3DR8A

Structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
174
structure length
173
Chain Sequence
SNMTIRFADKADCAAITEIYNHAVLHTAAIWNDRTVDTDNRLAWYEARQLLGYPVLVSEENGVVTGYASFGDWRSFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVMVAGIESQNAASIRLHHSLGFTVTAQMPQVGVKFGRWLDLTFMQLQLDEHAAPDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of yncA, a putative ACETYLTRANSFERASE from Salmonella typhimurium with its cofactor Acetyl-CoA
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords yncA
total genus 50
structure length 173
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3dr8A00
3P2HA 1NE9A 2Q4YA 4KOWA 1S5KA 2B5GB 1P4NA 5CNPA 3TTHA 2VBQA 1V0CA 4H89A 2WPXA 1RXTA 4BMHA 5JQ4A 2VEZA 4AG7A 5HH1A 2FIWA 4R3KA 3PP9A 4KVOE 4XPDC 2A4NA 4CAWA 2AJ6A 1M4DA 2D4OA 4DNCA 1S7NA 1M4GA 4QVTA 1XIXA 5KTCA 2C27A 5GCNA 3R9GA 4J3GA 2VZYA 5EC4A 5DWMA 2QECA 4B5OA 1Z4EA 1M1DA 5F48A 2Q0YA 2CNMA 3IGRA 4FD4A 2REFA 3T9YA 3JVNA 3N7ZA 5J8FA 2PR1A 3FBUA 3SXOA 1YLEA 3BJ7A 2PDOA 1QSMA 1BO4A 1IIDA 3T90A 3KKWA 2ZXVA 2OZUA 3R9FA 2JEVA 3FIXA 3DDDA 3W6XA 5F49A 2B4DB 2Q7BA 2JDCA 1S7KA 4PK3A 3D2PA 1YVKA 2G3TA 2ZW6A 3QB8A 5IB0A 3E0KA 4U9YA 3H4QA 4UWJA 4K30A 3EXNA 4FD5A 2NMTA 1Y9KA 1IYLA 2OZHA 4KOTA 4E0AA 2PSWA 4OADA 4QBJA 4IF5A 2P6FA 2B5GA 1QSRA 1Y7RA 2GANA 3OWCA 1XE4A 1ON0A 1YVOA 4PSXA 2J8NA 2GIVA 2JDDA 2D4PA 1VHSA 1U6MA 4AG9A 2P6GA 3GYAA 5H86A 4HNXB 3BLNA 3TT2A 4JWPA 3DR6A 4CS0B 1I21A 5KTAA 4FD6A 3CXSA 3FNCA 4QC6A 4MHDA 2I79A 5C88A 2CNTA 1GHEA 2HUZA 3SHPA 1PU9A 4PV6A 1N71A 3R95A 4H6UA 4NSQA 1KUXA 2B4DA 1Q2YA 2OH1A 3EC4A 5HMNA 1MK4A 4OLLA 1QSTA 4UA3A 4Y49B 4E8OA 2ZPAA 2FS5A 4RI1A 2P6EA 2G3AA 2PC1A 3BJ8A 2Z10A 3K9UA 4PSWA 1NMTA 2QMLA 1B6BA 3CXQA 3F0AA 2O28A 4CAVA 2DXQA 4YRHA 4LX9A 4R9MA 2Q44A 4CAXA 2FSRA 3V8IA 1IB1E 1S7FA 1B87A 5IX3A 2FT0A 4E2AA 4HNYB 3D8PA 3ZJ0A 1LRZA 3VWEA 4KOYA 2JLMA 4KUAA 4AVAA 1MJBA 1XEBA 2R8VA 2VI7A 1NSLA 1Z4RA 1IICA 1RO5A 3DNSA 1SQHA 4JLYA 4AVCA 5ISVA 1S60A 2FE7A 5JPHA 2Z0ZA 2ATRA 4XNHC 4XPKA 3R1KA 2B4BA 4KZTA 4ORFA 3GKRA 2CNSA 2ZW4A 4KVME 4MY3A 1VKCA 1CM0A 4KLWA 1YREA 3W91A 4II9A 3QAHA 2AE6A 2Z11A 4CRZB 3CXPA 2VQYA 4F6AA 4F0YA 1M44A 1YGHA 4UWIA 4ONUA 1J4JA 4MBUA 4JD6A 4MI4A 3LODA 1WWZA 2PQ8A 3S6HA 1IYKA 2PR8A 4X5KA 1MJAA 3MGDA 4M85A 4KOSA 1Q2CA 2R7HA 4HNWB 5J8CA 1BOBA 4QB9A 2ARHA 2FL4A 2X7BA 1I1DA 4OAEA 1KUVA 1PUAA 4XPLA 1OZPA 2REEA 3R9EA 2OU2A 3DSBA 4R87A 2B58A 5F47A 4H6ZA 5EBVA 3TOAA 3DR8A 3ZZIA 2ZW5A 3F8KA 2J8MA 2PRBA 3W6SA 4NCZA 4HKFA 2H5MA 3FYNA 3FB3A 3S6KA 1UFHA 2G0BA 3TCVA 4Y49C 3TO7A 1P0HA 4RS2A 4KVXA 3EFAA 2CY2A 3I9SA 5IV0A 1KUYA 2BSWA 1Q2DA 4FD7A 5KTDA 1YR0A 5E96A 3GY9A 5F46A 2BUEA 1S7LA 3EO4A 4M3SA 3TFYA 3FXTA 4KOXA 4L89A 5DWNA 4ZBGA 1M4IA 3S6GA 3SXNA 2FCKA 3WR7A 2VXKA 2BEIA 1QSOA 2WPWA 3D2MA 4XNHB 2RC4A 2KCWA 4R3LA 3FRMA 3PGPA 4KOUA 2FIAA 3C26A 4I49A 3EY5A 2F5IA 2P0WA 1WK4A 3RYOA 2QIRA 4KUBA 1XMTA 4NF1A 1TIQA 4CRYB 1MJ9A 2R1IA 5FVJA 2R98A 5I0CA 4IUSA 1FY7A 4EVYA 2I00A 4GS4A 4YGOA 1KZFA 4JXRA 2Q04A 1S3ZA 1R57A 3F5BA 4LUAA 4JXQA 3P2FA 3R96A 3G8WA 1L0CA 2BL1A 2J8RA 4NXYA 3TE4A 2HQYA 4NEXA 1YX0A 2ZW7A 2Q4VA 3TOBA 2GE3A 2EUIA 4YFJA 1Z9UA 2EVNA 3I3GA 2K5TA 4B5PB 4AB7A 2Y0MA 4KORA 4R57A 1YK3A 3UY5A 1QSNA 3G3SA 3TO9A 1K4JA 4XPDB 4KLVA 3IWGA 4U5YA 4KOVA 4B5PA 3S6FA 2FXFA 5H84A 3TO6A 2IL4A 4JJXA 3VWDA 3PZJA 4L8AA 2HV2A 2VZZA 3D3SA 4MY0A 2B3VA 1Y9WA 1XF8A 1I12A 4UBRA 4PK2A 2OB0A 3JUWA 2OZGA 3B8GA 1CJWA 4QUSA 4AVBA 4U9ZA 5C82A 3NE7A 4MJ8A 3LD2A 2B3UA
chains in the Genus database with same CATH superfamily
