ZEP A;  3F5B A;  4W9Y A;  4E0A A;  1VIX A;  4NGQ A;  5DWN A;  3KAS A;  4AB7 A;  4P4F A;  3NFZ A;  2OOT A;  1WK4 A;  3DDD A;  4OC1 A;  2OU2 A;  3V8I A;  3NH5 A;  4MY3 A;  2EWB A;  5JH9 A;  1ZO0 A;  2Q4V A;  3PGP A;  2VL1 A;  2J9A A;  2WPX A;  4NJQ A;  4P4E A;  1Z5R A;  5F09 A;  2GFQ A;  3VH9 A;  4A95 A;  4C7I A;  1LRZ A;  1PYT B;  2FSR A;  3PB9 X;  4DNC A;  3DLJ A;  3ZZI A;  3TO9 A;  4CYO A;  4HKF A;  4A2Z A;  1Y0R A;  2O53 A;  3IWW A;  3I3G A;  4AVC A;  1XMT A;  2PJ2 A;  2ZEM A;  2BSW A;  4UFX A;  2R7H A;  4PK2 A;  4U9Y A;  2FT0 A;  1M4G A;  3FXT A;  4JD6 A;  4CYP A;  5BWA B;  2XEF A;  3G3S A;  4MCS A;  1CM0 A;  4MHD A;  5IX3 A;  3DR6 A;  3D8P A;  3C26 A;  3PB8 X;  4F8Z A;  5KTC A;  1LAP A;  2Z3L A;  1YR0 A;  3T9Y A;  5AG5 A;  3BJ8 A;  1IID A;  1K4J A;  3GIU A;  3NH4 A;  2Q4Y A;  4XPK A;  4KVM E;  3E0K A;  4P44 A;  3FJU A;  4C2Y A;  3PP9 A;  2PJB A;  3EY5 A;  4PXB A;  1Y7E A;  2JDC A;  4QVT A;  1S7F A;  1Y9W A;  1YLE A;  3BI1 A;  2IMO A;  3PFE A;  4KOX A;  1P4N A;  1ZG8 A;  2ANP A;  3BJ7 A;  2ZEN A;  4MFL A;  5LYF A;  5I0C A;  1BPN A;  2YND A;  2CTC A;  2ZEE A;  3FIX A;  5IB9 A;  3K2K A;  3PB6 X;  4F0X A;  2Y0M A;  1IB1 E;  3NE7 A;  1ZLH A;  1Z4E A;  4U9Z A;  2P6G A;  2RFH A;  2ZED A;  4KOW A;  3IU1 A;  4MHZ A;  4L89 A;  3LAC A;  2ZPA A;  3ZJ0 A;  2QYV A;  3H8F A;  1ZLI A;  3SJX A;  4AG7 A;  1UFH A;  3EXN A;  3D2M A;  3TX8 A;  2NYQ A;  5THW A;  3B3T A;  2P6E A;  1Y9K A;  3R9E A;  1IYL A;  5G22 A;  3GB0 A;  4H6U A;  4R7M A;  3BHX A;  2PJ7 A;  5ELY A;  3T90 A;  5IB0 A;  2WPW A;  1XEB A;  2ZEG A;  4XNH C;  1TKH A;  2G3A A;  1CPS A;  4CGP A;  4NGT A;  2KCW A;  4KSI A;  2D4O A;  2C6P A;  2PIY A;  3RBU A;  4NFR A;  4B10 A;  2AFX A;  1JWQ A;  4UIA A;  1KUX A;  2V8G A;  2B4D B;  2PRB A;  4OC0 A;  4X3R A;  4A37 A;  1MJB A;  4MY0 A;  4KZT A;  2B4D A;  1R3N A;  2Q51 A;  2XEI A;  4MI4 A;  1ARM A;  3VAT A;  4ZGY B;  5AGE A;  1QSN A;  3SI1 A;  4IK2 A;  2B5G B;  2AJ6 A;  1R43 A;  2J8R A;  2OR4 A;  4H2K A;  3R9G A;  2BCO A;  4MFQ A;  1OBR A;  3B35 A;  3B8G A;  1TXR A;  3PB4 X;  3V7Z A;  1TKF A;  4MCQ A;  2WSA A;  3V38 A;  1H8L A;  4PSW A;  3GLJ A;  1S5K A;  4KOY A;  4RS2 A;  3P2H A;  3TOA A;  4LQG A;  3NA6 A;  1HEE A;  1KUV A;  1X12 A;  2BOA A;  2QJ8 A;  1LAN A;  3B2Y A;  1L0C A;  3K9T A;  1CJW A;  1ZG9 A;  2AFU A;  2IL4 A;  2Q4Z A;  4UFW A;  4UIB A;  5HVH A;  3TCV A;  2I79 A;  2X7B A;  4HNX B;  4NF1 A;  1UWY A;  1YX0 A;  2HUZ A;  2OZU A;  2YGW A;  2BL1 A;  3KQZ A;  3JTK A;  1VHS A;  2CXA A;  3GYA A;  5AG7 A;  5G1Z A;  5H86 A;  4NGP A;  3FED A;  4YGO A;  2WZN A;  1PUA A;  2JEV A;  3B3C A;  4QC6 A;  2VEZ A;  4EFD A;  4QB9 A;  2B4B A;  4PV6 A;  4ZYQ A;  2FCK A;  2EVN A;  2PJC A;  2I00 A;  2CNS A;  4YWY A;  4H89 A;  1Y7R A;  3DGV A;  3WC7 A;  4JWP A;  4CS0 B;  5HMN A;  2ODF A;  4E2A A;  2PVW A;  4GXH A;  4F0Y A;  3VAR A;  5FVJ A;  4CAW A;  1S60 A;  4UCN A;  5DS0 A;  4KSA A;  2EUI A;  2ZW4 A;  2EK8 A;  4PXC A;  3IFE A;  4C68 A;  3VWD A;  2Q43 A;  3TO7 A; 
#chains in the Genus database with same CATH homology
 3FYN A;  2H5M A;  2PSW A;  1S7K A;  2F5I A;  4R87 A;  4PSX A;  2R8V A;  1B87 A;  4H6Z A;  4UWJ A;  1M4D A;  1IIC A;  2JLM A;  1BOB A;  3TT2 A;  2ARH A;  4CYN A;  4R9M A;  4MJ8 A;  2DPT A;  2G3T A;  3DSB A;  1XF8 A;  3FRM A;  4Y49 C;  1S3Z A;  3S6F A;  3F8K A;  4B11 A;  4UFV A;  2CNM A;  2Z0Z A;  4M85 A;  3TE4 A;  1I21 A;  4XPL A;  4MFZ A;  4GS4 A;  3GY9 A;  3H4Q A;  4QBJ A;  1YGH A;  4L8A A;  3TO6 A;  1TIQ A;  3TOB A;  1IYK A;  5H84 A;  2PR8 A;  4RI1 A;  4R3K A;  4NEX A;  1NSL A;  2Q44 A;  4NSQ A;  5AG6 A;  4EVY A;  3S6G A;  4C7I A;  4FD6 A;  4UCP A;  2Z3O A;  2Q04 A;  1FY7 A;  2QIR A;  2VZZ A;  4U5Y A;  5EC4 A;  1R57 A;  4A30 A;  2ATR A;  3D3S A;  2OZG A;  3R1K A;  3CXP A;  1PU9 A;  3BLN A;  4KLW A;  4MFK A;  2HV2 A;  3S6H A;  3LOD A;  2Z11 A;  1NMT A;  2K5T A;  5F48 A;  4CAX A;  5KTD A;  3K9U A;  1Q2C A;  2FIW A;  3MGD A;  4XPD B;  4A31 A;  2VQY A;  1Q2D A;  2OB0 A;  2R98 A;  4Y49 B;  4CAE A;  2O28 A;  2P0W A;  1YVK A;  4II9 A;  5C82 A;  