3DR8A

Structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
174
structure length
173
Chain Sequence
b'SNMTIRFADKADCAAITEIYNHAVLHTAAIWNDRTVDTDNRLAWYEARQLLGYPVLVSEENGVVTGYASFGDWRSFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVMVAGIESQNAASIRLHHSLGFTVTAQMPQVGVKFGRWLDLTFMQLQLDEHAAPDAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords yncA
publication title Structure of yncA, a putative ACETYLTRANSFERASE from Salmonella typhimurium with its cofactor Acetyl-CoA
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 50
structure length 173
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3dr8A00
3F0AA 4AVCA 2KCWA 1XEBA 2R1IA 3IGRA 4XPDB 5EC4A 2Z10A 2JEVA 3F5BA 4CAWA 3LODA 3I3GA 3FYNA 4KORA 4KUBA 1M44A 1YVOA 1QSMA 2CNTA 1RO5A 2PR8A 4FD5A 3T90A 1VKCA 2FL4A 3WR7A 1IB1E 3DR6A 1ON0A 5KTDA 3MGDA 3QB8A 5KTCA 3G3SA 2PC1A 4JXQA 4BMHA 1Y7RA 1YLEA 3TFYA 2PR1A 2Z11A 3ZZIA 2Q7BA 1NMTA 1QSNA 2CNMA 4XPLA 2JDCA 5I0CA 2P6FA 3W91A 4UA3A 4YGOA 2VQYA 4MJ8A 4QUSA 2FSRA 4H89A 3CXPA 5KTAA 1P4NA 4MY3A 1IYLA 4Y49C 5C88A 5J8CA 2FT0A 3EY5A 4F6AA 4KOWA 4H6ZA 2QIRA 4R57A 4HNXB 3R9EA 4PSWA 4CS0B 2P0WA 4U9ZA 3R9GA 2F5IA 2PRBA 4M3SA 5H84A 4ZBGA 2J8NA 2FIWA 3SHPA 2ARHA 2HV2A 1S60A 4RI1A 2ATRA 4L8AA 4L89A 2BEIA 1S7LA 3TO9A 1Q2DA 4KOXA 3N7ZA 2Z0ZA 4JD6A 1CJWA 2VXKA 2AE6A 2C27A 4EVYA 3P2HA 4NXYA 3V8IA 3PZJA 1MJ9A 1PU9A 2ZW5A 3F8KA 5ISVA 2D4PA 2FXFA 5JPHA 1M4IA 1Q2CA 1L0CA 3T9YA 1KUXA 4KVME 3UY5A 2VZZA 4U9YA 3NE7A 3I9SA 4CAVA 4CRYB 4QB9A 5DWNA 2VZYA 4K30A 3FBUA 4AVBA 1M1DA 1XF8A 2FE7A 3DR8A 4KVXA 1XMTA 4UWJA 2ZXVA 1S7FA 1N71A 1VHSA 4YRHA 3FNCA 5J8FA 2FIAA 2B5GA 2ZW4A 2Q44A 3CXSA 2JDDA 2HQYA 4KLVA 4E8OA 3BJ8A 4ORFA 4Y49B 2B3VA 2IL4A 4IF5A 4J3GA 4B5PA 4FD4A 5F46A 1MK4A 3PP9A 1I12A 3OWCA 2EUIA 2REEA 4XNHB 2Q4VA 3R95A 4KLWA 4CRZB 2Q4YA 4UBRA 2CY2A 4FD6A 1K4JA 4JXRA 3RYOA 3TOBA 2EVNA 2FS5A 1Z4EA 4LX9A 1NSLA 4NCZA 2OZUA 3DDDA 1S7NA 3TCVA 4XPDC 4KOUA 3EC4A 3TE4A 1QSTA 1S3ZA 3CXQA 2R8VA 3KKWA 3VWEA 4R3KA 1BO4A 1XE4A 1P0HA 2O28A 4IUSA 4B5OA 4KOVA 4H6UA 2QMLA 1I1DA 2D4OA 3K9UA 1KZFA 4U5YA 5GCNA 1SQHA 5HH1A 4KOYA 4OAEA 4ONUA 3R96A 5F48A 3R1KA 1YR0A 4KVOE 3TT2A 4DNCA 2I79A 2CNSA 2P6GA 4MY0A 2BSWA 3S6GA 4LUAA 5IX3A 1YK3A 3SXOA 5IV0A 1IYKA 3BJ7A 4AB7A 2G0BA 1UFHA 1KUVA 2VI7A 4PSXA 1Z9UA 3S6FA 2B4DB 2Q04A 4OLLA 2ZW6A 2AJ6A 4PK2A 3H4QA 2J8RA 5DWMA 3BLNA 4QBJA 1NE9A 2H5MA 1XIXA 2GANA 4UWIA 4MBUA 4OADA 2Q0YA 4HKFA 4I49A 4YFJA 1Z4RA 2PSWA 2GE3A 3GKRA 2OZGA 4HNWB 4PV6A 1PUAA 4HNYB 5H86A 3EXNA 3D8PA 3JUWA 1Q2YA 3EO4A 3C26A 2K5TA 2BUEA 1FY7A 1U6MA 2RC4A 2VEZA 4JWPA 2PDOA 3QAHA 1YVKA 1OZPA 3DSBA 5FVJA 2OU2A 3W6SA 5F47A 2B58A 4MI4A 3ZJ0A 4E2AA 1MJAA 3TO7A 1BOBA 1RXTA 2P6EA 4PK3A 2I00A 5F49A 2R7HA 4NF1A 2WPWA 5C82A 3TOAA 3LD2A 3TTHA 3G8WA 4QC6A 4KOTA 2NMTA 1I21A 1IICA 4R9MA 2REFA 2B4BA 3JVNA 3FRMA 4KZTA 4JJXA 1GHEA 4KUAA 4R3LA 4II9A 2B3UA 1QSRA 2PQ8A 1M4DA 1YGHA 1Y9WA 1S5KA 2R98A 4M85A 2B4DA 4RS2A 1TIQA 4X5KA 2B5GB 2OH1A 4AG9A 1J4JA 3P2FA 1YX0A 1R57A 3FIXA 4XNHC 3S6KA 4B5PB 4NEXA 1B6BA 1IIDA 4AVAA 2BL1A 3IWGA 4QVTA 3TO6A 4CAXA 2GIVA 2HUZA 2Y0MA 3DNSA 3GY9A 1Y9KA 3FB3A 4E0AA 1CM0A 4KOSA 3D2MA 3E0KA 1MJBA 1WK4A 3VWDA 2ZPAA 3D3SA 3S6HA 3EFAA 5EBVA 1M4GA 2X7BA 4R87A 3SXNA 4MHDA 1YREA 1KUYA 2DXQA 1QSOA 2JLMA 2A4NA 2G3AA 1V0CA 3B8GA 3W6XA 5E96A 1LRZA 4AG7A 4NSQA 2OB0A 4JLYA 1WWZA 2QECA 1B87A 4GS4A 3FXTA 5CNPA 2OZHA 4XPKA 3R9FA 1S7KA 3GYAA 5HMNA 5IB0A 2VBQA 2FCKA 4F0YA 5JQ4A 2G3TA 2ZW7A 3PGPA 2WPXA 3D2PA 2J8MA 4FD7A
chains in the Genus database with same CATH superfamily