4CGLA 2ZEOA 3P2HA 1NE9A 3IJ3A 2Q4YA 4ONWA 1Z8LA 1QQ9A 4NGMA 2YNCC 4KOWA 1S5KA 3PBEA 4IAVA 2B5GB 4CPAA 3BI0A 2PJ0A 3H8GA 1P4NA 5CNPA 4OC4A 2WUUA 3TTHA 2VBQA 2PVVA 1V0CA 3NH5A 2PJ7A 2WPXA 4H89A 4R6TA 4MHPA 1RXTA 4BMHA 1CPSA 5JQ4A 4ZYQA 1YW4A 2VEZA 4WJBA 5AG4A 1ELLP 4AG7A 1BLLE 2FIWA 5HH1A 4B10A 4UEZA 1DE4C 4R3KA 3PP9A 4KVOE 2Z3LA 2A4NA 4XPDC 4CAWA 2O53A 4TNUA 2AJ6A 1M4DA 3KHZA 2D4OA 4DNCA 3L2NA 4OC1A 1S7NA 1M4GA 4C2ZA 4QVTA 1XIXA 5KTCA 2C27A 4HPSA 4BBHA 4ZY1A 3K9TA 2CXAA 3CPXA 2CTBA 5GCNA 3R9GA 4J3GA 4PPZA 2ZEEA 4LQ6A 2VZYA 2WZNA 2PJCA 3S9MA 3PEIA 5EC4A 5DWMA 3VARA 2QECA 4B5OA 4B12A 1Z4EA 2V8DA 3KQZA 1M1DA 2POKA 4OC0A 4Q7AA 4MHZA 4UIAA 4A39A 5F48A 2ZELA 2Q0YA 2CNMA 3HLPA 2PJ2A 3IGRA 1AUGA 4P10A 4A33A 1Z5RA 1CP6A 4Q36A 4FD4A 3D7GA 5EMIA 2YNDA 1Y0RA 2REFA 3T9YA 3JVNA 3N7ZA 4F9VA 2QYVA 4KSIA 2JEWA 2Q7SA 5J8FA 1Z8XA 1DTDA 2PR1A 2CTCA 4P4EA 3FBUA 4MCRA 3SXOA 1YLEA 3RNZA 3KI9A 4H2KA 1IU8A 4NJQA 5D8NA 5G1ZA 3VH9A 3FEDA 2QJ8A 3BJ7A 2PDOA 3CPAA 1LOKA 3IC1A 4A37A 1NSAA 1HDQA 1BO4A 1QSMA 4UFWA 1IIDA 1YQEA 2PRQA 3T90A 4F8ZA 3TC8A 3KKWA 2ZXVA 3BXMA 2OZUA 3R9FA 4R76A 2JEVA 3FIXA 2AFMA 3DDDA 5G20A 3W6XA 5F49A 5IB9A 3PRTA 2B4DB 2Q7BA 1ZLHA 2YNCA 2JDCA 2XEGA 1S7KA 4PK3A 4UIBA 5HVHA 3D2PA 1YVKA 2G3TA 1YMEA 2ZW6A 3QB8A 3E0KA 4U9YA 1X10A 3H4QA 2GLFA 4NJRA 4UWJA 5IB0A 3FVLA 3FH4A 4K30A 3EXNA 2Q43A 4FD5A 2NMTA 1Y9KA 3CZXA 3KHXA 1IYLA 3NE8A 2OZHA 4KOTA 4E0AA 2AFSA 2PSWA 4OADA 4QBJA 3RBUA 4IF5A 1LANA 3B3CA 3SJGA 2P6FA 4OC3A 4ZY0A 2B5GA 4CAEA 2G9DA 2V8VA 1QSRA 1Y7RA 2PJ5A 2GANA 3OWCA 1YLOA 1XE4A 1ON0A 3FECA 1YVOA 2IJZA 3KR5A 5JH9A 4PSXA 3RO0A 2NSMA 2J8NA 3SJXA 2GIVA 2JDDA 4OP4A 4C2XA 1F57A 2D4PA 2CIJA 1VHSA 3RAMA 1U6MA 4AG9A 2EK9A 2P6GA 3GYAA 5H86A 4RUHA 4HNXB 2Q4ZA 3BLNA 4JWPA 3TT2A 4CGOA 3BHXA 3DR6A 1I21A 4CS0B 4FD6A 5KTAA 3KL9A 4ZX9A 3CXSA 1R3NA 5LRKA 1ZG8A 4UEFA 3FNCA 1XMBA 4QC6A 3NFZA 2ZEFA 4RN7A 4MHDA 2I79A 4MRIA 5C88A 1ELMP 2CNTA 4YWYA 1GHEA 5AG5A 2HUZA 1EE3P 2PIYA 2V8HA 2YGWA 4NGSA 3SHPA 4NGNA 5G22A 3KQXA 4P4DA 1PYTB 1PU9A 4PV6A 1N71A 5HXDA 5J1QA 3NH8A 3R95A 4A31A 4H6UA 4NSQA 1KUXA 3FEEA 4MFLA 3B2YA 5LYLA 4NGQA 4KSAA 2B4DA 2J9AA 1Q2YA 2OH1A 1AMPA 3EC4A 3KR4A 2PJ3A 5HMNA 5JGFA 1MK4A 2ABZA 3LWUA 4UF4A 4OLLA 3B3VA 2Z3OA 1QMUA 1QSTA 4UA3A 2RFHA 4Y49B 4E8OA 4X8IA 2ZPAA 3H8FA 4IHMA 2FS5A 4RI1A 2P6EA 2G3AA 2PC1A 3BJ8A 2Z10A 3K9UA 4PSWA 1NMTA 2QMLA 5LYIA 3DLJA 4P44A 1B6BA 3CXQA 4JZ0A 3F0AA 1IGBA 1CBXA 4UFXA 1PCAA 2O28A 4CAVA 4EFDA 2DXQA 3PB8X 4YRHA 4YU9A 4LX9A 4R9MA 2Q44A 4IK2A 5I4MA 4CAXA 3JTKA 2FSRA 3IWEA 2XEJA 3D68A 1TKJA 3V8IA 4AXVA 2FVGA 3N5FA 1IB1E 1S7FA 1B87A 1BPMA 2I3CA 2Z3MA 3NA6A 5IX3A 2FT0A 4CYPA 1FNOA 3GB0A 4HNYB 1TXRA 4E2AA 4EWTA 3D8PA 3ZJ0A 4A38A 4X2TA 7CPAA 1LRZA 3VWEA 4PQAA 4A30A 3PFEA 4KOYA 5LYFA 3BI1A 2YNEA 1BAVA 2JLMA 3D7FA 4ZX8A 1ZO0A 4P4IA 4KUAA 4AVAA 1XBUA 1MJBA 2CF4A 3SJFA 1XEBA 2VL1A 2XEIA 2R8VA 2VI7A 4P4JA 1NSLA 4UCMA 4DUKA 2BO9A 1Q7LA 1Z4RA 3D4UA 2WYRA 1IICA 1RO5A 3DNSA 2F8HA 3CT9A 2F7VA 1SQHA 1BPNA 2AFXA 4W9YA 4JLYA 4OIDA 4AVCA 3NH4A 1CPXA 1S60A 2AFUA 2FE7A 2XEFA 2Z0ZA 3LACA 5JPHA 4MCQA 2ATRA 4XNHC 5ELYA 4XPKA 1IOFA 4R8FA 5DS0A 3SI0A 4MFJA 1X12A 4CGMA 3R1KA 2ZEDA 2C1CA 2B4BA 4A94A 4KZTA 1XFOA 4ORFA 3CDXA 3GKRA 2CNSA 5ISVA 1FT7A 2ZENA 2ZW4A 4KVME 4MY3A 1VKCA 2PJAA 2QVPA 1CM0A 3VATA 4KLWA 3MRUA 4OC2A 3TX8A 2OOTA 1YREA 1ZLIA 3W91A 3B3WA 4CGPA 3FX6A 3QAHA 6CPAA 4II9A 2AE6A 3S9NA 2Z11A 3D66A 4CRZB 5BWAB 2C6GA 3CXPA 4M6GA 2GU2A 1LFWA 2VQYA 3IFEA 4F6AA 4F0YA 1M44A 4C68A 1YGHA 5K8OA 2EWBA 4ONUA 1J4JA 4UWIA 1JQGA 4JD6A 4MBUA 2PJ8A 3WT4A 1CP7A 2ZOFA 4LQGA 4MI4A 3WC5A 2NYQA 4B14A 3LODA 4K3NA 1WWZA 2PJ1A 2PQ8A 3S6HA 1IYKA 2DF5A 2PR8A 4UCNA 5K8NA 3KGQA 4X5KA 4FBEA 3DGVA 2ANPA 1MJAA 3MGDA 2HC9A 4M85A 1IY7A 2BOAA 4KOSA 1Z2LA 2JBJA 3FJUA 3HUVA 4A2ZA 4M6HA 1Q2CA 1XOVA 1CG2A 2Z3KA 2R7HA 4HNWB 4NGTA 1BOBA 5J8CA 4QB9A 4F0XA 2ARHA 1Z8WA 2FL4A 2X7BA 1I1DA 2PCUA 4OAEA 1KUVA 2DPSA 3RZAA 3FMCA 3K2KA 4FAIA 1GYTA 1PUAA 2EBJA 4XPLA 2C6PA 4MCPA 1OZPA 2REEA 4OKOA 3R9EA 2GREA 2OU2A 2Z3PA 3DSBA 4R87A 2ZOGA 2B58A 1Y0YA 2DEAA 5F47A 4H6ZA 1VHEA 5EBVA 4Z65A 3TOAA 3DR8A 4MFPA 1TKHA 3FF3A 3ZZIA 2ZW5A 2O4HA 3F8KA 4ZGYB 1YSJA 5G21A 2J8MA 2PRBA 2PJ4A 3MN8A 3T8WA 3W6SA 2IMOA 2ZEGA 1RTQA 4NCZA 4PXEA 2GLJA 4BINA 3SJEA 4HKFA 4NGPA 4C7HA 2H5MA 2AFZA 3FYNA 3FB3A 2PVWA 4NGRA 3S6KA 2OR4A 1OBRA 4G1PA 4P4FA 5A28A 4MFKA 5D29A 1ZG9A 5HVGA 3H5ZA 1UFHA 4O23A 1XRYA 1ARMA 2G0BA 3KASA 3TCVA 3IU1A 4Y49C 3I1UA 2EK8A 5LYDA 1P0HA 4RS2A 2C6CA 4KVXA 3EFAA 3TO7A 2CY2A 3I9SA 4MHNA 5IV0A 1ARLA 1KUYA 2BSWA 3D7DA 2V77A 2ZEPA 4CYOA 3SI2A 2GFQA 4KS9A 