1XIX A;  3S6K A;  1QSR A;  4QUS A;  4I49 A;  3TFY A;  1N71 A;  4M3S A;  2B5G A;  3EFA A;  1I12 A;  4FD7 A;  2WUU A;  4NCZ A;  5AG4 A;  5EBV A;  1QSO A;  1Z9U A;  4B13 A;  4CGL A;  4KUB A;  5JQ4 A;  4YRH A;  4FD4 A;  4J3G A;  2RC4 A;  3JVN A;  4A33 A;  4AVA A;  4MFP A;  4CGO A;  4R3L A;  2FIA A;  4LX9 A;  2FL4 A;  3R9F A;  5F47 A;  2CY2 A;  4CGN A;  1QST A;  4BBH A;  1MJA A;  1RO5 A;  2OH1 A;  3QAH A;  4Q38 A;  4YFJ A;  4B12 A;  2ZXV A;  1KUY A;  2J8M A;  2ZW7 A;  1WWZ A;  4UCM A;  4X5K A;  2OZH A;  1M44 A;  3SHP A;  3FNC A;  3W6X A;  3FB3 A;  4UWI A;  4XPD C;  4OAE A;  2FE7 A;  1M4I A;  4PK3 A;  2QEC A;  4JLY A;  4KOT A;  4NXY A;  4IUS A;  5KTA A;  1Z4R A;  3DR8 A;  2REF A;  3W6S A;  1B6B A;  1XE4 A;  1YVO A;  4AG9 A;  1OZP A;  1U6M A;  4HNW B;  4OAD A;  3IGR A;  4CRZ B;  2VZY A;  3IWG A;  4MBU A;  4KOV A;  2G0B A;  5A27 A;  4JXR A;  4BMH A;  2R1I A;  1MK4 A;  4HNY B;  2VBQ A;  5J8F A;  2AE6 A;  1QSM A;  2Q7B A;  3FBU A;  1S7N A;  4B5O A;  5CNP A;  3TTH A;  3PZJ A;  3SXN A;  3WR7 A;  4C7H A;  2Z3N A;  5A28 A;  2P6F A;  3G8W A;  4B5P A;  4JXQ A;  4C2X A;  3H5Z A;  2B3U A;  2C27 A;  3LD2 A;  4R57 A;  1GHE A;  1RXT A;  2PQ8 A;  5HH1 A;  4E8O A;  3N7Z A;  3JUW A;  5C88 A;  2Q0Y A;  1J4J A;  1S7L A;  2Z3M A;  1BO4 A;  4UA3 A;  4IF5 A;  4KUA A;  3DNS A;  1SQH A;  2PC1 A;  4KSF A;  1P0H A;  4KS9 A;  5F46 A;  2Z3K A;  4XNH B;  2YNC A;  3D2P A;  1NE9 A;  4KVO E;  3R95 A;  2YNC C;  2PDO A;  4CAV A;  1Q2Y A;  5J8C A;  3SXO A;  2JDD A;  4A32 A;  4ZBG A;  5JPH A;  3CXQ A;  3A9L A;  4B5P B;  4C2Z A;  3I9S A;  2CNT A;  3EC4 A;  3VWE A;  4K30 A;  5E96 A;  3IWE A;  4UBR A;  4KOR A;  2D4P A;  4Q36 A;  4CYQ A;  4ONU A;  3F0A A;  4KOS A;  2GIV A;  2FXF A;  4KOU A;  4KLV A;  1I1D A;  2FS5 A;  4OLL A;  2Z10 A;  1V0C A;  4FD5 A;  2NMT A;  1KZF A;  3W91 A;  4LUA A;  3OWC A;  2HQY A;  2ZW6 A;  2DPS A;  2J8N A;  4ORF A;  3KKW A;  4JJX A;  2BUE A;  5G20 A;  2REE A;  2BEI A;  2GE3 A;  2GAN A;  4MFJ A;  1YK3 A;  2VI7 A;  2B58 A;  4CAF A;  5G21 A;  