2DPSA 1IU8A 1VIXA 3B3TA 3F0AA 2DEAA 4AVCA 2KCWA 1XEBA 2R1IA 3IGRA 3S9NA 4XPDB 5EC4A 1LOKA 2Z10A 2JEVA 2WZNA 3F5BA 2V8DA 3LWUA 3B35A 4CAWA 3KGQA 2YNCC 3LODA 4NGTA 3I3GA 1TKFA 3FYNA 2XEGA 1IY7A 4KORA 4JZ0A 4KUBA 1M44A 4MMOA 4MCPA 1YVOA 1QSMA 2CNTA 1RO5A 2PR8A 4FD5A 1R3NA 4P4BA 3T90A 1VKCA 3IEHA 4YWYA 1XRYA 4B14A 2FL4A 3WR7A 1IB1E 3DR6A 4M6IA 1TKJA 4MCSA 4A32A 1ON0A 4C2XA 3D4UA 4KSAA 1NSAA 4A94A 5KTDA 2Z3OA 2CIJA 3IU1A 3MGDA 4NJRA 3QB8A 2AFXA 5KTCA 3G3SA 1Q7LA 3VH9A 2ZELA 5CBMA 1ZG7A 2PC1A 4JXQA 4BMHA 1Y7RA 1YLEA 3TFYA 5HVGA 2PR1A 2Z11A 3FJUA 4MHPA 4OMEA 3ZZIA 2Q7BA 3QNVA 1NMTA 1QSNA 2CNMA 4XPLA 2XEJA 4A95A 4R6TA 2JDCA 2IMOA 1LAPA 2OR4A 2AFZA 4CPAA 2NSMA 1FNOA 4BINA 5I0CA 2G9DA 2P6FA 5JGFA 3K2KA 1ARLA 3BI0A 3PB8X 3W91A 4UFWA 4UA3A 4YGOA 2VQYA 4A39A 1CP6A 4B13A 4MJ8A 3H8EA 4QUSA 2EK8A 3FEEA 2GLFA 1Z8XA 4ZYQA 2AFUA 2ZOGA 2AFMA 3PFOA 2Q7SA 2FSRA 3WC5A 3KZWA 5A27A 4H89A 5AG7A 5F09A 5I4MA 3NH5A 3CXPA 5KTAA 1P4NA 4MY3A 5K8MA 1IYLA 4Y49C 5C88A 5J8CA 2FT0A 3EY5A 4G1PA 4CYOA 1XMBA 4NGMA 4F6AA 2Z3PA 1DE4C 4KOWA 6CPAA 4H6ZA 4P44A 3TX8A 5HVFA 2QIRA 4R57A 4HNXB 3R9EA 4PSWA 4NFRA 4MRIA 4OC4A 1LANA 2P0WA 2V8VA 4M6HA 2XEFA 5EMIA 4CS0B 8CPAA 3D7HA 4U9ZA 3R9GA 4IK2A 2F5IA 2PRBA 4M3SA 2JBJA 2GREA 2JEWA 3DGVA 5H84A 3NH4A 3IWWA 4ZBGA 4DUKA 2J8NA 2FIWA 3I1UA 3NH8A 3SHPA 3KHZA 3NFZA 3IWEA 2ARHA 2HV2A 1S60A 4RI1A 2ABZA 2ATRA 4L8AA 4L89A 2O4HA 4X2TA 1XJOA 1F57A 2BEIA 3FVLA 1S7LA 4MHZA 3TO9A 1Q2DA 4KOXA 3N7ZA 2Z3LA 1ZG8A 2Z0ZA 4JD6A 5JH9A 1CJWA 2IJZA 1XFOA 2AE6A 2VXKA 2C27A 4EVYA 3B3SA 4CYNA 4ZX8A 1M4LA 1ZG9A 3P2HA 4P4EA 1F2PA 5HVHA 4NGRA 4A30A 4NXYA 4IHMA 3V8IA 5LRKA 3PZJA 1MJ9A 1PU9A 2V77A 2PCUA 2ZW5A 3KQZA 3F8KA 3TC8A 5ISVA 1PCAA 2D4PA 1HDUA 2FXFA 3IJ3A 4MFLA 5JPHA 1M4IA 2GFQA 3CZXA 3K9TA 3IU2A 4NJQA 1Q2CA 1L0CA 3T9YA 4UIAA 4ZY1A 1KUXA 3PBEA 4KVME 3UY5A 2VZZA 4U9YA 3NE7A 2NYQA 3I9SA 3NA6A 3WABA 4CAVA 3KL9A 4CRYB 4QB9A 5DWNA 2Z3MA 2VZYA 1Z8WA 1FT7A 2C6CA 4K30A 5CNPA 3FBUA 3S9MA 4AVBA 4MCRA 4R8FA 1TF9A 3MRUA 1M1DA 1XF8A 1ELLP 2FE7A 4B6ZA 3QAYA 3DR8A 4KVXA 4ZGYB 2FVGA 2Q43A 2C6PA 4PXBA 3N5FA 5CPAA 1Y0RA 3D2PA 1XMTA 4WJBA 1RTQA 2QVPA 2QYVA 3PEIA 4UCNA 4UWJA 2ZXVA 1LFWA 1S7FA 3H8FA 1N71A 4DJLA 3V7ZA 4OC5A 1VHSA 3PB4X 3FNCA 4YRHA 5J8FA 4PQAA 2EO8A 2FIAA 2B5GA 2ZEDA 1AUGA 2BOAA 5AGEA 2ZW4A 2Q44A 3CXSA 4MFPA 2JDDA 2HQYA 4UEZA 4KLVA 4E8OA 4A33A 4UIBA 4BD9A 3BJ8A 4ORFA 4Y49B 2B3VA 2IL4A 3DLJA 4IF5A 4J3GA 2PJBA 4B5PA 4OP4A 2GLJA 4FD4A 5G22A 5IB9A 4CGPA 3PFEA 2IQ6A 2ZEGA 1MK4A 3PP9A 4P4JA 4FAIA 2PRQA 4UCPA 5F46A 1I12A 2C1CA 3OWCA 2EUIA 3JRUA 2REEA 4XNHB 2Q4VA 4B12A 3R95A 2ZOFA 5AG6A 4KLWA 4K3NA 4CRZB 2Z3NA 3RBUA 2DF5A 2Q4YA 4UBRA 2CY2A 4FD6A 4A38A 1ZLHA 3HUVA 4RUHA 1K4JA 2PJ8A 1X12A 1LCPA 2ZEMA 4JXRA 4CGLA 4R76A 3RYOA 3SJFA 2EVNA 3TOBA 3GUXA 3D68A 1CBXA 4WWVA 2WUUA 2FS5A 1Z4EA 3PBBA 4LX9A 1NSLA 4NCZA 4MFJA 1Z2LA 4H2KA 4Q38A 1LAMA 2OZUA 2PIZA 3DDDA 1S7NA 3PB6X 3SI2A 3TCVA 3D7GA 3FMCA 4XPDC 3SJGA 4KOUA 5K8NA 3EC4A 3TE4A 4A31A 1QSTA 4OC0A 5LYLA 3BXMA 1YSJA 1S3ZA 2HC9A 3CXQA 2R8VA 3FECA 4B11A 3KKWA 3VARA 3VWEA 1CP7A 4R3KA 1BO4A 3GIUA 1XE4A 1P0HA 1YW6A 2O28A 1BPMA 3GB0A 3IO1A 5D8NA 2ZEPA 4IUSA 1YQEA 4KOVA 4B5OA 2CXAA 1HEEA 4H6UA 4MCQA 2QMLA 2YNDA 1I1DA 3FF3A 2D4OA 4F8ZA 3K9UA 1KZFA 3RO0A 2O53A 4U5YA 5GCNA 1A2ZA 1SQHA 5HH1A 4MHNA 5LYDA 4KOYA 5G1ZA 5A28A 3PRTA 4OAEA 4ONUA 2F7VA 2C6GA 3R96A 4Q36A 4UCMA 3T8WA 4OC2A 4Z65A 2XEIA 5F48A 3V38A 3R1KA 1YR0A 4OKOA 4KVOE 3TT2A 4DNCA 2I79A 2CNSA 2P6GA 4MY0A 2EK9A 2BSWA 3H5ZA 1TXRA 3S6GA 4LUAA 5IX3A 1CPXA 1YK3A 4FWUA 3SJEA 4NGPA 2PJAA 3SXOA 5IV0A 1IYKA 1YMEA 1XOVA 2V8HA 3BJ7A 5ELYA 4AB7A 2G0BA 4W9YA 1UFHA 1KUVA 2VI7A 4PSXA 2I3CA 1Z9UA 3S6FA 2B4DB 2Q4ZA 1AYEA 2PVVA 7CPAA 2Q04A 3WT4A 2WSAA 4OLLA 2OOTA 4ZI6A 2ZW6A 3RAMA 2AJ6A 2DPTA 3B3WA 2Q51A 4PK2A 4UEEA 3H4QA 2ZEOA 2J8RA 4MHYA 5DWMA 3BLNA 4QBJA 4C68A 4YFJA 2RB7A 4RN7A 1NE9A 2H5MA 1XIXA 2GANA 4UWIA 4MBUA 4OADA 2POKA 2PJ9A 2Q0YA 4CGOA 3B3CA 4EFDA 3CPAA 2PE3A 1EE3P 4HKFA 5HXDA 2CTBA 2PJ6A 4I49A 4UF4A 1TKHA 1X10A 1Z4RA 2GU2A 2PSWA 4NGNA 3BI1A 4P4IA 2YNEA 1Y7EA 4P45A 5LRJA 2GE3A 3JTKA 4PXEA 4MFZA 4CAFA 3GKRA 4F9UA 2OZGA 4HNWB 4PV6A 1PUAA 4HNYB 5D29A 5H86A 3EXNA 3D8PA 3JUWA 4PPZA 1JWQA 2AFSA 1Q2YA 4MFKA 3ISXA 3EO4A 2PJ2A 1TF8A 3HLPA 3FH4A 1ZO0A 2V8GA 2K5TA 3C26A 5LYFA 4P4DA 2BUEA 1BLLE 1FY7A 1VGYA 4C2ZA 3B3VA 4CGMA 1U6MA 4R7MA 2RC4A 2VL1A 2VEZA 4JWPA 2PDOA 5K8PA 3QAHA 1YVKA 1OZPA 3DSBA 5FVJA 5THWA 1PYTB 2EBJA 2OU2A 2B58A 4MI4A 4OC3A 5F47A 3B2YA 3W6SA 3ZJ0A 1MJAA 3TO7A 1BOBA 4E2AA 1ARMA 2PJ3A 4F0XA 1RXTA 2P6EA 4FUUA 3RZAA 4C7IA 