5CBMA 2PJ6A 1Q2DA 4FD7A 5KTDA 1YR0A 1VIXA 3GUXA 5E96A 3GY9A 4B13A 5F46A 3KZWA 2BUEA 1S7LA 3EO4A 4M3SA 4MXUA 3TFYA 3FXTA 4KOXA 1VGYA 1UWYA 1R43A 4OC5A 4L89A 5DWNA 4ZBGA 4BD9A 4CGNA 1M4IA 2PE3A 3S6GA 2FCKA 3SXNA 3WR7A 2VXKA 2BEIA 5K8PA 1QSOA 4PXBA 2WPWA 3SI1A 1TF9A 5LRJA 1YW6A 3B3TA 3D2MA 1LAPA 4PXCA 4XNHB 2RC4A 1Z8TA 1F2PA 4C7IA 2KCWA 4F9UA 1KWMA 4R3LA 1A2ZA 3FRMA 3PGPA 4R7MA 4KOUA 2FIAA 4ZY2A 3C26A 3WABA 4I49A 5CPAA 4FWUA 1XJOA 3PB6X 1JWQA 3EY5A 3LMSA 3QAYA 2F5IA 2HB6A 4OMEA 4C2YA 1VHOA 2AFWA 5HVFA 2P0WA 1WK4A 3JRUA 3H8EA 3RYOA 2QIRA 4KUBA 4MFQA 1H8LA 1XMTA 4NF1A 1TIQA 4UFVA 3QNVA 4CRYB 1MJ9A 4A32A 2R1IA 5FVJA 3PB7X 3D7HA 2R98A 2WSAA 5I0CA 1LAMA 4IUSA 1FY7A 4EVYA 2I00A 4GS4A 4YGOA 1KZFA 2PJ9A 4DYOA 2Q51A 3V38A 4JXRA 2Q04A 1S3ZA 1R57A 3F5BA 4FUUA 4WWVA 3V7ZA 4LUAA 4CYQA 2RB7A 4JXQA 3A9LA 3P2FA 3ISZA 1Y7EA 4UEEA 4MFZA 3R96A 3PFOA 4GXHA 3G8WA 1L0CA 2BL1A 1CX8A 1F2OA 2BCOA 4TWEA 2J8RA 4NXYA 4CYNA 3TE4A 2PIZA 2ODFA 2HQYA 4P4BA 8CPAA 5F09A 4X3RA 4M6IA 4NEXA 1YX0A 5AG6A 2ZW7A 3WC6A 1HDUA 3PB9X 2Q4VA 4A95A 4B11A 2EO8A 1ZG7A 3TOBA 2GE3A 2EUIA 3IU2A 3WC7A 4YFJA 1Z9UA 2EVNA 3I3GA 3S9LA 5JM6A 1TF8A 2AFOA 4EMEA 3IO1A 4P6YA 2K5TA 3IEHA 4B5PB 2PJBA 4AB7A 2Y0MA 4KORA 3B35A 4R57A 2V8GA 1YK3A 3UY5A 1AYEA 1QSNA 3D67A 3G3SA 1LCPA 4NFRA 5AGEA 3TO9A 1M4LA 1K4JA 4CAFA 4DJLA 4XPDB 4KLVA 1HEEA 4B6ZA 4JYWA 3IWGA 2DPTA 3GIUA 4GM5A 3ISXA 4OIWA 4U5YA 3B7IA 4KOVA 4P45A 3S6FA 4B5PA 2FXFA 5H84A 4ZI6A 5K8MA 4MHYA 3TO6A 3IIBA 2ZEMA 2IL4A 4JJXA 3VWDA 5A27A 3IWWA 3PZJA 4L8AA 4PXDA 2HV2A 4MMOA 2VZZA 3PB4X 2ZEHA 3D3SA 4MY0A 2B3VA 1Y9WA 1IOIA 1XF8A 3B3SA 1I12A 3PBBA 4UBRA 4PK2A 2OB0A 3JUWA 2OZGA 3B8GA 1CJWA 4QUSA 4AVBA 2IQ6A 2Z3NA 4U9ZA 5C82A 3GLJA 3NE7A 4MJ8A 5LRGA 5AG7A 3LD2A 4Q38A 4UCPA 5THWA 1TKFA 2B3UA 2JBKA 4MCSA 4KSFA
chains in the Genus database with same CATH topology
4CGLA 3P2HA 1NE9A 2Q4YA 2YNCC 4KOWA 1S5KA 2B5GB 1P4NA 5CNPA 3TTHA 2WUUA 2VBQA 1V0CA 4H89A 2WPXA 1RXTA 4BMHA 5JQ4A 5AG4A 2VEZA 4AG7A 5HH1A 2FIWA 4B10A 4R3KA 3PP9A 4KVOE 2Z3LA 2A4NA 4XPDC 4CAWA 2AJ6A 1M4DA 2D4OA 4DNCA 1S7NA 1M4GA 4C2ZA 4QVTA 1XIXA 5KTCA 2C27A 4BBHA 2CXAA 5GCNA 3R9GA 4J3GA 2VZYA 5EC4A 5DWMA 2QECA 4B5OA 4B12A 1Z4EA 1M1DA 5F48A 2Q0YA 2CNMA 3IGRA 4A33A 4Q36A 4FD4A 2YNDA 2REFA 3T9YA 3JVNA 3N7ZA 5J8FA 2PR1A 3FBUA 3SXOA 1YLEA 5G1ZA 3BJ7A 2PDOA 1QSMA 1BO4A 4UFWA 1IIDA 3T90A 3KKWA 2ZXVA 2OZUA 3R9FA 2JEVA 3FIXA 3DDDA 5G20A 3W6XA 5F49A 2B4DB 2Q7BA 2YNCA 2JDCA 1S7KA 4PK3A 3D2PA 1YVKA 3QB8A 2G3TA 2ZW6A 5IB0A 3E0KA 4U9YA 3H4QA 4UWJA 4K30A 3EXNA 4FD5A 2NMTA 1Y9KA 1IYLA 2OZHA 4KOTA 4E0AA 2PSWA 4OADA 4QBJA 4IF5A 2P6FA 2B5GA 4CAEA 1QSRA 1Y7RA 2GANA 3OWCA 1XE4A 1ON0A 1YVOA 4PSXA 2J8NA 2GIVA 2JDDA 4C2XA 2D4PA 1VHSA 1U6MA 4AG9A 2P6GA 3GYAA 5H86A 4HNXB 3BLNA 3TT2A 4JWPA 4CGOA 3DR6A 4CS0B 1I21A 5KTAA 4FD6A 3CXSA 3FNCA 4QC6A 4MHDA 2I79A 5C88A 2CNTA 1GHEA 5AG5A 2HUZA 2YGWA 3SHPA 5G22A 1PU9A 4PV6A 1N71A 3R95A 4A31A 4H6UA 4NSQA 1KUXA 4MFLA 4KSAA 2B4DA 1Q2YA 2OH1A 3EC4A 5HMNA 1MK4A 4OLLA 2Z3OA 1QSTA 4UA3A 4Y49B 4E8OA 2ZPAA 2FS5A 4RI1A 2P6EA 2G3AA 2PC1A 3BJ8A 2Z10A 3K9UA 4PSWA 1NMTA 2QMLA 1B6BA 3CXQA 3F0AA 4UFXA 2O28A 4CAVA 2DXQA 4YRHA 4LX9A 4R9MA 2Q44A 4CAXA 3JTKA 2FSRA 3IWEA 3V8IA 1IB1E 1S7FA 1B87A 2Z3MA 5IX3A 2FT0A 4CYPA 4E2AA 4HNYB 3D8PA 3ZJ0A 1LRZA 3VWEA 4A30A 4KOYA 2YNEA 2JLMA 1ZO0A 4KUAA 4AVAA 1MJBA 1XEBA 2R8VA 2VI7A 1NSLA 4UCMA 1Z4RA 1IICA 1RO5A 3DNSA 1SQHA 4JLYA 4AVCA 5ISVA 1S60A 2FE7A 5JPHA 2Z0ZA 2ATRA 4XNHC 4XPKA 4MFJA 4CGMA 3R1KA 2B4BA 4KZTA 4ORFA 3GKRA 2CNSA 2ZW4A 4KVME 4MY3A 1VKCA 1CM0A 4KLWA 1YREA 3W91A 4CGPA 4II9A 3QAHA 2AE6A 2Z11A 4CRZB 5BWAB 3CXPA 2VQYA 4F6AA 4F0YA 1M44A 4C68A 1YGHA 4UWIA 4ONUA 1J4JA 4MBUA 4JD6A 4MI4A 4B14A 3LODA 1WWZA 2PQ8A 3S6HA 1IYKA 2PR8A 4UCNA 4X5KA 1MJAA 3MGDA 4M85A 4KOSA 4A2ZA 1Q2CA 2Z3KA 2R7HA 4HNWB 5J8CA 1BOBA 4QB9A 4F0XA 2ARHA 2FL4A 2X7BA 1I1DA 4OAEA 1KUVA 2DPSA 1PUAA 4XPLA 1OZPA 2REEA 3R9EA 2OU2A 2Z3PA 3DSBA 4R87A 2B58A 5F47A 4H6ZA 5EBVA 3TOAA 3DR8A 4MFPA 3ZZIA 2ZW5A 3F8KA 4ZGYB 5G21A 2J8MA 2PRBA 3W6SA 4NCZA 4HKFA 4C7HA 