3DR8A

Structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
174
structure length
173
Chain Sequence
SNMTIRFADKADCAAITEIYNHAVLHTAAIWNDRTVDTDNRLAWYEARQLLGYPVLVSEENGVVTGYASFGDWRSFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVMVAGIESQNAASIRLHHSLGFTVTAQMPQVGVKFGRWLDLTFMQLQLDEHAAPDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords yncA
publication title Structure of yncA, a putative ACETYLTRANSFERASE from Salmonella typhimurium with its cofactor Acetyl-CoA
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 50
structure length 173
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3dr8A00
2QIRA 1M4DA 5EBVA 1NMTA 3D2MA 2P6EA 4KLVA 2Q0YA 3R9GA 4CRYB 4QC6A 3I3GA 3QAHA 1S7LA 1YLEA 1Z4EA 2BUEA 4UWIA 3S6HA 2B5GA 1NSLA 3H4QA 3JUWA 2VEZA 2IL4A 4JXRA 3T90A 2KCWA 3DSBA 3S6KA 2FXFA 2WPWA 5ISVA 4KOUA 5KTAA 2CY2A 2PQ8A 3BJ8A 1XF8A 2FE7A 2B4DB 4AG9A 5GCNA 1YREA 2BEIA 5J8FA 4MY0A 3ZZIA 5H84A 3EO4A 5IB0A 1BOBA 4JJXA 1ON0A 2GE3A 4R87A 1Q2CA 4HNYB 1K4JA 4H6ZA 2EVNA 4IUSA 3MGDA 1Y9KA 4F0YA 5EC4A 1B6BA 2D4OA 2OU2A 3CXSA 4R3LA 3PGPA 4XPKA 4QUSA 4OLLA 4II9A 4KOXA 1Z4RA 3G8WA 2Y0MA 2PR1A 3FYNA 2JLMA 3EY5A 3TTHA 1Y9WA 2C27A 3T9YA 1MJBA 4UA3A 3W6XA 5E96A 1WWZA 2R8VA 1U6MA 3N7ZA 3TOBA 2D4PA 2B5GB 1BO4A 3S6FA 4UBRA 2PR8A 3FNCA 3V8IA 2JEVA 4UWJA 3GY9A 4AB7A 2QECA 4PV6A 2J8NA 3C26A 3PP9A 2GANA 5KTDA 5KTCA 4M85A 4LUAA 4Y49C 4YRHA 1IYKA 1XIXA 2PRBA 4CAWA 5HH1A 4PSXA 2CNTA 4E0AA 3DR6A 2PC1A 3DR8A 2OB0A 1S7NA 4H89A 1M44A 4E2AA 5IV0A 3D3SA 3F5BA 4FD7A 2R7HA 4JD6A 1VHSA 1QSNA 4QBJA 4NEXA 2H5MA 3TO6A 2ATRA 3TCVA 4XPDC 4NF1A 5F46A 3FXTA 2Q4YA 4CAXA 4MY3A 2VZZA 4EVYA 2HV2A 2ZW5A 1MK4A 5CNPA 5C88A 1QSRA 1S7KA 1XEBA 5F47A 1IYLA 2EUIA 3BLNA 3R96A 3F8KA 5F49A 4KZTA 1WK4A 1KUYA 3P2FA 4MI4A 5C82A 3DDDA 4PK2A 2B3VA 3BJ7A 2B4BA 2I79A 1S5KA 3B8GA 2FIAA 1XE4A 4KVME 1KZFA 3TO7A 3FRMA 4KLWA 3GKRA 3SXOA 5HMNA 3TO9A 2HQYA 3K9UA 1RO5A 2R98A 4MBUA 1QSMA 3FB3A 4XPLA 3W91A 3R1KA 1B87A 2X7BA 3ZJ0A 4KORA 2B58A 4OAEA 4IF5A 2GIVA 1LRZA 1M4IA 1UFHA 2RC4A 3TFYA 3WR7A 2VXKA 1Q2YA 2O28A 2OZGA 4CAVA 4YFJA 2CNSA 4XNHB 1IB1E 2OZUA 4OADA 4E8OA 3DNSA 4X5KA 1Q2DA 3GYAA 4GS4A 3PZJA 3CXQA 1YK3A 3EXNA 1QSTA 3QB8A 2QMLA 3I9SA 3RYOA 1L0CA 1R57A 2J8MA 2HUZA 4F6AA 1GHEA 3SXNA 2Z11A 4KUBA 4AVCA 2FL4A 2CNMA 4HNXB 4AVAA 3VWDA 1NE9A 2PDOA 4U9ZA 3G3SA 1TIQA 2G0BA 4B5PB 1CJWA 4KOSA 4HNWB 1M4GA 4AVBA 3D8PA 4ZBGA 1S7FA 3JVNA 3IWGA 1IICA 1SQHA 4AG7A 2AE6A 2FT0A 3R95A 2A4NA 4XNHC 2J8RA 3R9FA 1I21A 2FSRA 4PK3A 2Z0ZA 1Y7RA 4KUAA 2FIWA 1PU9A 2BSWA 1XMTA 4RS2A 1I1DA 2B3UA 3KKWA 3CXPA 2OH1A 4L89A 3W6SA 4R3KA 5J8CA 4RI1A 2JDDA 2REEA 3P2HA 4U9YA 1CM0A 4FD5A 3LODA 1J4JA 2G3AA 2I00A 4U5YA 4B5OA 1KUVA 2P0WA 2VBQA 4YGOA 2REFA 2ZW4A 1MJ9A 5H86A 1S60A 2BL1A 4B5PA 5FVJA 4NSQA 2NMTA 4KOTA 2Q4VA 2ZW6A 1P0HA 4J3GA 4KOWA 4R9MA 2R1IA 1MJAA 3FIXA 2P6FA 3S6GA 1I12A 2AJ6A 1YX0A 4NCZA 1M1DA 5DWNA 4JXQA 2G3TA 4I49A 4CS0B 4QVTA 5I0CA 4M3SA 2ZPAA 3VWEA 4Y49B 3FBUA 1YGHA 2Q44A 3LD2A 4JWPA 3UY5A 4R57A 3R9EA 4KVXA 3NE7A 5JQ4A 4ONUA 4MJ8A 1N71A 4HKFA 2ZXVA 3TE4A 2K5TA 4KOYA 5IX3A 5DWMA 1P4NA 4LX9A 3E0KA 4FD4A 4QB9A 1IIDA 2ARHA 4MHDA 1YVOA 2FS5A 4DNCA 2VI7A 1PUAA 2VZYA 1Z9UA 1RXTA 2PSWA 1KUXA 4JLYA 4NXYA 4XPDB 4KVOE 1VKCA 2Q04A 4H6UA 2P6GA 1YVKA 1QSOA 2JDCA 3F0AA 3OWCA 3SHPA 2B4DA 2FCKA 2F5IA 4L8AA 4BMHA 4KOVA 1OZPA 4K30A 4ORFA 3TOAA 3IGRA 1V0CA 2DXQA 2OZHA 1FY7A 2WPXA 3EFAA 3EC4A 1S3ZA 4PSWA 2ZW7A 3D2PA 3TT2A 1YR0A 2VQYA 4FD6A 2Q7BA 4CRZB 2Z10A 5JPHA 5F48A
chains in the Genus database with same CATH superfamily