4F9VA 2AFOA 4PK3A 4IAVA 2I00A 5F49A 2R7HA 4X8IA 4NF1A 2WPWA 1JQGA 4P10A 4GM5A 4UEFA 5AG5A 5C82A 3GLJA 1Z8LA 1IOIA 2PJ4A 3TOAA 1XBUA 3LD2A 4KS9A 3TTHA 3G8WA 4ONWA 4X3RA 2BCOA 1IGBA 1GYTA 3IFEA 4M6GA 1BPNA 3WC7A 4QC6A 4ZY2A 3D67A 4YU9A 4NGSA 2ZENA 4KOTA 2NMTA 1YW4A 1I21A 1IICA 2WYRA 4R9MA 4FBEA 2B4BA 1ELMP 1HDQA 3JVNA 1VHOA 2F8HA 3FRMA 1F2OA 4KZTA 4JJXA 1GHEA 2ODFA 3WC6A 3D7FA 4KUAA 1Z5RA 4AXVA 3SJXA 4R3LA 3H8GA 1CX8A 3CT9A 4II9A 4UFVA 1IOFA 2B3UA 1QSRA 2PQ8A 1M4DA 5JM6A 1QMUA 1YGHA 2QJ8A 4OC1A 4CGNA 4GXHA 4EMEA 1Y9WA 2ZEFA 1S5KA 4JYWA 2R98A 2YNCA 2CTCA 4TNUA 4PXCA 4M85A 2B4DA 4RS2A 1YLOA 3VATA 1TIQA 4CYPA 4X5KA 4KSFA 2B5GB 2OH1A 4MFQA 1J4JA 3CPXA 4AG9A 3ISZA 4NGQA 3P2FA 3MN8A 1YX0A 4P4FA 1R57A 2J9AA 4ZX9A 4C2YA 3SI1A 2ANPA 3PB9X 3S9LA 2CF4A 1R43A 4C7HA 1CG2A 3FIXA 4XNHC 3S6KA 4B5PB 2AFWA 4NEXA 4A2ZA 1AMPA 3IIBA 1B6BA 3D66A 3KR4A 1IIDA 4AVAA 2BL1A 3FX6A 3IWGA 4QVTA 3RNZA 3TO6A 2JBKA 4B10A 4CAXA 5DS0A 2GIVA 4LQGA 4DYOA 2HUZA 1UWYA 2RFHA 2Y0MA 3DNSA 3KR5A 3GY9A 4HPSA 1Y0YA 1Y9KA 4A37A 3FB3A 4CYQA 5J1QA 4E0AA 1CM0A 1H8LA 4KOSA 3KQXA 4KSIA 3L2NA 3A9LA 4O23A 3D2MA 3B7IA 3E0KA 1MJBA 1WK4A 2YGWA 3KI9A 2PVWA 3VWDA 5K8OA 2ZPAA 3D3SA 3S6HA 2PJCA 3EFAA 5EBVA 1M4GA 1CPSA 2X7BA 4R87A 1VHEA 1BAVA 3KHXA 3SXNA 5BWAB 4MHDA 3PB7X 1YREA 1KUYA 1ZLIA 1DTDA 2DXQA 2PJ0A 4Q7AA 1QSOA 4PXDA 2JLMA 2A4NA 4MXUA 3D7DA 3NE8A 4EWTA 4UFXA 2G3AA 1V0CA 3B8GA 4TWEA 4OIWA 2PJ1A 3W6XA 4P6YA 5LYIA 5G20A 5E96A 1LRZA 4AG7A 4LQ6A 4NSQA 3SI0A 4ZY0A 2OB0A 4JLYA 5AG4A 1WWZA 3CDXA 2QECA 1B87A 1OBRA 2ZEEA 3FXTA 4GS4A 1Z8TA 2ZEHA 1QQ9A 3LACA 2EWBA 4OIDA 1KWMA 3BHXA 2OZHA 4XPKA 2BO9A 2PIYA 3R9FA 4CAEA 2PJ5A 1S7KA 3GYAA 2HB6A 5HMNA 3KASA 3IC1A 4BBHA 3LMSA 5IB0A 2PJ7A 2FCKA 2VBQA 4F0YA 5JQ4A 2G3TA 2ZW7A 2Z3KA 3PGPA 2WPXA 5LRGA 2REFA 5G21A 3FEDA 2J8MA 4FD7A
chains in the Genus database with same CATH topology
2DPSA 3F0AA 4AVCA 2KCWA 1XEBA 2R1IA 3IGRA 4XPDB 5EC4A 2Z10A 2JEVA 3F5BA 4CAWA 2YNCC 3LODA 3I3GA 3FYNA 4KORA 4KUBA 1M44A 1YVOA 1QSMA 2CNTA 1RO5A 2PR8A 4FD5A 3T90A 1VKCA 4B14A 2FL4A 3WR7A 1IB1E 3DR6A 4A32A 1ON0A 4C2XA 4KSAA 5KTDA 2Z3OA 3MGDA 3IU1A 3QB8A 5KTCA 3G3SA 2PC1A 4JXQA 4BMHA 1Y7RA 1YLEA 3TFYA 2PR1A 2Z11A 3ZZIA 2Q7BA 1NMTA 1QSNA 2CNMA 4XPLA 4A95A 2JDCA 5I0CA 2P6FA 3W91A 4UFWA 4UA3A 4YGOA 2VQYA 4B13A 4MJ8A 4QUSA 5A27A 2FSRA 4H89A 5AG7A 3CXPA 5KTAA 1P4NA 4MY3A 1IYLA 4Y49C 5C88A 5J8CA 2FT0A 3EY5A 4CYOA 4F6AA 2Z3PA 4KOWA 4H6ZA 2QIRA 4R57A 4HNXB 3R9EA 4PSWA 4CS0B 2P0WA 4U9ZA 3R9GA 2F5IA 2PRBA 4M3SA 5H84A 4ZBGA 2J8NA 2FIWA 3SHPA 3IWEA 2ARHA 2HV2A 1S60A 4RI1A 2ATRA 4L8AA 4L89A 2BEIA 1S7LA 3TO9A 1Q2DA 4KOXA 3N7ZA 2Z3LA 2Z0ZA 4JD6A 1CJWA 2VXKA 2AE6A 2C27A 4EVYA 4CYNA 3P2HA 4A30A 4NXYA 3V8IA 3PZJA 1MJ9A 1PU9A 2ZW5A 3F8KA 5ISVA 2D4PA 2FXFA 4MFLA 5JPHA 1M4IA 3IU2A 1Q2CA 1L0CA 3T9YA 1KUXA 4KVME 3UY5A 2VZZA 4U9YA 3NE7A 3I9SA 4CAVA 4CRYB 4QB9A 5DWNA 2Z3MA 2VZYA 4K30A 3FBUA 4AVBA 1M1DA 1XF8A 2FE7A 3DR8A 4KVXA 4ZGYB 1XMTA 4UWJA 4UCNA 2ZXVA 1S7FA 1N71A 1VHSA 4YRHA 3FNCA 5J8FA 2FIAA 2B5GA 5AGEA 2ZW4A 2Q44A 3CXSA 4MFPA 2JDDA 2HQYA 4KLVA 4E8OA 4A33A 3BJ8A 4ORFA 4Y49B 2B3VA 2IL4A 4IF5A 4J3GA 4B5PA 4FD4A 5G22A 4CGPA 5F46A 1MK4A 3PP9A 4UCPA 1I12A 3OWCA 2EUIA 2REEA 4XNHB 2Q4VA 4B12A 3R95A 5AG6A 4KLWA 4CRZB 2Z3NA 2Q4YA 4UBRA 2CY2A 4FD6A 1K4JA 4CGLA 4JXRA 3RYOA 3TOBA 2EVNA 2WUUA 2FS5A 1Z4EA 4LX9A 1NSLA 4NCZA 4MFJA 4Q38A 2OZUA 3DDDA 1S7NA 3TCVA 4XPDC 4KOUA 3EC4A 3TE4A 4A31A 1QSTA 1S3ZA 3CXQA 2R8VA 4B11A 3KKWA 3VWEA 4R3KA 1BO4A 1XE4A 1P0HA 2O28A 4IUSA 4B5OA 4KOVA 2CXAA 4H6UA 2QMLA 2YNDA 1I1DA 2D4OA 3K9UA 1KZFA 4U5YA 5GCNA 1SQHA 5HH1A 4KOYA 5G1ZA 5A28A 4OAEA 4ONUA 3R96A 4Q36A 4UCMA 5F48A 3R1KA 1YR0A 4KVOE 3TT2A 4DNCA 2I79A 2CNSA 2P6GA 4MY0A 3H5ZA 2BSWA 3S6GA 4LUAA 5IX3A 1YK3A 3SXOA 5IV0A 1IYKA 3BJ7A 4AB7A 2G0BA 1UFHA 1KUVA 2VI7A 4PSXA 1Z9UA 3S6FA 2B4DB 2Q04A 2WSAA 4OLLA 2ZW6A 2AJ6A 2DPTA 4PK2A 3H4QA 2J8RA 5DWMA 3BLNA 4QBJA 4C68A 1NE9A 2H5MA 1XIXA 2GANA 4UWIA 4MBUA 4OADA 2Q0YA 4CGOA 4HKFA 4I49A 4YFJA 1Z4RA 2PSWA 2YNEA 2GE3A 3JTKA 4MFZA 3GKRA 2OZGA 4HNWB 4PV6A 1PUAA 