2H5MA 3FYNA 3FB3A 3S6KA 5A28A 4MFKA 3H5ZA 1UFHA 2G0BA 3TCVA 3IU1A 4Y49C 3TO7A 1P0HA 4RS2A 4KVXA 3EFAA 2CY2A 3I9SA 5IV0A 1KUYA 2BSWA 4CYOA 4KS9A 1Q2DA 4FD7A 5KTDA 1YR0A 5E96A 3GY9A 4B13A 5F46A 2BUEA 1S7LA 3EO4A 4M3SA 3TFYA 3FXTA 4KOXA 4L89A 5DWNA 4ZBGA 4CGNA 1M4IA 3S6GA 3SXNA 2FCKA 3WR7A 2VXKA 2BEIA 1QSOA 2WPWA 3D2MA 4XNHB 2RC4A 4C7IA 2KCWA 4R3LA 3FRMA 3PGPA 4KOUA 2FIAA 3C26A 4I49A 3EY5A 2F5IA 4C2YA 2P0WA 1WK4A 3RYOA 2QIRA 4KUBA 4MFQA 1XMTA 4NF1A 1TIQA 4UFVA 4CRYB 1MJ9A 4A32A 2R1IA 5FVJA 2R98A 2WSAA 5I0CA 4IUSA 1FY7A 4EVYA 2I00A 4GS4A 4YGOA 1KZFA 4JXRA 2Q04A 1S3ZA 1R57A 3F5BA 4LUAA 4CYQA 4JXQA 3A9LA 3P2FA 4MFZA 3R96A 3G8WA 1L0CA 2BL1A 4CYNA 2J8RA 4NXYA 3TE4A 2HQYA 4NEXA 1YX0A 5AG6A 2ZW7A 2Q4VA 4A95A 4B11A 3TOBA 2GE3A 2EUIA 3IU2A 4YFJA 1Z9UA 2EVNA 3I3GA 2K5TA 4B5PB 4AB7A 2Y0MA 4KORA 4R57A 1YK3A 3UY5A 1QSNA 5AGEA 3G3SA 3TO9A 1K4JA 4CAFA 4XPDB 4KLVA 3IWGA 2DPTA 4U5YA 4KOVA 4B5PA 3S6FA 2FXFA 5H84A 3TO6A 2IL4A 4JJXA 3VWDA 5A27A 3PZJA 4L8AA 2HV2A 2VZZA 3D3SA 4MY0A 2B3VA 1Y9WA 1XF8A 1I12A 4UBRA 4PK2A 2OB0A 3JUWA 2OZGA 3B8GA 1CJWA 4QUSA 4AVBA 2Z3NA 4U9ZA 5C82A 3NE7A 4MJ8A 5AG7A 3LD2A 4Q38A 4UCPA 2B3UA 4KSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P2H A;  1NE9 A;  2Q4Y A;  4KOW A;  1S5K A;  2B5G B;  1P4N A;  5CNP A;  3TTH A;  2VBQ A;  1V0C A;  4H89 A;  2WPX A;  1RXT A;  4BMH A;  5JQ4 A;  2VEZ A;  4AG7 A;  5HH1 A;  2FIW A;  4R3K A;  3PP9 A;  4KVO E;  4XPD C;  2A4N A;  4CAW A;  2AJ6 A;  1M4D A;  2D4O A;  4DNC A;  1S7N A;  1M4G A;  4QVT A;  1XIX A;  5KTC A;  2C27 A;  5GCN A;  3R9G A;  4J3G A;  2VZY A;  5EC4 A;  5DWM A;  2QEC A;  4B5O A;  1Z4E A;  1M1D A;  5F48 A;  2Q0Y A;  2CNM A;  3IGR A;  4FD4 A;  2REF A;  3T9Y A;  3JVN A;  3N7Z A;  5J8F A;  2PR1 A;  3FBU A;  3SXO A;  1YLE A;  3BJ7 A;  2PDO A;  1QSM A;  1BO4 A;  1IID A;  3T90 A;  3KKW A;  2ZXV A;  2OZU A;  3R9F A;  2JEV A;  3FIX A;  3DDD A;  3W6X A;  5F49 A;  2B4D B;  2Q7B A;  2JDC A;  1S7K A;  4PK3 A;  3D2P A;  1YVK A;  2G3T A;  2ZW6 A;  3QB8 A;  5IB0 A;  3E0K A;  4U9Y A;  3H4Q A;  4UWJ A;  4K30 A;  3EXN A;  4FD5 A;  2NMT A;  1Y9K A;  1IYL A;  2OZH A;  4KOT A;  4E0A A;  2PSW A;  4OAD A;  4QBJ A;  4IF5 A;  2P6F A;  2B5G A;  1QSR A;  1Y7R A;  2GAN A;  3OWC A;  1XE4 A;  1ON0 A;  1YVO A;  4PSX A;  2J8N A;  2GIV A;  2JDD A;  2D4P A;  1VHS A;  1U6M A;  4AG9 A;  2P6G A;  3GYA A;  5H86 A;  4HNX B;  3BLN A;  3TT2 A;  4JWP A;  3DR6 A;  4CS0 B;  1I21 A;  5KTA A;  4FD6 A;  3CXS A;  3FNC A;  4QC6 A;  4MHD A;  2I79 A;  5C88 A;  2CNT A;  1GHE A;  2HUZ A;  3SHP A;  1PU9 A;  4PV6 A;  1N71 A;  3R95 A;  4H6U A;  4NSQ A;  1KUX A;  2B4D A;  1Q2Y A;  2OH1 A;  3EC4 A;  5HMN A;  1MK4 A;  4OLL A;  1QST A;  4UA3 A;  4Y49 B;  4E8O A;  2ZPA A;  2FS5 A;  4RI1 A;  2P6E A;  2G3A A;  2PC1 A;  3BJ8 A;  2Z10 A;  3K9U A;  4PSW A;  1NMT A;  2QML A;  1B6B A;  3CXQ A;  3F0A A;  2O28 A;  4CAV A;  2DXQ A;  4YRH A;  4LX9 A;  4R9M A;  2Q44 A;  4CAX A;  2FSR A;  3V8I A;  1IB1 E;  1S7F A;  1B87 A;  5IX3 A;  2FT0 A;  4E2A A;  4HNY B;  3D8P A;  3ZJ0 A;  1LRZ A;  3VWE A;  4KOY A;  2JLM A;  4KUA A;  4AVA A;  1MJB A;  1XEB A;  2R8V A;  2VI7 A;  1NSL A;  1Z4R A;  1IIC A;  1RO5 A;  3DNS A;  1SQH A;  4JLY A;  4AVC A;  5ISV A;  1S60 A;  2FE7 A;  5JPH A;  2Z0Z A;  2ATR A;  4XNH C;  4XPK A;  3R1K A;  2B4B A;  4KZT A;  4ORF A;  3GKR A;  2CNS A;  2ZW4 A;  4KVM E;  4MY3 A;  1VKC A;  1CM0 A;  4KLW A;  1YRE A;  3W91 A;  4II9 A;  3QAH A;  2AE6 A;  2Z11 A;  4CRZ B;  3CXP A;  2VQY A;  4F6A A;  4F0Y A;  1M44 A;  1YGH A;  4UWI A;  4ONU A;  1J4J A;  4MBU A;  4JD6 A;  4MI4 A;  3LOD A;  1WWZ A;  2PQ8 A;  3S6H A;  1IYK A;  2PR8 A;  4X5K A;  1MJA A;  3MGD A;  4M85 A;  4KOS A;  1Q2C A;  2R7H A;  4HNW B;  5J8C A;  1BOB A;  4QB9 A;  2ARH A;  2FL4 A;  2X7B A;  1I1D A;  4OAE A;  1KUV A;  1PUA A;  4XPL A;  1OZP A;  2REE A;  3R9E A;  2OU2 A;  3DSB A;  4R87 A;  2B58 A;  5F47 A;  4H6Z A;  5EBV A;  3TOA A;  3DR8 A;  3ZZI A;  2ZW5 A;  3F8K A;  2J8M A;  2PRB A;  3W6S A;  4NCZ A;  4HKF A;  2H5M A;  3FYN A;  3FB3 A;  3S6K A;  