4MRIA 5LRKA 4CGNA 1FNOA 2QIRA 1M4DA 4NGTA 5EBVA 1NMTA 3D2MA 3GLJA 2P6EA 2PJCA 4IAVA 4KLVA 2PJ8A 4ONWA 1ELMP 2Q0YA 3R9GA 2AFXA 4C68A 2ZEMA 2PIZA 4QC6A 4CRYB 3I3GA 3PRTA 3NH4A 3QAHA 1S7LA 5IB9A 1YLEA 1XJOA 1Z4EA 2BUEA 4UWIA 3S6HA 2B5GA 2J9AA 2ZOGA 4GM5A 1NSLA 3H4QA 3JUWA 1Z2LA 2VEZA 2IL4A 4JXRA 3T90A 2KCWA 3DSBA 1UWYA 3S6KA 2FXFA 2WPWA 5ISVA 4KOUA 5KTAA 2CY2A 7CPAA 2PQ8A 3B3VA 2BCOA 3SJFA 3VATA 4UIBA 1HDUA 1LAPA 4CYOA 4FBEA 3JTKA 3KHXA 3VARA 1IU8A 2Z10A 5G22A 3BJ8A 4ZY1A 1YQEA 1XF8A 4NGNA 4Z65A 2FE7A 4ZI6A 2POKA 1CX8A 2QVPA 2Z3KA 4LQ6A 4ZX8A 2B4DB 4FAIA 4AG9A 1BLLE 5GCNA 1YREA 2BEIA 3FVLA 5J8FA 4MY0A 3ZZIA 1M4LA 3EO4A 5H84A 5IB0A 1BOBA 4JJXA 4YWYA 4MHZA 1ON0A 2GE3A 2PJBA 1R3NA 1Z8LA 3PBEA 4R87A 5HVFA 3BI0A 2GREA 1Q2CA 3CZXA 4C2XA 4HNYB 4P4IA 3S9NA 1K4JA 1ZLHA 4H6ZA 2EVNA 4IUSA 5JM6A 3MGDA 4FUUA 4A33A 3KR4A 4R8FA 1Y9KA 5G21A 5AG5A 5EC4A 4F0YA 1B6BA 2D4OA 2OU2A 2AFMA 2ZEGA 3CXSA 3ISZA 1ZG8A 3PGPA 4M6GA 4P10A 4R3LA 4TWEA 4A2ZA 4XPKA 1CP6A 4PXDA 4OC0A 4OLLA 4QUSA 3RAMA 3KR5A 2WYRA 5LYFA 4II9A 4KOXA 1Z4RA 3G8WA 4DUKA 2Y0MA 5AG6A 3LWUA 3RO0A 3V7ZA 2PR1A 4UIAA 3KI9A 3FYNA 3N5FA 1AYEA 2JLMA 3EY5A 3GB0A 3TTHA 3IO1A 1Y9WA 2C27A 2PJ3A 3T9YA 1MJBA 3D4UA 3WC6A 5K8NA 2YNDA 4UA3A 3W6XA 4CPAA 2ZEOA 3PB9X 5E96A 3KHZA 3IWWA 4CYPA 1WWZA 4MFZA 2R8VA 5CBMA 1U6MA 2V8HA 4EMEA 3N7ZA 4P4EA 4MFPA 3TOBA 3GIUA 2D4PA 2B5GB 1BO4A 5HVHA 2Q4ZA 2NSMA 1HEEA 4X2TA 3FF3A 4PXBA 3S6FA 1TKHA 4NGSA 4W9YA 4KSIA 4X8IA 4UBRA 2PR8A 3BHXA 3FNCA 4NJRA 3H8GA 1DE4C 2GFQA 3B3WA 3BI1A 2JEVA 3V8IA 4CGOA 5DS0A 2OR4A 4MHNA 5ELYA 1PCAA 2C6GA 4RUHA 1PYTB 4UWJA 3VH9A 2IQ6A 3IEHA 3GY9A 4AB7A 2QECA 1TF8A 3JRUA 4PV6A 4MCQA 3GUXA 2J8NA 5D29A 1IOIA 3C26A 3PEIA 3PP9A 2GANA 5KTDA 2V8DA 4H2KA 4OC4A 5KTCA 1Z8TA 3QAYA 4M85A 2PJ7A 4LUAA 3IU1A 4WJBA 4CAFA 4Y49C 4YRHA 1IYKA 4F9UA 1XIXA 2PRBA 4CAWA 1CPXA 4HPSA 5HH1A 2PRQA 3DGVA 4PSXA 4KS9A 5K8PA 2CNTA 2GLJA 4E0AA 3DR6A 5G20A 2PC1A 3DR8A 1VHOA 4B13A 3WABA 2OB0A 1BAVA 1S7NA 3MN8A 4H89A 4LQGA 2PJ2A 4P4JA 1M44A 4AXVA 4E2AA 5IV0A 3D3SA 5LRGA 3F5BA 2Q51A 4B10A 4FD7A 2PJ5A 4NGRA 2Z3LA 2R7HA 4OP4A 3RNZA 4JD6A 4K3NA 1VHSA 4A94A 2RFHA 1QSNA 4QBJA 2DPSA 2H5MA 2IMOA 2V8VA 4NEXA 3TO6A 2ATRA 5HXDA 1ZO0A 4F8ZA 3PB7X 5K8OA 3TCVA 2BOAA 1ARMA 2ZENA 2Z3MA 4XPDC 4NF1A 5CPAA 2RB7A 2AFUA 2Q4YA 3FXTA 4C2YA 4CAXA 4MY3A 1LCPA 5F46A 2VZZA 3HLPA 4EVYA 2HV2A 4MFJA 2ZW5A 2ZOFA 5A28A 3KASA 1MK4A 5CNPA 1VHEA 3WT4A 5C88A 4BD9A 1QSRA 1S7KA 1XEBA 1XRYA 1Y0RA 2ZEHA 5F47A 2DEAA 4P4FA 1IYLA 1RTQA 4UFXA 3S9MA 2EUIA 3SJEA 2F7VA 3BLNA 2Z3OA 3H5ZA 2AFWA 1HDQA 3R96A 3SI0A 3F8KA 4IHMA 2XEIA 5F49A 4KZTA 4MHYA 5JH9A 1WK4A 2CTBA 5G1ZA 1KUYA 3P2FA 4MI4A 4C7IA 4WWVA 4UCMA 5C82A 2F8HA 3DDDA 3PBBA 4PK2A 2B3VA 4PQAA 3B3TA 1F2OA 3D7GA 3IWEA 3BJ7A 2B4BA 2EK9A 5EMIA 4CGLA 4OIDA 1Y0YA 4PXEA 2I79A 1S5KA 3B8GA 2FIAA 3KL9A 4M6HA 4MFQA 1OBRA 1XE4A 4KVME 1KZFA 3TX8A 2PJ6A 1VIXA 3TO7A 3FRMA 4KLWA 3GKRA 4R76A 3SXOA 4M6IA 1XMBA 2ZEDA 4FWUA 3D7DA 4UCNA 5HMNA 3KQXA 3MRUA 3TO9A 2HQYA 1TKFA 3K9UA 1RO5A 4O23A 1ELLP 4JZ0A 2R98A 4C2ZA 4MBUA 1QSMA 3FB3A 4XPLA 3W91A 5I4MA 3NE8A 3R1KA 4A30A 2DPTA 5HVGA 1B87A 2YNCA 3D66A 2FVGA 2WSAA 2EBJA 3A9LA 2O4HA 2X7BA 3ZJ0A 4KORA 2ZEEA 2B58A 1CG2A 3NFZA 4MCPA 4OAEA 4P4DA 4IF5A 4A32A 2GIVA 5AG7A 3PB4X 5LYIA 1LRZA 1M4IA 1UFHA 2V8GA 3WC7A 8CPAA 2VL1A 2RC4A 1ARLA 4OC2A 4YU9A 3WR7A 1LAMA 5LYDA 3TFYA 3ISXA 1YMEA 2VXKA 1LFWA 1BPNA 1Q2YA 2O28A 4MCRA 2OZGA 4CAVA 2Z3PA 4YFJA 5LYLA 2CF4A 2ZEPA 2CNSA 3FEEA 4OMEA 4XNHB 1ZG9A 3PB8X 4UEZA 2YNEA 4DJLA 3IU2A 1IB1E 5K8MA 2OZUA 4BINA 4OADA 2GLFA 4P45A 4E8OA 1NSAA 2YGWA 3DNSA 3H8FA 4X5KA 2QJ8A 3B3SA 1Q2DA 3GYAA 6CPAA 3SJGA 1CPSA 1TKJA 3TC8A 4GS4A 2BO9A 3PZJA 3CXQA 1YK3A 3EXNA 1QSTA 3FEDA 2EWBA 3QB8A 2QMLA 1Z8XA 3I9SA 4OIWA 3RYOA 1XOVA 2QYVA 1X12A 1ZG7A 5BWAB 1L0CA 3B3CA 4C7HA 1IY7A 1R57A 2J8MA 2HUZA 3D7HA 5LRJA 4F6AA 2WZNA 4GXHA 1GHEA 3SXNA 4CYQA 2Z11A 4KUBA 4AVCA 2FL4A 2CNMA 3CPXA 4HNXB 3SJXA 1IGBA 3VWDA 1NE9A 2PDOA 4U9ZA 4AVAA 3G3SA 1TIQA 2I3CA 4EWTA 4X3RA 3SI2A 2G0BA 4B5PB 1CJWA 4KOSA 4HNWB 1M4GA 4A95A 4AVBA 3D8PA 4ZBGA 5J1QA 1S7FA 3JVNA 5JGFA 1LOKA 1KWMA 3IWGA 1JWQA 3L2NA 3PFOA 2O53A 1IICA 4UFVA 4P4BA 1AMPA 4AG7A 2AE6A 2Q7SA 2FT0A 2V77A 3R95A 3IIBA 2A4NA 3NH8A 4XNHC 2J8RA 3RZAA 3HUVA 3IJ3A 3R9FA 1I21A 2FSRA 4CYNA 4R7MA 4PK3A 3V38A 4BBHA 2PJ0A 1A2ZA 5AG4A 2Z0ZA 4UFWA 1Y7RA 4KUAA 2FIWA 2PJAA 1PU9A 4NFRA 2BSWA 2Q43A 1XMTA 4RS2A 1I1DA 2B3UA 2IJZA 3KKWA 4ZGYB 3CXPA 2PIYA 4P44A 2OH1A 4L89A 4OC3A 4TNUA 3W6SA 4R3KA 5J8CA 4RI1A 2XEJA 2JDDA 2REEA 3FX6A 2PJ4A 3P2HA 4U9YA 4A38A 1CM0A 1X10A 3B2YA 4JYWA 