4HNYB 5H86A 3EXNA 3D8PA 3JUWA 1Q2YA 4MFKA 3EO4A 1ZO0A 3C26A 2K5TA 2BUEA 1FY7A 4C2ZA 4CGMA 1U6MA 2RC4A 2VEZA 4JWPA 2PDOA 3QAHA 1YVKA 1OZPA 3DSBA 5FVJA 2OU2A 3W6SA 5F47A 2B58A 4MI4A 3ZJ0A 4CAFA 4E2AA 1MJAA 3TO7A 1BOBA 4F0XA 1RXTA 2P6EA 4C7IA 4PK3A 2I00A 5F49A 2R7HA 4NF1A 2WPWA 5AG5A 5C82A 3TOAA 3LD2A 4KS9A 3TTHA 3G8WA 4QC6A 4KOTA 2NMTA 1I21A 1IICA 4R9MA 2REFA 2B4BA 3JVNA 3FRMA 4KZTA 4JJXA 1GHEA 4KUAA 4R3LA 4II9A 4UFVA 2B3UA 1QSRA 2PQ8A 1M4DA 1YGHA 4CGNA 1Y9WA 1S5KA 2R98A 2YNCA 4M85A 2B4DA 4RS2A 1TIQA 4CYPA 4X5KA 4KSFA 2B5GB 2OH1A 4MFQA 1J4JA 4AG9A 3P2FA 1YX0A 1R57A 4C2YA 4C7HA 3FIXA 4XNHC 3S6KA 4B5PB 4NEXA 4A2ZA 1B6BA 1IIDA 4AVAA 2BL1A 3IWGA 4QVTA 3TO6A 4B10A 4CAXA 2GIVA 2HUZA 2Y0MA 3DNSA 3GY9A 1Y9KA 3FB3A 4CYQA 4E0AA 1CM0A 4KOSA 3A9LA 3D2MA 3E0KA 1MJBA 1WK4A 2YGWA 3VWDA 2ZPAA 3D3SA 3S6HA 3EFAA 5EBVA 1M4GA 2X7BA 4R87A 3SXNA 5BWAB 4MHDA 1YREA 1KUYA 2DXQA 1QSOA 2JLMA 2A4NA 4UFXA 2G3AA 1V0CA 3B8GA 3W6XA 5G20A 5E96A 1LRZA 4AG7A 4NSQA 2OB0A 4JLYA 5AG4A 1WWZA 2QECA 1B87A 4GS4A 3FXTA 5CNPA 2OZHA 4XPKA 3R9FA 4CAEA 1S7KA 3GYAA 5HMNA 4BBHA 5IB0A 2VBQA 2FCKA 4F0YA 5JQ4A 2G3TA 2ZW7A 2Z3KA 3PGPA 2WPXA 3D2PA 5G21A 2J8MA 4FD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0A A;  4AVC A;  2KCW A;  1XEB A;  2R1I A;  3IGR A;  4XPD B;  5EC4 A;  2Z10 A;  2JEV A;  3F5B A;  4CAW A;  3LOD A;  3I3G A;  3FYN A;  4KOR A;  4KUB A;  1M44 A;  1YVO A;  1QSM A;  2CNT A;  1RO5 A;  2PR8 A;  4FD5 A;  3T90 A;  1VKC A;  2FL4 A;  3WR7 A;  1IB1 E;  3DR6 A;  1ON0 A;  5KTD A;  3MGD A;  3QB8 A;  5KTC A;  3G3S A;  2PC1 A;  4JXQ A;  4BMH A;  1Y7R A;  1YLE A;  3TFY A;  2PR1 A;  2Z11 A;  3ZZI A;  2Q7B A;  1NMT A;  1QSN A;  2CNM A;  4XPL A;  2JDC A;  5I0C A;  2P6F A;  3W91 A;  4UA3 A;  4YGO A;  2VQY A;  4MJ8 A;  4QUS A;  2FSR A;  4H89 A;  3CXP A;  5KTA A;  1P4N A;  4MY3 A;  1IYL A;  4Y49 C;  5C88 A;  5J8C A;  2FT0 A;  3EY5 A;  4F6A A;  4KOW A;  4H6Z A;  2QIR A;  4R57 A;  4HNX B;  3R9E A;  4PSW A;  4CS0 B;  2P0W A;  4U9Z A;  3R9G A;  2F5I A;  2PRB A;  4M3S A;  5H84 A;  4ZBG A;  2J8N A;  2FIW A;  3SHP A;  2ARH A;  2HV2 A;  1S60 A;  4RI1 A;  2ATR A;  4L8A A;  4L89 A;  2BEI A;  1S7L A;  3TO9 A;  1Q2D A;  4KOX A;  3N7Z A;  2Z0Z A;  4JD6 A;  1CJW A;  2VXK A;  2AE6 A;  2C27 A;  4EVY A;  3P2H A;  4NXY A;  3V8I A;  3PZJ A;  1MJ9 A;  1PU9 A;  2ZW5 A;  3F8K A;  5ISV A;  2D4P A;  2FXF A;  5JPH A;  1M4I A;  1Q2C A;  1L0C A;  3T9Y A;  1KUX A;  4KVM E;  3UY5 A;  2VZZ A;  4U9Y A;  3NE7 A;  3I9S A;  4CAV A;  4CRY B;  4QB9 A;  5DWN A;  2VZY A;  4K30 A;  3FBU A;  4AVB A;  1M1D A;  1XF8 A;  2FE7 A;  3DR8 A;  4KVX A;  1XMT A;  4UWJ A;  2ZXV A;  1S7F A;  1N71 A;  1VHS A;  4YRH A;  3FNC A;  5J8F A;  2FIA A;  2B5G A;  2ZW4 A;  2Q44 A;  3CXS A;  2JDD A;  2HQY A;  4KLV A;  4E8O A;  3BJ8 A;  4ORF A;  4Y49 B;  2B3V A;  2IL4 A;  4IF5 A;  4J3G A;  4B5P A;  4FD4 A;  5F46 A;  1MK4 A;  3PP9 A;  1I12 A;  3OWC A;  2EUI A;  2REE A;  4XNH B;  2Q4V A;  3R95 A;  4KLW A;  4CRZ B;  2Q4Y A;  4UBR A;  2CY2 A;  4FD6 A;  1K4J A;  4JXR A;  3RYO A;  3TOB A;  2EVN A;  2FS5 A;  1Z4E A;  4LX9 A;  1NSL A;  4NCZ A;  2OZU A;  3DDD A;  1S7N A;  3TCV A;  4XPD C;  4KOU A;  3EC4 A;  3TE4 A;  1QST A;  1S3Z A;  3CXQ A;  2R8V A;  3KKW A;  3VWE A;  4R3K A;  1BO4 A;  1XE4 A;  1P0H A;  2O28 A;  4IUS A;  4B5O A;  4KOV A;  4H6U A;  2QML A;  1I1D A;  2D4O A;  3K9U A;  1KZF A;  4U5Y A;  5GCN A;  1SQH A;  5HH1 A;  4KOY A;  4OAE A;  4ONU A;  3R96 A;  5F48 A;  3R1K A;  1YR0 A;  4KVO E;  3TT2 A;  4DNC A;  2I79 A;  2CNS A;  2P6G A;  4MY0 A;  2BSW A;  3S6G A;  4LUA A;  5IX3 A;  1YK3 A;  3SXO A;  5IV0 A;  1IYK A;  3BJ7 A;  4AB7 A;  2G0B A;  1UFH A;  1KUV A;  2VI7 A;  4PSX A;  1Z9U A;  3S6F A;  2B4D B;  2Q04 A;  4OLL A;  2ZW6 A;  2AJ6 A;  4PK2 A;  3H4Q A;  2J8R A;  5DWM A;  3BLN A;  4QBJ A;  1NE9 A;  2H5M A;  1XIX A;  2GAN A;  4UWI A;  4MBU A;  4OAD A;  2Q0Y A;  4HKF A;  4I49 A;  4YFJ A;  1Z4R A;  2PSW A;  2GE3 A;  3GKR A;  2OZG A;  4HNW B;  4PV6 A;  1PUA A;  4HNY B;  5H86 A;  3EXN A;  3D8P A;  3JUW A;  1Q2Y