4B14 A;  2Z3P A;  2B3V A;  1ON0 A;  2VXK A;  3CXS A;  3R96 A;  4CGM A;  1M1D A;  3UY5 A;  4KVX A;  4CRY B;  3RYO A;  1YRE A;  4AVB A;  2ZW5 A;  5F49 A;  5GCN A;  3GKR A;  2QML A;  1MJ9 A;  2DXQ A;  2PR1 A;  2YNE A;  3EO4 A;  3P2F A;  3QB8 A;  5DWM A;  2A4N A;  5ISV A;  5IV0 A;  3IU2 A;  1VKC A;  3F5B A;  4E0A A;  5DWN A;  4AB7 A;  1WK4 A;  3DDD A;  3V8I A;  2OU2 A;  4MY3 A;  1ZO0 A;  2Q4V A;  3PGP A;  2WPX A;  4A95 A;  1LRZ A;  2FSR A;  4DNC A;  3ZZI A;  3TO9 A;  4CYO A;  4HKF A;  4A2Z A;  3I3G A;  4AVC A;  1XMT A;  2BSW A;  4UFX A;  2R7H A;  4PK2 A;  4U9Y A;  2FT0 A;  4JD6 A;  1M4G A;  3FXT A;  4CYP A;  5BWA B;  3G3S A;  1CM0 A;  4MHD A;  5IX3 A;  3DR6 A;  3D8P A;  3C26 A;  5KTC A;  3T9Y A;  2Z3L A;  1YR0 A;  5AG5 A;  3BJ8 A;  1IID A;  1K4J A;  4XPK A;  2Q4Y A;  4KVM E;  3E0K A;  4C2Y A;  3PP9 A;  3EY5 A;  2JDC A;  4QVT A;  1S7F A;  1Y9W A;  1YLE A;  4KOX A;  1P4N A;  3BJ7 A;  4MFL A;  2YND A;  3FIX A;  4F0X A;  2Y0M A;  1IB1 E;  3NE7 A;  1Z4E A;  4U9Z A;  2P6G A;  4KOW A;  3IU1 A;  4L89 A;  2ZPA A;  3ZJ0 A;  4AG7 A;  1UFH A;  3EXN A;  3D2M A;  2P6E A;  1Y9K A;  3R9E A;  1IYL A;  5G22 A;  4H6U A;  3T90 A;  5IB0 A;  2WPW A;  1XEB A;  4XNH C;  2G3A A;  4CGP A;  2KCW A;  2D4O A;  4B10 A;  1KUX A;  2B4D B;  2PRB A;  1MJB A;  4MY0 A;  4KZT A;  2B4D A;  4MI4 A;  4ZGY B;  5AGE A;  1QSN A;  2B5G B;  2AJ6 A;  2J8R A;  3R9G A;  4MFQ A;  4F6A A;  3B8G A;  2WSA A;  4PSW A;  1S5K A;  4KOY A;  4RS2 A;  3P2H A;  3TOA A;  1KUV A;  1L0C A;  1CJW A;  2IL4 A;  4UFW A;  3TCV A;  2I79 A;  2X7B A;  4HNX B;  4NF1 A;  1YX0 A;  2HUZ A;  2OZU A;  2YGW A;  2BL1 A;  3JTK A;  1VHS A;  2CXA A;  3GYA A;  5AG7 A;  5G1Z A;  5H86 A;  4YGO A;  4QC6 A;  1PUA A;  2JEV A;  2VEZ A;  4QB9 A;  2B4B A;  4PV6 A;  2FCK A;  2EVN A;  2I00 A;  2CNS A;  4H89 A;  1Y7R A;  4JWP A;  4CS0 B;  5HMN A;  4E2A A;  4F0Y A;  5FVJ A;  4CAW A;  1S60 A;  4UCN A;  4KSA A;  2EUI A;  2ZW4 A;  4C68 A;  3VWD A;  5I0C A;  3TO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...