4UCPA 4FD5A 3LACA 2EO8A 1F57A 2XEGA 3LODA 1J4JA 4RN7A 1XBUA 3I1UA 2Z3NA 2PVWA 2G3AA 2I00A 2C1CA 1DTDA 4R6TA 4U5YA 4Q38A 4B5OA 1XFOA 5F09A 1KUVA 5F48A 1LANA 4EFDA 2P0WA 3CDXA 1BPMA 2VBQA 1JQGA 2DF5A 4YGOA 2REFA 3NA6A 4UEEA 2ZW4A 1CP7A 3K2KA 4UEFA 1MJ9A 4B11A 2EK8A 2YNCC 3D68A 4NGPA 5A27A 3B7IA 2OOTA 5H86A 3FJUA 1S60A 4B12A 2BL1A 3FMCA 4B5PA 1F2PA 4B6ZA 5AGEA 5FVJA 4NSQA 2NMTA 4KOTA 2C6CA 2Q4VA 2ZW6A 4ZY0A 2CIJA 2ANPA 4A31A 1Y7EA 1YLOA 1P0HA 2JBKA 4J3GA 1QMUA 4KOWA 4PXCA 1VGYA 2PCUA 2R1IA 4R9MA 1MJAA 3FIXA 2P6FA 3S6GA 1I12A 2AJ6A 3D7FA 4OKOA 1YX0A 4NCZA 1M1DA 3RBUA 2WUUA 5DWNA 4JXQA 2G3TA 4I49A 4NGMA 4QVTA 4CS0B 4MHPA 5I0CA 1Z8WA 4M3SA 4F0XA 4NGQA 2ZPAA 4OC1A 4G1PA 3VWEA 1YSJA 4A37A 2PJ1A 3FECA 4Y49B 3FBUA 3NH5A 2AFOA 4ZX9A 1YGHA 2Q44A 3IC1A 3LD2A 3IFEA 4JWPA 4MFKA 4P6YA 3WC5A 3UY5A 3B35A 3CPAA 4Q36A 4R57A 3R9EA 1TXRA 4KVXA 3NE7A 4NJQA 5JQ4A 2JEWA 4MMOA 4MJ8A 4ONUA 4B14A 3QNVA 4CGPA 1N71A 2CTCA 2ZXVA 4HKFA 4MFLA 4MCSA 3DLJA 4ZY2A 3TE4A 2K5TA 1TF9A 3LMSA 1CBXA 2AFSA 4KOYA 5IX3A 2PJ9A 3FH4A 5DWMA 1P4NA 1R43A 4LX9A 3E0KA 4CGMA 3S9LA 4FD4A 2GU2A 1IIDA 2ARHA 4QB9A 5THWA 4MHDA 4F9VA 1YVOA 1IOFA 2FS5A 4DNCA 1Z5RA 2VI7A 1PUAA 2PVVA 2VZYA 1Z9UA 1RXTA 2PSWA 1GYTA 1KUXA 4JLYA 4NXYA 4PPZA 1H8LA 4XPDB 4KVOE 1VKCA 2HB6A 2JBJA 4KSAA 4DYOA 2Q04A 2ZELA 4H6UA 2P6GA 1YVKA 2ODFA 3SI1A 1QSOA 3PFEA 1AUGA 2JDCA 1FT7A 1ZLIA 3F0AA 3OWCA 3KGQA 3KQZA 3SHPA 2B4DA 2FCKA 2F5IA 4L8AA 4BMHA 4Q7AA 3K9TA 4KOVA 2XEFA 2ZEFA 4A39A 2CXAA 4KSFA 4UF4A 3T8WA 1OZPA 2ABZA 4K30A 4ORFA 3TOAA 3CT9A 3PB6X 3IGRA 2PE3A 1V0CA 2DXQA 2OZHA 1FY7A 1Q7LA 3D67A 2WPXA 3EFAA 4IK2A 2NYQA 3EC4A 1S3ZA 4OC5A 4PSWA 2ZW7A 1YW4A 4CAEA 4MXUA 3D2PA 5D8NA 1EE3P 1YR0A 3TT2A 2G9DA 1QQ9A 4ZYQA 2VQYA 2HC9A 3H8EA 3KZWA 1YW6A 2AFZA 4FD6A 3BXMA 2Q7BA 4CRZB 1SQHA 5JPHA 2C6PA
chains in the Genus database with same CATH topology
4CGNA 2QIRA 1M4DA 5EBVA 1NMTA 3D2MA 2P6EA 4KLVA 2Q0YA 3R9GA 4C68A 4CRYB 4QC6A 3I3GA 3QAHA 1S7LA 1YLEA 1Z4EA 2BUEA 4UWIA 3S6HA 2B5GA 1NSLA 3H4QA 3JUWA 2VEZA 2IL4A 4JXRA 3T90A 2KCWA 3DSBA 3S6KA 2FXFA 2WPWA 5ISVA 4KOUA 5KTAA 2CY2A 2PQ8A 4CYOA 3JTKA 5G22A 3BJ8A 1XF8A 2FE7A 2Z3KA 2B4DB 4AG9A 5GCNA 1YREA 2BEIA 5J8FA 4MY0A 3ZZIA 5H84A 3EO4A 5IB0A 1BOBA 4JJXA 1ON0A 2GE3A 4R87A 1Q2CA 4C2XA 4HNYB 1K4JA 4H6ZA 2EVNA 4IUSA 3MGDA 4A33A 1Y9KA 5G21A 5AG5A 5EC4A 4F0YA 1B6BA 2D4OA 2OU2A 3CXSA 4R3LA 4A2ZA 3PGPA 4XPKA 4QUSA 4OLLA 4II9A 4KOXA 1Z4RA 3G8WA 2Y0MA 5AG6A 2PR1A 3FYNA 2JLMA 3EY5A 3TTHA 1Y9WA 2C27A 3T9YA 1MJBA 2YNDA 4UA3A 3W6XA 5E96A 4CYPA 1WWZA 4MFZA 2R8VA 1U6MA 3N7ZA 4MFPA 3TOBA 2D4PA 2B5GB 1BO4A 3S6FA 4UBRA 2PR8A 3FNCA 3V8IA 4CGOA 2JEVA 4UWJA 3GY9A 4AB7A 2QECA 4PV6A 2J8NA 3C26A 3PP9A 2GANA 5KTDA 5KTCA 4M85A 4LUAA 3IU1A 4CAFA 4Y49C 4YRHA 1IYKA 1XIXA 2PRBA 4CAWA 5HH1A 4PSXA 4KS9A 2CNTA 4E0AA 3DR6A 5G20A 2PC1A 3DR8A 4B13A 2OB0A 1S7NA 4H89A 1M44A 4E2AA 5IV0A 3D3SA 3F5BA 4B10A 4FD7A 2Z3LA 2R7HA 4JD6A 1VHSA 1QSNA 4QBJA 2DPSA 2H5MA 4NEXA 3TO6A 2ATRA 1ZO0A 3TCVA 2Z3MA 4XPDC 4NF1A 5F46A 3FXTA 2Q4YA 4C2YA 4CAXA 4MY3A 2VZZA 4EVYA 2HV2A 4MFJA 2ZW5A 5A28A 1MK4A 5CNPA 5C88A 1QSRA 1S7KA 1XEBA 5F47A 4UFXA 1IYLA 2EUIA 3BLNA 3H5ZA 2Z3OA 3R96A 3F8KA 5F49A 4KZTA 1WK4A 5G1ZA 1KUYA 3P2FA 4MI4A 4C7IA 4UCMA 5C82A 3DDDA 4PK2A 2B3VA 3IWEA 3BJ7A 2B4BA 4CGLA 2I79A 1S5KA 3B8GA 2FIAA 4MFQA 1XE4A 4KVME 1KZFA 3TO7A 3FRMA 4KLWA 3GKRA 3SXOA 4UCNA 5HMNA 3TO9A 2HQYA 3K9UA 1RO5A 2R98A 4C2ZA 4MBUA 1QSMA 3FB3A 4XPLA 3W91A 3R1KA 4A30A 2DPTA 1B87A 2YNCA 3A9LA 2WSAA 2X7BA 3ZJ0A 4KORA 2B58A 4OAEA 4IF5A 4A32A 2GIVA 5AG7A 1LRZA 1M4IA 1UFHA 2RC4A 3TFYA 3WR7A 2VXKA 1Q2YA 2O28A 2OZGA 4CAVA 2Z3PA 4YFJA 2CNSA 4XNHB 2YNEA 3IU2A 1IB1E 2OZUA 4OADA 4E8OA 2YGWA 3DNSA 4X5KA 1Q2DA 3GYAA 4GS4A 3PZJA 3CXQA 1YK3A 3EXNA 1QSTA 3QB8A 2QMLA 3I9SA 3RYOA 5BWAB 1L0CA 4C7HA 1R57A 2J8MA 2HUZA 4F6AA 1GHEA 3SXNA 4CYQA 2Z11A 4KUBA 4AVCA 2FL4A 2CNMA 4HNXB 4AVAA 3VWDA 1NE9A 2PDOA 4U9ZA 3G3SA 1TIQA 2G0BA 4B5PB 1CJWA 4KOSA 4HNWB 1M4GA 4A95A 4AVBA 3D8PA 4ZBGA 1S7FA 3JVNA 3IWGA 1IICA 4UFVA 1SQHA 4AG7A 2AE6A 2FT0A 3R95A 2A4NA 4XNHC 