A;  3EO4 A;  3C26 A;  2K5T A;  2BUE A;  1FY7 A;  1U6M A;  2RC4 A;  2VEZ A;  4JWP A;  2PDO A;  3QAH A;  1YVK A;  1OZP A;  3DSB A;  5FVJ A;  2OU2 A;  3W6S A;  5F47 A;  2B58 A;  4MI4 A;  3ZJ0 A;  4E2A A;  1MJA A;  3TO7 A;  1BOB A;  1RXT A;  2P6E A;  4PK3 A;  2I00 A;  5F49 A;  2R7H A;  4NF1 A;  2WPW A;  5C82 A;  3TOA A;  3LD2 A;  3TTH A;  3G8W A;  4QC6 A;  4KOT A;  2NMT A;  1I21 A;  1IIC A;  4R9M A;  2REF A;  2B4B A;  3JVN A;  3FRM A;  4KZT A;  4JJX A;  1GHE A;  4KUA A;  4R3L A;  4II9 A;  2B3U A;  1QSR A;  2PQ8 A;  1M4D A;  1YGH A;  1Y9W A;  1S5K A;  2R98 A;  4M85 A;  2B4D A;  4RS2 A;  1TIQ A;  4X5K A;  2B5G B;  2OH1 A;  4AG9 A;  1J4J A;  3P2F A;  1YX0 A;  1R57 A;  3FIX A;  4XNH C;  3S6K A;  4B5P B;  4NEX A;  1B6B A;  1IID A;  4AVA A;  2BL1 A;  3IWG A;  4QVT A;  3TO6 A;  4CAX A;  2GIV A;  2HUZ A;  2Y0M A;  3DNS A;  3GY9 A;  1Y9K A;  3FB3 A;  4E0A A;  1CM0 A;  4KOS A;  3D2M A;  3E0K A;  1MJB A;  1WK4 A;  3VWD A;  2ZPA A;  3D3S A;  3S6H A;  3EFA A;  5EBV A;  1M4G A;  2X7B A;  4R87 A;  3SXN A;  4MHD A;  1YRE A;  1KUY A;  2DXQ A;  1QSO A;  2JLM A;  2A4N A;  2G3A A;  1V0C A;  3B8G A;  3W6X A;  5E96 A;  1LRZ A;  4AG7 A;  4NSQ A;  2OB0 A;  4JLY A;  1WWZ A;  2QEC A;  1B87 A;  4GS4 A;  3FXT A;  5CNP A;  2OZH A;  4XPK A;  3R9F A;  1S7K A;  3GYA A;  5HMN A;  5IB0 A;  2VBQ A;  2FCK A;  4F0Y A;  5JQ4 A;  2G3T A;  2ZW7 A;  3PGP A;  2WPX A;  3D2P A;  2J8M A;  4FD7 A; 
#chains in the Genus database with same CATH topology
 2DPS A;  1IU8 A;  1VIX A;  3B3T A;  3F0A A;  2DEA A;  4AVC A;  2KCW A;  1XEB A;  2R1I A;  3IGR A;  3S9N A;  4XPD B;  5EC4 A;  1LOK A;  2Z10 A;  2JEV A;  2WZN A;  3F5B A;  2V8D A;  3LWU A;  3B35 A;  4CAW A;  3KGQ A;  2YNC C;  3LOD A;  4NGT A;  3I3G A;  1TKF A;  3FYN A;  2XEG A;  1IY7 A;  4KOR A;  4JZ0 A;  4KUB A;  1M44 A;  4MMO A;  4MCP A;  1YVO A;  1QSM A;  2CNT A;  1RO5 A;  2PR8 A;  4FD5 A;  1R3N A;  4P4B A;  3T90 A;  1VKC A;  3IEH A;  4YWY A;  1XRY A;  4B14 A;  2FL4 A;  3WR7 A;  1IB1 E;  3DR6 A;  4M6I A;  1TKJ A;  4MCS A;  4A32 A;  1ON0 A;  4C2X A;  3D4U A;  4KSA A;  1NSA A;  4A94 A;  5KTD A;  2Z3O A;  2CIJ A;  3IU1 A;  3MGD A;  4NJR A;  3QB8 A;  2AFX A;  5KTC A;  3G3S A;  1Q7L A;  3VH9 A;  2ZEL A;  5CBM A;  1ZG7 A;  2PC1 A;  4JXQ A;  4BMH A;  1Y7R A;  1YLE A;  3TFY A;  5HVG A;  2PR1 A;  2Z11 A;  3FJU A;  4MHP A;  4OME A;  3ZZI A;  2Q7B A;  3QNV A;  1NMT A;  1QSN A;  2CNM A;  4XPL A;  2XEJ A;  4A95 A;  4R6T A;  2JDC A;  2IMO A;  1LAP A;  2OR4 A;  2AFZ A;  4CPA A;  2NSM A;  1FNO A;  4BIN A;  5I0C A;  2G9D A;  2P6F A;  5JGF A;  3K2K A;  1ARL A;  3BI0 A;  3PB8 X;  3W91 A;  4UFW A;  4UA3 A;  4YGO A;  2VQY A;  4A39 A;  1CP6 A;  4B13 A;  4MJ8 A;  3H8E A;  4QUS A;  2EK8 A;  3FEE A;  2GLF A;  1Z8X A;  4ZYQ A;  2AFU A;  2ZOG A;  2AFM A;  3PFO A;  2Q7S A;  2FSR A;  3WC5 A;  3KZW A;  5A27 A;  4H89 A;  5AG7 A;  5F09 A;  5I4M A;  3NH5 A;  3CXP A;  5KTA A;  1P4N A;  4MY3 A;  5K8M A;  1IYL A;  4Y49 C;  5C88 A;  5J8C A;  2FT0 A;  3EY5 A;  4G1P A;  4CYO A;  1XMB A;  4NGM A;  4F6A A;  2Z3P A;  1DE4 C;  4KOW A;  6CPA A;  4H6Z A;  4P44 A;  3TX8 A;  5HVF A;  2QIR A;  4R57 A;  4HNX B;  3R9E A;  4PSW A;  4NFR A;  4MRI A;  4OC4 A;  1LAN A;  2P0W A;  2V8V A;  4M6H A;  2XEF A;  5EMI A;  4CS0 B;  8CPA A;  3D7H A;  4U9Z A;  3R9G A;  4IK2 A;  2F5I A;  2PRB A;  4M3S A;  2JBJ A;  2GRE A;  2JEW A;  3DGV A;  5H84 A;  3NH4 A;  3IWW A;  4ZBG A;  4DUK A;  2J8N A;  2FIW A;  3I1U A;  3NH8 A;  3SHP A;  3KHZ A;  3NFZ A;  3IWE A;  2ARH A;  2HV2 A;  1S60 A;  4RI1 A;  2ABZ A;  2ATR A;  4L8A A;  4L89 A;  2O4H A;  4X2T A;  1XJO A;  1F57 A;  2BEI A;  3FVL A;  1S7L A;  4MHZ A;  3TO9 A;  1Q2D A;  4KOX A;  3N7Z A;  2Z3L A;  1ZG8 A;  2Z0Z A;  4JD6 A;  5JH9 A;  1CJW A;  2IJZ A;  1XFO A;  2AE6 A;  2VXK A;  2C27 A;  4EVY A;  3B3S A;  4CYN A;  4ZX8 A;  1M4L A;  1ZG9 A;  3P2H A;  4P4E A;  1F2P A;  5HVH A;  4NGR A;  4A30 A;  4NXY A;  4IHM A;  3V8I A;  5LRK A;  3PZJ A;  1MJ9 A;  1PU9 A;  2V77 A;  2PCU A;  2ZW5 A;  3KQZ A;  3F8K A;  3TC8 A;  5ISV A;  