1UFH A;  2G0B A;  3TCV A;  4Y49 C;  3TO7 A;  1P0H A;  4RS2 A;  4KVX A;  3EFA A;  2CY2 A;  3I9S A;  5IV0 A;  1KUY A;  2BSW A;  1Q2D A;  4FD7 A;  5KTD A;  1YR0 A;  5E96 A;  3GY9 A;  5F46 A;  2BUE A;  1S7L A;  3EO4 A;  4M3S A;  3TFY A;  3FXT A;  4KOX A;  4L89 A;  5DWN A;  4ZBG A;  1M4I A;  3S6G A;  3SXN A;  2FCK A;  3WR7 A;  2VXK A;  2BEI A;  1QSO A;  2WPW A;  3D2M A;  4XNH B;  2RC4 A;  2KCW A;  4R3L A;  3FRM A;  3PGP A;  4KOU A;  2FIA A;  3C26 A;  4I49 A;  3EY5 A;  2F5I A;  2P0W A;  1WK4 A;  3RYO A;  2QIR A;  4KUB A;  1XMT A;  4NF1 A;  1TIQ A;  4CRY B;  1MJ9 A;  2R1I A;  5FVJ A;  2R98 A;  5I0C A;  4IUS A;  1FY7 A;  4EVY A;  2I00 A;  4GS4 A;  4YGO A;  1KZF A;  4JXR A;  2Q04 A;  1S3Z A;  1R57 A;  3F5B A;  4LUA A;  4JXQ A;  3P2F A;  3R96 A;  3G8W A;  1L0C A;  2BL1 A;  2J8R A;  4NXY A;  3TE4 A;  2HQY A;  4NEX A;  1YX0 A;  2ZW7 A;  2Q4V A;  3TOB A;  2GE3 A;  2EUI A;  4YFJ A;  1Z9U A;  2EVN A;  3I3G A;  2K5T A;  4B5P B;  4AB7 A;  2Y0M A;  4KOR A;  4R57 A;  1YK3 A;  3UY5 A;  1QSN A;  3G3S A;  3TO9 A;  1K4J A;  4XPD B;  4KLV A;  3IWG A;  4U5Y A;  4KOV A;  4B5P A;  3S6F A;  2FXF A;  5H84 A;  3TO6 A;  2IL4 A;  4JJX A;  3VWD A;  3PZJ A;  4L8A A;  2HV2 A;  2VZZ A;  3D3S A;  4MY0 A;  2B3V A;  1Y9W A;  1XF8 A;  1I12 A;  4UBR A;  4PK2 A;  2OB0 A;  3JUW A;  2OZG A;  3B8G A;  1CJW A;  4QUS A;  4AVB A;  4U9Z A;  5C82 A;  3NE7 A;  4MJ8 A;  3LD2 A;  2B3U A; 
#chains in the Genus database with same CATH topology
 4CGL A;  2ZEO A;  3P2H A;  1NE9 A;  3IJ3 A;  2Q4Y A;  4ONW A;  1Z8L A;  1QQ9 A;  4NGM A;  2YNC C;  4KOW A;  1S5K A;  3PBE A;  4IAV A;  2B5G B;  4CPA A;  3BI0 A;  2PJ0 A;  3H8G A;  1P4N A;  5CNP A;  4OC4 A;  2WUU A;  3TTH A;  2VBQ A;  2PVV A;  1V0C A;  3NH5 A;  2PJ7 A;  2WPX A;  4H89 A;  4R6T A;  4MHP A;  1RXT A;  4BMH A;  1CPS A;  5JQ4 A;  4ZYQ A;  1YW4 A;  2VEZ A;  4WJB A;  5AG4 A;  1ELL P;  4AG7 A;  1BLL E;  2FIW A;  5HH1 A;  4B10 A;  4UEZ A;  1DE4 C;  4R3K A;  3PP9 A;  4KVO E;  2Z3L A;  2A4N A;  4XPD C;  4CAW A;  2O53 A;  4TNU A;  2AJ6 A;  1M4D A;  3KHZ A;  2D4O A;  4DNC A;  3L2N A;  4OC1 A;  1S7N A;  1M4G A;  4C2Z A;  4QVT A;  1XIX A;  5KTC A;  2C27 A;  4HPS A;  4BBH A;  4ZY1 A;  3K9T A;  2CXA A;  3CPX A;  2CTB A;  5GCN A;  3R9G A;  4J3G A;  4PPZ A;  2ZEE A;  4LQ6 A;  2VZY A;  2WZN A;  2PJC A;  3S9M A;  3PEI A;  5EC4 A;  5DWM A;  3VAR A;  2QEC A;  4B5O A;  4B12 A;  1Z4E A;  2V8D A;  3KQZ A;  1M1D A;  2POK A;  4OC0 A;  4Q7A A;  4MHZ A;  4UIA A;  4A39 A;  5F48 A;  2ZEL A;  2Q0Y A;  2CNM A;  3HLP A;  2PJ2 A;  3IGR A;  1AUG A;  4P10 A;  4A33 A;  1Z5R A;  1CP6 A;  4Q36 A;  4FD4 A;  3D7G A;  5EMI A;  2YND A;  1Y0R A;  2REF A;  3T9Y A;  3JVN A;  3N7Z A;  4F9V A;  2QYV A;  4KSI A;  2JEW A;  2Q7S A;  5J8F A;  1Z8X A;  1DTD A;  2PR1 A;  2CTC A;  4P4E A;  3FBU A;  4MCR A;  3SXO A;  1YLE A;  3RNZ A;  3KI9 A;  4H2K A;  1IU8 A;  4NJQ A;  5D8N A;  5G1Z A;  3VH9 A;  3FED A;  2QJ8 A;  3BJ7 A;  2PDO A;  3CPA A;  1LOK A;  3IC1 A;  4A37 A;  1NSA A;  1HDQ A;  1BO4 A;  1QSM A;  4UFW A;  1IID A;  1YQE A;  2PRQ A;  3T90 A;  4F8Z A;  3TC8 A;  3KKW A;  2ZXV A;  3BXM A;  2OZU A;  3R9F A;  4R76 A;  2JEV A;  3FIX A;  2AFM A;  3DDD A;  5G20 A;  3W6X A;  5F49 A;  5IB9 A;  3PRT A;  2B4D B;  2Q7B A;  1ZLH A;  2YNC A;  2JDC A;  2XEG A;  1S7K A;  4PK3 A;  4UIB A;  5HVH A;  3D2P A;  1YVK A;  2G3T A;  1YME A;  2ZW6 A;  3QB8 A;  3E0K A;  4U9Y A;  1X10 A;  3H4Q A;  2GLF A;  4NJR A;  4UWJ A;  5IB0 A;  3FVL A;  3FH4 A;  4K30 A;  3EXN A;  2Q43 A;  4FD5 A;  2NMT A;  1Y9K A;  3CZX A;  3KHX A;  1IYL A;  3NE8 A;  2OZH A;  4KOT A;  4E0A A;  2AFS A;  2PSW A;  4OAD A;  4QBJ A;  3RBU A;  4IF5 A;  1LAN A;  3B3C A;  3SJG A;  2P6F A;  4OC3 A;  4ZY0 A;  2B5G A;  4CAE A;  2G9D A;  2V8V A;  1QSR A;  1Y7R A;  2PJ5 A;  2GAN A;  3OWC A;  1YLO A;  1XE4 A;  1ON0 A;  3FEC A;  1YVO A;  2IJZ A;  3KR5 A;  5JH9 A;  4PSX A;  3RO0 A;  2NSM A;  2J8N A;  3SJX A;  2GIV A;  2JDD A;  4OP4 A;  4C2X A;  1F57 A;  2D4P A;  2CIJ A;  1VHS A;  3RAM A;  1U6M A;  4AG9 A;  2EK9 