2J8RA 3R9FA 1I21A 2FSRA 4PK3A 4BBHA 5AG4A 2Z0ZA 4UFWA 1Y7RA 4KUAA 2FIWA 1PU9A 2BSWA 1XMTA 4RS2A 1I1DA 2B3UA 3KKWA 4ZGYB 3CXPA 2OH1A 4L89A 3W6SA 4R3KA 5J8CA 4RI1A 2JDDA 2REEA 3P2HA 4U9YA 1CM0A 4UCPA 4FD5A 3LODA 1J4JA 2Z3NA 2G3AA 2I00A 4U5YA 4Q38A 4B5OA 1KUVA 2P0WA 2VBQA 4YGOA 2REFA 2ZW4A 1MJ9A 4B11A 2YNCC 5A27A 5H86A 1S60A 4B12A 2BL1A 4B5PA 5AGEA 5FVJA 4NSQA 2NMTA 4KOTA 2Q4VA 2ZW6A 4A31A 1P0HA 4J3GA 4KOWA 4R9MA 2R1IA 1MJAA 3FIXA 2P6FA 3S6GA 1I12A 2AJ6A 1YX0A 4NCZA 1M1DA 2WUUA 5DWNA 4JXQA 2G3TA 4I49A 4CS0B 4QVTA 5I0CA 4M3SA 4F0XA 2ZPAA 3VWEA 4Y49B 3FBUA 1YGHA 2Q44A 3LD2A 4MFKA 4JWPA 3UY5A 4Q36A 4R57A 3R9EA 4KVXA 3NE7A 5JQ4A 4ONUA 4MJ8A 4B14A 4CGPA 1N71A 4HKFA 2ZXVA 4MFLA 3TE4A 2K5TA 4KOYA 5IX3A 5DWMA 1P4NA 4LX9A 3E0KA 4CGMA 4FD4A 4QB9A 1IIDA 2ARHA 4MHDA 1YVOA 2FS5A 4DNCA 2VI7A 1PUAA 2VZYA 1Z9UA 1RXTA 2PSWA 1KUXA 4JLYA 4NXYA 4XPDB 4KVOE 1VKCA 4KSAA 2Q04A 4H6UA 2P6GA 1YVKA 1QSOA 4CYNA 2JDCA 3F0AA 3OWCA 3SHPA 2B4DA 2FCKA 2F5IA 4L8AA 4BMHA 4KOVA 2CXAA 4KSFA 1OZPA 4K30A 4ORFA 3TOAA 3IGRA 1V0CA 2DXQA 2OZHA 1FY7A 2WPXA 3EFAA 3EC4A 1S3ZA 4PSWA 2ZW7A 4CAEA 3D2PA 3TT2A 1YR0A 2VQYA 4FD6A 2Q7BA 4CRZB 2Z10A 5JPHA 5F48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIR A;  1M4D A;  5EBV A;  1NMT A;  3D2M A;  2P6E A;  4KLV A;  2Q0Y A;  3R9G A;  4CRY B;  4QC6 A;  3I3G A;  3QAH A;  1S7L A;  1YLE A;  1Z4E A;  2BUE A;  4UWI A;  3S6H A;  2B5G A;  1NSL A;  3H4Q A;  3JUW A;  2VEZ A;  2IL4 A;  4JXR A;  3T90 A;  2KCW A;  3DSB A;  3S6K A;  2FXF A;  2WPW A;  5ISV A;  4KOU A;  5KTA A;  2CY2 A;  2PQ8 A;  3BJ8 A;  1XF8 A;  2FE7 A;  2B4D B;  4AG9 A;  5GCN A;  1YRE A;  2BEI A;  5J8F A;  4MY0 A;  3ZZI A;  5H84 A;  3EO4 A;  5IB0 A;  1BOB A;  4JJX A;  1ON0 A;  2GE3 A;  4R87 A;  1Q2C A;  4HNY B;  1K4J A;  4H6Z A;  2EVN A;  4IUS A;  3MGD A;  1Y9K A;  4F0Y A;  5EC4 A;  1B6B A;  2D4O A;  2OU2 A;  3CXS A;  4R3L A;  3PGP A;  4XPK A;  4QUS A;  4OLL A;  4II9 A;  4KOX A;  1Z4R A;  3G8W A;  2Y0M A;  2PR1 A;  3FYN A;  2JLM A;  3EY5 A;  3TTH A;  1Y9W A;  2C27 A;  3T9Y A;  1MJB A;  4UA3 A;  3W6X A;  5E96 A;  1WWZ A;  2R8V A;  1U6M A;  3N7Z A;  3TOB A;  2D4P A;  2B5G B;  1BO4 A;  3S6F A;  4UBR A;  2PR8 A;  3FNC A;  3V8I A;  2JEV A;  4UWJ A;  3GY9 A;  4AB7 A;  2QEC A;  4PV6 A;  2J8N A;  3C26 A;  3PP9 A;  2GAN A;  5KTD A;  5KTC A;  4M85 A;  4LUA A;  4Y49 C;  4YRH A;  1IYK A;  1XIX A;  2PRB A;  4CAW A;  5HH1 A;  4PSX A;  2CNT A;  4E0A A;  3DR6 A;  2PC1 A;  3DR8 A;  2OB0 A;  1S7N A;  4H89 A;  1M44 A;  4E2A A;  5IV0 A;  3D3S A;  3F5B A;  4FD7 A;  2R7H A;  4JD6 A;  1VHS A;  1QSN A;  4QBJ A;  4NEX A;  2H5M A;  3TO6 A;  2ATR A;  3TCV A;  4XPD C;  4NF1 A;  5F46 A;  3FXT A;  2Q4Y A;  4CAX A;  4MY3 A;  2VZZ A;  4EVY A;  2HV2 A;  2ZW5 A;  1MK4 A;  5CNP A;  5C88 A;  1QSR A;  1S7K A;  1XEB A;  5F47 A;  1IYL A;  2EUI A;  3BLN A;  3R96 A;  3F8K A;  5F49 A;  4KZT A;  1WK4 A;  1KUY A;  3P2F A;  4MI4 A;  5C82 A;  3DDD A;  4PK2 A;  2B3V A;  3BJ7 A;  2B4B A;  2I79 A;  1S5K A;  3B8G A;  2FIA A;  1XE4 A;  4KVM E;  1KZF A;  3TO7 A;  3FRM A;  4KLW A;  3GKR A;  3SXO A;  5HMN A;  3TO9 A;  2HQY A;  3K9U A;  1RO5 A;  2R98 A;  4MBU A;  1QSM A;  3FB3 A;  4XPL A;  3W91 A;  3R1K A;  1B87 A;  2X7B A;  3ZJ0 A;  4KOR A;  2B58 A;  4OAE A;  4IF5 A;  2GIV A;  1LRZ A;  1M4I A;  1UFH A;  2RC4 A;  3TFY A;  3WR7 A;  2VXK A;  1Q2Y A;  2O28 A;  2OZG A;  4CAV A;  4YFJ A;  2CNS A;  4XNH B;  1IB1 E;  2OZU A;  4OAD A;  4E8O A;  3DNS A;  4X5K A;  1Q2D A;  3GYA A;  4GS4 A;  3PZJ A;  3CXQ A;  1YK3 A;  3EXN A;  1QST A;  3QB8 A;  2QML A;  3I9S A;  3RYO A;  1L0C A;  1R57 A;  2J8M A;  2HUZ A;  4F6A A;  1GHE A;  3SXN A;  2Z11 A;  4KUB A;  4AVC A;  2FL4 A;  2CNM A;  4HNX B;  4AVA A;  3VWD A;  1NE9 A;  2PDO A;  4U9Z A;  3G3S A;  1TIQ A;  2G0B A;  4B5P B;  1CJW A;  4KOS A;  4HNW B;  1M4G A;  4AVB A;  3D8P A;  4ZBG A;  1S7F A;  3JVN A;  3IWG A;  1IIC A;  1SQH A;  4AG7 A;  2AE6 A;  2FT0 A;  3R95 A;  2A4N A;  4XNH C;  2J8R A;  3R9F A;  1I21 A;  2FSR A;  4PK3 A;  2Z0Z A;  1Y7R A;  4KUA A;  2FIW A;  