1PCA A;  2D4P A;  1HDU A;  2FXF A;  3IJ3 A;  4MFL A;  5JPH A;  1M4I A;  2GFQ A;  3CZX A;  3K9T A;  3IU2 A;  4NJQ A;  1Q2C A;  1L0C A;  3T9Y A;  4UIA A;  4ZY1 A;  1KUX A;  3PBE A;  4KVM E;  3UY5 A;  2VZZ A;  4U9Y A;  3NE7 A;  2NYQ A;  3I9S A;  3NA6 A;  3WAB A;  4CAV A;  3KL9 A;  4CRY B;  4QB9 A;  5DWN A;  2Z3M A;  2VZY A;  1Z8W A;  1FT7 A;  2C6C A;  4K30 A;  5CNP A;  3FBU A;  3S9M A;  4AVB A;  4MCR A;  4R8F A;  1TF9 A;  3MRU A;  1M1D A;  1XF8 A;  1ELL P;  2FE7 A;  4B6Z A;  3QAY A;  3DR8 A;  4KVX A;  4ZGY B;  2FVG A;  2Q43 A;  2C6P A;  4PXB A;  3N5F A;  5CPA A;  1Y0R A;  3D2P A;  1XMT A;  4WJB A;  1RTQ A;  2QVP A;  2QYV A;  3PEI A;  4UCN A;  4UWJ A;  2ZXV A;  1LFW A;  1S7F A;  3H8F A;  1N71 A;  4DJL A;  3V7Z A;  4OC5 A;  1VHS A;  3PB4 X;  3FNC A;  4YRH A;  5J8F A;  4PQA A;  2EO8 A;  2FIA A;  2B5G A;  2ZED A;  1AUG A;  2BOA A;  5AGE A;  2ZW4 A;  2Q44 A;  3CXS A;  4MFP A;  2JDD A;  2HQY A;  4UEZ A;  4KLV A;  4E8O A;  4A33 A;  4UIB A;  4BD9 A;  3BJ8 A;  4ORF A;  4Y49 B;  2B3V A;  2IL4 A;  3DLJ A;  4IF5 A;  4J3G A;  2PJB A;  4B5P A;  4OP4 A;  2GLJ A;  4FD4 A;  5G22 A;  5IB9 A;  4CGP A;  3PFE A;  2IQ6 A;  2ZEG A;  1MK4 A;  3PP9 A;  4P4J A;  4FAI A;  2PRQ A;  4UCP A;  5F46 A;  1I12 A;  2C1C A;  3OWC A;  2EUI A;  3JRU A;  2REE A;  4XNH B;  2Q4V A;  4B12 A;  3R95 A;  2ZOF A;  5AG6 A;  4KLW A;  4K3N A;  4CRZ B;  2Z3N A;  3RBU A;  2DF5 A;  2Q4Y A;  4UBR A;  2CY2 A;  4FD6 A;  4A38 A;  1ZLH A;  3HUV A;  4RUH A;  1K4J A;  2PJ8 A;  1X12 A;  1LCP A;  2ZEM A;  4JXR A;  4CGL A;  4R76 A;  3RYO A;  3SJF A;  2EVN A;  3TOB A;  3GUX A;  3D68 A;  1CBX A;  4WWV A;  2WUU A;  2FS5 A;  1Z4E A;  3PBB A;  4LX9 A;  1NSL A;  4NCZ A;  4MFJ A;  1Z2L A;  4H2K A;  4Q38 A;  1LAM A;  2OZU A;  2PIZ A;  3DDD A;  1S7N A;  3PB6 X;  3SI2 A;  3TCV A;  3D7G A;  3FMC A;  4XPD C;  3SJG A;  4KOU A;  5K8N A;  3EC4 A;  3TE4 A;  4A31 A;  1QST A;  4OC0 A;  5LYL A;  3BXM A;  1YSJ A;  1S3Z A;  2HC9 A;  3CXQ A;  2R8V A;  3FEC A;  4B11 A;  3KKW A;  3VAR A;  3VWE A;  1CP7 A;  4R3K A;  1BO4 A;  3GIU A;  1XE4 A;  1P0H A;  1YW6 A;  2O28 A;  1BPM A;  3GB0 A;  3IO1 A;  5D8N A;  2ZEP A;  4IUS A;  1YQE A;  4KOV A;  4B5O A;  2CXA A;  1HEE A;  4H6U A;  4MCQ A;  2QML A;  2YND A;  1I1D A;  3FF3 A;  2D4O A;  4F8Z A;  3K9U A;  1KZF A;  3RO0 A;  2O53 A;  4U5Y A;  5GCN A;  1A2Z A;  1SQH A;  5HH1 A;  4MHN A;  5LYD A;  4KOY A;  5G1Z A;  5A28 A;  3PRT A;  4OAE A;  4ONU A;  2F7V A;  2C6G A;  3R96 A;  4Q36 A;  4UCM A;  3T8W A;  4OC2 A;  4Z65 A;  2XEI A;  5F48 A;  3V38 A;  3R1K A;  1YR0 A;  4OKO A;  4KVO E;  3TT2 A;  4DNC A;  2I79 A;  2CNS A;  2P6G A;  4MY0 A;  2EK9 A;  2BSW A;  3H5Z A;  1TXR A;  3S6G A;  4LUA A;  5IX3 A;  1CPX A;  1YK3 A;  4FWU A;  3SJE A;  4NGP A;  2PJA A;  3SXO A;  5IV0 A;  1IYK A;  1YME A;  1XOV A;  2V8H A;  3BJ7 A;  5ELY A;  4AB7 A;  2G0B A;  4W9Y A;  1UFH A;  1KUV A;  2VI7 A;  4PSX A;  2I3C A;  1Z9U A;  3S6F A;  2B4D B;  2Q4Z A;  1AYE A;  2PVV A;  7CPA A;  2Q04 A;  3WT4 A;  2WSA A;  4OLL A;  2OOT A;  4ZI6 A;  2ZW6 A;  3RAM A;  2AJ6 A;  2DPT A;  3B3W A;  2Q51 A;  4PK2 A;  4UEE A;  3H4Q A;  2ZEO A;  2J8R A;  4MHY A;  5DWM A;  3BLN A;  4QBJ A;  4C68 A;  4YFJ A;  2RB7 A;  4RN7 A;  1NE9 A;  2H5M A;  1XIX A;  2GAN A;  4UWI A;  4MBU A;  4OAD A;  2POK A;  2PJ9 A;  2Q0Y A;  4CGO A;  3B3C A;  4EFD A;  3CPA A;  2PE3 A;  1EE3 P;  4HKF A;  5HXD A;  2CTB A;  2PJ6 A;  4I49 A;  4UF4 A;  1TKH A;  1X10 A;  1Z4R A;  2GU2 A;  2PSW A;  4NGN A;  3BI1 A;  4P4I A;  2YNE A;  1Y7E A;  4P45 A;  5LRJ A;  2GE3 A;  3JTK A;  4PXE A;  4MFZ A;  4CAF A;  3GKR A;  4F9U A;  2OZG A;  4HNW B;  4PV6 A;  1PUA A;  4HNY B;  5D29 A;  5H86 A;  3EXN A;  3D8P A;  3JUW A;  4PPZ A;  1JWQ A;  2AFS A;  1Q2Y A;  4MFK A;  3ISX A;  3EO4 A;  2PJ2 A;  1TF8 A;  3HLP A;  3FH4 A;  1ZO0 A;  2V8G A;  2K5T A;  3C26 A;  5LYF A;  4P4D A;  2BUE A;  1BLL E;  1FY7 A;  1VGY A;  4C2Z A;  3B3V A;  4CGM A;  1U6M A;  4R7M A;  2RC4 A;  2VL1 A;  2VEZ A;  4JWP A;  2PDO A;  5K8P A;  3QAH A;  1YVK A;  1OZP A;  3DSB A;  