A;  2P6G A;  3GYA A;  5H86 A;  4RUH A;  4HNX B;  2Q4Z A;  3BLN A;  4JWP A;  3TT2 A;  4CGO A;  3BHX A;  3DR6 A;  1I21 A;  4CS0 B;  4FD6 A;  5KTA A;  3KL9 A;  4ZX9 A;  3CXS A;  1R3N A;  5LRK A;  1ZG8 A;  4UEF A;  3FNC A;  1XMB A;  4QC6 A;  3NFZ A;  2ZEF A;  4RN7 A;  4MHD A;  2I79 A;  4MRI A;  5C88 A;  1ELM P;  2CNT A;  4YWY A;  1GHE A;  5AG5 A;  2HUZ A;  1EE3 P;  2PIY A;  2V8H A;  2YGW A;  4NGS A;  3SHP A;  4NGN A;  5G22 A;  3KQX A;  4P4D A;  1PYT B;  1PU9 A;  4PV6 A;  1N71 A;  5HXD A;  5J1Q A;  3NH8 A;  3R95 A;  4A31 A;  4H6U A;  4NSQ A;  1KUX A;  3FEE A;  4MFL A;  3B2Y A;  5LYL A;  4NGQ A;  4KSA A;  2B4D A;  2J9A A;  1Q2Y A;  2OH1 A;  1AMP A;  3EC4 A;  3KR4 A;  2PJ3 A;  5HMN A;  5JGF A;  1MK4 A;  2ABZ A;  3LWU A;  4UF4 A;  4OLL A;  3B3V A;  2Z3O A;  1QMU A;  1QST A;  4UA3 A;  2RFH A;  4Y49 B;  4E8O A;  4X8I A;  2ZPA A;  3H8F A;  4IHM A;  2FS5 A;  4RI1 A;  2P6E A;  2G3A A;  2PC1 A;  3BJ8 A;  2Z10 A;  3K9U A;  4PSW A;  1NMT A;  2QML A;  5LYI A;  3DLJ A;  4P44 A;  1B6B A;  3CXQ A;  4JZ0 A;  3F0A A;  1IGB A;  1CBX A;  4UFX A;  1PCA A;  2O28 A;  4CAV A;  4EFD A;  2DXQ A;  3PB8 X;  4YRH A;  4YU9 A;  4LX9 A;  4R9M A;  2Q44 A;  4IK2 A;  5I4M A;  4CAX A;  3JTK A;  2FSR A;  3IWE A;  2XEJ A;  3D68 A;  1TKJ A;  3V8I A;  4AXV A;  2FVG A;  3N5F A;  1IB1 E;  1S7F A;  1B87 A;  1BPM A;  2I3C A;  2Z3M A;  3NA6 A;  5IX3 A;  2FT0 A;  4CYP A;  1FNO A;  3GB0 A;  4HNY B;  1TXR A;  4E2A A;  4EWT A;  3D8P A;  3ZJ0 A;  4A38 A;  4X2T A;  7CPA A;  1LRZ A;  3VWE A;  4PQA A;  4A30 A;  3PFE A;  4KOY A;  5LYF A;  3BI1 A;  2YNE A;  1BAV A;  2JLM A;  3D7F A;  4ZX8 A;  1ZO0 A;  4P4I A;  4KUA A;  4AVA A;  1XBU A;  1MJB A;  2CF4 A;  3SJF A;  1XEB A;  2VL1 A;  2XEI A;  2R8V A;  2VI7 A;  4P4J A;  1NSL A;  4UCM A;  4DUK A;  2BO9 A;  1Q7L A;  1Z4R A;  3D4U A;  2WYR A;  1IIC A;  1RO5 A;  3DNS A;  2F8H A;  3CT9 A;  2F7V A;  1SQH A;  1BPN A;  2AFX A;  4W9Y A;  4JLY A;  4OID A;  4AVC A;  3NH4 A;  1CPX A;  1S60 A;  2AFU A;  2FE7 A;  2XEF A;  2Z0Z A;  3LAC A;  5JPH A;  4MCQ A;  2ATR A;  4XNH C;  5ELY A;  4XPK A;  1IOF A;  4R8F A;  5DS0 A;  3SI0 A;  4MFJ A;  1X12 A;  4CGM A;  3R1K A;  2ZED A;  2C1C A;  2B4B A;  4A94 A;  4KZT A;  1XFO A;  4ORF A;  3CDX A;  3GKR A;  2CNS A;  5ISV A;  1FT7 A;  2ZEN A;  2ZW4 A;  4KVM E;  4MY3 A;  1VKC A;  2PJA A;  2QVP A;  1CM0 A;  3VAT A;  4KLW A;  3MRU A;  4OC2 A;  3TX8 A;  2OOT A;  1YRE A;  1ZLI A;  3W91 A;  3B3W A;  4CGP A;  3FX6 A;  3QAH A;  6CPA A;  4II9 A;  2AE6 A;  3S9N A;  2Z11 A;  3D66 A;  4CRZ B;  5BWA B;  2C6G A;  3CXP A;  4M6G A;  2GU2 A;  1LFW A;  2VQY A;  3IFE A;  4F6A A;  4F0Y A;  1M44 A;  4C68 A;  1YGH A;  5K8O A;  2EWB A;  4ONU A;  1J4J A;  4UWI A;  1JQG A;  4JD6 A;  4MBU A;  2PJ8 A;  3WT4 A;  1CP7 A;  2ZOF A;  4LQG A;  4MI4 A;  3WC5 A;  2NYQ A;  4B14 A;  3LOD A;  4K3N A;  1WWZ A;  2PJ1 A;  2PQ8 A;  3S6H A;  1IYK A;  2DF5 A;  2PR8 A;  4UCN A;  5K8N A;  3KGQ A;  4X5K A;  4FBE A;  3DGV A;  2ANP A;  1MJA A;  3MGD A;  2HC9 A;  4M85 A;  1IY7 A;  2BOA A;  4KOS A;  1Z2L A;  2JBJ A;  3FJU A;  3HUV A;  4A2Z A;  4M6H A;  1Q2C A;  1XOV A;  1CG2 A;  2Z3K A;  2R7H A;  4HNW B;  4NGT A;  1BOB A;  5J8C A;  4QB9 A;  4F0X A;  2ARH A;  1Z8W A;  2FL4 A;  2X7B A;  1I1D A;  2PCU A;  4OAE A;  1KUV A;  2DPS A;  3RZA A;  3FMC A;  3K2K A;  4FAI A;  1GYT A;  1PUA A;  2EBJ A;  4XPL A;  2C6P A;  4MCP A;  1OZP A;  2REE A;  4OKO A;  3R9E A;  2GRE A;  2OU2 A;  2Z3P A;  3DSB A;  4R87 A;  2ZOG A;  2B58 A;  1Y0Y A;  2DEA A;  5F47 A;  4H6Z A;  1VHE A;  5EBV A;  4Z65 A;  3TOA A;  3DR8 A;  4MFP A;  1TKH A;  3FF3 A;  3ZZI A;  2ZW5 A;  2O4H A;  3F8K A;  4ZGY B;  1YSJ A;  5G21 A;  2J8M A;  2PRB A;  2PJ4 A;  3MN8 A;  3T8W A;  3W6S A;  2IMO A;  2ZEG A;  1RTQ A;  4NCZ A;  4PXE A;  2GLJ A;  4BIN A;  3SJE A;  4HKF A;  4NGP A;  4C7H A;  2H5M A;  2AFZ A;  3FYN A;  3FB3 A;  2PVW A;  4NGR A;  3S6K A;  2OR4 A;  1OBR A;  4G1P A;  4P4F A;  5A28 A;  4MFK A;  5D29 A;  1ZG9 A;  5HVG A;  3H5Z A;  1UFH A;  4O23 A;  1XRY A;  1ARM A;  2G0B A;  3KAS