1PU9 A;  2BSW A;  1XMT A;  4RS2 A;  1I1D A;  2B3U A;  3KKW A;  3CXP A;  2OH1 A;  4L89 A;  3W6S A;  4R3K A;  5J8C A;  4RI1 A;  2JDD A;  2REE A;  3P2H A;  4U9Y A;  1CM0 A;  4FD5 A;  3LOD A;  1J4J A;  2G3A A;  2I00 A;  4U5Y A;  4B5O A;  1KUV A;  2P0W A;  2VBQ A;  4YGO A;  2REF A;  2ZW4 A;  1MJ9 A;  5H86 A;  1S60 A;  2BL1 A;  4B5P A;  5FVJ A;  4NSQ A;  2NMT A;  4KOT A;  2Q4V A;  2ZW6 A;  1P0H A;  4J3G A;  4KOW A;  4R9M A;  2R1I A;  1MJA A;  3FIX A;  2P6F A;  3S6G A;  1I12 A;  2AJ6 A;  1YX0 A;  4NCZ A;  1M1D A;  5DWN A;  4JXQ A;  2G3T A;  4I49 A;  4CS0 B;  4QVT A;  5I0C A;  4M3S A;  2ZPA A;  3VWE A;  4Y49 B;  3FBU A;  1YGH A;  2Q44 A;  3LD2 A;  4JWP A;  3UY5 A;  4R57 A;  3R9E A;  4KVX A;  3NE7 A;  5JQ4 A;  4ONU A;  4MJ8 A;  1N71 A;  4HKF A;  2ZXV A;  3TE4 A;  2K5T A;  4KOY A;  5IX3 A;  5DWM A;  1P4N A;  4LX9 A;  3E0K A;  4FD4 A;  4QB9 A;  1IID A;  2ARH A;  4MHD A;  1YVO A;  2FS5 A;  4DNC A;  2VI7 A;  1PUA A;  2VZY A;  1Z9U A;  1RXT A;  2PSW A;  1KUX A;  4JLY A;  4NXY A;  4XPD B;  4KVO E;  1VKC A;  2Q04 A;  4H6U A;  2P6G A;  1YVK A;  1QSO A;  2JDC A;  3F0A A;  3OWC A;  3SHP A;  2B4D A;  2FCK A;  2F5I A;  4L8A A;  4BMH A;  4KOV A;  1OZP A;  4K30 A;  4ORF A;  3TOA A;  3IGR A;  1V0C A;  2DXQ A;  2OZH A;  1FY7 A;  2WPX A;  3EFA A;  3EC4 A;  1S3Z A;  4PSW A;  2ZW7 A;  3D2P A;  3TT2 A;  1YR0 A;  2VQY A;  4FD6 A;  2Q7B A;  4CRZ B;  2Z10 A;  5JPH A;  5F48 A; 
#chains in the Genus database with same CATH topology
 4MRI A;  5LRK A;  4CGN A;  1FNO A;  2QIR A;  1M4D A;  4NGT A;  5EBV A;  1NMT A;  3D2M A;  3GLJ A;  2P6E A;  2PJC A;  4IAV A;  4KLV A;  2PJ8 A;  4ONW A;  1ELM P;  2Q0Y A;  3R9G A;  2AFX A;  4C68 A;  2ZEM A;  2PIZ A;  4QC6 A;  4CRY B;  3I3G A;  3PRT A;  3NH4 A;  3QAH A;  1S7L A;  5IB9 A;  1YLE A;  1XJO A;  1Z4E A;  2BUE A;  4UWI A;  3S6H A;  2B5G A;  2J9A A;  2ZOG A;  4GM5 A;  1NSL A;  3H4Q A;  3JUW A;  1Z2L A;  2VEZ A;  2IL4 A;  4JXR A;  3T90 A;  2KCW A;  3DSB A;  1UWY A;  3S6K A;  2FXF A;  2WPW A;  5ISV A;  4KOU A;  5KTA A;  2CY2 A;  7CPA A;  2PQ8 A;  3B3V A;  2BCO A;  3SJF A;  3VAT A;  4UIB A;  1HDU A;  1LAP A;  4CYO A;  4FBE A;  3JTK A;  3KHX A;  3VAR A;  1IU8 A;  2Z10 A;  5G22 A;  3BJ8 A;  4ZY1 A;  1YQE A;  1XF8 A;  4NGN A;  4Z65 A;  2FE7 A;  4ZI6 A;  2POK A;  1CX8 A;  2QVP A;  2Z3K A;  4LQ6 A;  4ZX8 A;  2B4D B;  4FAI A;  4AG9 A;  1BLL E;  5GCN A;  1YRE A;  2BEI A;  3FVL A;  5J8F A;  4MY0 A;  3ZZI A;  1M4L A;  3EO4 A;  5H84 A;  5IB0 A;  1BOB A;  4JJX A;  4YWY A;  4MHZ A;  1ON0 A;  2GE3 A;  2PJB A;  1R3N A;  1Z8L A;  3PBE A;  4R87 A;  5HVF A;  3BI0 A;  2GRE A;  1Q2C A;  3CZX A;  4C2X A;  4HNY B;  4P4I A;  3S9N A;  1K4J A;  1ZLH A;  4H6Z A;  2EVN A;  4IUS A;  5JM6 A;  3MGD A;  4FUU A;  4A33 A;  3KR4 A;  4R8F A;  1Y9K A;  5G21 A;  5AG5 A;  5EC4 A;  4F0Y A;  1B6B A;  2D4O A;  2OU2 A;  2AFM A;  2ZEG A;  3CXS A;  3ISZ A;  1ZG8 A;  3PGP A;  4M6G A;  4P10 A;  4R3L A;  4TWE A;  4A2Z A;  4XPK A;  1CP6 A;  4PXD A;  4OC0 A;  4OLL A;  4QUS A;  3RAM A;  3KR5 A;  2WYR A;  5LYF A;  4II9 A;  4KOX A;  1Z4R A;  3G8W A;  4DUK A;  2Y0M A;  5AG6 A;  3LWU A;  3RO0 A;  3V7Z A;  2PR1 A;  4UIA A;  3KI9 A;  3FYN A;  3N5F A;  1AYE A;  2JLM A;  3EY5 A;  3GB0 A;  3TTH A;  3IO1 A;  1Y9W A;  2C27 A;  2PJ3 A;  3T9Y A;  1MJB A;  3D4U A;  3WC6 A;  5K8N A;  2YND A;  4UA3 A;  3W6X A;  4CPA A;  2ZEO A;  3PB9 X;  5E96 A;  3KHZ A;  3IWW A;  4CYP A;  1WWZ A;  4MFZ A;  2R8V A;  5CBM A;  1U6M A;  2V8H A;  4EME A;  3N7Z A;  4P4E A;  4MFP A;  3TOB A;  3GIU A;  2D4P A;  2B5G B;  1BO4 A;  5HVH A;  2Q4Z A;  2NSM A;  1HEE A;  4X2T A;  3FF3 A;  4PXB A;  3S6F A;  1TKH A;  4NGS A;  4W9Y A;  4KSI A;  4X8I A;  4UBR A;  2PR8 A;  3BHX A;  3FNC A;  4NJR A;  3H8G A;  1DE4 C;  2GFQ A;  3B3W A;  3BI1 A;  2JEV A;  3V8I A;  4CGO A;  5DS0 A;  2OR4 A;  4MHN A;  5ELY A;  1PCA A;  2C6G A;  4RUH A;  1PYT B;  4UWJ A;  3VH9 A;  2IQ6 A;  3IEH A;  3GY9 A;  4AB7 A;  2QEC A;  1TF8 A;  3JRU A;  4PV6 A;  4MCQ A;  3GUX A;  2J8N A;  5D29 A;  1IOI A;  3C26 A;  3PEI A;  