5FVJ A;  5THW A;  1PYT B;  2EBJ A;  2OU2 A;  2B58 A;  4MI4 A;  4OC3 A;  5F47 A;  3B2Y A;  3W6S A;  3ZJ0 A;  1MJA A;  3TO7 A;  1BOB A;  4E2A A;  1ARM A;  2PJ3 A;  4F0X A;  1RXT A;  2P6E A;  4FUU A;  3RZA A;  4C7I A;  4F9V A;  2AFO A;  4PK3 A;  4IAV A;  2I00 A;  5F49 A;  2R7H A;  4X8I A;  4NF1 A;  2WPW A;  1JQG A;  4P10 A;  4GM5 A;  4UEF A;  5AG5 A;  5C82 A;  3GLJ A;  1Z8L A;  1IOI A;  2PJ4 A;  3TOA A;  1XBU A;  3LD2 A;  4KS9 A;  3TTH A;  3G8W A;  4ONW A;  4X3R A;  2BCO A;  1IGB A;  1GYT A;  3IFE A;  4M6G A;  1BPN A;  3WC7 A;  4QC6 A;  4ZY2 A;  3D67 A;  4YU9 A;  4NGS A;  2ZEN A;  4KOT A;  2NMT A;  1YW4 A;  1I21 A;  1IIC A;  2WYR A;  4R9M A;  4FBE A;  2B4B A;  1ELM P;  1HDQ A;  3JVN A;  1VHO A;  2F8H A;  3FRM A;  1F2O A;  4KZT A;  4JJX A;  1GHE A;  2ODF A;  3WC6 A;  3D7F A;  4KUA A;  1Z5R A;  4AXV A;  3SJX A;  4R3L A;  3H8G A;  1CX8 A;  3CT9 A;  4II9 A;  4UFV A;  1IOF A;  2B3U A;  1QSR A;  2PQ8 A;  1M4D A;  5JM6 A;  1QMU A;  1YGH A;  2QJ8 A;  4OC1 A;  4CGN A;  4GXH A;  4EME A;  1Y9W A;  2ZEF A;  1S5K A;  4JYW A;  2R98 A;  2YNC A;  2CTC A;  4TNU A;  4PXC A;  4M85 A;  2B4D A;  4RS2 A;  1YLO A;  3VAT A;  1TIQ A;  4CYP A;  4X5K A;  4KSF A;  2B5G B;  2OH1 A;  4MFQ A;  1J4J A;  3CPX A;  4AG9 A;  3ISZ A;  4NGQ A;  3P2F A;  3MN8 A;  1YX0 A;  4P4F A;  1R57 A;  2J9A A;  4ZX9 A;  4C2Y A;  3SI1 A;  2ANP A;  3PB9 X;  3S9L A;  2CF4 A;  1R43 A;  4C7H A;  1CG2 A;  3FIX A;  4XNH C;  3S6K A;  4B5P B;  2AFW A;  4NEX A;  4A2Z A;  1AMP A;  3IIB A;  1B6B A;  3D66 A;  3KR4 A;  1IID A;  4AVA A;  2BL1 A;  3FX6 A;  3IWG A;  4QVT A;  3RNZ A;  3TO6 A;  2JBK A;  4B10 A;  4CAX A;  5DS0 A;  2GIV A;  4LQG A;  4DYO A;  2HUZ A;  1UWY A;  2RFH A;  2Y0M A;  3DNS A;  3KR5 A;  3GY9 A;  4HPS A;  1Y0Y A;  1Y9K A;  4A37 A;  3FB3 A;  4CYQ A;  5J1Q A;  4E0A A;  1CM0 A;  1H8L A;  4KOS A;  3KQX A;  4KSI A;  3L2N A;  3A9L A;  4O23 A;  3D2M A;  3B7I A;  3E0K A;  1MJB A;  1WK4 A;  2YGW A;  3KI9 A;  2PVW A;  3VWD A;  5K8O A;  2ZPA A;  3D3S A;  3S6H A;  2PJC A;  3EFA A;  5EBV A;  1M4G A;  1CPS A;  2X7B A;  4R87 A;  1VHE A;  1BAV A;  3KHX A;  3SXN A;  5BWA B;  4MHD A;  3PB7 X;  1YRE A;  1KUY A;  1ZLI A;  1DTD A;  2DXQ A;  2PJ0 A;  4Q7A A;  1QSO A;  4PXD A;  2JLM A;  2A4N A;  4MXU A;  3D7D A;  3NE8 A;  4EWT A;  4UFX A;  2G3A A;  1V0C A;  3B8G A;  4TWE A;  4OIW A;  2PJ1 A;  3W6X A;  4P6Y A;  5LYI A;  5G20 A;  5E96 A;  1LRZ A;  4AG7 A;  4LQ6 A;  4NSQ A;  3SI0 A;  4ZY0 A;  2OB0 A;  4JLY A;  5AG4 A;  1WWZ A;  3CDX A;  2QEC A;  1B87 A;  1OBR A;  2ZEE A;  3FXT A;  4GS4 A;  1Z8T A;  2ZEH A;  1QQ9 A;  3LAC A;  2EWB A;  4OID A;  1KWM A;  3BHX A;  2OZH A;  4XPK A;  2BO9 A;  2PIY A;  3R9F A;  4CAE A;  2PJ5 A;  1S7K A;  3GYA A;  2HB6 A;  5HMN A;  3KAS A;  3IC1 A;  4BBH A;  3LMS A;  5IB0 A;  2PJ7 A;  2FCK A;  2VBQ A;  4F0Y A;  5JQ4 A;  2G3T A;  2ZW7 A;  2Z3K A;  3PGP A;  2WPX A;  5LRG A;  2REF A;  5G21 A;  3FED A;  2J8M A;  4FD7 A; 
#chains in the Genus database with same CATH homology
 2DPS A;  3F0A A;  4AVC A;  2KCW A;  1XEB A;  2R1I A;  3IGR A;  4XPD B;  5EC4 A;  2Z10 A;  2JEV A;  3F5B A;  4CAW A;  2YNC C;  3LOD A;  3I3G A;  3FYN A;  4KOR A;  4KUB A;  1M44 A;  1YVO A;  1QSM A;  2CNT A;  1RO5 A;  2PR8 A;  4FD5 A;  3T90 A;  1VKC A;  4B14 A;  2FL4 A;  3WR7 A;  1IB1 E;  3DR6 A;  4A32 A;  1ON0 A;  4C2X A;  4KSA A;  5KTD A;  2Z3O A;  3MGD A;  3IU1 A;  3QB8 A;  5KTC A;  3G3S A;  2PC1 A;  4JXQ A;  4BMH A;  1Y7R A;  1YLE A;  3TFY A;  2PR1 A;  2Z11 A;  3ZZI A;  2Q7B A;  1NMT A;  1QSN A;  2CNM A;  4XPL A;  4A95 A;  2JDC A;  5I0C A;  2P6F A;  3W91 A;  4UFW A;  4UA3 A;  4YGO A;  2VQY A;  4B13 A;  4MJ8 A;  4QUS A;  5A27 A;  2FSR A;  4H89 A;  5AG7 A;  3CXP A;  5KTA A;  1P4N A;  4MY3 A;  1IYL A;  4Y49 C;  5C88 A;  5J8C A;  2FT0 A;  3EY5 A;  4CYO A;  4F6A A;  2Z3P A;  4KOW A;  4H6Z A;  2QIR A;  4R57 A;  4HNX B;  3R9E A;  4PSW A;  4CS0 B;  2P0W A;  4U9Z A;  3R9G A;  2F5I A;  2PRB A;  4M3S A;  5H84 A;  4ZBG A;  2J8N A;  2FIW A;  3SHP A;  3IWE A;  2ARH A;  2HV2 A;  1S60 A;  4RI1 