A;  3TCV A;  3IU1 A;  4Y49 C;  3I1U A;  2EK8 A;  5LYD A;  1P0H A;  4RS2 A;  2C6C A;  4KVX A;  3EFA A;  3TO7 A;  2CY2 A;  3I9S A;  4MHN A;  5IV0 A;  1ARL A;  1KUY A;  2BSW A;  3D7D A;  2V77 A;  2ZEP A;  4CYO A;  3SI2 A;  2GFQ A;  4KS9 A;  5CBM A;  2PJ6 A;  1Q2D A;  4FD7 A;  5KTD A;  1YR0 A;  1VIX A;  3GUX A;  5E96 A;  3GY9 A;  4B13 A;  5F46 A;  3KZW A;  2BUE A;  1S7L A;  3EO4 A;  4M3S A;  4MXU A;  3TFY A;  3FXT A;  4KOX A;  1VGY A;  1UWY A;  1R43 A;  4OC5 A;  4L89 A;  5DWN A;  4ZBG A;  4BD9 A;  4CGN A;  1M4I A;  2PE3 A;  3S6G A;  2FCK A;  3SXN A;  3WR7 A;  2VXK A;  2BEI A;  5K8P A;  1QSO A;  4PXB A;  2WPW A;  3SI1 A;  1TF9 A;  5LRJ A;  1YW6 A;  3B3T A;  3D2M A;  1LAP A;  4PXC A;  4XNH B;  2RC4 A;  1Z8T A;  1F2P A;  4C7I A;  2KCW A;  4F9U A;  1KWM A;  4R3L A;  1A2Z A;  3FRM A;  3PGP A;  4R7M A;  4KOU A;  2FIA A;  4ZY2 A;  3C26 A;  3WAB A;  4I49 A;  5CPA A;  4FWU A;  1XJO A;  3PB6 X;  1JWQ A;  3EY5 A;  3LMS A;  3QAY A;  2F5I A;  2HB6 A;  4OME A;  4C2Y A;  1VHO A;  2AFW A;  5HVF A;  2P0W A;  1WK4 A;  3JRU A;  3H8E A;  3RYO A;  2QIR A;  4KUB A;  4MFQ A;  1H8L A;  1XMT A;  4NF1 A;  1TIQ A;  4UFV A;  3QNV A;  4CRY B;  1MJ9 A;  4A32 A;  2R1I A;  5FVJ A;  3PB7 X;  3D7H A;  2R98 A;  2WSA A;  5I0C A;  1LAM A;  4IUS A;  1FY7 A;  4EVY A;  2I00 A;  4GS4 A;  4YGO A;  1KZF A;  2PJ9 A;  4DYO A;  2Q51 A;  3V38 A;  4JXR A;  2Q04 A;  1S3Z A;  1R57 A;  3F5B A;  4FUU A;  4WWV A;  3V7Z A;  4LUA A;  4CYQ A;  2RB7 A;  4JXQ A;  3A9L A;  3P2F A;  3ISZ A;  1Y7E A;  4UEE A;  4MFZ A;  3R96 A;  3PFO A;  4GXH A;  3G8W A;  1L0C A;  2BL1 A;  1CX8 A;  1F2O A;  2BCO A;  4TWE A;  2J8R A;  4NXY A;  4CYN A;  3TE4 A;  2PIZ A;  2ODF A;  2HQY A;  4P4B A;  8CPA A;  5F09 A;  4X3R A;  4M6I A;  4NEX A;  1YX0 A;  5AG6 A;  2ZW7 A;  3WC6 A;  1HDU A;  3PB9 X;  2Q4V A;  4A95 A;  4B11 A;  2EO8 A;  1ZG7 A;  3TOB A;  2GE3 A;  2EUI A;  3IU2 A;  3WC7 A;  4YFJ A;  1Z9U A;  2EVN A;  3I3G A;  3S9L A;  5JM6 A;  1TF8 A;  2AFO A;  4EME A;  3IO1 A;  4P6Y A;  2K5T A;  3IEH A;  4B5P B;  2PJB A;  4AB7 A;  2Y0M A;  4KOR A;  3B35 A;  4R57 A;  2V8G A;  1YK3 A;  3UY5 A;  1AYE A;  1QSN A;  3D67 A;  3G3S A;  1LCP A;  4NFR A;  5AGE A;  3TO9 A;  1M4L A;  1K4J A;  4CAF A;  4DJL A;  4XPD B;  4KLV A;  1HEE A;  4B6Z A;  4JYW A;  3IWG A;  2DPT A;  3GIU A;  4GM5 A;  3ISX A;  4OIW A;  4U5Y A;  3B7I A;  4KOV A;  4P45 A;  3S6F A;  4B5P A;  2FXF A;  5H84 A;  4ZI6 A;  5K8M A;  4MHY A;  3TO6 A;  3IIB A;  2ZEM A;  2IL4 A;  4JJX A;  3VWD A;  5A27 A;  3IWW A;  3PZJ A;  4L8A A;  4PXD A;  2HV2 A;  4MMO A;  2VZZ A;  3PB4 X;  2ZEH A;  3D3S A;  4MY0 A;  2B3V A;  1Y9W A;  1IOI A;  1XF8 A;  3B3S A;  1I12 A;  3PBB A;  4UBR A;  4PK2 A;  2OB0 A;  3JUW A;  2OZG A;  3B8G A;  1CJW A;  4QUS A;  4AVB A;  2IQ6 A;  2Z3N A;  4U9Z A;  5C82 A;  3GLJ A;  3NE7 A;  4MJ8 A;  5LRG A;  5AG7 A;  3LD2 A;  4Q38 A;  4UCP A;  5THW A;  1TKF A;  2B3U A;  2JBK A;  4MCS A;  4KSF A; 
#chains in the Genus database with same CATH homology
 4CGL A;  3P2H A;  1NE9 A;  2Q4Y A;  2YNC C;  4KOW A;  1S5K A;  2B5G B;  1P4N A;  5CNP A;  3TTH A;  2WUU A;  2VBQ A;  1V0C A;  4H89 A;  2WPX A;  1RXT A;  4BMH A;  5JQ4 A;  5AG4 A;  2VEZ A;  4AG7 A;  5HH1 A;  2FIW A;  4B10 A;  4R3K A;  3PP9 A;  4KVO E;  2Z3L A;  2A4N A;  4XPD C;  4CAW A;  2AJ6 A;  1M4D A;  2D4O A;  4DNC A;  1S7N A;  1M4G A;  4C2Z A;  4QVT A;  1XIX A;  5KTC A;  2C27 A;  4BBH A;  2CXA A;  5GCN A;  3R9G A;  4J3G A;  2VZY A;  5EC4 A;  5DWM A;  2QEC A;  4B5O A;  4B12 A;  1Z4E A;  1M1D A;  5F48 A;  2Q0Y A;  2CNM A;  3IGR A;  4A33 A;  4Q36 A;  4FD4 A;  2YND A;  2REF A;  3T9Y A;  3JVN A;  3N7Z A;  5J8F A;  2PR1 A;  3FBU A;  3SXO A;  1YLE A;  5G1Z A;  3BJ7 A;  2PDO A;  1QSM A;  1BO4 A;  4UFW A;  1IID A;  3T90 A;  3KKW A;  2ZXV A;  2OZU A;  3R9F A;  2JEV A;  3FIX A;  3DDD A;  5G20 A;  3W6X A;  5F49 A;  2B4D B;  2Q7B A;  2YNC A;  2JDC A;  1S7K A;  4PK3 A;  3D2P A;  1YVK A;  3QB8 A;  2G3T A;  2ZW6 A;  5IB0 A;  3E0K A;  4U9Y A;  3H4Q A;  4UWJ A;  4K30 A;  3EXN A;  4FD5 A;  2NMT