3PP9 A;  2GAN A;  5KTD A;  2V8D A;  4H2K A;  4OC4 A;  5KTC A;  1Z8T A;  3QAY A;  4M85 A;  2PJ7 A;  4LUA A;  3IU1 A;  4WJB A;  4CAF A;  4Y49 C;  4YRH A;  1IYK A;  4F9U A;  1XIX A;  2PRB A;  4CAW A;  1CPX A;  4HPS A;  5HH1 A;  2PRQ A;  3DGV A;  4PSX A;  4KS9 A;  5K8P A;  2CNT A;  2GLJ A;  4E0A A;  3DR6 A;  5G20 A;  2PC1 A;  3DR8 A;  1VHO A;  4B13 A;  3WAB A;  2OB0 A;  1BAV A;  1S7N A;  3MN8 A;  4H89 A;  4LQG A;  2PJ2 A;  4P4J A;  1M44 A;  4AXV A;  4E2A A;  5IV0 A;  3D3S A;  5LRG A;  3F5B A;  2Q51 A;  4B10 A;  4FD7 A;  2PJ5 A;  4NGR A;  2Z3L A;  2R7H A;  4OP4 A;  3RNZ A;  4JD6 A;  4K3N A;  1VHS A;  4A94 A;  2RFH A;  1QSN A;  4QBJ A;  2DPS A;  2H5M A;  2IMO A;  2V8V A;  4NEX A;  3TO6 A;  2ATR A;  5HXD A;  1ZO0 A;  4F8Z A;  3PB7 X;  5K8O A;  3TCV A;  2BOA A;  1ARM A;  2ZEN A;  2Z3M A;  4XPD C;  4NF1 A;  5CPA A;  2RB7 A;  2AFU A;  2Q4Y A;  3FXT A;  4C2Y A;  4CAX A;  4MY3 A;  1LCP A;  5F46 A;  2VZZ A;  3HLP A;  4EVY A;  2HV2 A;  4MFJ A;  2ZW5 A;  2ZOF A;  5A28 A;  3KAS A;  1MK4 A;  5CNP A;  1VHE A;  3WT4 A;  5C88 A;  4BD9 A;  1QSR A;  1S7K A;  1XEB A;  1XRY A;  1Y0R A;  2ZEH A;  5F47 A;  2DEA A;  4P4F A;  1IYL A;  1RTQ A;  4UFX A;  3S9M A;  2EUI A;  3SJE A;  2F7V A;  3BLN A;  2Z3O A;  3H5Z A;  2AFW A;  1HDQ A;  3R96 A;  3SI0 A;  3F8K A;  4IHM A;  2XEI A;  5F49 A;  4KZT A;  4MHY A;  5JH9 A;  1WK4 A;  2CTB A;  5G1Z A;  1KUY A;  3P2F A;  4MI4 A;  4C7I A;  4WWV A;  4UCM A;  5C82 A;  2F8H A;  3DDD A;  3PBB A;  4PK2 A;  2B3V A;  4PQA A;  3B3T A;  1F2O A;  3D7G A;  3IWE A;  3BJ7 A;  2B4B A;  2EK9 A;  5EMI A;  4CGL A;  4OID A;  1Y0Y A;  4PXE A;  2I79 A;  1S5K A;  3B8G A;  2FIA A;  3KL9 A;  4M6H A;  4MFQ A;  1OBR A;  1XE4 A;  4KVM E;  1KZF A;  3TX8 A;  2PJ6 A;  1VIX A;  3TO7 A;  3FRM A;  4KLW A;  3GKR A;  4R76 A;  3SXO A;  4M6I A;  1XMB A;  2ZED A;  4FWU A;  3D7D A;  4UCN A;  5HMN A;  3KQX A;  3MRU A;  3TO9 A;  2HQY A;  1TKF A;  3K9U A;  1RO5 A;  4O23 A;  1ELL P;  4JZ0 A;  2R98 A;  4C2Z A;  4MBU A;  1QSM A;  3FB3 A;  4XPL A;  3W91 A;  5I4M A;  3NE8 A;  3R1K A;  4A30 A;  2DPT A;  5HVG A;  1B87 A;  2YNC A;  3D66 A;  2FVG A;  2WSA A;  2EBJ A;  3A9L A;  2O4H A;  2X7B A;  3ZJ0 A;  4KOR A;  2ZEE A;  2B58 A;  1CG2 A;  3NFZ A;  4MCP A;  4OAE A;  4P4D A;  4IF5 A;  4A32 A;  2GIV A;  5AG7 A;  3PB4 X;  5LYI A;  1LRZ A;  1M4I A;  1UFH A;  2V8G A;  3WC7 A;  8CPA A;  2VL1 A;  2RC4 A;  1ARL A;  4OC2 A;  4YU9 A;  3WR7 A;  1LAM A;  5LYD A;  3TFY A;  3ISX A;  1YME A;  2VXK A;  1LFW A;  1BPN A;  1Q2Y A;  2O28 A;  4MCR A;  2OZG A;  4CAV A;  2Z3P A;  4YFJ A;  5LYL A;  2CF4 A;  2ZEP A;  2CNS A;  3FEE A;  4OME A;  4XNH B;  1ZG9 A;  3PB8 X;  4UEZ A;  2YNE A;  4DJL A;  3IU2 A;  1IB1 E;  5K8M A;  2OZU A;  4BIN A;  4OAD A;  2GLF A;  4P45 A;  4E8O A;  1NSA A;  2YGW A;  3DNS A;  3H8F A;  4X5K A;  2QJ8 A;  3B3S A;  1Q2D A;  3GYA A;  6CPA A;  3SJG A;  1CPS A;  1TKJ A;  3TC8 A;  4GS4 A;  2BO9 A;  3PZJ A;  3CXQ A;  1YK3 A;  3EXN A;  1QST A;  3FED A;  2EWB A;  3QB8 A;  2QML A;  1Z8X A;  3I9S A;  4OIW A;  3RYO A;  1XOV A;  2QYV A;  1X12 A;  1ZG7 A;  5BWA B;  1L0C A;  3B3C A;  4C7H A;  1IY7 A;  1R57 A;  2J8M A;  2HUZ A;  3D7H A;  5LRJ A;  4F6A A;  2WZN A;  4GXH A;  1GHE A;  3SXN A;  4CYQ A;  2Z11 A;  4KUB A;  4AVC A;  2FL4 A;  2CNM A;  3CPX A;  4HNX B;  3SJX A;  1IGB A;  3VWD A;  1NE9 A;  2PDO A;  4U9Z A;  4AVA A;  3G3S A;  1TIQ A;  2I3C A;  4EWT A;  4X3R A;  3SI2 A;  2G0B A;  4B5P B;  1CJW A;  4KOS A;  4HNW B;  1M4G A;  4A95 A;  4AVB A;  3D8P A;  4ZBG A;  5J1Q A;  1S7F A;  3JVN A;  5JGF A;  1LOK A;  1KWM A;  3IWG A;  1JWQ A;  3L2N A;  3PFO A;  2O53 A;  1IIC A;  4UFV A;  4P4B A;  1AMP A;  4AG7 A;  2AE6 A;  2Q7S A;  2FT0 A;  2V77 A;  3R95 A;  3IIB A;  2A4N A;  3NH8 A;  4XNH C;  2J8R A;  3RZA A;  3HUV A;  3IJ3 A;  3R9F A;  1I21 A;  2FSR A;  4CYN A;  4R7M A;  4PK3 A;  3V38 A;  4BBH A;  2PJ0 A;  1A2Z A;  5AG4 A;  2Z0Z A;  4UFW A;  1Y7R A;  4KUA A;  2FIW A;  2PJA A;  1PU9 A;  4NFR A;  2BSW A;  2Q43 A;  1XMT A;  4RS2 A;  1I1D A;  2B3U A;  2IJZ A;  3KKW