A;  2ATR A;  4L8A A;  4L89 A;  2BEI A;  1S7L A;  3TO9 A;  1Q2D A;  4KOX A;  3N7Z A;  2Z3L A;  2Z0Z A;  4JD6 A;  1CJW A;  2VXK A;  2AE6 A;  2C27 A;  4EVY A;  4CYN A;  3P2H A;  4A30 A;  4NXY A;  3V8I A;  3PZJ A;  1MJ9 A;  1PU9 A;  2ZW5 A;  3F8K A;  5ISV A;  2D4P A;  2FXF A;  4MFL A;  5JPH A;  1M4I A;  3IU2 A;  1Q2C A;  1L0C A;  3T9Y A;  1KUX A;  4KVM E;  3UY5 A;  2VZZ A;  4U9Y A;  3NE7 A;  3I9S A;  4CAV A;  4CRY B;  4QB9 A;  5DWN A;  2Z3M A;  2VZY A;  4K30 A;  3FBU A;  4AVB A;  1M1D A;  1XF8 A;  2FE7 A;  3DR8 A;  4KVX A;  4ZGY B;  1XMT A;  4UWJ A;  4UCN A;  2ZXV A;  1S7F A;  1N71 A;  1VHS A;  4YRH A;  3FNC A;  5J8F A;  2FIA A;  2B5G A;  5AGE A;  2ZW4 A;  2Q44 A;  3CXS A;  4MFP A;  2JDD A;  2HQY A;  4KLV A;  4E8O A;  4A33 A;  3BJ8 A;  4ORF A;  4Y49 B;  2B3V A;  2IL4 A;  4IF5 A;  4J3G A;  4B5P A;  4FD4 A;  5G22 A;  4CGP A;  5F46 A;  1MK4 A;  3PP9 A;  4UCP A;  1I12 A;  3OWC A;  2EUI A;  2REE A;  4XNH B;  2Q4V A;  4B12 A;  3R95 A;  5AG6 A;  4KLW A;  4CRZ B;  2Z3N A;  2Q4Y A;  4UBR A;  2CY2 A;  4FD6 A;  1K4J A;  4CGL A;  4JXR A;  3RYO A;  3TOB A;  2EVN A;  2WUU A;  2FS5 A;  1Z4E A;  4LX9 A;  1NSL A;  4NCZ A;  4MFJ A;  4Q38 A;  2OZU A;  3DDD A;  1S7N A;  3TCV A;  4XPD C;  4KOU A;  3EC4 A;  3TE4 A;  4A31 A;  1QST A;  1S3Z A;  3CXQ A;  2R8V A;  4B11 A;  3KKW A;  3VWE A;  4R3K A;  1BO4 A;  1XE4 A;  1P0H A;  2O28 A;  4IUS A;  4B5O A;  4KOV A;  2CXA A;  4H6U A;  2QML A;  2YND A;  1I1D A;  2D4O A;  3K9U A;  1KZF A;  4U5Y A;  5GCN A;  1SQH A;  5HH1 A;  4KOY A;  5G1Z A;  5A28 A;  4OAE A;  4ONU A;  3R96 A;  4Q36 A;  4UCM A;  5F48 A;  3R1K A;  1YR0 A;  4KVO E;  3TT2 A;  4DNC A;  2I79 A;  2CNS A;  2P6G A;  4MY0 A;  3H5Z A;  2BSW A;  3S6G A;  4LUA A;  5IX3 A;  1YK3 A;  3SXO A;  5IV0 A;  1IYK A;  3BJ7 A;  4AB7 A;  2G0B A;  1UFH A;  1KUV A;  2VI7 A;  4PSX A;  1Z9U A;  3S6F A;  2B4D B;  2Q04 A;  2WSA A;  4OLL A;  2ZW6 A;  2AJ6 A;  2DPT A;  4PK2 A;  3H4Q A;  2J8R A;  5DWM A;  3BLN A;  4QBJ A;  4C68 A;  1NE9 A;  2H5M A;  1XIX A;  2GAN A;  4UWI A;  4MBU A;  4OAD A;  2Q0Y A;  4CGO A;  4HKF A;  4I49 A;  4YFJ A;  1Z4R A;  2PSW A;  2YNE A;  2GE3 A;  3JTK A;  4MFZ A;  3GKR A;  2OZG A;  4HNW B;  4PV6 A;  1PUA A;  4HNY B;  5H86 A;  3EXN A;  3D8P A;  3JUW A;  1Q2Y A;  4MFK A;  3EO4 A;  1ZO0 A;  3C26 A;  2K5T A;  2BUE A;  1FY7 A;  4C2Z A;  4CGM A;  1U6M A;  2RC4 A;  2VEZ A;  4JWP A;  2PDO A;  3QAH A;  1YVK A;  1OZP A;  3DSB A;  5FVJ A;  2OU2 A;  3W6S A;  5F47 A;  2B58 A;  4MI4 A;  3ZJ0 A;  4CAF A;  4E2A A;  1MJA A;  3TO7 A;  1BOB A;  4F0X A;  1RXT A;  2P6E A;  4C7I A;  4PK3 A;  2I00 A;  5F49 A;  2R7H A;  4NF1 A;  2WPW A;  5AG5 A;  5C82 A;  3TOA A;  3LD2 A;  4KS9 A;  3TTH A;  3G8W A;  4QC6 A;  4KOT A;  2NMT A;  1I21 A;  1IIC A;  4R9M A;  2REF A;  2B4B A;  3JVN A;  3FRM A;  4KZT A;  4JJX A;  1GHE A;  4KUA A;  4R3L A;  4II9 A;  4UFV A;  2B3U A;  1QSR A;  2PQ8 A;  1M4D A;  1YGH A;  4CGN A;  1Y9W A;  1S5K A;  2R98 A;  2YNC A;  4M85 A;  2B4D A;  4RS2 A;  1TIQ A;  4CYP A;  4X5K A;  4KSF A;  2B5G B;  2OH1 A;  4MFQ A;  1J4J A;  4AG9 A;  3P2F A;  1YX0 A;  1R57 A;  4C2Y A;  4C7H A;  3FIX A;  4XNH C;  3S6K A;  4B5P B;  4NEX A;  4A2Z A;  1B6B A;  1IID A;  4AVA A;  2BL1 A;  3IWG A;  4QVT A;  3TO6 A;  4B10 A;  4CAX A;  2GIV A;  2HUZ A;  2Y0M A;  3DNS A;  3GY9 A;  1Y9K A;  3FB3 A;  4CYQ A;  4E0A A;  1CM0 A;  4KOS A;  3A9L A;  3D2M A;  3E0K A;  1MJB A;  1WK4 A;  2YGW A;  3VWD A;  2ZPA A;  3D3S A;  3S6H A;  3EFA A;  5EBV A;  1M4G A;  2X7B A;  4R87 A;  3SXN A;  5BWA B;  4MHD A;  1YRE A;  1KUY A;  2DXQ A;  1QSO A;  2JLM A;  2A4N A;  4UFX A;  2G3A A;  1V0C A;  3B8G A;  3W6X A;  5G20 A;  5E96 A;  1LRZ A;  4AG7 A;  4NSQ A;  2OB0 A;  4JLY A;  5AG4 A;  1WWZ A;  2QEC A;  1B87 A;  4GS4 A;  3FXT A;  5CNP A;  2OZH A;  4XPK A;  3R9F A;  4CAE A;  1S7K A;  3GYA A;  5HMN A;  4BBH A;  5IB0 A;  2VBQ A;  2FCK A;  4F0Y A;  5JQ4 A;  2G3T A;  2ZW7 A;  2Z3K A;  3PGP A;  2WPX A;  3D2P A;  5G21 A;  2J8M A;  4FD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...