A;  1Y9K A;  1IYL A;  2OZH A;  4KOT A;  4E0A A;  2PSW A;  4OAD A;  4QBJ A;  4IF5 A;  2P6F A;  2B5G A;  4CAE A;  1QSR A;  1Y7R A;  2GAN A;  3OWC A;  1XE4 A;  1ON0 A;  1YVO A;  4PSX A;  2J8N A;  2GIV A;  2JDD A;  4C2X A;  2D4P A;  1VHS A;  1U6M A;  4AG9 A;  2P6G A;  3GYA A;  5H86 A;  4HNX B;  3BLN A;  3TT2 A;  4JWP A;  4CGO A;  3DR6 A;  4CS0 B;  1I21 A;  5KTA A;  4FD6 A;  3CXS A;  3FNC A;  4QC6 A;  4MHD A;  2I79 A;  5C88 A;  2CNT A;  1GHE A;  5AG5 A;  2HUZ A;  2YGW A;  3SHP A;  5G22 A;  1PU9 A;  4PV6 A;  1N71 A;  3R95 A;  4A31 A;  4H6U A;  4NSQ A;  1KUX A;  4MFL A;  4KSA A;  2B4D A;  1Q2Y A;  2OH1 A;  3EC4 A;  5HMN A;  1MK4 A;  4OLL A;  2Z3O A;  1QST A;  4UA3 A;  4Y49 B;  4E8O A;  2ZPA A;  2FS5 A;  4RI1 A;  2P6E A;  2G3A A;  2PC1 A;  3BJ8 A;  2Z10 A;  3K9U A;  4PSW A;  1NMT A;  2QML A;  1B6B A;  3CXQ A;  3F0A A;  4UFX A;  2O28 A;  4CAV A;  2DXQ A;  4YRH A;  4LX9 A;  4R9M A;  2Q44 A;  4CAX A;  3JTK A;  2FSR A;  3IWE A;  3V8I A;  1IB1 E;  1S7F A;  1B87 A;  2Z3M A;  5IX3 A;  2FT0 A;  4CYP A;  4E2A A;  4HNY B;  3D8P A;  3ZJ0 A;  1LRZ A;  3VWE A;  4A30 A;  4KOY A;  2YNE A;  2JLM A;  1ZO0 A;  4KUA A;  4AVA A;  1MJB A;  1XEB A;  2R8V A;  2VI7 A;  1NSL A;  4UCM A;  1Z4R A;  1IIC A;  1RO5 A;  3DNS A;  1SQH A;  4JLY A;  4AVC A;  5ISV A;  1S60 A;  2FE7 A;  5JPH A;  2Z0Z A;  2ATR A;  4XNH C;  4XPK A;  4MFJ A;  4CGM A;  3R1K A;  2B4B A;  4KZT A;  4ORF A;  3GKR A;  2CNS A;  2ZW4 A;  4KVM E;  4MY3 A;  1VKC A;  1CM0 A;  4KLW A;  1YRE A;  3W91 A;  4CGP A;  4II9 A;  3QAH A;  2AE6 A;  2Z11 A;  4CRZ B;  5BWA B;  3CXP A;  2VQY A;  4F6A A;  4F0Y A;  1M44 A;  4C68 A;  1YGH A;  4UWI A;  4ONU A;  1J4J A;  4MBU A;  4JD6 A;  4MI4 A;  4B14 A;  3LOD A;  1WWZ A;  2PQ8 A;  3S6H A;  1IYK A;  2PR8 A;  4UCN A;  4X5K A;  1MJA A;  3MGD A;  4M85 A;  4KOS A;  4A2Z A;  1Q2C A;  2Z3K A;  2R7H A;  4HNW B;  5J8C A;  1BOB A;  4QB9 A;  4F0X A;  2ARH A;  2FL4 A;  2X7B A;  1I1D A;  4OAE A;  1KUV A;  2DPS A;  1PUA A;  4XPL A;  1OZP A;  2REE A;  3R9E A;  2OU2 A;  2Z3P A;  3DSB A;  4R87 A;  2B58 A;  5F47 A;  4H6Z A;  5EBV A;  3TOA A;  3DR8 A;  4MFP A;  3ZZI A;  2ZW5 A;  3F8K A;  4ZGY B;  5G21 A;  2J8M A;  2PRB A;  3W6S A;  4NCZ A;  4HKF A;  4C7H A;  2H5M A;  3FYN A;  3FB3 A;  3S6K A;  5A28 A;  4MFK A;  3H5Z A;  1UFH A;  2G0B A;  3TCV A;  3IU1 A;  4Y49 C;  3TO7 A;  1P0H A;  4RS2 A;  4KVX A;  3EFA A;  2CY2 A;  3I9S A;  5IV0 A;  1KUY A;  2BSW A;  4CYO A;  4KS9 A;  1Q2D A;  4FD7 A;  5KTD A;  1YR0 A;  5E96 A;  3GY9 A;  4B13 A;  5F46 A;  2BUE A;  1S7L A;  3EO4 A;  4M3S A;  3TFY A;  3FXT A;  4KOX A;  4L89 A;  5DWN A;  4ZBG A;  4CGN A;  1M4I A;  3S6G A;  3SXN A;  2FCK A;  3WR7 A;  2VXK A;  2BEI A;  1QSO A;  2WPW A;  3D2M A;  4XNH B;  2RC4 A;  4C7I A;  2KCW A;  4R3L A;  3FRM A;  3PGP A;  4KOU A;  2FIA A;  3C26 A;  4I49 A;  3EY5 A;  2F5I A;  4C2Y A;  2P0W A;  1WK4 A;  3RYO A;  2QIR A;  4KUB A;  4MFQ A;  1XMT A;  4NF1 A;  1TIQ A;  4UFV A;  4CRY B;  1MJ9 A;  4A32 A;  2R1I A;  5FVJ A;  2R98 A;  2WSA A;  5I0C A;  4IUS A;  1FY7 A;  4EVY A;  2I00 A;  4GS4 A;  4YGO A;  1KZF A;  4JXR A;  2Q04 A;  1S3Z A;  1R57 A;  3F5B A;  4LUA A;  4CYQ A;  4JXQ A;  3A9L A;  3P2F A;  4MFZ A;  3R96 A;  3G8W A;  1L0C A;  2BL1 A;  4CYN A;  2J8R A;  4NXY A;  3TE4 A;  2HQY A;  4NEX A;  1YX0 A;  5AG6 A;  2ZW7 A;  2Q4V A;  4A95 A;  4B11 A;  3TOB A;  2GE3 A;  2EUI A;  3IU2 A;  4YFJ A;  1Z9U A;  2EVN A;  3I3G A;  2K5T A;  4B5P B;  4AB7 A;  2Y0M A;  4KOR A;  4R57 A;  1YK3 A;  3UY5 A;  1QSN A;  5AGE A;  3G3S A;  3TO9 A;  1K4J A;  4CAF A;  4XPD B;  4KLV A;  3IWG A;  2DPT A;  4U5Y A;  4KOV A;  4B5P A;  3S6F A;  2FXF A;  5H84 A;  3TO6 A;  2IL4 A;  4JJX A;  3VWD A;  5A27 A;  3PZJ A;  4L8A A;  2HV2 A;  2VZZ A;  3D3S A;  4MY0 A;  2B3V A;  1Y9W A;  1XF8 A;  1I12 A;  4UBR A;  4PK2 A;  2OB0 A;  3JUW A;  2OZG A;  3B8G A;  1CJW A;  4QUS A;  4AVB A;  2Z3N A;  4U9Z A;  5C82 A;  3NE7 A;  4MJ8 A;  5AG7 A;  3LD2 A;  4Q38 A;  4UCP A;  2B3U A;  4KSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...