A;  4ZGY B;  3CXP A;  2PIY A;  4P44 A;  2OH1 A;  4L89 A;  4OC3 A;  4TNU A;  3W6S A;  4R3K A;  5J8C A;  4RI1 A;  2XEJ A;  2JDD A;  2REE A;  3FX6 A;  2PJ4 A;  3P2H A;  4U9Y A;  4A38 A;  1CM0 A;  1X10 A;  3B2Y A;  4JYW A;  4UCP A;  4FD5 A;  3LAC A;  2EO8 A;  1F57 A;  2XEG A;  3LOD A;  1J4J A;  4RN7 A;  1XBU A;  3I1U A;  2Z3N A;  2PVW A;  2G3A A;  2I00 A;  2C1C A;  1DTD A;  4R6T A;  4U5Y A;  4Q38 A;  4B5O A;  1XFO A;  5F09 A;  1KUV A;  5F48 A;  1LAN A;  4EFD A;  2P0W A;  3CDX A;  1BPM A;  2VBQ A;  1JQG A;  2DF5 A;  4YGO A;  2REF A;  3NA6 A;  4UEE A;  2ZW4 A;  1CP7 A;  3K2K A;  4UEF A;  1MJ9 A;  4B11 A;  2EK8 A;  2YNC C;  3D68 A;  4NGP A;  5A27 A;  3B7I A;  2OOT A;  5H86 A;  3FJU A;  1S60 A;  4B12 A;  2BL1 A;  3FMC A;  4B5P A;  1F2P A;  4B6Z A;  5AGE A;  5FVJ A;  4NSQ A;  2NMT A;  4KOT A;  2C6C A;  2Q4V A;  2ZW6 A;  4ZY0 A;  2CIJ A;  2ANP A;  4A31 A;  1Y7E A;  1YLO A;  1P0H A;  2JBK A;  4J3G A;  1QMU A;  4KOW A;  4PXC A;  1VGY A;  2PCU A;  2R1I A;  4R9M A;  1MJA A;  3FIX A;  2P6F A;  3S6G A;  1I12 A;  2AJ6 A;  3D7F A;  4OKO A;  1YX0 A;  4NCZ A;  1M1D A;  3RBU A;  2WUU A;  5DWN A;  4JXQ A;  2G3T A;  4I49 A;  4NGM A;  4QVT A;  4CS0 B;  4MHP A;  5I0C A;  1Z8W A;  4M3S A;  4F0X A;  4NGQ A;  2ZPA A;  4OC1 A;  4G1P A;  3VWE A;  1YSJ A;  4A37 A;  2PJ1 A;  3FEC A;  4Y49 B;  3FBU A;  3NH5 A;  2AFO A;  4ZX9 A;  1YGH A;  2Q44 A;  3IC1 A;  3LD2 A;  3IFE A;  4JWP A;  4MFK A;  4P6Y A;  3WC5 A;  3UY5 A;  3B35 A;  3CPA A;  4Q36 A;  4R57 A;  3R9E A;  1TXR A;  4KVX A;  3NE7 A;  4NJQ A;  5JQ4 A;  2JEW A;  4MMO A;  4MJ8 A;  4ONU A;  4B14 A;  3QNV A;  4CGP A;  1N71 A;  2CTC A;  2ZXV A;  4HKF A;  4MFL A;  4MCS A;  3DLJ A;  4ZY2 A;  3TE4 A;  2K5T A;  1TF9 A;  3LMS A;  1CBX A;  2AFS A;  4KOY A;  5IX3 A;  2PJ9 A;  3FH4 A;  5DWM A;  1P4N A;  1R43 A;  4LX9 A;  3E0K A;  4CGM A;  3S9L A;  4FD4 A;  2GU2 A;  1IID A;  2ARH A;  4QB9 A;  5THW A;  4MHD A;  4F9V A;  1YVO A;  1IOF A;  2FS5 A;  4DNC A;  1Z5R A;  2VI7 A;  1PUA A;  2PVV A;  2VZY A;  1Z9U A;  1RXT A;  2PSW A;  1GYT A;  1KUX A;  4JLY A;  4NXY A;  4PPZ A;  1H8L A;  4XPD B;  4KVO E;  1VKC A;  2HB6 A;  2JBJ A;  4KSA A;  4DYO A;  2Q04 A;  2ZEL A;  4H6U A;  2P6G A;  1YVK A;  2ODF A;  3SI1 A;  1QSO A;  3PFE A;  1AUG A;  2JDC A;  1FT7 A;  1ZLI A;  3F0A A;  3OWC A;  3KGQ A;  3KQZ A;  3SHP A;  2B4D A;  2FCK A;  2F5I A;  4L8A A;  4BMH A;  4Q7A A;  3K9T A;  4KOV A;  2XEF A;  2ZEF A;  4A39 A;  2CXA A;  4KSF A;  4UF4 A;  3T8W A;  1OZP A;  2ABZ A;  4K30 A;  4ORF A;  3TOA A;  3CT9 A;  3PB6 X;  3IGR A;  2PE3 A;  1V0C A;  2DXQ A;  2OZH A;  1FY7 A;  1Q7L A;  3D67 A;  2WPX A;  3EFA A;  4IK2 A;  2NYQ A;  3EC4 A;  1S3Z A;  4OC5 A;  4PSW A;  2ZW7 A;  1YW4 A;  4CAE A;  4MXU A;  3D2P A;  5D8N A;  1EE3 P;  1YR0 A;  3TT2 A;  2G9D A;  1QQ9 A;  4ZYQ A;  2VQY A;  2HC9 A;  3H8E A;  3KZW A;  1YW6 A;  2AFZ A;  4FD6 A;  3BXM A;  2Q7B A;  4CRZ B;  1SQH A;  5JPH A;  2C6P A; 
#chains in the Genus database with same CATH homology
 4CGN A;  2QIR A;  1M4D A;  5EBV A;  1NMT A;  3D2M A;  2P6E A;  4KLV A;  2Q0Y A;  3R9G A;  4C68 A;  4CRY B;  4QC6 A;  3I3G A;  3QAH A;  1S7L A;  1YLE A;  1Z4E A;  2BUE A;  4UWI A;  3S6H A;  2B5G A;  1NSL A;  3H4Q A;  3JUW A;  2VEZ A;  2IL4 A;  4JXR A;  3T90 A;  2KCW A;  3DSB A;  3S6K A;  2FXF A;  2WPW A;  5ISV A;  4KOU A;  5KTA A;  2CY2 A;  2PQ8 A;  4CYO A;  3JTK A;  5G22 A;  3BJ8 A;  1XF8 A;  2FE7 A;  2Z3K A;  2B4D B;  4AG9 A;  5GCN A;  1YRE A;  2BEI A;  5J8F A;  4MY0 A;  3ZZI A;  5H84 A;  3EO4 A;  5IB0 A;  1BOB A;  4JJX A;  1ON0 A;  2GE3 A;  4R87 A;  1Q2C A;  4C2X A;  4HNY B;  1K4J A;  4H6Z A;  2EVN A;  4IUS A;  3MGD A;  4A33 A;  1Y9K A;  5G21 A;  5AG5 A;  5EC4 A;  4F0Y A;  1B6B A;  2D4O A;  2OU2 A;  3CXS A;  4R3L A;  4A2Z A;  3PGP A;  4XPK A;  4QUS A;  4OLL A;  4II9 A;  4KOX A;  1Z4R A;  3G8W A;  2Y0M A;  5AG6 A;  2PR1 A;  3FYN A;  2JLM A;  3EY5 A;  3TTH A;  1Y9W A;  2C27 A;  3T9Y A;  1MJB A;  2YND A;  4UA3 A;  3W6X A;  5E96 A;  4CYP A;  1WWZ A;  4MFZ A;  2R8V A;  1U6M A;  3N7Z A;  4MFP A;  3TOB A;  2D4P A;  2B5G B;  1BO4 A;  3S6F A;  4UBR A;  2PR8 A;  3FNC A;  3V8I A;  4CGO A;  2JEV A;  4UWJ A;  3GY9 A;  4AB7 A;  2QEC A;  4PV6 A;  2J8N A;  3C26 A;  3PP9 A;  2GAN A;  5KTD A;  5KTC A;  4M85 A;  4LUA A;  3IU1 A;  4CAF A;  4Y49 C;  4YRH A;  1IYK A;  1XIX A;  2PRB A;  4CAW A;  5HH1 A;  4PSX A;  4KS9 A;  2CNT A;  4E0A A;  3DR6 A;  5G20 A;  2PC1 A;  3DR8 A;  4B13 A;  2OB0 A;  1S7N A;  4H89 A;  1M44 A;  4E2A A;  5IV0 A;  3D3S A;  3F5B A;  4B10 A;  4FD7 A;  2Z3L A;  2R7H A;  4JD6 A;  1VHS A;  1QSN A;  4QBJ A;  2DPS A;  2H5M A;  4NEX A;  3TO6 A;  2ATR A;  1ZO0 A;  3TCV A;  2Z3M A;  4XPD C;  4NF1 A;  5F46 A;  3FXT A;  2Q4Y A;  4C2Y A;  4CAX A;  4MY3 A;  2VZZ A;  4EVY A;  2HV2 A;  4MFJ A;  2ZW5 A;  5A28 A;  1MK4 A;  5CNP A;  5C88 A;  1QSR A;  1S7K A;  1XEB A;  5F47 A;  4UFX A;  1IYL A;  2EUI A;  3BLN A;  3H5Z A;  2Z3O A;  3R96 A;  3F8K A;  5F49 A;  4KZT A;  1WK4 A;  5G1Z A;  1KUY A;  3P2F A;  4MI4 A;  4C7I A;  4UCM A;  5C82 A;  3DDD A;  4PK2 A;  2B3V A;  3IWE A;  3BJ7 A;  2B4B A;  4CGL A;  2I79 A;  1S5K A;  3B8G A;  2FIA A;  4MFQ A;  1XE4 A;  4KVM E;  1KZF A;  3TO7 A;  3FRM A;  4KLW A;  3GKR A;  3SXO A;  4UCN A;  5HMN A;  3TO9 A;  2HQY A;  3K9U A;  1RO5 A;  2R98 A;  4C2Z A;  4MBU A;  1QSM A;  3FB3 A;  4XPL A;  3W91 A;  3R1K A;  4A30 A;  2DPT A;  1B87 A;  2YNC A;  3A9L A;  2WSA A;  2X7B A;  3ZJ0 A;  4KOR A;  2B58 A;  4OAE A;  4IF5 A;  4A32 A;  2GIV A;  5AG7 A;  1LRZ A;  1M4I A;  1UFH A;  2RC4 A;  3TFY A;  3WR7 A;  2VXK A;  1Q2Y A;  2O28 A;  2OZG A;  4CAV A;  2Z3P A;  4YFJ A;  2CNS A;  4XNH B;  2YNE A;  3IU2 A;  1IB1 E;  2OZU A;  4OAD A;  4E8O A;  2YGW A;  3DNS A;  4X5K A;  1Q2D A;  3GYA A;  4GS4 A;  3PZJ A;  3CXQ A;  1YK3 A;  3EXN A;  1QST A;  3QB8 A;  2QML A;  3I9S A;  3RYO A;  5BWA B;  1L0C A;  4C7H A;  1R57 A;  2J8M A;  2HUZ A;  4F6A A;  1GHE A;  3SXN A;  4CYQ A;  2Z11 A;  4KUB A;  4AVC A;  2FL4 A;  2CNM A;  4HNX B;  4AVA A;  3VWD A;  1NE9 A;  2PDO A;  4U9Z A;  3G3S A;  1TIQ A;  2G0B A;  4B5P B;  1CJW A;  4KOS A;  4HNW B;  1M4G A;  4A95 A;  4AVB A;  3D8P A;  4ZBG A;  1S7F A;  3JVN A;  3IWG A;  1IIC A;  4UFV A;  1SQH A;  4AG7 A;  2AE6 A;  2FT0 A;  3R95 A;  2A4N A;  4XNH C;  2J8R A;  3R9F A;  1I21 A;  2FSR A;  4PK3 A;  4BBH A;  5AG4 A;  2Z0Z A;  4UFW A;  1Y7R A;  4KUA A;  2FIW A;  1PU9 A;  2BSW A;  1XMT A;  4RS2 A;  1I1D A;  2B3U A;  3KKW A;  4ZGY B;  3CXP A;  2OH1 A;  4L89 A;  3W6S A;  4R3K A;  5J8C A;  4RI1 A;  2JDD A;  2REE A;  3P2H A;  4U9Y A;  1CM0 A;  4UCP A;  4FD5 A;  3LOD A;  1J4J A;  2Z3N A;  2G3A A;  2I00 A;  4U5Y A;  4Q38 A;  4B5O A;  1KUV A;  2P0W A;  2VBQ A;  4YGO A;  2REF A;  2ZW4 A;  1MJ9 A;  4B11 A;  2YNC C;  5A27 A;  5H86 A;  1S60 A;  4B12 A;  2BL1 A;  4B5P A;  5AGE A;  5FVJ A;  4NSQ A;  2NMT A;  4KOT A;  2Q4V A;  2ZW6 A;  4A31 A;  1P0H A;  4J3G A;  4KOW A;  4R9M A;  2R1I A;  1MJA A;  3FIX A;  2P6F A;  3S6G A;  1I12 A;  2AJ6 A;  1YX0 A;  4NCZ A;  1M1D A;  2WUU A;  5DWN A;  4JXQ A;  2G3T A;  4I49 A;  4CS0 B;  4QVT A;  5I0C A;  4M3S A;  4F0X A;  2ZPA A;  3VWE A;  4Y49 B;  3FBU A;  1YGH A;  2Q44 A;  3LD2 A;  4MFK A;  4JWP A;  3UY5 A;  4Q36 A;  4R57 A;  3R9E A;  4KVX A;  3NE7 A;  5JQ4 A;  4ONU A;  4MJ8 A;  4B14 A;  4CGP A;  1N71 A;  4HKF A;  2ZXV A;  4MFL A;  3TE4 A;  2K5T A;  4KOY A;  5IX3 A;  5DWM A;  1P4N A;  4LX9 A;  3E0K A;  4CGM A;  4FD4 A;  4QB9 A;  1IID A;  2ARH A;  4MHD A;  1YVO A;  2FS5 A;  4DNC A;  2VI7 A;  1PUA A;  2VZY A;  1Z9U A;  1RXT A;  2PSW A;  1KUX A;  4JLY A;  4NXY A;  4XPD B;  4KVO E;  1VKC A;  4KSA A;  2Q04 A;  4H6U A;  2P6G A;  1YVK A;  1QSO A;  4CYN A;  2JDC A;  3F0A A;  3OWC A;  3SHP A;  2B4D A;  2FCK A;  2F5I A;  4L8A A;  4BMH A;  4KOV A;  2CXA A;  4KSF A;  1OZP A;  4K30 A;  4ORF A;  3TOA A;  3IGR A;  1V0C A;  2DXQ A;  2OZH A;  1FY7 A;  2WPX A;  3EFA A;  3EC4 A;  1S3Z A;  4PSW A;  2ZW7 A;  4CAE A;  3D2P A;  3TT2 A;  1YR0 A;  2VQY A;  4FD6 A;  2Q7B A;  4CRZ B;  2Z10 A;  5JPH A;  5F48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...